
Sample records for white spot virus

  1. Immune defence White Spot Syndrome Virus infected shrimp, Penaeus monodon


    Arts, J.A.J.


    White spot syndrome virus (WSSV) is the most important viral pathogen of cultured penaeid shrimp worldwide. Since the initial discovery of the virus inTaiwanin 1992, it has spread to shrimp farming regions in Southeast Asia, theAmericas, Europe and theMiddle Eastcausing major economic losses. The virus has a wide host range among crustaceans and induces distinctive clinical signs (white spots)on the inner surface of the exoskeletonof penaeid shrimps.Limited data is available about the immune ...

  2. On the vaccination of shrimp against white spot syndrome virus

    NARCIS (Netherlands)

    Witteveldt, J.


    More than a decade after its discovery inSouth-East Asia, White Spot Syndrome Virus (WSSV) is still the most important (viral) pathogen in the shrimp culture industry. Despite the shift from culturingPenaeusmonodon

  3. Draft Genome Sequence of White Spot Syndrome Virus Isolated from Cultured Litopenaeus vannamei in Mexico (United States)

    Rodriguez-Anaya, Libia Zulema; Gonzalez-Galaviz, Jose Reyes; Casillas-Hernandez, Ramón; Lares-Villa, Fernando; Estrada, Karel


    The first genome sequence of a Mexican white spot syndrome virus is presented here. White spot syndrome is a shrimp pandemic virus that has devastated production in Mexico for more than 10 years. The availability of this genome will greatly aid epidemiological studies worldwide, contributing to the molecular diagnostic and disease prevention in shrimp farming. PMID:26966222

  4. Proteomic Analyses of the Shrimp White Spot Syndrome Virus

    Institute of Scientific and Technical Information of China (English)

    Yan-wei TAN; Zheng-li SHI


    White spot syndrome virus (WSSV), a unique member within the virus family Nimaviridae, is the most notorious aquatic virus infecting shrimp and other crustaceans and has caused enormous economic losses in the shrimp farming industry worldwide. Therefore, a comprehensive understanding of WSSV morphogenesis, structural proteins, and replication is essential for developing prevention measures of this serious parasite. The viral genome is approximately 300kb and contains more than 180 open reading frames (ORF). However, most of proteins encoded by these ORF have not been characterized. Due to the importance of WSSV structural proteins in the composition of the virion structure, infection process and interaction with host cells, knowledge of structural proteins is essential to understanding WSSV entry and infection as well as for exploring effective prevention measures. This review article summarizes mainly current investigations on WSSV structural proteins including the relative quantities, localization, function and protein-protein interactions. Traditional proteomic studies of 1D or 2D gel electrophoresis separations and mass spectrometry (MS) followed by database searches have identified a total of 39 structural proteins. Shotgun proteomics and iTRAQ were initiated to identify more structural proteins. To date, it is estimated that WSSV is assembled by at least 59 structural proteins, among them 35 are defined as the envelope fraction (including tegument proteins) and 9 as nucleocapsid proteins. Furthermore, the interaction within several major structural proteins has also been investigated. This identitification and characterization of WSSV protein components should help in the understanding of the viral assembly process and elucidate the roles of several major structural proteins.

  5. White spot syndrome virus molecular epidemiology: relation with shrimp farming and disease outbreaks

    NARCIS (Netherlands)

    Tran Thi Tuyet, H.


    White spot syndrome virus (WSSV), the causative agent of white spot disease (WSD), has been responsible for most shrimp production losses around the world since the early 1990s. Previous research has focused mainly on the characterization of WSSV genomic variation to gain a better insight in the evo

  6. Antiviral property of marine actinomycetes against white spot syndrome virus in penaeid shrimps

    Digital Repository Service at National Institute of Oceanography (India)

    Kumar, S.S.; Philip, R.; Achuthankutty, C.T.

    Aquaculture farms, particularly in Southeast Asia are facing severe crisis due to increasing incidences of White Spot Syndrome Virus (WSSV). Actinomycetes have provided many important bioactive compounds of high prophylactic and therapeutic value...

  7. Production and Characterization of Monoclonal Antibodies of Shrimp White Spot Syndrome Virus Envelope Protein VP28

    Institute of Scientific and Technical Information of China (English)

    Wan-gang GU; Jun-fa YUAN; Ge-lin XU; Li-juan LI; Ni LIU; Cong ZHANG; Jian-hong ZHANG; Zheng-li SHI


    BALB/c mice were immunized with purified White spot syndrome virus (WSSV).Six monoclonal antibody cell lines were selected by ELISA with VP28 protein expressed in E.coll in vitro neutralization experiments showed that 4 of them could inhibit the virus infection in crayfish.Westernblot suggested that all these monoclonal antibodies were against the conformational structure of VP28.The monoclonal antibody 7B4 was labeled with colloidal gold particles and used to locate the VP28 on virus envelope by immunogold labeling.These monoclonal antibodies could be used to develop immunological diagnosis methods for WSSV infection.

  8. Genotyping of white spot syndrome virus on wild and farm crustaceans from Sonora, Mexico


    González-Galaviz José Reyes; Rodriguez-Anaya Libia Zulema; Molina-Garza Zinnia Judith; Ibarra-Gámez José Cuauhtémoc; Galaviz-Silva Lucio


    White spot syndrome is a viral disease affecting wild and farm crustaceans that serve as reservoirs. Previous reports have demonstrated high genomic variation in WSS viruses (WSSV) isolated from distinct geographical regions. In this study, we collected wild shrimps (Litopenaeus stylirostris), crabs (Callinectes arcuatus) and farmed shrimp (L. vannamei) in Sonora, Mexico, between 2008 and 2010. DNA was extracted, and the variable regions and transposase genes were subjected to PCR and s...

  9. Molecular Mechanisms of White Spot Syndrome Virus Infection and Perspectives on Treatments. (United States)

    Verbruggen, Bas; Bickley, Lisa K; van Aerle, Ronny; Bateman, Kelly S; Stentiford, Grant D; Santos, Eduarda M; Tyler, Charles R


    Since its emergence in the 1990s, White Spot Disease (WSD) has had major economic and societal impact in the crustacean aquaculture sector. Over the years shrimp farming alone has experienced billion dollar losses through WSD. The disease is caused by the White Spot Syndrome Virus (WSSV), a large dsDNA virus and the only member of the Nimaviridae family. Susceptibility to WSSV in a wide range of crustacean hosts makes it a major risk factor in the translocation of live animals and in commodity products. Currently there are no effective treatments for this disease. Understanding the molecular basis of disease processes has contributed significantly to the treatment of many human and animal pathogens, and with a similar aim considerable efforts have been directed towards understanding host-pathogen molecular interactions for WSD. Work on the molecular mechanisms of pathogenesis in aquatic crustaceans has been restricted by a lack of sequenced and annotated genomes for host species. Nevertheless, some of the key host-pathogen interactions have been established: between viral envelope proteins and host cell receptors at initiation of infection, involvement of various immune system pathways in response to WSSV, and the roles of various host and virus miRNAs in mitigation or progression of disease. Despite these advances, many fundamental knowledge gaps remain; for example, the roles of the majority of WSSV proteins are still unknown. In this review we assess current knowledge of how WSSV infects and replicates in its host, and critique strategies for WSD treatment. PMID:26797629

  10. Molecular Mechanisms of White Spot Syndrome Virus Infection and Perspectives on Treatments

    Directory of Open Access Journals (Sweden)

    Bas Verbruggen


    Full Text Available Since its emergence in the 1990s, White Spot Disease (WSD has had major economic and societal impact in the crustacean aquaculture sector. Over the years shrimp farming alone has experienced billion dollar losses through WSD. The disease is caused by the White Spot Syndrome Virus (WSSV, a large dsDNA virus and the only member of the Nimaviridae family. Susceptibility to WSSV in a wide range of crustacean hosts makes it a major risk factor in the translocation of live animals and in commodity products. Currently there are no effective treatments for this disease. Understanding the molecular basis of disease processes has contributed significantly to the treatment of many human and animal pathogens, and with a similar aim considerable efforts have been directed towards understanding host–pathogen molecular interactions for WSD. Work on the molecular mechanisms of pathogenesis in aquatic crustaceans has been restricted by a lack of sequenced and annotated genomes for host species. Nevertheless, some of the key host–pathogen interactions have been established: between viral envelope proteins and host cell receptors at initiation of infection, involvement of various immune system pathways in response to WSSV, and the roles of various host and virus miRNAs in mitigation or progression of disease. Despite these advances, many fundamental knowledge gaps remain; for example, the roles of the majority of WSSV proteins are still unknown. In this review we assess current knowledge of how WSSV infects and replicates in its host, and critique strategies for WSD treatment.

  11. Multiple proteins of White spot syndrome virus involved in recognition of -integrin

    Indian Academy of Sciences (India)

    Jing-Yan Zhang; Qing-Hui Liu; Jie Huang


    The recognition and attachment of virus to its host cell surface is a critical step for viral infection. Recent research revealed that -integrin was involved in White spot syndrome virus (WSSV) infection. In this study, the interaction of -integrin with structure proteins of WSSV and motifs involved in WSSV infection was examined. The results showed that envelope proteins VP26, VP31, VP37, VP90 and nucleocapsid protein VP136 interacted with LvInt. RGD-, YGL- and LDV-related peptide functioned as motifs of WSSV proteins binding with -integrin. The -integrin ligand of RGDT had better blocking effect compared with that of YGL- and LDV-related peptides. In vivo assay indicated that RGD-, LDV- and YGL-related peptides could partially block WSSV infection. These data collectively indicate that multiple proteins were involved in recognition of -integrin. Identification of proteins in WSSV that are associated with -integrin will assist development of new agents for effective control of the white spot syndrome.

  12. White Spot Syndrome Virus infection in Penaeus monodon is facilitated by housekeeping molecules

    Indian Academy of Sciences (India)

    Vinayak Biradar; Santosh Narwade; Mandar Paingankar; Deepti Deobagkar


    White Spot Syndrome Virus (WSSV) is a major pathogen in shrimp aquaculture, and its rampant spread has resulted in great economic loss. Identification of host cellular proteins interacting with WSSV will help in unravelling the repertoire of host proteins involved in WSSV infection. In this study, we have employed one-dimensional and two-dimension virus overlay protein binding assay (VOPBA) followed by matrix-assisted laser desorption ionization-time of flight mass spectrometry (MALDI-TOF MS) to identify the host proteins of Penaeus monodon that could interact with WSSV. The VOPBA results suggest that WSSV interacted with housekeeping proteins such as heat shock protein 70, ATP synthase subunit , phosphopyruvate hydratase, allergen Pen m 2, glyceraldehyde-3-phosphate dehydrogenase, sarcoplasmic calcium-binding protein, actin and 14-3-3-like protein. Our findings suggest that WSSV exploits an array of housekeeping proteins for its transmission and propagation in P. monodon.

  13. Comparative analysis of differentially expressed genes in normal and white spot syndrome virus infected Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Juan Hsueh-Fen


    Full Text Available Abstract Background White spot syndrome (WSS is a viral disease that affects most of the commercially important shrimps and causes serious economic losses to the shrimp farming industry worldwide. However, little information is available in terms of the molecular mechanisms of the host-virus interaction. In this study, we used an expressed sequence tag (EST approach to observe global gene expression changes in white spot syndrome virus (WSSV-infected postlarvae of Penaeus monodon. Results Sequencing of the complementary DNA clones of two libraries constructed from normal and WSSV-infected postlarvae produced a total of 15,981 high-quality ESTs. Of these ESTs, 46% were successfully matched against annotated genes in National Center of Biotechnology Information (NCBI non-redundant (nr database and 44% were functionally classified using the Gene Ontology (GO scheme. Comparative EST analyses suggested that, in postlarval shrimp, WSSV infection strongly modulates the gene expression patterns in several organs or tissues, including the hepatopancreas, muscle, eyestalk and cuticle. Our data suggest that several basic cellular metabolic processes are likely to be affected, including oxidative phosphorylation, protein synthesis, the glycolytic pathway, and calcium ion balance. A group of immune-related chitin-binding protein genes is also likely to be strongly up regulated after WSSV infection. A database containing all the sequence data and analysis results is accessible at Conclusion This study suggests that WSSV infection modulates expression of various kinds of genes. The predicted gene expression pattern changes not only reflect the possible responses of shrimp to the virus infection but also suggest how WSSV subverts cellular functions for virus multiplication. In addition, the ESTs reported in this study provide a rich source for identification of novel genes in shrimp.

  14. White spot syndrome virus strains of different virulence induce distinct immune response in Cherax quadricarinatus. (United States)

    Gao, Meiling; Li, Fang; Xu, Limei; Zhu, Xiaoming


    In this study, we identified three white spot syndrome virus (WSSV) strains (WSSV-CN01, WSSV-CN02 and WSSV-CN03) with significant differences in virulence. Among them, WSSV-CN01 caused significant higher and earlier mortality in redclaw crayfish Cherax quadricarinatus, thus was determined as high-virulent, while WSSV-CN02 and WSSV-CN03 were moderate-virulent and low-virulent. By investigating the total number of the circulating haemocytes and the activity of immune relative enzymes, we demonstrated that the different virulent WSSV strains induced distinct immune response in the host. Notably, a dramatic reduction of circulating haemocytes was observed in the crayfish infected with WSSV-CN01 and WSSV-CN02 but not WSSV-CN03. Further analysis revealed that cell death induced by WSSV-CN01 and WSSV-CN02 might be responsible for the decrease of circulating haemocytes. PMID:24795080

  15. Genotyping of white spot syndrome virus on wild and farm crustaceans from Sonora, Mexico

    Directory of Open Access Journals (Sweden)

    González-Galaviz José Reyes


    Full Text Available White spot syndrome is a viral disease affecting wild and farm crustaceans that serve as reservoirs. Previous reports have demonstrated high genomic variation in WSS viruses (WSSV isolated from distinct geographical regions. In this study, we collected wild shrimps (Litopenaeus stylirostris, crabs (Callinectes arcuatus and farmed shrimp (L. vannamei in Sonora, Mexico, between 2008 and 2010. DNA was extracted, and the variable regions and transposase genes were subjected to PCR and sequencing. Compared to strains of WSSV from other sites, Mexican samples exhibited a distinct number of repeat units (RUs in ORF94, ORF75 and ORF125, which ranged between 1-11, 3-15, and 8-11 RUs respectively, and a unique single nucleotide polymorphism (SNP at position 48 of ORF94. A total of six Mexican genotypes were found in organism from shrimp farm and natural environment.

  16. Functional identification of the non-specific nuclease from white spot syndrome virus

    International Nuclear Information System (INIS)

    The product encoded by the wsv191 gene from shrimp white spot syndrome virus (WSSV) is homologous with non-specific nucleases (NSN) of other organisms. To functionally identify the protein, the wsv191 gene was expressed in Escherichia coli as a glutathione S-transferase (GST) fusion protein with 6His-tag at C-terminal. The fusion protein (termed as rWSSV-NSN) was purified using Ni-NTA affinity chromatography under denatured conditions, renatured and characterized by three methods. The results showed that rWSSV-NSN could hydrolyze both DNA and RNA. 5'-RACE result revealed that the transcription initiation site of the wsv191 gene was located at nucleotide residue G of the predicted ATG triplet. Therefore, we concluded that the next ATG should be the genuine translation initiation codon of the wsv191 gene. Western blot analysis revealed that the molecular mass of natural WSSV-NSN was 37 kDa

  17. In vivo neutralization assays by monoclonal antibodies against white spot syndrome virus in crayfish (Cambarus proclarkii)

    Institute of Scientific and Technical Information of China (English)

    WANG Yinan; ZHAN Wenbin; XING Jing; JIANG Yousheng


    The neutralizing activities of eight monoclonal antibodies (MAbs) against white spot syndrome virus (WSSV) (2D2,2B2,1D2,1DS,1C2,4A1,6A4 and 6B4) were analyzed by in vivo experiments.Gills from WSSV-infected shrimp were homogenized and ten-fold serially diluted by PBS,and then incubated with MAbs (hybridoma culture supernatant),respectively.The mixture of WSSV and MAbs were injected into crayfish (Procambarus clarkii).Mter challenge,the death rates of crayfish were counted to determine the neutralizing activities of MAbs.At the same time,the mixture of myeloma culture supernatant and WSSV or PBS was served as positive or negative control,respectively.The results showed that,at each virus dilution,the mean time to death of the crayfish injected with MAb-treated virus was significantly longer than that in the positive control,though they all showed 100% mortality within 25 d,and meanwhile,few crayfish died in the negative control.Among the eight MAbs,2D2,2B2,1D2 and 1DS,especially the former two,delayed the mortality significantly,and 1C2,4Al and 6A4 delayed the mortality as well but not so efficiently,while MAb 6B4 was efficient only when the virus concentration increased.The results indicated that the anti-WSSV MAbs can neutralize WSSV in different virus dilutions.

  18. White spot syndrome virus infection: Threat to crustacean biodiversity in Vembanad Lake, India

    Directory of Open Access Journals (Sweden)

    Toms C. Joseph


    Full Text Available The Vembanad Lake located on the south-west coast of India, an ecological hotspot is the nursing ground of many economically important crustaceans. The prevalence of white spot syndrome virus (WSSV among crustaceans from farmed, estuarine and marine environments surrounding the Vembanad Lake, India was detected using PCR. A total of 308 samples from aquaculture ponds consisting of six species of crustaceans collected from five different farms were tested for the presence of WSSV. Of these, 67% were found to carry the virus. A total of 258 samples of crustaceans from the Cochin backwater system that forms a part of the Vembanad lake viz., Metapenaeus dobsoni, Metapenaeus monoceros, Penaeus monodon and Penaeus indicus were found to contain WSSV in 62% of the samples. Fifteen species of crustaceans caught from the seas off Cochin were also screened for the presence of WSSV. Out of these, twelve species had WSSV incidence levels ranging from 6–23%. WSSV was not detected from three species of deep sea crustaceans tested. The black tiger shrimp, Penaeus monodon had the highest incidence of WSSV among the species screened in farmed, estuarine and marine environments.

  19. Viral interference between infectious hypodermal and hematopoietic necrosis virus and white spot syndrome virus in Litopenaeus vannamei. (United States)

    Bonnichon, Valérie; Lightner, Donald V; Bonami, Jean-Robert


    White spot syndrome virus (WSSV) is highly virulent and has caused significant production losses to the shrimp culture industry over the last decade. Infectious hypodermal and hematopoietic necrosis virus (IHHNV) also infects penaeid shrimp and, while being less important than WSSV, remains a major cause of significant production losses in Litopenaeus vannamei (also called Penaeus vannamei) and L. stylirostris (also called Penaeus stylirostris). These 2 viruses and their interactions were previously investigated in L. stylirostris. We report here laboratory challenge studies carried out to determine if viral interference between IHHNV and WSSV also occurs in L. vannamei, and it was found that experimental infection with IHHNV induced a significant delay in mortality following WSSV challenge. L. vannamei infected per os with IHHNV were challenged with WSSV at 0, 10, 20, 30, 40 and 50 d post-infection. Groups of naïve shrimp infected with WSSV alone died in 3 d whereas shrimp pre-infected with IHHNV for 30, 40 or 50 d died in 5 d. Real-time PCR analysis showed that the delay correlated to the IHHNV load and that WSSV challenge induced a decrease in IHHNV load, indicating some form of competition between the 2 viruses. PMID:17140141

  20. Mud crab susceptibility to disease from white spot syndrome virus is species-dependent

    Directory of Open Access Journals (Sweden)

    Sritunyalucksana Kallaya


    Full Text Available Abstract Background Based on a report for one species (Scylla serrata, it is widely believed that mud crabs are relatively resistant to disease caused by white spot syndrome virus (WSSV. We tested this hypothesis by determining the degree of susceptibility in two species of mud crabs, Scylla olivacea and Scylla paramamosain, both of which were identified by mitochondrial 16 S ribosomal gene analysis. We compared single-dose and serial-dose WSSV challenges on S. olivacea and S. paramamosain. Findings In a preliminary test using S. olivacea alone, a dose of 1 × 106 WSSV copies/g gave 100% mortality within 7 days. In a subsequent test, 17 S. olivacea and 13 S. paramamosain were divided into test and control groups for challenge with WSSV at 5 incremental, biweekly doses starting from 1 × 104 and ending at 5 × 106 copies/g. For 11 S. olivacea challenged, 3 specimens died at doses between 1 × 105 and 5 × 105 copies/g and none died for 2 weeks after the subsequent dose (1 × 106 copies/g that was lethal within 7 days in the preliminary test. However, after the final challenge on day 56 (5 × 106 copies/g, the remaining 7 of 11 S. olivacea (63.64% died within 2 weeks. There was no mortality in the buffer-injected control crabs. For 9 S. paramamosain challenged in the same way, 5 (55.56% died after challenge doses between 1 × 104 and 5 × 105 copies/g, and none died for 2 weeks after the challenge dose of 1 × 106 copies/g. After the final challenge (5 × 106 copies/g on day 56, no S. paramamosain died during 2 weeks after the challenge, and 2 of 9 WSSV-infected S. paramamosain (22.22% remained alive together with the control crabs until the end of the test on day 106. Viral loads in these survivors were low when compared to those in the moribund crabs. Conclusions S. olivacea and S. paramamosain show wide variation in response to challenge with WSSV. S. olivacea and S. paramamosain are susceptible to white spot disease, and S. olivacea is more

  1. Metabolic product response profiles of Cherax quadricarinatus towards white spot syndrome virus infection. (United States)

    Fan, Weiwei; Ye, Yangfang; Chen, Zhen; Shao, Yina; Xie, Xiaolu; Zhang, Weiwei; Liu, Hai-Peng; Li, Chenghua


    White spot syndrome virus (WSSV) is one of the most devastating viral pathogens in both shrimp and crayfish farms, which often causes disease outbreak and leads to massive moralities with significant economic losses of aquaculture. However, limited research has been carried out on the intrinsic mechanisms toward WSSV challenge at the metabolic level. To gain comprehensive insight into metabolic responses induced by WSSV, we applied an NMR approach to investigate metabolic changes of crayfish gill and hepatopancreas infected by WSSV for 1, 6 and 12 h. In gill, an enhanced energy metabolism was observed in WSSV-challenged crayfish samples at 1 h, as marked by increased glucose, alanine, methionine, glutamate and uracil. Afterwards, energy metabolism, lipid metabolism as well as osmoregulation were markedly increased at 6 hpi, as shown by elevated glucose, alanine, methionine, fumarate, tyrosine, tryptophan, histidine, phosphorylcholine, betaine and uracil, whereas no obvious metabolites change was detected at 12 hpi. As for hepatopancreas, disturbed lipid metabolism and induced osmotic regulation was found at 6 hpi based on the metabolic biomarkers such as branched chain amino acids, threonine, alanine, methionine, glutamate, glutamine, tyrosine, phenylalanine, lactate and lipid. However, no obvious metabolic change was shown in hepatopancreas at both 1 hpi and 12 hpi. Taken together, our present results provided essential metabolic information about host-pathogen interactions in crayfish, which shed new light on our understanding of WSSV infection at metabolic level. PMID:27068762

  2. Genotyping of White Spot Syndrome Virus in Chinese Cultured Shrimp during 1998-1999

    Institute of Scientific and Technical Information of China (English)

    Yan-wei Tan; Zheng-li Shi


    Recent studies showed that white spot syndrome virus(WSSV)isolates from different geographic locations share a high genetic similarity except the variable regions in ORF23/24 and ORF14/15,and variable number of tandem repeats(VNTR)within ORF94.In this study,genotyping was performed according to these three variable regions among WSSV isolates collected during 1998/1999 from Southern China.These WSSV isolates contain a deletion of 1168,5657,5898,9316 and 11093 bp,respectively in the variable region ORF23/24compared with WSSV-TW,and a deletion of 4749 or 5622 bp in the variable region ORF14/15 relative to TH-96-II.Four types of repeat units(RUs)(6,8,9 and 13 RUs)in ORF94 were detected in these isolates,with the shortest 6 RUs as the most prevalent type.Our results provide important information for a better understanding of the spatio-temporal transmission mode and the WSSV genetic evolution lineage.

  3. A transcriptome study on Macrobrachium rosenbergii hepatopancreas experimentally challenged with white spot syndrome virus (WSSV). (United States)

    Rao, Rama; Bhassu, Subha; Bing, Robin Zhu Ya; Alinejad, Tahereh; Hassan, Sharifah Syed; Wang, Jun


    The world production of shrimp such as the Malaysian giant freshwater prawn, Macrobrachium rosenbergii is seriously affected by the white spot syndrome virus (WSSV). There is an urgent need to understand the host pathogen interaction between M. rosenbergii and WSSV which will be able to provide a solution in controlling the spread of this infectious disease and lastly save the aquaculture industry. Now, using Next Generation Sequencing (NGS), we will be able to capture the response of the M. rosenbergii to the pathogen and have a better understanding of the host defence mechanism. Two cDNA libraries, one of WSSV-challenged M. rosenbergii and a normal control one, were sequenced using the Illumina HiSeq™ 2000 platform. After de novo assembly and clustering of the unigenes from both libraries, 63,584 standard unigenes were generated with a mean size of 698bp and an N50 of 1137bp. We successfully annotated 35.31% of all unigenes by using BLASTX program (E-value <10-5) against NCBI non-redundant (Nr), Swiss-Prot, Kyoto Encyclopedia of Genes and Genome pathway (KEGG) and Orthologous Groups of proteins (COG) databases. Gene Ontology (GO) assessment was conducted using BLAST2GO software. Differentially expressed genes (DEGs) by using the FPKM method showed 8443 host genes were significantly up-regulated whereas 5973 genes were significantly down-regulated. The differentially expressed immune related genes were grouped into 15 animal immune functions. The present study showed that WSSV infection has a significant impact on the transcriptome profile of M. rosenbergii's hepatopancreas, and further enhanced the knowledge of this host-virus interaction. Furthermore, the high number of transcripts generated in this study will provide a platform for future genomic research on freshwater prawns. PMID:26880158

  4. Litopenaeus vannamei clathrin coat AP17 involved in white spot syndrome virus infection. (United States)

    Wang, Xiu-Fang; Liu, Qing-Hui; Wu, Yin; Huang, Jie


    White spot syndrome virus (WSSV) is the main pathogen of shrimp culture, and has brought great losses of the shrimp aquaculture industry every year since it has been found. However, the specific mechanism of the virus into the cell is not very clear. Recent research suggests that clathrin-mediated endocytosis is involved in WSSV infection. By sequence analysis, clathrin coat AP17 is an σ subunit of AP-2 complex which is involved in clathrin-mediated endocytosis. To obtain the full-length sequence of Clathrin coat AP17 of Litopenaeus vannamei (LvCCAP17), the rapid amplification of cDNA ends (RACE) was performed to get the sequence of 3'and 5' end and splicing by DNAMAN. The full-length sequence of LvCCAP17 is 842 bp and expected to encoding 142 amino acids, and the amino acid sequence was analyzed by online software. The mRNA expression of LvCCAP17 in different tissues was carried out with quantitative real-time PCR and the LvCCAP17 was detected in all tested tissues of Litopenaeus vannamei. The transcriptional expression level of LvCCAP17 in epithelium and hepatopancreas was significantly up-regulated after WSSV infection. Far-Western blotting and ELISA assay showed that LvCCAP17 interacted with rVP26 and rVP37. Silencing of LvCCAP17 gene by double-strand RNA (dsRNA) interference significantly delay of cumulative mortality rate in WSSV infected shrimp and reduced the expression level of immediate early gene 1(ie1) and vp28. These results indicated that clathrin-meated endocytosis is responsible for WSSV infection. PMID:26988289

  5. Cloning of Litopenaeus vannamei CD63 and it's role in white spot syndrome virus infection. (United States)

    Guan, Guang-Kuo; Liu, Qing-Hui; Li, Chen; Huang, Jie


    White Spot Syndrome Virus (WSSV) is currently the most serious shrimp pathogen, which has brought huge losses to shrimp industry worldwide. CD63 of shrimp belongs to the tetraspanin superfamily, which plays an important role in signal transduction and immune process. In this paper, CD63 cDNA sequence of Litopenaeus vannamei was cloned using RACE method. The amplified sequence is 1472 bp, with its ORF 744 bp, encoding 247 amino acids. Bioinformatics analysis showed that the sequence of LvCD63 has 93% similarity with Penaeus monodon and 92% similarity with Fenneropenaeus chinensis. Real-time PCR analysis showed that the mRNA levels of LvCD63 expressed in the tissues of hemocytes, gill, epithelial tissue, heart, lymphoid, hepatopancreas, stomach, intestines, muscle and nerve. Among these tissues the highest expression level was showed in the tissue of haemolymph, followed by epithelial tissue, hepatopancreas, and nerve. The lowest expression level of LvCD63 was appeared in the muscle tissue. After WSSV challenge, the expression levels of LvCD63 were both up-regulated in the tissues of gill and epithelial. However the expression level of LvCD63 in hepatopancreas was down-regulated. Far-western blot analysis showed that LvCD63 interacts with VP28, and both VP28N and VP28C fragments interact with LvCD63. Flow cytometry analysis showed that LvCD63 was present on the surface of hemocytes and it is required for binding of WSSV virions. Neutral experiments in vivo showed that LvCD63LEL delayed WSSV infection in shrimp. PMID:26964710

  6. Evolutionary trajectory of white spot syndrome virus (WSSV genome shrinkage during spread in Asia.

    Directory of Open Access Journals (Sweden)

    Mark P Zwart

    Full Text Available BACKGROUND: White spot syndrome virus (WSSV is the sole member of the novel Nimaviridae family, and the source of major economic problems in shrimp aquaculture. WSSV appears to have rapidly spread worldwide after the first reported outbreak in the early 1990s. Genomic deletions of various sizes occur at two loci in the WSSV genome, the ORF14/15 and ORF23/24 variable regions, and these have been used as molecular markers to study patterns of viral spread over space and time. We describe the dynamics underlying the process of WSSV genome shrinkage using empirical data and a simple mathematical model. METHODOLOGY/PRINCIPAL FINDINGS: We genotyped new WSSV isolates from five Asian countries, and analyzed this information together with published data. Genome size appears to stabilize over time, and deletion size in the ORF23/24 variable region was significantly related to the time of the first WSSV outbreak in a particular country. Parameter estimates derived from fitting a simple mathematical model of genome shrinkage to the data support a geometric progression (k<1 of the genomic deletions, with k = 0.371 ± 0.150. CONCLUSIONS/SIGNIFICANCE: The data suggest that the rate of genome shrinkage decreases over time before attenuating. Bioassay data provided support for a link between genome size and WSSV fitness in an aquaculture setting. Differences in genomic deletions between geographic WSSV isolates suggest that WSSV spread did not follow a smooth pattern of geographic radiation, suggesting spread of WSSV over long distances by commercial activities. We discuss two hypotheses for genome shrinkage, an adaptive and a neutral one. We argue in favor of the adaptive hypothesis, given that there is support for a link between WSSV genome size and fitness.

  7. Shrimp miRNAs regulate innate immune response against white spot syndrome virus infection. (United States)

    Kaewkascholkul, Napol; Somboonviwat, Kulwadee; Asakawa, Shuichi; Hirono, Ikuo; Tassanakajon, Anchalee; Somboonwiwat, Kunlaya


    MicroRNAs are short noncoding RNAs of RNA interference pathways that regulate gene expression through partial complementary base-pairing to target mRNAs. In this study, miRNAs that are expressed in white spot syndrome virus (WSSV)-infected Penaeus monodon, were identified using next generation sequencing. Forty-six miRNA homologs were identified from WSSV-infected shrimp hemocyte. Stem-loop real-time RT-PCR analysis showed that 11 out of 16 selected miRNAs were differentially expressed upon WSSV infection. Of those, pmo-miR-315 and pmo-miR-750 were highly responsive miRNAs. miRNA target prediction revealed that the miRNAs were targeted at 5'UTR, ORF, and 3'UTR of several immune-related genes such as genes encoding antimicrobial peptides, signaling transduction proteins, heat shock proteins, oxidative stress proteins, proteinases or proteinase inhibitors, proteins in blood clotting system, apoptosis-related proteins, proteins in prophenoloxidase system, pattern recognition proteins and other immune molecules. The highly conserved miRNA homolog, pmo-bantam, was characterized for its function in shrimp. The pmo-bantam was predicted to target the 3'UTR of Kunitz-type serine protease inhibitor (KuSPI). Binding of pmo-bantam to the target sequence of KuSPI gene was analyzed by luciferase reporter assay. Correlation of pmo-bantam and KuSPI expression was observed in lymphoid organ of WSSV-infected shrimp. These results implied that miRNAs might play roles as immune gene regulators in shrimp antiviral response. PMID:26945623

  8. Sensitivitas Berbagai Stadia Kepiting Bakau (Scylla paramamosain Estampador terhadap White Spot Syndrome Virus

    Directory of Open Access Journals (Sweden)



    Full Text Available Mud crab is the most commercial crabs which are highly sold because oftheir delicious taste and high protein content. In nature, the capture intensity of this crab is very high so the population would decrease rapidly. For this reason people start to breed it. At the moment breeding of mud crab still have a lot of problems. One of those is the lower survival rate of larva stage due to the diseases. The objective of this research was to observe the sensitivity of mud crab from various stages to White Spot Syndrome Virus (WSSV. The research was conducted in Pathology laboratory, Balai Besar Riset Perikanan Budidaya Laut Gondol, Bali, January to April 2004. This experiment was run using three stages they were zoea-1, zoea-3 and crablet stage. The treatment of this research were: for zoea-1 and zoea-3 stage, i.e. treatment (A the larvae were bathed for 2 hours in stock WSSV suspension, in which the solution was diluted for 150 times; treatment (B the larvae were bathed for 2 hours in stock WSSV suspension, in which the solution was diluted for 15000 times; C as control, without WSSV. For crablet stage the WSSV infection was done by feeding them with tiger shrimp which infected by WSSV. ANOVA used to analyze the different effect of infection treatment, i.e. diluted 150x, 15000x, and control to survival rate, then continue DMRT test in 5% level. T test used to compare two treatments i.e. infection treatment with feed and without infection. PCR method used to detect WSSV of infection in zoea-1, zoea-3 and crablet stages. The results showed that for zoea-1 and zoea-3 stage, increasing concentration virus showed significant difference respect, showed by decreasing of survival rate. In crablet stage the WSSV infection by feeding can decrease survival rate. In proving the dead of mud crab zoea-1, zoea-3 and crablet were due to the infection of WSSV, the PCR method was used. The result showed that look PCR product was revenged in the cell with size of band

  9. Minichromosome maintenance protein 7 regulates phagocytosis in kuruma shrimp Marsupenaeus japonicas against white spot syndrome virus. (United States)

    Wang, Zhi; Zhu, Fei


    Minichromosome maintenance protein (MCM7) belongs to the MCM protein family and participates in the MCM complex by playing a role in the cell replication cycle and chromosome initiation of eukaryotes. Previously, we found that several genes, including MCM7, were over-expressed in Drosophila melanogaster after white spot syndrome virus (WSSV) infection. In this study, we aimed to further research the MCM7 of kuruma shrimp, Marsupenaeus japonicus (mjMCM7) and determine its role in the innate immune system. To this end, we cloned the entire 2307-bp mjMCM7 sequence, including a 1974-bp open reading frame (ORF) encoding a 658-aa-long protein. Real-time PCR showed that the gene was primarily expressed in the hemolymph and hepatopancreas and over-expressed in shrimp challenged with WSSV. Gene function study was carried out by knocking down the expression of MCM7 using small interference RNA (siRNA). The results revealed that β-actin, hemocyanin, prophenoloxidase (proPO) and tumor necrosis factor-α (TNF-α) were up-regulated while the cytoskeleton proteins such as myosin and Rho were significantly down-regulated at 24 h after treatment. The results indicate a possible relationship between mjMCM7 and the innate immune system, and suggest that mjMCM7 may play a role in phagocytosis. After WSSV challenge, WSSV copies and mortality count were both higher in the MCM7-siRNA-treated groups at 60 h after treatment, and the mortality count approached that of the control groups over time. The phagocytosis rate was significantly lower in the MCM7-siRNA-treated group than in the WSSV group. The findings of this study confirm that mjMCM7 positively regulates phagocytosis and plays an important role against WSSV. These results could help researchers to further understand the function of the MCM7 protein and reveal its potential role in the innate immunity of invertebrates. PMID:27276115

  10. The endemic region and infection regimes of the White Spot Syndrome virus (WSSV) in shrimp farms in northwestern México


    Héctor Manuel Esparza Leal; Francisco Javier Magallón Barajas; Ricardo Pérez Enriquez; Ramón Casillas Hernández; Julio A. Cabanillas Ramos; Wenceslao Valenzuela Quiñónez


    Shrimp farming with a value annually of US$711 million approximately, is one of the most important primary activities in Mexico. However, shrimp farming has had to face various problems that have limited their development, within which the mortality caused by the white spot syndrome virus (WSSV) is the most important. To have scientific elements to focus on preventive health management actions is necessary to know, among other factors, aspects of the epidemiologyof white spot disease (WSD). T...


    Directory of Open Access Journals (Sweden)

    Damayanthi Devi.I


    Full Text Available White spot disease is a major infectious disease of penaeid shrimps caused by the white spot syndrome virus (WSSV. The viral structural proteins are responsib le for binding virus to the cellular membranes of the host that is being systematically infected. An In silic o attempt was made to identify the potential drug to inhibit the WSSV spread of diseases. For that an effort , was made to deduce the antiviral potentiality of Cynodon dactylon derived phytochemicals with docking tec hnique. To stimulate the structure based drug design the, 3D structure of the VP26 (PDB-ID: 2EDM, a tegument protein thought to be i nvolved in the entry of WSSV nucleocapsid into the host nucleus, is retrieved from PDB datab ase and docking studies are carried out with the sketched phytochemical structures using GOLD software. Among the phytochemicals scr eened, luteolin and apigenin shows the best binding affinity with binding energies of 42.51 and 38.92 ol exhibiting the potential to block VP26 (2EDM protein of WSSV. This study will be helpful in developing novel antiviral drugs from plant sources against aquatic important pathogens.

  12. Identification and characterization of a prawn white spot syndrome virus gene that encodes an envelope protein VP31

    International Nuclear Information System (INIS)

    Based on a combination of SDS-PAGE and mass spectrometry, a protein with an apparent molecular mass of 31 kDa (termed as VP31) was identified from purified shrimp white spot syndrome virus (WSSV) envelope fraction. The resulting amino acid (aa) sequence matched an open reading frame (WSV340) of the WSSV genome. This ORF contained 783 nucleotides (nt), encoding 261 aa. A fragment of WSV340 was expressed in Escherichia coli as a glutathione S-transferase (GST) fusion protein with a 6His-tag, and then specific antibody was raised. Western blot analysis and the immunoelectron microscope method (IEM) confirmed that VP31 was present exclusively in the viral envelope fraction. The neutralization experiment suggested that VP31 might play an important role in WSSV infectivity

  13. Isolation and expression analysis of an MAPKK gene from Fenneropenaeus chinensis in response to white spot syndrome virus infection. (United States)

    Li, Xupeng; Kong, Jie; Meng, Xianhong; Luo, Kun; Luan, Sheng; Cao, Baoxiang; Liu, Ning


    Mitogen-activated kinase kinase (MAPKK) is an important gene involved in the host-virus interaction process. To obtain a better understanding of MAPKK in the interaction process between the Chinese shrimp Fenneropenaeus chinensis and white spot syndrome virus (WSSV), we cloned the sequence of an MAPKK cDNA from F. chinensis (FcMAPKK) and investigated the effect of FcMAPKK on WSSV infection. The results showed that the FcMAPKK gene contained a 1227 bp open reading frame (ORF), which encoded a highly conserved protein with a serine/threonine protein kinase catalytic (S_TKc) domain. The deduced amino acid sequence of FcMAPKK shared identities between 11.9 and 92.6% with MAPKKs from vertebrate, invertebrate, plant and fungus species. The FcMAPKK was expressed in all the examined tissues in the normal F. chinensis. FcMAPKK expression level was highest in the hepatopancreas where it was approximately 2.6-fold the expression level in the gill, and lowest in the muscle where it was approximately 0.3-fold the expression level in the hepatopancreas. The FcMAPKK expression levels in the muscle, gill, and hepatopancreas were all changed post WSSV challenge. The FcMAPKK expression was significantly (P process, and hijacking of FcMAPKK might be required for WSSV replication in F. chinensis. PMID:27164214

  14. Identification and Characterization of Nuclear Localization Signals within the Nucleocapsid Protein VP15 of White Spot Syndrome Virus

    Institute of Scientific and Technical Information of China (English)

    Li-juan LI; Hua-jun ZHANG; Cong ZHANG; Zheng-li SHI


    The nucleocapsid protein VP15 of white spot syndrome virus (WSSV) is a basic DNA-binding protein. Three canonical bipartite nuclear localization signals (NLSs), called NLS1 (aa 11-27), NLS2 (aa 33-49) and NLS3 (44-60), have been detected in this protein, using the ScanProsite computer program. To determine the nuclear localization sequence of VP15, the full-length open reading frame, or the sequence of one of the three NLSs, was fused to the green fluorescent protein (GFP) gene, and transiently expressed in insect Sf9 cells. Transfection with full-length VP15 resulted in GFP fluorescence being distributed exclusively in the nucleus. NLS 1 alone could also direct GFP to the nucleus, but less efficiently. Neither of the other two NLSs (NLS2 and 3) was functional when expressed alone, but exhibited similar activity to NLS1 when they were expressed as a fusion peptide. Furthermore, a mutated VP15, in which the two basic amino acids (11RR12) of NLSI were changed to two alanines (11AA12), caused GFP to be localized only in the cytoplasm of Sf9 cells. These results demonstrated that VP15, as a nuclear localization protein, needs cooperation between its three NLSs, and that the two residues (11RR12) of NLS1 play a key role in transporting the protein to the nucleus.

  15. Dorsal transcription factor is involved in regulating expression of crustin genes during white spot syndrome virus infection. (United States)

    Huang, Xin; Wang, Wen; Ren, Qian


    Nuclear factor-kappa B (NF-κB) pathways play important roles in innate immune responses. In this study, we identified a dorsal homolog (MrDorsal) from freshwater prawn Macrobrachium rosenbergii. The full-length cDNA of MrDorsal comprised 2533 bp with an open reading frame of 1986 bp, which encoded a peptide of 661 amino acid residues. Amino acid sequence analysis showed that MrDorsal contains a Rel homolog domain and an IPT/TIG (i.e., Ig-like, plexin, and transcription factors) domain. The signature sequence of dorsal protein FRYMCEG existed in the deduced amino acid sequence. Sequence analysis showed that MrDorsal shared high similarities with Dorsal from invertebrate species. MrDorsal was abundant in the hemocytes and gills of healthy prawns but minute levels were detected in other tissues. The expression of MrDorsal was significantly upregulated 48 h after the white spot syndrome virus (WSSV-) challenge. Knockdown of MrDorsal using double-stranded RNA could suppress the transcription of crustin genes (MrCrustin2 and MrCrustin4) in gills of prawns after 48 h of the WSSV challenge. Results indicated that MrDorsal was involved to regulate the expression of crustin genes and it might play potential important roles during WSSV infection. PMID:27181712

  16. A simple and rapid immunochromatographic test strip for detection of white spot syndrome virus (WSSV) of shrimp. (United States)

    Sithigorngul, Weerawan; Rukpratanporn, Sombat; Pecharaburanin, Nilawan; Longyant, Siwaporn; Chaivisuthangkura, Parin; Sithigorngul, Paisarn


    A simple strip-test kit for white spot syndrome virus (WSSV) detection was developed using monoclonal antibody W29 (against the VP28 structural protein) conjugated with colloidal gold as the detector antibody. A rabbit anti-recombinant VP28F118 (rVP28) protein antibody in combination with a W28 monoclonal antibody was used as the capture complex at the test line (T), and goat anti-mouse IgG antibody (GAM) was used as the capture antibody at the control line (C). For evidence, the ready-to-use strip was kept in a plastic case and stored in a desiccated plastic bag. A sample volume of 100 microl gill homogenate in application buffer was applied to the sample chamber at one end of the strip and allowed to flow by chromatography through the nitrocellulose membrane to the other end. In test samples containing WSSV, the virus bound to the monoclonal antibody conjugated with colloidal gold and the resulting complex was captured by the antibodies at T to give a reddish-purple band. Any unbound monoclonal antibody conjugated with colloidal gold moved across T to be captured by the GAM and formed a band at C. In samples without WSSV or with WSSV below the limit of detection of the kit, only the band at C was seen. This method was 4 times less sensitive than dot blotting, and about 2 000 000 times less sensitive than 1-step PCR. Nonetheless, it could be used to screen individual shrimp or pooled shrimp samples to confirm high levels of WSSV infection or WSSV disease outbreaks. The beneficial features of this kit are that simple, convenient and quick results can be obtained without the requirement of sophisticated tools or special skills. PMID:17140132

  17. White spot syndrome virus (WSSV) in Litopenaeus vannamei captured from the Gulf of California near an area of extensive aquaculture activity. (United States)

    Mijangos-Alquisires, Z; Quintero-Arredondo, N; Castro-Longoria, R; Grijalva-Chon, J M; Ramos-Paredes, J


    For the shrimp farming industry of Mexico, disease outbreaks caused by white spot syndrome virus (WSSV) are relatively recent. Efforts to control the virus are assisted by monitoring for its prevalence in aquaculture systems, but few attempts have been made to search for it in carriers from coastal waters. To search for WSSV carriers in the Gulf of California, we made surveys off the coast of Sinaloa, Mexico, in March 2001, November 2001, and September 2003 using polymerase chain reaction (PCR) assays and histopathology. WSSV-positive shrimp were detected only in November 2001, after hurricane Julliete. This suggested possible dispersal of WSSV to the marine environment from infected shrimp farms. PMID:16922004

  18. Transcriptome analysis of hemocytes and hepatopancreas in red swamp crayfish, Procambarus clarkii, challenged with white spot syndrome virus

    Directory of Open Access Journals (Sweden)

    X-Z Shi


    Full Text Available Red swamp crayfish Procambarus clarkii is used for the innate immune defense of crustaceans due to its convenience for laboratory culture and study. To know more about the transcriptome of the crayfish, we constructed and sequenced a cDNA library from a mixture of hemocytes and hepatopancreas from white spot syndrome virus (WSSV-infected crayfish. By random sequencing, we obtained 9115 high-quality expressed sequence tags with a mean length of 370 bp, representing 3033 unigenes. Most of the unigenes are first reports for the red swamp crayfish. Besides the metabolic genes, many genes that may be involved in the innate immune system of the crayfish are also obtained from the library, such as antimicrobial peptides, pattern recognition receptors, proteases and protease inhibitors, signal transduction proteins, apoptosis-, antioxidant-, and RNA interference-related proteins. We chose ten immune-related genes to analyze their expression pattern by quantitative real time polymerase chain reaction (qRT-PCR from the hemocytes of normal and WSSV-challenged crayfish. Seven of them, including anti-lipopolysaccharide factor, astacidin, crustin 1, H3 histone family 3A, serine/threonine protein kinase, TGF beta-inducible nuclear protein, and tar RNA binding protein, were upregulated after WSSV injection, but the mRNA expression levels of crustin 2, a lectin, and a digestive cysteine protease decreased after WSSV infection. Our results showed that the transcriptome analysis provides a useful resource for identification of immune related genes and understanding the immune responses of the crayfish.

  19. Effects of white spot syndrome virus infection on immuno-enzyme activities and ultrastructure in gills of Cherax quadricarinatus. (United States)

    Wang, Dan-Li; Zuo, Di; Wang, Lan-Mei; Sun, Ting; Wang, Qun; Zhao, Yun-Long


    In this study, we explored the pathogenic mechanism of white spot syndrome virus (WSSV) in crayfish, Cherax quadricarinatus, by investigating activities of enzymes related to innate immune function during infection. After 6-12 h of exposure to WSSV, the activities of four enzymes, phenoloxidase (PO), peroxidase (POD), superoxide dismutase (SOD) and lysozyme (LSZ), increased in the gills of C. quadricarinatus but then sharply decreased during longer infection times. Except for PO, the activities of other enzymes in the WSSV-infected crayfish (Group II) were significantly lower than those of the controls at 72 h post-exposure (P < 0.01). Interestingly, the enzyme activities in the group treated with polysaccharides before challenge with WSSV (Group III) were higher than those in Group II. This phenomenon demonstrated that the polysaccharides could improve the immuno-enzyme activities and enhance the organism's antiviral defenses. Morphological examination by transmission electron microscopy revealed abundant WSSV particles and significant damage in the gills of infected crayfish. WSSV infection caused parts of the gill epithelium and microvilli to be reduced in number and size or damaged; meanwhile, the mitochondria morphology changed, with parts of the cristae diminished leaving large vacuoles. Moreover, electron dense deposits appeared and heterochromatinized nuclei could be seen in blood cells with ruptured nuclear membranes and outflow of nucleoplasm. The findings of this study furthers our understanding of the biochemical alterations induced by viral infections, including changes in the antioxidant status, oxidative stress and lysozyme activity, which could help to advance strategies for control of WSSV in crayfish. PMID:22281607

  20. Immune gene expression profile of Penaeus monodon in response to marine yeast glucan application and white spot syndrome virus challenge. (United States)

    Wilson, Wilsy; Lowman, Douglas; Antony, Swapna P; Puthumana, Jayesh; Bright Singh, I S; Philip, Rosamma


    Immunostimulant potential of eight marine yeast glucans (YG) from Candida parapsilosis R20, Hortaea werneckii R23, Candida spencermartinsiae R28, Candida haemulonii R63, Candida oceani R89, Debaryomyces fabryi R100, Debaryomyces nepalensis R305 and Meyerozyma guilliermondii R340 were tested against WSSV challenge in Penaeus monodon post larvae (PL). Structural characterization of these marine yeast glucans by proton nuclear magnetic resonance (NMR) indicated structures containing (1-6)-branched (1-3)-β-D-glucan. PL were fed 0.2% glucan incorporated diet once in seven days for a period of 45 days and the animals were challenged with white spot syndrome virus (WSSV). The immunostimulatory activity of yeast glucans were assessed pre- and post-challenge WSSV by analysing the expression profile of six antimicrobial peptide (AMP) genes viz., anti-lipopolysaccharide factor (ALF), crustin-1, crustin-2, crustin-3, penaeidin-3 and penaeidin-5 and 13 immune genes viz., alpha-2-macroglobulin (α-2-M), astakine, caspase, catalase, glutathione peroxidase, glutathione-s-transferase, haemocyanin, peroxinectin, pmCathepsinC, prophenol oxidase (proPO), Rab-7, superoxide dismutase and transglutaminase. Expression of seven WSSV genes viz., DNA polymerase, endonuclease, protein kinase, immediate early gene, latency related gene, thymidine kinase and VP28 were also analysed to detect the presence and intensity of viral infection in the experimental animals post-challenge. The study revealed that yeast glucans (YG) do possess immunostimulatory activity against WSSV and also supported higher survival (40-70 %) post-challenge WSSV. Among the various glucans tested, YG23 showed maximum survival (70.27%), followed by YG20 (66.66%), YG28 (60.97%), YG89 (58.53%), YG100 (54.05%), YG63 (48.64%), YG305 (45.7%) and YG340 (43.24%). PMID:25555812

  1. Impact of Vibrio parahaemolyticus and white spot syndrome virus (WSSV) co-infection on survival of penaeid shrimp Litopenaeus vannamei (United States)

    Zhang, Xiaojing; Song, Xiaoling; Huang, Jie


    White spot syndrome virus (WSSV) is an important viral pathogen that infects farmed penaeid shrimp, and the threat of Vibrio parahaemolyticus infection to shrimp farming has become increasingly severe. Viral and bacterial cross or superimposed infections may induce higher shrimp mortality. We used a feeding method to infect Litopenaeus vannamei with WSSV and then injected a low dose of V. parahaemolyticus (WSSV+Vp), or we first infected L. vannamei with a low-dose injection of V. parahaemolyticus and then fed the shrimp WSSV to achieve viral infection (Vp+WSSV). The eff ect of V. parahaemolyticus and WSSV co-infection on survival of L. vannamei was evaluated by comparing cumulative mortality rates between experimental and control groups. We also spread L. vannamei hemolymph on thiosulfate citrate bile salt sucrose agar plates to determine the number of Vibrio, and the WSSV copy number in L. vannamei gills was determined using an absolute quantitative polymerase chain reaction (PCR) method. LvMyD88 and Lvakt gene expression levels were detected in gills of L. vannamei by real-time PCR to determine the cause of the diff erent mortality rates. Our results show that (1) the cumulative mortality rate of L. vannamei in the WSSV+Vp group reached 100% on day 10 after WSSV infection, whereas the cumulative mortality rate of L. vannamei in the Vp+WSSV group and the WSSV-alone control group approached 100% on days 11 and 13 of infection; (2) the number of Vibrio in the L. vannamei group infected with V. parahaemolyticus alone declined gradually, whereas the other groups showed significant increases in the numbers of Vibrio (P<0.05); (3) the WSSV copy numbers in the gills of the WSSV+Vp, Vp+WSSV, and the WSSV-alone groups increased from 105 to 107 /mg tissue 72, 96, and 144 h after infection, respectively. These results suggest that V. parahaemolyticus infection accelerated proliferation of WSSV in L. vannamei and vice versa. The combined accelerated proliferation of both V

  2. Yeast Surface Display of Two Proteins Previously Shown to Be Protective Against White Spot Syndrome Virus (WSSV in Shrimp.

    Directory of Open Access Journals (Sweden)

    Vorawit Ananphongmanee

    Full Text Available Cell surface display using the yeasts Saccharomyces cerevisiae and Pichia pastoris has been extensively developed for application in bioindustrial processes. Due to the rigid structure of their cell walls, a number of proteins have been successfully displayed on their cell surfaces. It was previously reported that the viral binding protein Rab7 from the giant tiger shrimp Penaeus monodon (PmRab7 and its binding partner envelope protein VP28 of white spot syndrome virus (WSSV could independently protect shrimp against WSSV infection. Thus, we aimed to display these two proteins independently on the cell surfaces of 2 yeast clones with the ultimate goal of using a mixture of the two clones as an orally deliverable, antiviral agent to protect shrimp against WSSV infection. PmRab7 and VP28 were modified by N-terminal tagging to the C-terminal half of S. cerevisiae α-agglutinin. DNA fragments, harboring fused-gene expression cassettes under control of an alcohol oxidase I (AOX1 promoter were constructed and used to transform the yeast cells. Immunofluorescence microscopy with antibodies specific to both proteins demonstrated that mutated PmRab7 (mPmRab7 and partial VP28 (pVP28 were localized on the cell surfaces of the respective clones, and fluorescence intensity for each was significantly higher than that of control cells by flow cytometry. Enzyme-linked immunosorbant assay (ELISA using cells displaying mPmRab7 or pVP28 revealed that the binding of specific antibodies for each was dose-dependent, and could be saturated. In addition, the binding of mPmRab7-expressing cells with free VP28, and vice versa was dose dependent. Binding between the two surface-expressed proteins was confirmed by an assay showing agglutination between cells expressing complementary mPmRab7 and pVP28. In summary, our genetically engineered P. pastoris can display biologically active mPmRab7 and pVP28 and is now ready for evaluation of efficacy in protecting shrimp against

  3. Molecular docking analyses of Avicennia marinaderived phytochemicals against white spot syndrome virus (WSSV) envelope protein-VP28


    Sahu, Sunil Kumar; KATHIRESAN, Kandasamy; Singh, Reena; Senthilraja, Poomalai


    White spot syndrome (WSS) is one of the most common and most disastrous diseases of shrimp worldwide. It causes up to 100% mortality within 3 to 4 days in commercial shrimp farms, resulting in large economic losses to the shrimp farming industry. VP28 envelope protein of WSSV is reported to play a key role in the systemic infection in shrimps. Considering the most sombre issue of viral disease in cultivated shrimp, the present study was undertaken to substantiate the inhibition potential of A...

  4. The DNA virus white spot syndrome virus uses an internal ribosome entry site for translation of the highly expressed nonstructural protein ICP35. (United States)

    Kang, Shih-Ting; Wang, Han-Ching; Yang, Yi-Ting; Kou, Guang-Hsiung; Lo, Chu-Fang


    Although shrimp white spot syndrome virus (WSSV) is a large double-stranded DNA virus (∼300 kbp), it expresses many polycistronic mRNAs that are likely to use internal ribosome entry site (IRES) elements for translation. A polycistronic mRNA encodes the gene of the highly expressed nonstructural protein ICP35, and here we use a dual-luciferase assay to demonstrate that this protein is translated cap independently by an IRES element located in the 5' untranslated region of icp35. A deletion analysis of this region showed that IRES activity was due to stem-loops VII and VIII. A promoterless assay, a reverse transcription-PCR together with quantitative real-time PCR analysis, and a stable stem-loop insertion upstream of the Renilla luciferase open reading frame were used, respectively, to rule out the possibility that cryptic promoter activity, abnormal splicing, or read-through was contributing to the IRES activity. In addition, a Northern blot analysis was used to confirm that only a single bicistronic mRNA was expressed. The importance of ICP35 to viral replication was demonstrated in a double-stranded RNA (dsRNA) interference knockdown experiment in which the mortality of the icp35 dsRNA group was significantly reduced. Tunicamycin was used to show that the α subunit of eukaryotic initiation factor 2 is required for icp35 IRES activity. We also found that the intercalating drug quinacrine significantly inhibited icp35 IRES activity in vitro and reduced the mortality rate and viral copy number in WSSV-challenged shrimp. Lastly, in Sf9 insect cells, we found that knockdown of the gene for the Spodoptera frugiperda 40S ribosomal protein RPS10 decreased icp35 IRES-regulated firefly luciferase activity but had no effect on cap-dependent translation. PMID:24089551

  5. First report on White Spot Syndrome Virus (WSSV infection in white leg shrimp Litopenaeus vannamei (Crustacea, Penaeidae under semi intensive culture condition in India

    Directory of Open Access Journals (Sweden)

    Gunalan Balakrishnan


    Full Text Available Scientific shrimp culture began in India in the late eighties along the east coast particularly inAndrapradesh and Tamilnadu. Continuous success of shrimp culture was affected by mass mortalities ofcultured shrimp in 1994. Thereafter disease infection on survival and production of shrimps get itsimportance in culture. The present study is the first report on WSSV (white spot syndrome virusinfection in cultured Litopenaeus vannamei (Boone, 1931 in India. WSSV infection was observed on 70thdays of culture due to cross contamination of white spot infected shrimp from the neighboring farmbecause of birds. Due to this infection within two days the mortality ratio has gone up to 25% in pond 1and 12% in pond 2. So this present study strongly recommends to every shrimp farmers to go for birdfencing & crab fencing to avoid horizontal contamination, before stocking the good quality seed, thenthey will have the risk free WSSV culture.

  6. Haemocyanin content of shrimp (Fenneropenaeus chinensis) associated with white spot syndrome virus and Vibrio harveyi infection process. (United States)

    Chang, Yanhong; Xing, Jing; Tang, Xiaoqian; Sheng, Xiuzhen; Zhan, Wenbin


    Haemocyanin (Hc) is frequently reported to vary significantly by physiological status and environmental stress in Crustaceans. In this paper, the shrimp Fenneropenaeus chinensis was infected with different concentrations of white spot syndrome virus (WSSV) and Vibrio harveyi. Then, the variation of Hc and total protein content of the haemolymph (TPCH) were investigated using the established double antibody sandwich enzyme linked immunosorbent assay (DAS-ELISA) and Coomassie brilliant blue method, respectively. The results showed that the Hc content peaked at 12 h post-infection (PI) in the 10(-2), 10(-4) and 10(-6) viral supernatant (VS) groups, and the maximum was 93.03 ± 2.55 mg ml(-1), 77.57 ± 6.02 mg ml(-1) and 70.25 ± 3.96 mg ml(-1), respectively. TPCH reached the maximum of 108.18 ± 1.36 mg ml(-1) and 103.49 ± 1.33 mg ml(-1) at 12 h PI in the 10(-2) and 10(-4) VS groups, respectively. The maximum was 96.94 ± 1.06 mg ml(-1) at 24 h PI in the 10(-6) VS group. In the V. harveyi infection groups, the Hc content reached a maximum of 87.97 ± 4.39 mg ml(-1) at 36 h PI in the 10(6) CFU ml(-1) group, 73.74 ± 4.38 mg ml(-1) and 72.47 ± 2.09 mg ml(-1) at 12 h PI in the 10(7) and 10(8) CFU ml(-1) groups, respectively. TPCH reached a maximum of 111.16 ± 0.86 mg ml(-1) at 36 h PI in the 10(6) CFU ml(-1) group, 100.41 ± 0.51 mg ml(-1) and 101.94 ± 0.47 mg ml(-1) at 12 h PI in the 10(7) and 10(8) CFU ml(-1) groups, respectively. These data showed that both Hc content and TPCH varied as the same extent after infection. The up-regulation of the Hc content at 6-36 h PI might be a reference threshold for shrimp infection. PMID:26616234

  7. Influence of Agathi grandiflora active principles inhibit viral multiplication and stimulate immune system in Indian white shrimp Fenneropenaeus indicus against white spot syndrome virus infection. (United States)

    Bindhu, Francis; Velmurugan, Subramanian; Donio, Mariathason Birdilla Selva; Michaelbabu, Mariavincent; Citarasu, Thavasimuthu


    Five herbs including Adathoda vasica, Agathi grandiflora, Leucas aspera, Psoralea corylifolia, and Quercus infectoria were selected to screen the antiviral and immunostimulant activity against white spot syndrome virus (WSSV) and Vibrio harveyi respectively using different organic polar and non-polar solvents. Based on the initial screening results, ethyl acetate and methanolic extracts of A. grandiflora had strong antiviral and immunostimulant activities. Those extracts incubated with WSSV injected Fenneropenaeus indicus got only 20% mortality and no PCR positive signals were seen in two step PCR amplification. The methanolic extracts of A. grandiflora were further purified through silica column chromatography and the fractions screened again for antiviral and immunostimulant activity. The secondary screening results revealed that, the fractions of F5 to F7 had effectively controlled the WSSV multiplication and V. harveyi growth. The pooled fractions (F5 to F7) was structurally characterized by gas chromatograph-mass spectrometry (GC-MS) analysis and few compounds were identified including 3,7.11,15-Tetramethyl-2-Hexane-1-ol, pytol and 1,2-Benzenedicarboxylic acid, diisooctyl ester. The pooled fractions were mixed with the basal feed ingredients at the concentration of 100 (D-1), 200 (D-2), 300 (D-3) and 400 (D-4) mg kg(-1) and the diets fed to the F. indicus (9.0 ± 0.5 g) for 30 days. After the completion of feeding trail, they were challenged with virulent WSSV and studied the cumulative mortality, molecular diagnosis by quantitative real time PCR (qRT-PCR), biochemical, haematological and immunological parameters. The control diet fed F. indicus succumbed to death 100% within 3 days whereas the D-3 and D-4 helped to reduced the cumulative mortality of 60-80% respectively. The qRT-PCR revealed that, the WSSV copy number was gradually decreased when increasing concentration of A. grandiflora extract active fraction in the diets. The diets D-3 and D-4 helped to

  8. Simultaneous and rapid detection of white spot syndrome virus and yellow head virus infection in shrimp with a dual immunochromatographic strip test. (United States)

    Sithigorngul, Paisarn; Rukpratanporn, Sombat; Chaivisuthangkura, Parin; Sridulyakul, Pattarin; Longyant, Siwaporn


    A strip test for the dual detection of white spot syndrome virus (WSSV) and yellow head virus (YHV) was developed using monoclonal antibodies (MAbs) specific to the WSSV major envelope protein VP28 (W1 and W30) and the YHV nucleocapsid protein p20 (Y19 and Y21). The MAbs W30 and Y19 were conjugated with colloidal gold and sprayed onto a glass fiber pad that was placed adjacent to a sample chamber. The MAbs W1 and Y21 and the goat anti-mouse immunoglobulin G (GAM) antibody were sprayed onto a nitrocellulose membrane in strips at positions designated W, Y and C, respectively. These test strips were placed in plastic cases and stored desiccated in a plastic bag. The test strips were assessed for their ability to detect WSSV and YHV simultaneously using pleopods sampled from shrimp. A pleopod homogenate in application buffer 100μl was applied to the sample chamber to flow through the nitrocellulose membrane strip, and antibody-protein complexes could be observed within 15min. In sample from shrimp infected with WSSV and/or YHV, viral protein bound to the colloidal gold-conjugated MAbs. These complexes were captured by the MAbs at the W and/or Y test lines, resulting in the appearance of reddish-purple coloured bands. Any unbound colloidal gold-conjugated MAbs migrated pass the W and Y lines would be captured by the GAM antibody, forming a band at position C. When samples not containing WSSV and YHV proteins or containing viral proteins at below the detection limit of the test, only the band at position C was observed. The sensitivity of the test was comparable to dot blot tests using single MAbs, and ∼500-fold less sensitive than a 1-step PCR test for WSSV and 1000-fold less sensitive than an RT-PCR test for YHV. Despite this lower sensitivity, the dual strip test has advantages in speed and simplicity in not requiring sophisticated equipment or specialized skills. The ability to co-detect WSSV and YHV provides simultaneously cost savings. PMID:21256869

  9. Application of Spirulina platensis for prevention of white spot syndrome virus in post larvae and juvenile black tiger shrimp (Penaeus monodon

    Directory of Open Access Journals (Sweden)

    Hemtanon, P.


    Full Text Available In this study, the extract of Spirulina platensis were examined in vitro to inhibit white spot syndrome virus (WSSV and application of dry S. platensis in diet for prevention of white spot syndrome (WSS in post larvae and juvenile black tiger shrimp (Penaeus monodon. The results showed that the lowest concentration of the extract for inhibiting WSSV was 0.01 mg/ml, while the optimum concentration was found to be 0.1 mg/ ml in which the mortality rate of the shrimp was 4 percents and infection was not detected from survivalshrimp by the immunohistochemistry method.Furthermore, The results showed that the survival rate of the post larvae fed on steamed egg containing dry S. platensis 5 g/kg of diet was higher than that of the control (p<0.05 when challenged with WSSV and no WSSV infected shrimp examine by polymerase chain reaction (PCR assay. In the case of juvenile shrimp, the survival rate of shrimp fed pellets containing dry S. platensis 10 g/kg of diet was higher than that of the control group (p<0.05 after challenging with WSSV. Moreover percent of WSSV infection in the survival shrimp using the immunohistochemistry method was lower than that of the control group.

  10. Molecular cloning and recombinant expression of the VP28 carboxyl-terminal hydrophilic region from a brazilian white spot syndrome virus isolate

    Directory of Open Access Journals (Sweden)

    Patricia Braunig


    Full Text Available In the present study, a fragment of the VP28 coding sequence from a Brazilian WSSV isolate (BrVP28 was cloned, sequenced and expressed in E. coli BL21(DE3 pLysS strain in order to produce the VP28 carboxyl-terminal hydrophilic region. The expression resulted in a protein of about 21 kDa, which was purified under denaturing conditions, resulting in a final highly purified BrVP28 preparation. The recombinant protein obtained can be used in several biotechnology applications, such as the production of monoclonal antibodies which could be used in the development of diagnostic tools as well as in the studies on the characterization of white spot syndrome virus (WSSV isolated in Brazil.

  11. Validation of a commercial insulated isothermal PCR-based POCKIT test for rapid and easy detection of white spot syndrome virus infection in Litopenaeus vannamei.

    Directory of Open Access Journals (Sweden)

    Yun-Long Tsai

    Full Text Available Timely pond-side detection of white spot syndrome virus (WSSV plays a critical role in the implementation of bio-security measures to help minimize economic losses caused by white spot syndrome disease, an important threat to shrimp aquaculture industry worldwide. A portable device, namely POCKIT™, became available recently to complete fluorescent probe-based insulated isothermal PCR (iiPCR, and automatic data detection and interpretation within one hour. Taking advantage of this platform, the IQ Plus™ WSSV Kit with POCKIT system was established to allow simple and easy WSSV detection for on-site users. The assay was first evaluated for its analytical sensitivity and specificity performance. The 95% limit of detection (LOD of the assay was 17 copies of WSSV genomic DNA per reaction (95% confidence interval [CI], 13 to 24 copies per reaction. The established assay has detection sensitivity similar to that of OIE-registered IQ2000™ WSSV Detection and Protection System with serial dilutions of WSSV-positive Litopenaeus vannamei DNA. No cross-reaction signals were generated from infectious hypodermal and haematopoietic necrosis virus (IHHNV, monodon baculovirus (MBV, and hepatopancreatic parvovirus (HPV positive samples. Accuracy analysis using 700 L. vannamei of known WSSV infection status shows that the established assayhassensitivity93.5% (95% CI: 90.61-95.56% and specificity 97% (95% CI: 94.31-98.50%. Furthermore, no discrepancy was found between the two assays when 100 random L. vannamei samples were tested in parallel. Finally, excellent correlation was observed among test results of three batches of reagents with 64 samples analyzed in three different laboratories. Working in a portable device, IQ Plus™ WSSV Kit with POCKIT system allows reliable, sensitive and specific on-site detection of WSSV in L. vannamei.

  12. The endemic region and infection regimes of the White Spot Syndrome virus (WSSV in shrimp farms in northwestern México

    Directory of Open Access Journals (Sweden)

    Héctor Manuel Esparza Leal


    Full Text Available Shrimp farming with a value annually of US$711 million approximately, is one of the most important primary activities in Mexico. However, shrimp farming has had to face various problems that have limited their development, within which the mortality caused by the white spot syndrome virus (WSSV is the most important. To have scientific elements to focus on preventive health management actions is necessary to know, among other factors, aspects of the epidemiologyof white spot disease (WSD. Therefore this study focused on delimiting the endemic region for WSD and its temporal regimes of infection and discusses possible risk factors related to outbreaks of the disease in shrimp farms of northwestern Mexico. We analyzed information from the databases of the State Committees of Aquaculture Health of Baja California Sur, Sonora, Sinaloa and Nayarit, as well as data of Integrated Program on Shrimp Aquaculture Health (PISA 2007-2008 and the Strategic Alliance Network Aquaculture Industry Innovation (AERI-2008. Data analysis showed that, for the shrimp production cycles of 2007-2008, white spot syndrome virus (WSSV was endemic to the region of Tuxpan, Nayarit in the south and to Agiabampo, Sonora in the north. Spring outbreaks of WSD in the fishfarms had a spatiotemporal distribution, indicating three infections regimes: (1 March-April in the southern shrimpfarming region (Local Aquaculture Health Boards [LAHBs] of Mazatlan, El Rosario, Escuinapa, Tecuala, and Tuxpan; 2 April-May in the central region (LAHBs of Navolato Norte, Navolato Sur, and El dorado; and (3 May-June in the northern region (LAHBs of Agiabampo-Sonora, Ahome, Guasave Norte and Sur. The WSD were consistent between 2007 and 2008, with slight variations among some LAHBs, with respect to the onset or presence of spring WSD outbreaks. It shows the association of infection regimes throughout the region endemic with the location of Mazatlan,Pescadero and Farallon oceanographic basins

  13. In vivo titration of white spot syndrome virus (WSSV) in specific pathogen-free Litopenaeus vannamei by intramuscular and oral routes


    Escobedo-Bonilla, C.M.; Wille, M.; Sanz, V.A.; Sorgeloos, P.; Pensaert, M. B.; Nauwynck, H.J.


    White spot syndrome virus (WSSV) is a devastating pathogen in shrimp aquaculture. Standardized challenge procedures using a known amount of infectious virus would assist in evaluating strategies to reduce its impact. In this study, the shrimp infectious dose 50% endpoint (SID50 ml-1) of a Thai isolate of WSSV was determined by intramuscular inoculation (i.m.) in 60 and 135 d old specific pathogen-free (SPF) Litopenaeus vannamei using indirect immunofluorescence (IIF) and 1-step polymerase cha...

  14. White Spot Syndrome Virus vulnerability of Tiger shrimp (Penaeus monodon cultured in the coastal ponds of Cox’s Bazar region, Bangladesh

    Directory of Open Access Journals (Sweden)

    Mohammad M. Monwar


    Full Text Available Jumbo tiger prawn, Penaeus monodon is the world’s most popular cultivable species for itsfast growth, hardy nature, delicious taste and market demand. During the last three decades shrimpculture has been expanded rapidly. White spot Syndrome Virus (WSSV is a great treat to this cultureexpansion. In this research, WSSV free fries were stocked in four coastal ponds with different salinities.The stocking density was kept low and constant. Water parameters, fish growth, and WSSVcontamination were recorded fortnightly. The WSSV contamination was primarily detected by using EnbioShrimp Virus Detection Test Kit, ‘Shrimple’ and further confirmed by the PCR test. Among the ponds,Pond A, B, and C were in completely controlled environmental condition where as pond D was traditionalone that exposed to tidal variations. Physico-chemical parameter varied from as, temperature 29 to32ºC, salinity 0 to 31‰, water pH 7.1 to 8.3, dissolved oxygen 3.8 to 6.3 mL L-1, alkalinity 80-122 mg L-1,ammonia 0 to 1.5 mg L-1 and transparency 23 to 50 cm. The WSSV was found positive in the pond D justafter hundred days, when the average weight of the shrimps was 26.69 g. It is observed that rapidchange in the salinity and temperature, poor environmental conditions and uncontrolled exchange ofwater made the shrimp more vulnerable to the WSSV.

  15. Studies on the immunomodulatory effect of extract of Cyanodon dactylon in shrimp, Penaeus monodon, and its efficacy to protect the shrimp from white spot syndrome virus (WSSV). (United States)

    Balasubramanian, G; Sarathi, M; Venkatesan, C; Thomas, John; Hameed, A S Sahul


    The present study investigates the protection of shrimp Penaeus monodon against white spot syndrome virus (WSSV) using antiviral plant extract derived from Cyanodon dactylon and the modulation of the shrimp non-specific immunity. To determine the antiviral activity, the shrimp were treated by both in vitro (intramuscular injection) and in vivo (orally with feed) methods at the concentration of 2mg per animal and 2% of the plant extract incorporated with commercially available artificial pellet feed, respectively. The antiviral activity of C. dactylon plant extract was confirmed by PCR, bioassay and Western blot analysis. In the present study, anti-WSSV activity of C. dactylon plant extract by in vivo and in vitro methods showed strong antiviral activity and the immunological parameters such as proPO, O(2)(-), NO, THC and clotting time were all significantly (Pprice, we believe that oral administration of C. dactylon plant extract along with the pellet feed is a potential prophylactic agent against WSSV infection of shrimp. PMID:18834943

  16. Proteomic analysis by iTRAQ in red claw crayfish, Cherax quadricarinatus, hematopoietic tissue cells post white spot syndrome virus infection. (United States)

    Jeswin, Joseph; Xie, Xiao-Lu; Ji, Qiao-Lin; Wang, Ke-Jian; Liu, Hai-Peng


    To elucidate proteomic changes of Hpt cells from red claw crayfish, Cherax quadricarinatus, we have carried out isobaric tags for relative and absolute quantitation (iTRAQ) of cellular proteins at both early (1 hpi) and late stage (12 hpi) post white spot syndrome virus (WSSV) infection. Protein database search revealed 594 protein hits by Mascot, in which 17 and 30 proteins were present as differentially expressed proteins at early and late viral infection, respectively. Generally, these differentially expressed proteins include: 1) the metabolic process related proteins in glycolysis and glucogenesis, DNA replication, nucleotide/amino acid/fatty acid metabolism and protein biosynthesis; 2) the signal transduction related proteins like small GTPases, G-protein-alpha stimulatory subunit, proteins bearing PDZ- or 14-3-3-domains that help holding together and organize signaling complexes, casein kinase I and proteins of the MAP-kinase signal transduction pathway; 3) the immune defense related proteins such as α-2 macroglobulin, transglutaminase and trans-activation response RNA-binding protein 1. Taken together, these protein information shed new light on the host cellular response against WSSV infection in a crustacean cell culture. PMID:26845698

  17. Identification of a Novel Nonstructural Protein, VP9, from White Spot Syndrome Virus: Its Structure Reveals a Ferredoxin Fold with Specific Metal Binding Sites

    Energy Technology Data Exchange (ETDEWEB)

    Liu,Y.; Wu, J.; Song, J.; Sivaraman, J.; Hew, C.


    White spot syndrome virus (WSSV) is a major pathogen in shrimp aquaculture. VP9, a full-length protein of WSSV, encoded by open reading frame wsv230, was identified for the first time in the infected Penaeus monodon shrimp tissues, gill, and stomach as a novel, nonstructural protein by Western blotting, mass spectrometry, and immunoelectron microscopy. Real-time reverse transcription-PCR demonstrated that the transcription of VP9 started from the early to the late stage of WSSV infection as a major mRNA species. The structure of full-length VP9 was determined by both X-ray and nuclear magnetic resonance (NMR) techniques. It is the first structure to be reported for WSSV proteins. The crystal structure of VP9 revealed a ferredoxin fold with divalent metal ion binding sites. Cadmium sulfate was found to be essential for crystallization. The Cd2+ ions were bound between the monomer interfaces of the homodimer. Various divalent metal ions have been titrated against VP9, and their interactions were analyzed using NMR spectroscopy. The titration data indicated that VP9 binds with both Zn2+ and Cd2+. VP9 adopts a similar fold as the DNA binding domain of the papillomavirus E2 protein. Based on our present investigations, we hypothesize that VP9 might be involved in the transcriptional regulation of WSSV, a function similar to that of the E2 protein during papillomavirus infection of the host cells.

  18. Responses of three very large inducible GTPases to bacterial and white spot syndrome virus challenges in the giant fresh water prawn Macrobrachium rosenbergii. (United States)

    Huang, Ying; Jin, Min; Yin, Shaowu; Ding, Zhengfeng; Wang, Wen; Ren, Qian


    Interferons (IFNs) are cytokines secreted by cells in response to invasion by pathogens, such as viruses, bacteria, parasites, or tumor cells. Very large inducible GTPases (VLIG) are the latest IFN-inducible GTPase family to be discovered and are the largest known GTPases of any species. However, VLIG proteins from invertebrates have yet to be characterized. In this study, three forms of VLIGs designated as MrVLIG1, MrVLIG2, and MrVLIG3 were cloned from the giant fresh water prawn Macrobrachium rosenbergii. MrVLIG1 has a 5445 bp open reading frame (ORF) encoding an 1814-amino acid protein. The complete nucleotide sequence of MrVLIG2 cDNA is 7055 bp long consisting of a 5757 bp ORF encoding a protein with 1918 amino acids. The full length of the MrVLIG3 gene consists of 5511 bp with a 3909 bp ORF encoding a peptide with 1302 amino acids. BLASTP and phylogenetic tree analyses showed that the three MrVLIGs are clustered into one subgroup and, together with other vertebrate VLIGs, into a branch. Tissue distribution analysis indicated that the mRNAs of the three MrVLIGs were widely expressed in almost all detected tissues, including the hemocytes, heart, hepatopancreas, gills, stomach, and intestine, with the highest expression in the hepatopancreas. They were also detected in the intestine but with relatively low expression levels. Quantitative real-time RT-PCR analysis showed that the mRNA transcripts of the MrVLIGs in the hepatopancreas were significantly expressed at various time points after infection with Vibrio parahaemolyticus and white spot syndrome virus. In summary, the three isoforms of VLIG genes participate in the innate immune response of the shrimps to bacterial and viral infections. PMID:26850335

  19. Primary hemocyte culture of Penaeus monodon as an in vitro model for white spot syndrome virus titration, viral and immune related gene expression and cytotoxicity assays. (United States)

    Jose, Seena; Mohandas, A; Philip, Rosamma; Bright Singh, I S


    Immortal cell lines have not yet been reported from Penaeus monodon, which delimits the prospects of investigating the associated viral pathogens especially white spot syndrome virus (WSSV). In this context, a method of developing primary hemocyte culture from this crustacean has been standardized by employing modified double strength Leibovitz-15 (L-15) growth medium supplemented with 2% glucose, MEM vitamins (1×), tryptose phosphate broth (2.95 gl⁻¹), 20% FBS, N-phenylthiourea (0.2 mM), 0.06 μg ml⁻¹ chloramphenicol, 100 μg ml⁻¹ streptomycin and 100 IU ml⁻¹ penicillin and hemolymph drawn from shrimp grown under a bio-secured recirculating aquaculture system (RAS). In this medium the hemocytes remained viable up to 8 days. 5-Bromo-2'-deoxyuridine (BrdU) labeling assay revealed its incorporation in 22 ± 7% of cells at 24h. Susceptibility of the cells to WSSV was confirmed by immunofluorescence assay using a monoclonal antibody against 28 kDa envelope protein of WSSV. A convenient method for determining virus titer as MTT(50)/ml was standardized employing the primary hemocyte culture. Expression of viral genes and cellular immune genes were also investigated. The cell culture could be demonstrated for determining toxicity of a management chemical (benzalkonium chloride) by determining its IC(50). The primary hemocyte culture could serve as a model for WSSV titration and viral and cellular immune related gene expression and also for investigations on cytotoxicity of aquaculture drugs and chemicals. PMID:20807537

  20. Protection of blue shrimp (Litopenaeus stylirostris) against the White Spot Syndrome Virus (WSSV) when injected with shrimp lysozyme. (United States)

    Mai, Wei-jun; Wang, Wei-na


    In this study we found that a blue shrimp (Litopenaeus stylirostris) lysozyme gene (Lslzm) was up-regulated in WSSV-infected shrimp, suggesting that lysozyme is involved in the innate response of shrimp to this virus. Shrimp were intramuscularly injected with Lslzm protein to identify how this recombinant protein protects L. stylirostris from WSSV infection and to determine how this protein influences nonspecific cellular and humoral defense mechanisms. Higher survival rates and a lower viral load (compared with controls) were reported for shrimps that were first injected with the Lslzm protein and then infected with WSSV. In addition, the Lslzm expression level and the immunological parameters (including THC, phagocytic activity, respiratory burst activity, phenoloxidase activity and lysozyme activity) were all significantly higher in the WSSV-infected shrimp treated with the Lslzm protein, compared with the controls. These results indicate that lysozyme is effective at blocking WSSV infection in L. stylirostris and that lysozyme modulates the cellular and humoral defense mechanisms after they are suppressed by the WSSV virus. PMID:20074645

  1. Activating transcription factor 4 and X box binding protein 1 of Litopenaeus vannamei transcriptional regulated white spot syndrome virus genes Wsv023 and Wsv083.

    Directory of Open Access Journals (Sweden)

    Xiao-Yun Li

    Full Text Available In response to endoplasmic reticulum (ER stress, the signaling pathway termed unfolded protein response (UPR is activated. To investigate the role of UPR in Litopenaeus vannamei immunity, the activating transcription factor 4 (designated as LvATF4 which belonged to a branch of the UPR, the [protein kinase RNA (PKR-like ER kinase, (PERK]-[eukaryotic initiation factor 2 subunit alpha (eIF2α] pathway, was identified and characterized. The full-length cDNA of LvATF4 was 1972 bp long, with an open reading frame of 1299 bp long that encoded a 432 amino acid protein. LvATF4 was highly expressed in gills, intestines and stomach. For the white spot syndrome virus (WSSV challenge, LvATF4 was upregulated in the gills after 3 hpi and increased by 1.9-fold (96 hpi compared to the mock-treated group. The LvATF4 knock-down by RNA interference resulted in a lower cumulative mortality of L. vannamei under WSSV infection. Reporter gene assays show that LvATF4 could upregulate the expression of the WSSV gene wsv023 based on the activating transcription factor/cyclic adenosine 3', 5'-monophosphate response element (ATF/CRE. Another transcription factor of L. vannamei, X box binding protein 1 (designated as LvXBP1, has a significant function in [inositol-requiring enzyme-1(IRE1 - (XBP1] pathway. This transcription factor upregulated the expression of the WSSV gene wsv083 based on the UPR element (UPRE. These results suggest that in L. vannamei UPR signaling pathway transcription factors are important for WSSV and might facilitate WSSV infection.

  2. SUMO and SUMO-Conjugating Enzyme E2 UBC9 Are Involved in White Spot Syndrome Virus Infection in Fenneropenaeus chinensis.

    Directory of Open Access Journals (Sweden)

    Xiaoqian Tang

    Full Text Available In previous work, small ubiquitin-like modifier (SUMO in hemocytes of Chinese shrimp Fenneropenaeus chinensis was found to be up-regulated post-white spot syndrome virus (WSSV infection using proteomic approach. However, the role of SUMO in viral infection is still unclear. In the present work, full length cDNAs of SUMO (FcSUMO and SUMO-conjugating enzyme E2 UBC9 (FcUBC9 were cloned from F. chinensis using rapid amplification of cDNA ends approach. The open reading frame (ORF of FcSUMO encoded a 93 amino acids peptide with the predicted molecular weight (M.W of 10.55 kDa, and the UBC9 ORF encoded a 160 amino acids peptide with the predicted M.W of 18.35 kDa. By quantitative real-time RT-PCR, higher mRNA transcription levels of FcSUMO and FcUBC9 were detected in hemocytes and ovary of F. chinensis, and the two genes were significantly up-regulated post WSSV infection. Subsequently, the recombinant proteins of FcSUMO and FcUBC9 were expressed in Escherichia coli BL21 (DE3, and employed as immunogens for the production of polyclonal antibody (PAb. Indirect immunofluorescence assay revealed that the FcSUMO and UBC9 proteins were mainly located in the hemocytes nuclei. By western blotting, a 13.5 kDa protein and a 18.7 kDa protein in hemocytes were recognized by the PAb against SUMO or UBC9 respectively. Furthermore, gene silencing of FcSUMO and FcUBC9 were performed using RNA interference, and the results showed that the number of WSSV copies and the viral gene expressions were inhibited by knockdown of either SUMO or UBC9, and the mortalities of shrimp were also reduced. These results indicated that FcSUMO and FcUBC9 played important roles in WSSV infection.

  3. Sustainable control of white spot disease

    DEFF Research Database (Denmark)

    Heinecke, Rasmus Demuth; Buchmann, Kurt

    White spot disease caused by the ciliate Ichthyophthirius multifiliis Fouquet, 1876 is a serious problem in freshwater aquaculture worldwide. This parasitosis is of frequent occurrence in both conventional earth pond fish farms and in fish farms using new high technology re-circulation systems...... of live theronts were counted every 15 minutes using a stereo-microscope (8-100× magnification). Lysed and/or immobilised theronts with no movement of cilia were considered dead. For both substances a negative relationship was seen between the survival of theronts and length of treatment, temperature...... concentration all had significant influences on parasite survival. Strategic treatment using the environmentally friendly chemical sodium percarbonate in combination with continuous micro-filtering of the pond water is suggested for control and management of this parasitosis....

  4. The protection of CpG ODNs and Yarrowia lipolytica harboring VP28 for shrimp Litopenaeus vannamei against White spot syndrome virus infection

    Directory of Open Access Journals (Sweden)

    Q Yi


    Full Text Available The white spot syndrome is one of the most serious disease which has caused high mortalities and huge economic losses to shrimp culture. In the present study, the oral administrations with CpG ODNs and Yarrowia lipolytica harboring VP28 (rVP28-yl as dietary supplement for shrimp Litopenaeus vannamei were conducted to evaluate their protective effects against WSSV. After feeding for 15 days, the cumulative mortality and the copy number of WSSV in CpG and rVP28-yl feeding shrimps were significantly lower when they were challenged by WSSV, compared with those in control shrimps (p < 0.05. The caspase-3 activity was suppressed in rVP28-yl feeding shrimps but ascended in CpG feeding shrimps after WSSV challenge. Besides, the PO activity in CpG feeding shrimps was significantly increased after feeding trial, and kept increasing post WSSV challenge (p < 0.05. While the increased NO production was observed both in CpG and rVP28-yl feeding shrimps after feeding trial and WSSV challenge. In addition, increased mRNA expression levels of STAT and Dicer were observed in CpG group post WSSV challenge. These results together indicated that oral feeding of CpG ODNs and rVP28-yl could enhance the innate non-specific immune responses especially antiviral immunity of shrimps in varying degrees, and increase their resistance against WSSV infection

  5. Dietary supplementation of probiotic Bacillus PC465 isolated from the gut of Fenneropenaeus chinensis improves the health status and resistance of Litopenaeus vannamei against white spot syndrome virus. (United States)

    Chai, Peng-Cheng; Song, Xiao-Ling; Chen, Guo-Fu; Xu, Hua; Huang, Jie


    This study conducted a 30-day feeding trial and a subsequent 20-day anti-virus infection trial to determine the effects of probiotic Bacillus PC465 on the growth, health status, and disease resistance of Litopenaeus vannamei. Shrimp samples were fed with three practical diets prepared from shrimp feed containing varying probiotic doses [0 (control), 10(7), and 10(9) CFU g(-1)]. Probiotic supplementation significantly increased the weight gain and survival of L. vannamei (p digestive enzymes, such as amylase, protease, and lipase, in the shrimp mid-gut significantly increased in the probiotic-fed groups on days 15 and 30, except lipase on day 30. The influence of 10(9) CFU g(-1) on enzyme activities was also greater than that of 10(7) CFU g(-1). Scanning electron microscopy revealed folds and large ravines across the interior surface of the mid-gut, and the number of these folds and ravines increased significantly after the probiotic was administered. The probiotic treatment significantly (p digestion, and nutrient absorption of L. vannamei. Probiotic treatment also enhances the microbial structures in the gut, promotes the immune status of shrimp, and provides protection against viral infection. The supplementation with 10(9) CFU g(-1) can also improve the growth and survival of L. vannamei. PMID:27177431

  6. Effects of various toothpastes on remineralization of white spot lesions


    Jo, Su-Yeon; Chong, Hyun-Jeong; Lee, Eon-Hwa; Chang, Na-Young; Chae, Jong-Moon; Cho, Jin-Hyoung; Kim, Sang-Cheol; Kang, Kyung-Hwa


    Objective The purpose of this in vitro study was to examine the effects of fluoridated, casein phosphopeptide.amorphous calcium phosphate complex (CPP-ACP)-containing, and functionalized β-tricalcium phosphate (fTCP)-containing toothpastes on remineralization of white spot lesions (WSLs) by using Quantitative light-induced fluorescence (QLF-D) Biluminator™ 2. Methods Forty-eight premolars, extracted for orthodontic reasons from 12 patients, with artificially induced WSLs were randomly and equ...

  7. A Dark Spot on a Massive White Dwarf

    CERN Document Server

    Kilic, Mukremin; Bell, Keaton J; Curd, Brandon; Brown, Warren R; Hermes, J J; Dufour, Patrick; Wisniewski, John P; Winget, D E; Winget, K I


    We present the serendipitous discovery of eclipse-like events around the massive white dwarf SDSS J152934.98+292801.9 (hereafter J1529+2928). We selected J1529+2928 for time-series photometry based on its spectroscopic temperature and surface gravity, which place it near the ZZ Ceti instability strip. Instead of pulsations, we detect photometric dips from this white dwarf every 38 minutes. Follow-up optical spectroscopy observations with Gemini reveal no significant radial velocity variations, ruling out stellar and brown dwarf companions. A disintegrating planet around this white dwarf cannot explain the observed light curves in different filters. Given the short period, the source of the photometric dips must be a dark spot that comes into view every 38 min due to the rotation of the white dwarf. Our optical spectroscopy does not show any evidence of Zeeman splitting of the Balmer lines, limiting the magnetic field strength to B<70 kG. Since up to 15% of white dwarfs display kG magnetic fields, such ecli...

  8. Management of post-orthodontic white spot lesions

    DEFF Research Database (Denmark)

    Sonesson, Mikael; Bergstrand, Fredrik; Gizani, Sotiria;


    BACKGROUND/OBJECTIVES: The management of post-orthodontic white spot lesions is based on remineralization strategies or a minimal-invasive camouflage of the lesions. AIM: The aim of this systematic review was to identify and assess the quality of evidence for the various clinical technologies...... were considered. Furthermore, a follow-up period of at least 8 weeks was required. The publication bias could not be assessed due to the paucity of included trials. CONCLUSIONS/CLINICAL IMPLICATIONS: There is a lack of reliable scientific evidence to support re-mineralizing or camouflaging strategies...

  9. Endogenous retrovirus insertion in the KIT oncogene determines white and white spotting in domestic cats. (United States)

    David, Victor A; Menotti-Raymond, Marilyn; Wallace, Andrea Coots; Roelke, Melody; Kehler, James; Leighty, Robert; Eizirik, Eduardo; Hannah, Steven S; Nelson, George; Schäffer, Alejandro A; Connelly, Catherine J; O'Brien, Stephen J; Ryugo, David K


    The Dominant White locus (W) in the domestic cat demonstrates pleiotropic effects exhibiting complete penetrance for absence of coat pigmentation and incomplete penetrance for deafness and iris hypopigmentation. We performed linkage analysis using a pedigree segregating White to identify KIT (Chr. B1) as the feline W locus. Segregation and sequence analysis of the KIT gene in two pedigrees (P1 and P2) revealed the remarkable retrotransposition and evolution of a feline endogenous retrovirus (FERV1) as responsible for two distinct phenotypes of the W locus, Dominant White, and white spotting. A full-length (7125 bp) FERV1 element is associated with white spotting, whereas a FERV1 long terminal repeat (LTR) is associated with all Dominant White individuals. For purposes of statistical analysis, the alternatives of wild-type sequence, FERV1 element, and LTR-only define a triallelic marker. Taking into account pedigree relationships, deafness is genetically linked and associated with this marker; estimated P values for association are in the range of 0.007 to 0.10. The retrotransposition interrupts a DNAase I hypersensitive site in KIT intron 1 that is highly conserved across mammals and was previously demonstrated to regulate temporal and tissue-specific expression of KIT in murine hematopoietic and melanocytic cells. A large-population genetic survey of cats (n = 270), representing 30 cat breeds, supports our findings and demonstrates statistical significance of the FERV1 LTR and full-length element with Dominant White/blue iris (P < 0.0001) and white spotting (P < 0.0001), respectively. PMID:25085922

  10. Suction generation in white-spotted bamboo sharks Chiloscyllium plagiosum. (United States)

    Wilga, Cheryl D; Sanford, Christopher P


    After the divergence of chondrichthyans and teleostomes, the structure of the feeding apparatus also diverged leading to alterations in the suction mechanism. In this study we investigated the mechanism for suction generation during feeding in white-spotted bamboo sharks, Chiloscyllium plagiosum and compared it with that in teleosts. The internal movement of cranial elements and pressure in the buccal, hyoid and pharyngeal cavities that are directly responsible for suction generation was quantified using sonomicrometry and pressure transducers. Backward stepwise multiple linear regressions were used to explore the relationship between expansion and pressure, accounting for 60-96% of the variation in pressure among capture events. The progression of anterior to posterior expansion in the buccal, hyoid and pharyngeal cavities is accompanied by the sequential onset of subambient pressure in these cavities as prey is drawn into the mouth. Gape opening triggers the onset of subambient pressure in the oropharyngeal cavities. Peak gape area coincides with peak subambient buccal pressure. Increased velocity of hyoid area expansion is primarily responsible for generating peak subambient pressure in the buccal and hyoid regions. Pharyngeal expansion appears to function as a sink to receive water influx from the mouth, much like that of compensatory suction in bidirectional aquatic feeders. Interestingly, C. plagiosum generates large suction pressures while paradoxically compressing the buccal cavity laterally, delaying the time to peak pressure. This represents a fundamental difference from the mechanism used to generate suction in teleost fishes. Interestingly, pressure in the three cavities peaks in the posterior to anterior direction. The complex shape changes that the buccal cavity undergoes indicate that, as in teleosts, unsteady flow predominates during suction feeding. Several kinematic variables function together, with great variation over long gape cycles to

  11. Assessment of White Spot Lesions and In-Vivo Evaluation of the Effect of CPP-ACP on White Spot Lesions in Permanent Molars of Children (United States)

    Munjal, Deepti; Garg, Shalini; Dhindsa, Abhishek; Sidhu, Gagandeep Kaur


    Introduction As hindrance of remineralisation process occurs during orthodontic therapy resulting in decalcification of enamel because number of plaque retention sites increases due to banding and bonding of appliances to teeth. Aim The present analytic study was undertaken to assess the occurrence of white spot lesions in permanent molars of children with and without orthodontic therapy and to evaluate the effect of Casein PhosphoPeptide-Amorphous Calcium Phosphate (CPP-ACP) on white spot lesions in post-orthodontic patients in a given period of time. Materials and Methods The study comprised of examination of 679 first permanent molars which were examined to assess the occurrence of smooth surface white spot lesions in children of 8 to 16 years age group. Group I comprised subjects without any orthodontic treatment and Group II comprised of subjects who had undergone orthodontic therapy. The sample size was calculated using the epi-info6 computer package. Treatment group included 20 post-orthodontic patients examined with at least one white spot lesion within the enamel who received remineralizing cream (GC Tooth Mousse, Recaldent, GC Corporation.) i.e., CPP–ACP cream two times a day for 12 consecutive weeks. Computerized image analysis method was taken to evaluate white spot lesions. These frequency and percentages were compared with chi-square test. For comparison of numeric data, paired t-test was used. Results Of the total 278 (49.6%) first permanent molars showed occurrence of smooth surface white spot lesions out of 560 in Group I and 107 (89.9%) first permanent molars showed presence of white spot lesions out of 119 debanded first permanent molars of children examined in Group II. CPP-ACP therapy group showed reduction in severity of codes which was found to be highly significant after 12 weeks and eight weeks on gingival-third, p-value (<0.001) and significant after eight weeks and four weeks on middle-third according to ICDAS II criteria and

  12. Fluoride-Releasing Materials to Prevent White Spot Lesions around Orthodontic Brackets: A Systematic Review. (United States)

    Nascimento, Patrícia Layane de Menezes Macêdo; Fernandes, Micaelle Tenório Guedes; Figueiredo, Fabricio Eneas Diniz de; Faria-E-Silva, André Luis


    The relation between orthodontic fixed appliances use and enamel demineralization is well established. Different preventive approaches have been suggested to this problem, but controversy remains about which is the best. The aim of this study was to perform a systematic review of clinical trials that investigated the effectiveness of materials containing fluorides to lute brackets or cover the bonding interface in order to inhibit the development and progression of white spot lesions. The null hypothesis was that fluoride materials do not affect the incidence of white spot lesions around brackets. A MEDLINE search was conducted for randomized clinical trials evaluating the development of white spot lesions in patients using fixed orthodontic appliances, followed by meta-analysis comparing the results for patients for whom dental materials containing fluorides were used (experimental group) to those for whom these materials were not used (control group). The pooled relative risk of developing white spot lesions for the experimental group was 0.42 (95% confidence interval: 0.25 to 0.72); hence, when fluoride-releasing materials are used, the patient has 58% less risk of white spot lesion development. Regarding white spot lesion extent, the pooled mean difference between the experimental and control groups was not statistically significant (-0.12; 95% confidence interval: -0.29 to 0.04). In conclusion, the results of the present systematic review suggest that fluoride-releasing materials can reduce the risk of white spot lesions around brackets. However, when white spot lesions had already occurred, there is no evidence that fluoride-releasing materials reduce the extent of these lesions. PMID:27007355

  13. The 2010 Saturn's Great White Spot: Observations and models (United States)

    Sanchez-Lavega, A.


    On December 5, 2010, a major storm erupted in Saturn's northern hemisphere at a planetographic latitude of 37.7 deg [1]. These phenomena are known as "Great White Spots" (GWS) and they have been observed once per Saturn year since the first case confidently reported in 1876. The last event occurred at Saturn's Equator in 1990 [2]. A GWS differs from similar smaller-scale storms in that it generates a planetary-scale disturbance that spreads zonally spanning the whole latitude band. We report on the evolution and motions of the 2010 GWS and its associated disturbance during the months following the outbreak, based mainly on high quality images obtained in the visual range submitted to the International Outer Planet Watch PVOL database [3], with the 1m telescope at Pic-du-Midi Observatory and the 2.2 m telescope at Calar Alto Observatory. The GWS "head source" extinguished by June 2011 implying that it survived about 6 months. Since this source is assumed to be produced by water moist convection, a reservoir of water vapor must exist at a depth of 10 bar and at the same time a disturbance producing the necessary convergence to trigger the ascending motions. The high temporal sampling and coverage allowed us to study the dynamics of the GWS in detail and the multi-wavelength observations provide information on its cloud top structure. We present non-linear simulations using the EPIC code of the evolution of the potential vorticity generated by a continuous Gaussian heat source extending from 10 bar to about 1 bar, that compare extraordinary well to the observed cloud field evolution. Acknowledgements: This work has been funded by Spanish MICIIN AYA2009-10701 with FEDER support and Grupos Gobierno Vasco IT-464-07. The presentation is done on behalf of the team listed in Reference [1]. [1]Sánchez-Lavega A., et al., Nature, 475, 71-74 (2011) [2]Sánchez-Lavega A., et al., Nature, 353, 397-401 (1991) [3]Hueso R., et al., Planet. Space Sci., 58, 1152-1159 (2010).

  14. Status of tobacco viruses in Serbia and molecular characterization of tomato spotted wilt virus isolates. (United States)

    Stanković, I; Bulajić, A; Vučurović, A; Ristić, D; Milojević, K; Berenji, J; Krstić, B


    In a four-year survey to determine the presence and distribution of viruses in tobacco crops at 17 localities of the Vojvodina Province and Central Serbia, 380 samples were collected and analyzed by DAS-ELISA. Out of the seven viruses tested, tomato spotted wilt virus (TSWV), potato virus Y (PVY), tobacco mosaic virus (TMV), cucumber mosaic virus (CMV), and alfalfa mosaic virus (AMV) were detected in 37.9, 33.4, 28.7, 23.9, and 15.5% of the total tested samples, respectively. TSWV was the most frequently found virus at the localities of Central Serbia, while PVY and CMV were the most frequent viruses in the Vojvodina Province. Single infections were prevalent in years 2005-2007 and the most frequent were those of PVY. A triple combination of those viruses was most frequent mixed infection type in 2008. The presence of all five detected viruses was confirmed in selected ELISA-positive samples by RT-PCR and sequencing. The comparisons of obtained virus isolate sequences with those available in NCBI, confirmed the authenticity of serologically detected viruses. Phylogenetic analysis based on partial nucleocapsid gene sequences revealed a joint clustering of Serbian, Bulgarian and Montenegrin TSWV isolates into one geographic subpopulation, which was distinct from the other subpopulation of TSWV isolates from the rest of the European countries. The high incidence of viruses in Serbian tobacco crops highlights the importance of enhancing farmers knowledge towards better implementation of control strategies for preventing serious losses. PMID:22149499

  15. White-spot disease of Chinese soft-shelled turtles (Trionyx sinens) caused by Paecilomyces lilacinus *


    Li, Xiao-liang; Zhang, Chu-Long; Fang, Wei-huan; Lin, Fu-cheng


    Chinese soft-shelled turtles (Trionyx sinens) in culture farms using an artificial warming system in Zhejiang, China, often show typical signs of white-spot disease such as white spots on their bodies, skin lesions, anorexia and eventually death. The sick turtles were mostly 5~80 g in weight. A suspected fungal pathogen was isolated from the sick turtles and verified as Paecilomyces lilacinus by sequence analysis of the internal transcribed spacer (ITS) of its ribosomal DNA (rDNA). Detailed m...

  16. Effect of the probiotic bacterium Lactobacillus reuteri on white spot lesion development in orthodontic patients

    DEFF Research Database (Denmark)

    Gizani, Sotiria; Petsi, Georgia; Twetman, Svante;


    BACKGROUND/OBJECTIVES: The purpose of the study is to evaluate the effect of daily intake of lozenges containing probiotic bacteria on white spot lesion (WSL) formation as well as on salivary lactobacilli (LB) and mutans streptococci (MS) counts, in patients undergoing orthodontic treatment with ...

  17. A review on prevention and treatment of post-orthodontic white spot lesions - evidence-based methods and emerging technologies

    DEFF Research Database (Denmark)

    Bergstrand, Fredrik; Twetman, Svante


    The aim of this paper was to update the evidence for primary and secondary prevention (treatment) of white spot lesions (WSL) adjacent to fixed orthodontic appliances.......The aim of this paper was to update the evidence for primary and secondary prevention (treatment) of white spot lesions (WSL) adjacent to fixed orthodontic appliances....

  18. 南中国斑节对虾养殖中控制白斑综合症病的理论和策略%Theory and Strategies for Controlling White Spot Syndrome (WSS) of Cultured Penaeus monodon in South China

    Institute of Scientific and Technical Information of China (English)


    @@ White spot syndrome virus (WSSV) is the causative agent of white spot syndrome (WSS) of cultured penaeid shrimps. WSS breaks out and prevails in cultured penaeid shrimps in many countries and regions of the world, especially in southeast Asia. WSSV is the virus most severe damaging to the cultured penaeid shrimps in the world. At the present time, the control of the outbreaks of WSSV will recover and develop the penaeid shrimp cultures in China and even in the world.

  19. First report of Tomato chlorotic spot virus on Annual Vinca (Catharanthus roseus) in the United States (United States)

    Tomato chlorotic spot virus was identified in the ornamental crop Catharanthus roseus (commonly known as vinca) in south Florida, the first report of this virus naturally infecting this species. Genetic diversity of the virus was characterized. This report provides an overview of this emerging vir...

  20. The structure of melon necrotic spot virus determined at 2.8 Å resolution

    International Nuclear Information System (INIS)

    The structure of melon necrotic spot virus is reported. The structure of melon necrotic spot virus (MNSV) was determined at 2.8 Å resolution. Although MNSV is classified into the genus Carmovirus of the family Tombusviridae, the three-dimensional structure of MNSV showed a higher degree of similarity to tomato bushy stunt virus (TBSV), which belongs to the genus Tombusvirus, than to carnation mottle virus (CMtV), turnip crinkle virus (TCV) or cowpea mottle virus (CPMtV) from the genus Carmovirus. Thus, the classification of the family Tombusviridae at the genus level conflicts with the patterns of similarity among coat-protein structures. MNSV is one of the viruses belonging to the genera Tombusvirus or Carmovirus that are naturally transmitted in the soil by zoospores of fungal vectors. The X-ray structure of MNSV provides us with a representative structure of viruses transmitted by fungi

  1. Phylogenetic and recombination analysis of tomato spotted wilt virus.

    Directory of Open Access Journals (Sweden)

    Sen Lian

    Full Text Available Tomato spotted wilt virus (TSWV severely damages and reduces the yield of many economically important plants worldwide. In this study, we determined the whole-genome sequences of 10 TSWV isolates recently identified from various regions and hosts in Korea. Phylogenetic analysis of these 10 isolates as well as the three previously sequenced isolates indicated that the 13 Korean TSWV isolates could be divided into two groups reflecting either two different origins or divergences of Korean TSWV isolates. In addition, the complete nucleotide sequences for the 13 Korean TSWV isolates along with previously sequenced TSWV RNA segments from Korea and other countries were subjected to phylogenetic and recombination analysis. The phylogenetic analysis indicated that both the RNA L and RNA M segments of most Korean isolates might have originated in Western Europe and North America but that the RNA S segments for all Korean isolates might have originated in China and Japan. Recombination analysis identified a total of 12 recombination events among all isolates and segments and five recombination events among the 13 Korea isolates; among the five recombinants from Korea, three contained the whole RNA L segment, suggesting reassortment rather than recombination. Our analyses provide evidence that both recombination and reassortment have contributed to the molecular diversity of TSWV.

  2. Case Report:White-spot disease of Chinese soft-shelled turtles (Trionyx sinens) caused by Paecilomyces lilacinus

    Institute of Scientific and Technical Information of China (English)

    Xiao-liang LI; Chu-long ZHANG; Wei-huan FANG; Fu-cheng LIN


    Chinese soft-shelled turtles (Trionyx sinens) in culture farms using an artificial warming system in Zhejiang, China,often show typical signs of white-spot disease such as white spots on their bodies, skin lesions, anorexia and eventually death. The sick turtles were mostly 5~80 g in weight. A suspected fungai pathogen was isolated from the sick turtles and verified as Pae-cilomyces lilacinus by sequence analysis of the internal transcribed spacer (ITS) of its ribosomal DNA (rDNA). Detailed mor-phological examinations were also conducted to confirm the white-spot disease.

  3. Praziquantel treatment of captive white-spotted eagle rays (Aetobatus narinari) infested with monogean trematodes


    Janse, M.; Borgsteede, F.H.M.


    Captive white-spotted eagle rays (Aetobatus narinari) were infested with Clemacotyle australis (Monogenea: Monocotylidae) on the skin and with a species of the Hexabothriinae on the gills. Different behavioural changes have been described caused by these infections. Oral treatment with 10-40 mg praziquantel per kg bodyweight had no effect. Bath treatment with 20 mg praziquantel per litre for 45-90 minutes showed good results against both parasite species. The presence of cleaner wrasse (Labro...

  4. Prevalence of enamel white spots and risk factors in children up to 36 months old


    Ana Valéria Pagliari Tiano; Suzely Adas Saliba Moimaz; Orlando Saliba; Cléa Adas Saliba Garbin


    The aim of this study was to determine the prevalence of enamel white spots and the quality of oral hygiene in children up to 36 months old, in municipalities with different fluoride levels in the water supply, analyzing the contribution of several variables. After approval of the Ethics Committee, the parents signed an informed consent form and were interviewed about their educational level, economic classification of the family, nursing habits, use of toothpaste, access to dental service an...

  5. Role of the envelope glycoproteins in the infection cycle of tomato spotted wilt virus


    Kikkert, M.


    Tomato spotted wilt virus (TSWV) forms the type member of the genus Tospovirus , which today harbors more than twelve different species. TSWV is able to infect an enormous variety of different plants, to which it often causes devastating effects, resulting in severe economical losses. Among the plant viruses, TSWV and the other tospoviruses form a distinct group. Taxonomically, they surprisingly do not belong to a plant virus family, but to a virus family which further consists of animal-infe...

  6. Prevalence of enamel white spots and risk factors in children up to 36 months old

    Directory of Open Access Journals (Sweden)

    Ana Valéria Pagliari Tiano


    Full Text Available The aim of this study was to determine the prevalence of enamel white spots and the quality of oral hygiene in children up to 36 months old, in municipalities with different fluoride levels in the water supply, analyzing the contribution of several variables. After approval of the Ethics Committee, the parents signed an informed consent form and were interviewed about their educational level, economic classification of the family, nursing habits, use of toothpaste, access to dental service and other information. The children were clinically examined using the same codes and criteria established by the WHO (World Health Organization and ADA (American Dental Association. The data were processed and analyzed with the Epi-info software program, version 3.2, and Microsoft Excel. Fisher's exact test (p<0.05 was applied to assess the association among the variables. The enamel white spot prevalence was 30.8% and the age group, duration of the bedtime milk feeding habit, age of initial practice of oral hygiene and presence of caries lesions with cavitation were considered statistically significant with regard to enamel white spot prevalence (p < 0.05. No association was found between oral hygiene quality and the study variables.

  7. Tomato spotted wilt virus glycoproteins exhibit trafficking and localization signals that are functional in mammalian cells

    NARCIS (Netherlands)

    Kikkert, M.; Verschoor, A.; Kormelink, R.; Rottier, P.; Goldbach, R.


    The glycoprotein precursor (G1/G2) gene of tomato spotted wilt virus (TSWV) was expressed in BHK cells using the Semliki Forest virus expression system. The results reveal that in this cell system, the precursor is efficiently cleaved and the resulting G1 and G2 glycoproteins are transported from th

  8. A novel virus transmitted through pollination causes ring-spot disease on gentian (Gentiana triflora) ovaries. (United States)

    Atsumi, Go; Tomita, Reiko; Yamashita, Tetsuro; Sekine, Ken-Taro


    In this study, we identified a novel virus from gentian (Gentiana triflora) that causes ring-spots on ovaries. Furthermore, the virus causes unusual symptoms, ring-spots that appear specifically on the outer surface of the ovarian wall after pollination. Pollen grains carrying the virus were used to infect host plants by hand-pollination. RNA extracted from purified virions indicated that the virus had two segments, RNA1 and RNA2. The full-length cDNA sequence indicated that RNA1 had two ORFs: ORF1 had methyltransferase and helicase motifs, and ORF2 had an RNA-dependent RNA polymerase motif. RNA2 had five ORFs encoding a coat protein, triple gene block proteins 1-3 and a cysteine-rich protein. The length of RNA1 was 5519 bases and that of RNA2 was 3810 bases not including a polyU/polyA region between the first and second ORFs. Viral RNA does not have a polyA tail at the 3' end. Sequence similarity and phylogenetic analysis suggested that the virus is closely related to members of the genera Pecluvirus and Hordeivirus but distinct from them. These combined results suggest that the causal agent inducing ring-spot symptoms on gentian ovaries is a new virus belonging to the family Virgaviridae but not to any presently known genus. We tentatively name the virus gentian ovary ring-spot virus. PMID:25351517

  9. Occurrence of Tomato spotted wilt virus in Stevia rebaudiana and Solanum tuberosum in Northern Greece

    NARCIS (Netherlands)

    Chatzivassiliou, E.K.; Peters, D.; Lolas, P.


    Tomato spotted wilt virus (TSWV) (genus Tospovirus, family Bunyaviridae) was first reported in Greece during 1972 (3) and currently is widespread in the central and northern part of the country infecting several cultivated and wild plant species (1,2). In June 2006, virus-like symptoms similar to th

  10. Analysis of the transcription initiation mechanism of tomato spotted wilt virus

    NARCIS (Netherlands)

    Duijsings, D.M.J.M.


    Genome replication and transcription of Tomato spotted wilt virus (TSWV, genus Tospovirus ) follows in most aspects the general rules for negative strand RNA viruses with segmented genomes. One common feature is the occurrence of "cap snatching" during transcription initiation. During this process,

  11. First report of the natural occurence of Tomato chlorotic spot virus in peanuts in Haiti (United States)

    Tomato chlorotic spot virus (TCSV) was identified in peanut in Haiti. This is the first report of TCSV naturally infecting peanut. Genetic diversity of TCSV was characterized. This report provides an overview of this emerging virus for growers, extension workers, crop consultants and research and...

  12. Dynamics of genetic diversity of Tomato spotted wilt virus in the United States (United States)

    Among known tospoviruses, Tomato spotted wilt virus (TSWV; genus Tospovirus, family Bunyaviridae) continues to be the major viral disease affecting a wide range of agricultural and horticultural crops worldwide. Like many other RNA viruses, TSWV is known to maintain heterogeneous and divergent popul...

  13. Proteomic analysis of shrimp white spot syndrome viral proteins and characterization of a novel envelope protein VP466. (United States)

    Huang, Canhua; Zhang, Xiaobo; Lin, Qingsong; Xu, Xun; Hu, Zhihong; Hew, Choy-L


    White spot syndrome virus (WSSV) is at present one of the major pathogens in shrimp culture worldwide. The complete genome of this virus has been sequenced recently. To identify the structural and functional proteins of WSSV, the purified virions were separated by SDS-PAGE. Twenty-four protein bands were excised, in-gel digested with trypsin, and subjected to matrix-assisted laser desorption ionization-time of flight mass spectrometry and electrospray ionization tandem mass spectrometry, respectively. Eighteen proteins matching the open reading frames of WSSV genome were identified. Except for three known structural proteins and collagen, the functions of the remaining 14 proteins were unknown. Temporal analysis revealed that all the genes were transcribed in the late stage of WSSV infection except for vp121. Of the newly identified proteins, VP466 (derived from band 16) was further characterized. The cDNA encoding VP466 was expressed in Escherichia coli as a glutathione S-transferase (GST) fusion protein. Specific antibody was generated with the purified GST-VP466 fusion protein. Western blot showed that the mouse anti-GST-VP466 antibody bound specifically to a 51-kDa protein of WSSV. Immunogold labeling revealed that VP466 protein is a component of the viral envelope. Results in this investigation thus proved the effectiveness of proteomic approaches for discovering new proteins of WSSV. PMID:12096122

  14. Caries progression of white spot lesions sealed with an unfilled resin. (United States)

    Garcia-Godoy, F; Summitt, J B; Donly, K J


    This study evaluated the artificial caries resistance provided to white spot lesions by sealing with an unfilled resin. Twenty extracted molar teeth were coated with an acid-resistant varnish (ARV), except for two 5 mm x 2 mm enamel windows (mesial and distal), and immersed for 5 weeks in an acidified gel brought to a pH of 4.2 with lactic acid. White spot lesions (not frank caries) were created in each window. The teeth were removed from the gel, rinsed and dried. One window was divided into two equal parts; one half was covered with the ARV (Group 1); the other half was not covered (Group 2). The other window was treated with 37% phosphoric acid for 20 sec, rinsed with water for 20 sec, dried and sealed with Prisma Universal Bond 2 Adhesive (Group 3). The teeth were reimmersed in the acidified gel for 40 days until frank caries was induced in Group 2. Specimens were then removed from the gel, rinsed, and sectioned occlusogingivally. Sections were polished to approximately 100 microns, imbibed in water, and analyzed using polarized light microscopy. Depth of demineralization was evaluated in the varnished, sealed and frankly carious areas. The mean (SD) lesion depths were as follows: Group 1 (under ARV) 366 microns (103 microns); Group 2 (frank caries) 746 microns (219 microns); Group 3 (under sealed area) 298 microns (111 microns). ANOVA and Student-Newman-Keuls procedure were used to compare group means. The mean depths of demineralization under the ARV (Group 1) and the unfilled resin sealant (Group 2) were significantly less than for the unprotected enamel (Group 2) (p > 0.0001). Results indicate the potential effectiveness of sealing white spot lesions with an unfilled resin to prevent further demineralization. PMID:9484106

  15. Measuring color change of tooth enamel by in vitro remineralization of white spot lesion.


    Betina Raquel Tolcachir; Luis Crohare; Raquel Vivian Gallará


    Introduction: Objective colour determination is based on calculating the colorimetric distance (ΔE) within a colour space. So far, the most used colour space in dentistry is CIE L*a*b (Comission Internationale de l´Éclairage). CIE L*C*h* has been recently developed, showing a better correlation with the perception of the human eye. Objective: To determine the ability of an in vitro remineralisation substance to mimic the colour of white spot lesions (WSL) with sound enamel, determining ΔE by...


    Institute of Scientific and Technical Information of China (English)

    丁晶; 王彦波; 傅玲琳


    以枯草芽孢杆菌(Bacillus subtilis)为活载体口服递呈对虾白斑综合征病毒(WSSV)囊膜蛋白 VP28,评价其抗病毒感染能力、对南美白对虾免疫相关基因表达以及血淋巴细胞对病毒特异性吞噬的影响。经口服免疫枯草重组菌株B. subtilis-VP28攻毒后,对虾的相对存活率达83.3%。为探讨重组菌株的抗病机理,比较研究了免疫相关基因-proPO(酚氧化酶原)、Peroxinectin(PE)和脂多糖-β-1,3-葡聚糖结合蛋白(LGBP)基因的表达差异,并进一步分析了血淋巴细胞吞噬活性和特异性。结果表明, B. subtilis-VP28菌液能显著提高(P<0.05)对虾proPO、PE和LGBP mRNA的表达水平和血细胞对WSSV的吞噬活性, B. subtilis组对免疫相关基因也有一定的激活作用,而B. subtilis-VP28发酵上清液则能增加血细胞吞噬活性;此外, B. subtilis-VP28菌液组血细胞对WSSV具有特异性吞噬作用。研究为枯草重组菌株B. subtilis-VP28抗WSSV感染作用及其作为特殊功能水产微生态制剂的应用提供了一定的科学依据。%The regulation of immune-related genes expression and phagocytosis of White Spot Syndrome Virus (WSSV) were evaluated by oral delivery of VP28 using Bacillus subtilis as vehicles in Litopenaeus vannamei. In our initial ex-periment, by oral delivery of B. subtilis spores harboring VP28 (B. subtilis-VP28) to L. vannamei, the extremely high survival (Relative Percent Survival:83.3%) upon challenge with WSSV can be observed. The differences of genes ex-pression levels of proPO, Peroxinectin (PE) and lipopolysaccharide-and beta-1, 3-glucan-binding protein (LGBP) were demonstrated among experimental groups of B. subtilis-VP28 bacterial spores, B. subtilis-VP28 supernatants, B. subtilis and control. The result showed that immune-related genes (proPO, PE and LGBP) were significantly (P<0.05) upregu-lated in both B. subtilis-VP28 bacterial spores and B. subtilis feeding groups compared to B. subtilis-VP28

  17. Molecular and Ultrastructural Properties of Maize White Line Virus (United States)

    This paper reports the complete nucleotide sequence of the genome of Maize white line mosaic virus (MWLMV) and describes the ultrastructural features of infected maize cells. The viral genome is an RNA molecule 4293 nt in size with the same structural organization of members of the Aureusvirus and ...

  18. Comparative analysis of chrysanthemum transcriptome in response to three RNA viruses: Cucumber mosaic virus, Tomato spotted wilt virus and Potato virus X. (United States)

    Choi, Hoseong; Jo, Yeonhwa; Lian, Sen; Jo, Kyoung-Min; Chu, Hyosub; Yoon, Ju-Yeon; Choi, Seung-Kook; Kim, Kook-Hyung; Cho, Won Kyong


    The chrysanthemum is one of popular flowers in the world and a host for several viruses. So far, molecular interaction studies between the chrysanthemum and viruses are limited. In this study, we carried out a transcriptome analysis of chrysanthemum in response to three different viruses including Cucumber mosaic virus (CMV), Tomato spotted wilt virus (TSWV) and Potato virus X (PVX). A chrysanthemum 135K microarray derived from expressed sequence tags was successfully applied for the expression profiles of the chrysanthemum at early stage of virus infection. Finally, we identified a total of 125, 70 and 124 differentially expressed genes (DEGs) for CMV, TSWV and PVX, respectively. Many DEGs were virus specific; however, 33 DEGs were commonly regulated by three viruses. Gene ontology (GO) enrichment analysis identified a total of 132 GO terms, and of them, six GO terms related stress response and MCM complex were commonly identified for three viruses. Several genes functioning in stress response such as chitin response and ethylene mediated signaling pathway were up-regulated indicating their involvement in establishment of host immune system. In particular, TSWV infection significantly down-regulated genes related to DNA metabolic process including DNA replication, chromatin organization, histone modification and cytokinesis, and they are mostly targeted to nucleosome and MCM complex. Taken together, our comparative transcriptome analysis revealed several genes related to hormone mediated viral stress response and DNA modification. The identified chrysanthemums genes could be good candidates for further functional study associated with resistant to various plant viruses. PMID:25904110

  19. Bonding brackets on white spot lesions pretreated by means of two methods (United States)

    Vianna, Julia Sotero; Marquezan, Mariana; Lau, Thiago Chon Leon; Sant'Anna, Eduardo Franzotti


    Abstract Objective: The aim of this study was to evaluate the shear bond strength (SBS) of brackets bonded to demineralized enamel pretreated with low viscosity Icon Infiltrant resin (DMG) and glass ionomer cement (Clinpro XT Varnish, 3M Unitek) with and without aging. Methods: A total of 75 bovine enamel specimens were allocated into five groups (n = 15). Group 1 was the control group in which the enamel surface was not demineralized. In the other four groups, the surfaces were submitted to cariogenic challenge and white spot lesions were treated. Groups 2 and 3 were treated with Icon Infiltrant resin; Groups 4 and 5, with Clinpro XT Varnish. After treatment, Groups 3 and 5 were artificially aged. Brackets were bonded with Transbond XT adhesive system and SBS was evaluated by means of a universal testing machine. Statistical analysis was performed by one-way analysis of variance followed by Tukey post-hoc test. Results: All groups tested presented shear bond strengths similar to or higher than the control group. Specimens of Group 4 had significantly higher shear bond strength values (p < 0.05) than the others. Conclusion: Pretreatment of white spot lesions, with or without aging, did not decrease the SBS of brackets. PMID:27275613

  20. Effects of Microabrasion on non Active White Spots in Primary Teeth

    Directory of Open Access Journals (Sweden)

    Carolina Júdica RAMOS


    Full Text Available Objective: The aim of this study was to verify the enamel micromorphology with non active white spot lesions after the application of two different compounds used in microabrasion technique. Method: Thirty primary molars with non active white spot lesions in approximal surfaces were selected. Samples were randomly divided into three groups. G1 (n=10: control, untreated. G2 (n=10: compound (35% phosphoric acid and pumice mixed - 1:1 was applied on stain enamel. G3 (n=10: compound Opalustre, a slurry containing 6.6% HCl (hydrochloric acid and silicon carbide microparticles was applied. After this, all specimens were dehydrated, mounted on metal stubs, coated with gold and examined under scanning electron microscope (Jeol, JSM - 6100. Results: Eletronmicrographs analysis showed that the G1 samples (control, without treatment had a smooth surface with the presence of pumice residue. G2 samples (phosphoric acid and pumice presented rugous enamel surface with areas of enamel prisms demineralization. In G3 samples (Opalustre it were observed the formation of scratchs and grooves, beyond the presence of compound residue. Conclusion: The application of different types of compounds led to the formation of different aspects in micromorphology of primary teeth enamel.

  1. The hemic response of white-spotted bamboo sharks (Chiloscyllium plagiosum) with inflammatory disease. (United States)

    Alexander, Amy B; Parkinson, Lily A; Grant, Krystan R; Carlson, Eric; Campbell, Terry W


    As elasmobranch medicine becomes more commonplace, there continues to be confusion with techniques and evaluation of the shark hemogram and it remains unknown if they are able to mount an inflammatory hemic response. The aims of this study were to compare two total white blood cell (WBC) count techniques, establish a reference interval for captive white-spotted bamboo sharks (Chiloscyllium plagiosum), and determine if elasmobranchs are capable of mounting an inflammatory hemic response. Correlation statistics were performed on hematologic results for healthy female bamboo sharks to assess the use of Natt-Herrick's and phloxine methods. Total WBC counts and differentials were obtained from males with severe traumatic clasper wounds and compared to the healthy females. We elected clasper amputation as the preferred treatment intervention and post-operative hematology was performed one month later. There was poor correlation of leukocyte counts between the two WBC count methods. Hematologic values were established for the females and males pre- and post-operatively. Males with wounds had a marked leukocytosis and heterophilia. Post-operative blood work showed a resolution of total WBC count and a trend toward resolution of the heterophilia. This study provides hematologic values for white-spotted bamboo sharks and confirms that the Natt-Herrick's method is preferred for lymphocytic species. Hematologic differences present in males with clasper wounds suggests that elasmobranchs do mount an inflammatory hemic response. Treatment via clasper amputation proved to be a safe and efficient means for clinical treatment that led to a trend toward resolution of the inflammatory leukogram. Zoo Biol. 35:251-259, 2016. © 2016 Wiley Periodicals, Inc. PMID:26970476

  2. Molecular Diagnosis of Iris Yellow Spot Virus (IYSV) on Onion in Iran


    Beikzadeh, N.; Jafarpour, B.; Rouhani, H.; Peters, D.; Hassani-Mehraban, A.


    Viral symptoms indicative of Iris yellow spot virus (IYSV) were observed on onion in several fields near Chenaran in Khorasan Razavi Province. Mechanical inoculation of herbaceous hosts with onion sap extracts from symptomatic plants showed similar symptoms to those described for IYSV. The mechanically transmitted virus reacted only with antisera specific to IYSV in DAS-ELISA but not with antisera specific to seven other tospoviruses. In RT-PCR, a DNA fragment approximately 822 bp in size was...

  3. Regular exposure to rabies virus and lack of symptomatic disease in Serengeti spotted hyenas


    Marion L East; Hofer, Heribert; Cox, James H.; Wulle, Ulrich; Wiik, Harald; Pitra, Christian


    We report a previously unrecognized complexity to the ecology of rabies in wildlife. Rabies-specific virus-neutralizing antibodies in spotted hyenas, the most numerous large carnivore in the Serengeti ecosystem (Tanzania, East Africa), revealed a high frequency of exposure of 37.0% to rabies virus, and reverse transcriptase (RT) PCR demonstrated rabies RNA in 13.0% of hyenas. Despite this high frequency, exposure neither caused symptomatic rabies nor decreased surv...

  4. Four kinds of ENU-induced white spot mice and chromosome locations of the mutant genes

    Institute of Scientific and Technical Information of China (English)

    WU Baojin; MAO Huihua; SHAO Yixiang; XUE Zhengfeng; LI Houda


    Phenotype-driven is the name for an approach used to study gene functions through mutagenesis, location and cloning of the mutant gene. In this study, 150 male C57BL/6J(B6) mice were treated with ENU and reproduced a total offspring of 3860. Of these descendants, 210 exhibited mutation phenotypes by screening, and more than 10 of them are hereditable. Four kinds of mutant mice, named Wbct, W-1Bao, W-2Bao, and W-3Bao, showed dominant hereditary white spot mutation with partial albinism on their belly, distal limbs and tail terminal. To map these mutant genes, 39 microsatellites, equally distributed on the mouse genome and with difference between B6 and DBA/2J (D2), were selected to scan the genome after discrimination of the white spots in the F2 mice [(B6×D2)×D2]. It is found that, the log odds score (LODS) between W-1Bao and D5Mit168 is 0.56, and the LODS of W-1Bao and D5Mit352 is 4.47. With the gradual application of microsatellites D5Mit290, D5Mit312, D5Mit308 and D5Mit356 that are close to the mutant gene, and the number of F2 mice going up to 537, the mutant W-1Bao is located between D5Mit356 and D5Mit308 on chromosome 5, about 42.19 cM from the centromere. In the same way, W-2Bao and W-3Bao are mapped nearby W-1Bao, and Wbct is located on chromosome 1, about 41.6 cM from the centromere. After searching for the mouse genome database (MGD) and performing a one-by-one study of all genes located on chromosome subregion, it is believed that the kit gene is an excellent candidate for the white spot mutations of W-1Bao, W-2Bao and W-3Bao.

  5. Prevention and Treatment of White Spot Lesions During and After Treatment with Fixed Orthodontic Appliances: a Systematic Literature Review

    Directory of Open Access Journals (Sweden)

    Kristina Lopatiene


    Full Text Available Objectives: The aim of the systematic literature review is to update the evidence for the prevention of white spot lesions, using materials containing fluoride and/or casein phosphopeptide-amorphous calcium phosphate during and after treatment with fixed orthodontic appliances. Material and Methods: Information search for controlled studies on humans published between January 2008 and February 2016 was performed in PubMed, ScienceDirect, Embase, The Cochrane Library. Inclusion criteria were: the English language, study on humans, patients undergoing orthodontic treatment with fixed appliances, randomized or quasi-randomized controlled clinical studies fluoride-containing product or casein derivates used throughout the appliance therapy or straightaway after debonding. Results: 326 articles were reviewed (Embase 141, PubMed 129, ScienceDirect 41, Cochrane 15. Twelve clinical studies fulfilled all inclusion criteria. Use of fluoridated toothpaste had a remineralizing effect on white spot lesions (WSLs (P < 0.05; fluoride varnish and casein supplements were effective in prevention and early treatment of WSLs (P < 0.05. Conclusions: Early detection of white spot lesions during orthodontic treatment would allow implementing preventive measures to control the demineralization process before lesions progress. The systemic review has showed that the usage of fluoride and casein supplements in ameliorating white spot lesions during and after fixed orthodontic treatment is significantly effective. However the use of casein phosphopeptide-amorphous calcium phosphate can be more beneficial than fluoride rinse in the reduction of demineralization spots.

  6. Ensuring US onion sustainability: Breeding and genomics to control thrips and iris yellow spot virus (United States)

    This five-year project was initiated in the fall of 2008 and has three main goals: evaluate onion germplasms for reduced damage by thrips and/or Iris yellow spot virus (IYSV); elucidate the diversity among IYSV isolates and develop efficient inoculation protocols; and produce a detailed molecular m...

  7. First Report of Iris yellow spot virus on Onion and Leek in Western Oregon (United States)

    Onion (Allium cepa) and leek (Allium porrum) are grown on approximately 600 ha in western Oregon annually for bulb and seed production. Plants with elongated to diamond-shaped, straw-colored lesions characteristic of those caused by Iris yellow spot virus (IYSV) were observed on onion bulb crops an...

  8. Purified tomato spotted wilt virus particles support both genome replication and transcription

    NARCIS (Netherlands)

    Knippenberg, van I.; Goldbach, R.W.; Kormelink, R.


    Purified Tomato spotted wilt virus particles were shown to support either genome replication or transcription in vitro, depending on the conditions chosen. Transcriptional activity was observed only upon addition of rabbit reticulocyte lysate, indicating a dependence on translation. Under these cond

  9. Tomato spotted wilt virus nucleocapsid protein interacts with both viral glycoproteins Gn and Gc in planta

    NARCIS (Netherlands)

    Ribeiro, D.M.O.G.; Borst, J.W.; Goldbach, R.W.; Kormelink, R.J.M.


    Recently, the Tomato Spotted Wilt Virus (TSWV) Gn and Gc glycoproteins were shown to induce the formation of (pseudo-) circular and pleomorphic membrane structures upon transient expression in plant cells. Furthermore, when singly expressed, Gc retains in the ER, while Gn is able to further migrate

  10. Treatment of post-orthodontic white spot lesions with casein phosphopeptide-stabilised amorphous calcium phosphate

    DEFF Research Database (Denmark)

    Bröchner, Ann; Christensen, Carsten; Kristensen, Bjarne;


    This study aims to investigate the effect of topical applications of 10% casein phosphopeptide-amorphous calcium phosphate (CPP-ACP) on white spot lesions (WSL) detected after treatment with fixed orthodontic appliances. Sixty healthy adolescents with >/=1 clinically visible WSL at debonding were...... recruited and randomly allocated to a randomised controlled trial with two parallel groups. The intervention group was instructed to topically apply a CPP-ACP -containing agent (Tooth Mousse, GC Europe) once daily and the subjects of the control group brushed their teeth with standard fluoride toothpaste...... included in the final evaluation. A statistically significant (p <0.05) regression of the WSL was disclosed in both study groups compared to baseline, but there was no difference between the groups. The mean area of the lesions decreased by 58% in the CPP-ACP group and 26% in the fluoride group (p = 0...

  11. Esthetic improvement of white spot lesions and non-pitted fluorosis using resin infiltration technique: Series of four clinical cases

    Directory of Open Access Journals (Sweden)

    Neeraj Gugnani


    Full Text Available White opacities have always been a major concern of esthetics for patients and can have varying etiology. In general, white discolorations of enamel might be due to dental fluorosis, early caries (white spot lesions, developmental defects etc. Conventional treatment options available for such opacities include non-invasive and invasive approaches. Recently, a new "micro-invasive" technique has been introduced as an alternative therapeutic approach that improves such opacities esthetically, in a single sitting, is painless and exhibits no complications. This case series illustrates the use of resin infiltration to treat fluorosis stains and WSLs, exhibiting significant improvement in esthetics.

  12. Resistance breaking tomato spotted wilt virus isolates on resistant pepper varieties in Italy. (United States)

    Crescenzi, A; Viggiano, A; Fanigliulo, A


    In spring 2012, resistance breaking (RB) isolates of tomato spotted wilt virus (TSWV) that overcome the resistance conferred by the Tsw gene in different pepper hybrids have been recovered in different locations in southern Italy (Campania and Apulia regions) in protected cultivation, about one month after transplant. The percentage of symptomatic plants was 5-10% and, only in particular cases of advanced stage of cultivation, it reached 30-50% at the end of cycle. All TSWV isolates induced similar systemic symptoms in all resistant infected pepper hybrids: yellowing or browning of apical leaves, which later become necrotic, long necrotic streakson stems, extending to the terminal shoots, complete necrosis of younger fruits and large necrotic streaks and spots on fruits formed after infection. On ripe fruits, yellow spots with concentric rings or necrotic streaks could be observed. Leaf extracts of these samples were tested in ELISA for the detection of TSWV, Cucumber mosaic virus (CMV), Tobacco mosaic virus (TMV), Tomato mosaic virus (ToMV), Impatiens necrotic spot virus (INSV), Potato virus Y (PVY), Alfalfa mosaic virus (AMV), Pepper mild mottle virus (PMMoV) and Pepper Mottle Virus (PepMoV). Only TSWV was detected in all the field samples tested. The correspondent virus isolates were inoculated mechanically and by Frankliniella occidentalis on to a set of different pepper and tomato hybrids, as well as on some herbaceous test plants, in order to investigate for their ability to overcome the resistance genes Tsw and Sw5, respectively. Tomato hybrids carrying the Sw5 gene were uninfected by all RB isolates, whereas all resistant pepper hybrids became systemically infected. RB isolates did not differ noticeably in transmission efficiency when they were tested with the thrips F. occidentalis. Obtained results demonstrate that evolved strains of TSWV have emerged, that they are able to overcome the Tsw resistance gene in pepper plants experimentally inoculated both

  13. A white spot disease-like syndrome in the Pacific blue shrimp (Litopenaeus stylirostris) as a form of bacterial shell disease


    Goarant, Cyrille; Brizard, Raphael; Marteau, Anne-laure


    In May 1997, some white lesions evoking the white spot syndrome disease were observed in Litopenaeus stylirostris broodstock in New Caledonia. The occurrence of these lesions was neither associated with mortality, nor with histological evidence of white spot syndrome baculovirus (WSBV), The evidence suggests that these lesions result from a form of bacterial disease and are associated with an increased bacterial flora on the outer surface of the cuticle, as well as an increased incidence thro...

  14. Tomato chlorotic spot virus in hydroponically-grown lettuce in São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Colariccio Addolorata


    Full Text Available In the regions of Campinas and Sumaré, São Paulo, Brazil, hidroponically grown crops of Lettuce (Lactuca sativa cv. Verônica, which showed virus-like symptoms were examined by electron microscope, biological, serological and molecular tests. Pleomorphic, enveloped particles (80-100 nm in diameter were always detected in these samples. Experimentally inoculated host plants, including lettuce, reacted with tospoviruses-induced symptoms. Some differences were observed in Gomphrena globosa, which reacted by showing local lesions and systemic mosaic. Two isolates of Tomato chlorotic spot virus (TCSV were identified by DAS-ELISA and by RT-PCR. The sequencing and alignment of the RT-PCR coat protein amplified fragments have indicated a high degree of homology with the TCSV sequences stored in the GenBank. This is the first report of losses due to a virus from the genus Tospovirus in commercial hydroponic lettuce crops in Brazil. Further epidemiological studies are needed for better understanding the spread of the virus in hydroponic crops, since Tomato spotted wilt virus (TSWV is reported to spread through the nutritive solution.

  15. Measuring color change of tooth enamel by in vitro remineralization of white spot lesion.

    Directory of Open Access Journals (Sweden)

    Betina Raquel Tolcachir


    Full Text Available Introduction: Objective colour determination is based on calculating the colorimetric distance (ΔE within a colour space. So far, the most used colour space in dentistry is CIE L*a*b (Comission Internationale de l´Éclairage. CIE L*C*h* has been recently developed, showing a better correlation with the perception of the human eye. Objective: To determine the ability of an in vitro remineralisation substance to mimic the colour of white spot lesions (WSL with sound enamel, determining ΔE by using the CIE L*C*h* colour space. Methods: In vitro WSL was generated by immersing 10 samples obtained from human third molars in a demineralization solution for 72 h. Amorphous calcium phosphate stabilized by casein phosphopeptide (CPP-ACP was then applied for 60 days while maintaining the samples in artificial saliva at 37º C. To evaluate the colour of enamel, images were taken from the samples placed in specifically designed silicone moulds after generating the WSL (pre stage and after remineralisation by scanning, applying the colorimetric distance equation (ΔE*CMC according to the Color Measurement Committee. Results: Treatment with CPP-ACP caused a significant ΔE decrease with respect to the pre stage (p

  16. Acyl-homoserine lactones produced by Pantoea sp. isolated from the "maize white spot" foliar disease. (United States)

    Pomini, Armando M; Paccola-Meirelles, Luzia D; Marsaioli, Anita J


    The "maize white spot" foliar disease is a problem of increasing importance to Brazilian maize crops. A bacterium isolated from water-soaked lesions from infected maize leaves was pathogenic in biological assays in vivo. It was identified as a Gram-negative, nonsporulating, facultative anaerobic bacterium, belonging to the genus Pantoea. Chemical study of the extracts from bacterial cultivation media allowed the identification of (S)-(-)-N-butanoyl-homoserine lactone and trace amounts of N-hexanoyl-homoserine lactone, widely recognized quorum-sensing signaling substances employed in cell-to-cell communication systems. The absolute configuration of natural (S)-(-)-N-butanoyl-homoserine lactone was determined by gas chromatography-flame ionization detection with a chiral stationary phase and by comparison of circular dichroism spectroscopic data with enantiopure synthetic substances. Biological evaluations with reporter Agrobacterium tumefaciens NTL4(pZLR4) were carried out with synthetic and natural products and also with extracts from maize leaves contaminated with the isolated bacterium, as well as from healthy leaves. PMID:17256964

  17. Identifying geographic hot spots of reassortment in a multipartite plant virus. (United States)

    Savory, Fiona R; Varma, Varun; Ramakrishnan, Uma


    Reassortment between different species or strains plays a key role in the evolution of multipartite plant viruses and can have important epidemiological implications. Identifying geographic locations where reassortant lineages are most likely to emerge could be a valuable strategy for informing disease management and surveillance efforts. We developed a predictive framework to identify potential geographic hot spots of reassortment based upon spatially explicit analyses of genome constellation diversity. To demonstrate the utility of this approach, we examined spatial variation in the potential for reassortment among Cardamom bushy dwarf virus (CBDV; Nanoviridae, Babuvirus) isolates in Northeast India. Using sequence data corresponding to six discrete genome components for 163 CBDV isolates, a quantitative measure of genome constellation diversity was obtained for locations across the sampling region. Two key areas were identified where viruses with highly distinct genome constellations cocirculate, and these locations were designated as possible geographic hot spots of reassortment, where novel reassortant lineages could emerge. Our study demonstrates that the potential for reassortment can be spatially dependent in multipartite plant viruses and highlights the use of evolutionary analyses to identify locations which could be actively managed to facilitate the prevention of outbreaks involving novel reassortant strains. PMID:24944570

  18. Molecular variability analyses of Apple chlorotic leaf spot virus capsid protein

    Indian Academy of Sciences (India)

    T Rana; V Chandel; Y Kumar; R Ram; V Hallan; A A Zaidi


    The complete sequences of the coat protein (CP) gene of 26 isolates of Apple chlorotic leaf spot virus (ACLSV) from India were determined. The isolates were obtained from various pome (apple, pear and quince) and stone (plum, peach, apricot, almond and wild Himalayan cherry) fruit trees. Other previously characterized ACLSV isolates and Trichoviruses were used for comparative analysis. Indian ACLSV isolates among themselves and with isolates from elsewhere in the world shared 91–100% and 70–98% sequence identities at the amino acid and nucleotide levels, respectively. The highest degree of variability was observed in the middle portion with 9 amino acid substitutions in contrast to the N-terminal and C-terminal ends, which were maximally conserved with only 4 amino acid substitutions. In phylogenetic analysis no reasonable correlation between host species and/or geographic origin of the isolates was observed. Alignment with capsid protein genes of other Trichoviruses revealed the TaTao ACLSV peach isolate to be phylogenetically closest to Peach mosaic virus, Apricot pseudo chlorotic leaf spot virus and Cherry mottle leaf virus. Recombination analysis (RDP3 ver.2.6) done for all the available ACLSV complete CP sequences of the world and Indian isolates indicate no significant evidence of recombination. However, one recombination event among Indian ACLSV-CP isolates was detected. To the best of our knowledge, this is the first report of complete CP sequence variability study from India and also the first evidence of homologous recombination in ACLSV.

  19. Role of casein phosphopeptide amorphous calcium phosphate in remineralization of white spot lesions and inhibition of Streptococcus mutans?


    Ruchi Vashisht; Rajamani Indira; Ramachandran, S.; Anil Kumar; Manali Ramakrishnan Srinivasan


    Introduction: To promote the remineralization by ionic exchange mechanism instead of invasive techniques many remineralizing agents can be used. Objective: To evaluate the remineralization effects of casein phosphopeptide-amorphous calcium phosphate (CPP-ACP) on white spot lesions (WSLs) and its inhibitory effect on Streptococcus mutans colonization. Materials and Methods: The study group consisted of 60 subjects exhibiting at least 1-WSL. Subjects were randomly divided into 2 groups:...

  20. Colour improvement and stability of white spot lesions following infiltration, micro-abrasion, or fluoride treatments in vitro


    Yetkiner, Enver; Wegehaupt, Florian; Wiegand, Annette; Attin, Rengin; Attin, Thomas


    SUMMARY BACKGROUND/OBJECTIVES White spot lesions (WSLs) are unwelcome side effects of fixed appliances that compromise the treatment outcome. Recently, infiltration of WSLs has been introduced as a viable treatment alternative. The objective was to evaluate the colour improvement of WSLs and their stability against discolouration following infiltration, fluoride, or micro-abrasion treatments in vitro. MATERIALS/METHODS Artificial WSLs were created in bovine enamel (N = 96) using acidic buf...

  1. Control of White Spot Lesion Adjacent to Orthodontic Bracket with Use of Fluoride Varnish or Chlorhexidine Gel


    Manuel Restrepo; Bussaneli, Diego G.; Fabiano Jeremias; Cordeiro, Rita C. L.; Magalhães, Ana C.; Palomari Spolidorio, Denise M.; Lourdes Santos-Pinto


    The aims of this study were to compare the effectiveness of fluoride varnish and chlorhexidine gel in controlling white spot lesions (WSLs) adjacent to orthodontic brackets and to compare the ability of Quantitative Light-Induced Fluorescence (QLF) to measure mineral uptake with that of transverse microradiography (TMR). Thirty premolars with artificially induced WSLs were randomly assigned to three groups: (1) two applications of 5% NaF-varnish (F), with one-week interval, (2) two applicatio...

  2. Hybridization between native white-spotted charr and nonnative brook trout in the upper Sorachi River, Hokkaido, Japan


    Kitano, Satoshi; Ohdachi, Satoshi; Koizumi, Itsuro; Hasegawa, Koh


    Invasion status and impacts of nonnative brook trout (Salvelinus fontinalis) in a Hokkaido stream were investigated with field surveys and genetic analyses. Nonnative brook trout was detected in nine (41 %) of the 22 sampled reaches in three tributaries of the Sorachi River, Hokkaido, Japan. Based on the external pigmentation, twelve putative hybrids between brook trout and native white-spotted charr (Salvelinus leucomaenis) were collected in two reaches. Microsatellite and mitochondrial DNA ...

  3. Global Deletion of Trp53 Reverts Ovarian Tumor Phenotype of the Germ Cell–Deficient White Spotting Variant (Wv) Mice


    Kathy Qi Cai; Ying Wang; Elizabeth R Smith; Smedberg, Jennifer L.; Dong-Hua Yang; Wan-Lin Yang; Xiang-Xi Xu


    White spotting variant (Wv) mice are spontaneous mutants attributed to a point mutation in the c-Kit gene, which reduces the tyrosine kinase activity to around 1% and affects the development of melanocytes, mast cells, and germ cells. Homozygous mutant mice are sterile but can live nearly a normal life span. The female Wv mice have a greatly reduced ovarian germ cell and follicle reserve at birth, and the remaining follicles are largely depleted soon after the females reach reproductive stage...

  4. Predictive Models for Tomato Spotted Wilt Virus Spread Dynamics, Considering Frankliniella occidentalis Specific Life Processes as Influenced by the Virus.

    Directory of Open Access Journals (Sweden)

    Pamella Akoth Ogada

    Full Text Available Several models have been studied on predictive epidemics of arthropod vectored plant viruses in an attempt to bring understanding to the complex but specific relationship between the three cornered pathosystem (virus, vector and host plant, as well as their interactions with the environment. A large body of studies mainly focuses on weather based models as management tool for monitoring pests and diseases, with very few incorporating the contribution of vector's life processes in the disease dynamics, which is an essential aspect when mitigating virus incidences in a crop stand. In this study, we hypothesized that the multiplication and spread of tomato spotted wilt virus (TSWV in a crop stand is strongly related to its influences on Frankliniella occidentalis preferential behavior and life expectancy. Model dynamics of important aspects in disease development within TSWV-F. occidentalis-host plant interactions were developed, focusing on F. occidentalis' life processes as influenced by TSWV. The results show that the influence of TSWV on F. occidentalis preferential behaviour leads to an estimated increase in relative acquisition rate of the virus, and up to 33% increase in transmission rate to healthy plants. Also, increased life expectancy; which relates to improved fitness, is dependent on the virus induced preferential behaviour, consequently promoting multiplication and spread of the virus in a crop stand. The development of vector-based models could further help in elucidating the role of tri-trophic interactions in agricultural disease systems. Use of the model to examine the components of the disease process could also boost our understanding on how specific epidemiological characteristics interact to cause diseases in crops. With this level of understanding we can efficiently develop more precise control strategies for the virus and the vector.

  5. Predictive Models for Tomato Spotted Wilt Virus Spread Dynamics, Considering Frankliniella occidentalis Specific Life Processes as Influenced by the Virus (United States)

    Ogada, Pamella Akoth; Moualeu, Dany Pascal; Poehling, Hans-Michael


    Several models have been studied on predictive epidemics of arthropod vectored plant viruses in an attempt to bring understanding to the complex but specific relationship between the three cornered pathosystem (virus, vector and host plant), as well as their interactions with the environment. A large body of studies mainly focuses on weather based models as management tool for monitoring pests and diseases, with very few incorporating the contribution of vector’s life processes in the disease dynamics, which is an essential aspect when mitigating virus incidences in a crop stand. In this study, we hypothesized that the multiplication and spread of tomato spotted wilt virus (TSWV) in a crop stand is strongly related to its influences on Frankliniella occidentalis preferential behavior and life expectancy. Model dynamics of important aspects in disease development within TSWV-F. occidentalis-host plant interactions were developed, focusing on F. occidentalis’ life processes as influenced by TSWV. The results show that the influence of TSWV on F. occidentalis preferential behaviour leads to an estimated increase in relative acquisition rate of the virus, and up to 33% increase in transmission rate to healthy plants. Also, increased life expectancy; which relates to improved fitness, is dependent on the virus induced preferential behaviour, consequently promoting multiplication and spread of the virus in a crop stand. The development of vector–based models could further help in elucidating the role of tri-trophic interactions in agricultural disease systems. Use of the model to examine the components of the disease process could also boost our understanding on how specific epidemiological characteristics interact to cause diseases in crops. With this level of understanding we can efficiently develop more precise control strategies for the virus and the vector. PMID:27159134

  6. Fluid dynamics of feeding behaviour in white-spotted bamboo sharks. (United States)

    Nauwelaerts, Sandra; Wilga, Cheryl D; Lauder, George V; Sanford, Christopher P


    Although the motor control of feeding is presumed to be generally conserved, some fishes are capable of modulating the feeding behaviour in response to prey type and or prey size. This led to the 'feeding modulation hypothesis', which states that rapid suction strikes are pre-programmed stereotyped events that proceed to completion once initiated regardless of sensory input. If this hypothesis holds true, successful strikes should be indistinguishable from unsuccessful strikes owing to a lack of feedback control in specialized suction feeding fishes. The hydrodynamics of suction feeding in white-spotted bamboo sharks (Chiloscyllium plagiosum) was studied in three behaviours: successful strikes, intraoral transports of prey and unsuccessful strikes. The area of the fluid velocity region around the head of feeding sharks was quantified using time-resolved digital particle image velocimetry (DPIV). The maximal size of the fluid velocity region is 56% larger in successful strikes than unsuccessful strikes (10.79 cm2 vs 6.90 cm2), but they do not differ in duration, indicating that strikes are modulated based on some aspect of the prey or simply as a result of decreased effort on the part of the predator. The hydrodynamic profiles of successful and unsuccessful strikes differ after 21 ms, a period probably too short to provide time to react through feedback control. The predator-to-prey distance is larger in missed strikes compared with successful strikes, indicating that insufficient suction is generated to compensate for the increased distance. An accuracy index distinguishes unsuccessful strikes (-0.26) from successful strikes (0.45 to 0.61). Successful strikes occur primarily between the horizontal axis of the mouth and the dorsal boundary of the ingested parcel of water, and missed prey are closer to the boundary or beyond. Suction transports are shorter in duration than suction strikes but have similar maximal fluid velocity areas to move the prey through the

  7. Dynamics of Saturn’s 2010 Great White Spot from high-resolution Cassini ISS observations (United States)

    Hueso, Ricardo; Sánchez-Lavega, A.; del Río-Gaztelurrutia, T.


    On December 5th 2010 a storm erupted in Saturn’s North Temperate latitudes which were experiencing early spring season. The storm quickly developed to a planet-wide disturbance of the Great White Spot type. The ISS instrument onboard Cassini acquired its first images of the storm on 23th December 2010 and performed repeated observations with a variety of spatial resolutions over the nearly 10 months period the storm continued active. Here we present an analysis of two of the image sequences with better spatial resolution of the mature storm when it was fully developed and very active. We used an image correlation algorithm to measure the cloud motions obtained from images separated 20 minutes and obtained 16,000 wind tracers in a domain of 60 degrees longitude per 20 degrees in latitude. Intense zonal and meridional motions accompanied the storm and reached values of 120 m/s in particular regions of the active storm. The storm released a chain of anticyclonic and cyclonic vortices at planetocentric latitudes of 36° and 32° respectively. The short time difference between the images results in estimated wind uncertainties of 15 m/s that did not allow to perform a complete analysis of the turbulence and kinetic spectrum of the motions. We identify locations of the updrafts and link those with the morphology in different observing filters. The global behaviour of the storm was examined in images separated by 10 hours confirming the intensity of the winds and the global behaviour of the vortices. Acknowledgments: This work was supported by the Spanish MICIIN project AYA2009-10701 with FEDER funds, by Grupos Gobierno Vasco IT-464-07 and by Universidad País Vasco UPV/EHU through program UFI11/55.

  8. A description of Haemogregarina species naturally infecting white-spotted gecko (Tarentola annularis) in Qena, Egypt. (United States)

    Rabie, Soheir A H; Hussein, Abdel-Nasser A


    The present study describes the developmental stages of Haemogregarina species in the blood and tissues of naturally infecting white-spotted gecko Tarentola annularis collected from Qena, Egypt. Different parasite's forms were observed infecting the erythrocytes. The gamonts enclosed within parasitophorous vacuole and seems to have no clear effect on the host cell especially in case of immature parasite forms. But in the presence of mature gamonts the host cell nucleus displaced. The parasitaemia level is up to 280 per 10,000 erythrocytes counted. Trophozoites and gamonts have been recognized in the blood smears. The rounded trophozoite diameter is 3.84 ±0.87 μm, while the elongated trophozoite measured 4.42 ± 0.69 x 2.8 ± 0.56 μm. The mature gamonts were differentiated into two forms; short gamont measuring 10.82 ± 0.82 x 3.30 ± 0.73 μm (range: 10-12.1 x 2.2-4.4 μm) and the long gamont measured 14.67 ± 0.83 x 3.96 ± 0.77 μm (range: 14.1-16.5 x 3.3-5.5 μm). Merogony carried out only in the endothelial cells of the blood capillaries in the lung. Different merogonic stages have been recognized and differentiated in two forms; micromeront measured 13.25 ± 0.50 x 12 ± 0.0 μm and produces a few number of large merozoites, macromeront measured 19.75+0.87x13.25+0.50 im and produces more small sized merozoites. The gamonts and merozoites have the general characteristic ultrastructures of the Apicomplexa containing components of the apical complex, e.g. pellicle, micronemes, rhoptries, and few dense bodies and subpellicular microtubules. PMID:25597149

  9. 斑点杂交检测对虾白斑综合征病毒青岛株在螯虾体内的动态分布%Dynamic Distribution of Shrimp White spot syndrome virus (WSSV) Qingdao Strain in Crawfishes by Dot Hybridization

    Institute of Scientific and Technical Information of China (English)

    朱建中; 夏晓勤; 陆承平; 郭福生


    A fragment sized 400bp of White spot syndrome virus(WS SV,formerly de signated NOSV),recovered from recombinant plasmid pAFD, was labeled with Digox igenin as a probe to detect dynamic distribution of WSSV within 120h and 72h in crawfishes(Cambarus proclarkii) inoculated WSSV by oral taking and injecti on r espectively. Stomach epithelium, intestine epithelium, heart, gill, haemolymph, muscle, hepatopancreas, hypoderm, connective tissue and ovary of infected crawfi shes were examined for WSSV. In both groups, WSSV was first detected in heamoly mph at 12h p.i. and then disappeared. Again it was detected at 96h p.i. only in oral infection group and maintained till 120h p.i., but it didn't appear at 72h p.i. in injection group. WSSV in heart, muscle was detected at 36h p.i. in oral infection group and 24h p.i. in injection group respectively, and then increased generally. In addition, WSSV in intestine epithelium, connective tissue, ovary of oral infection group and intestine epithelium, hypoderm, ovary of injection g roup could also be detected. In dead crawfishes after 120h and 72h p.i. in two groups, WSSV could be detected in all the examined tissues and it demonstrated t hat systemic infection occurred in the animales. The tissue containing more amo unts of WSSV was hypoderm in oral infection group, while intestine epithelium, g ill, hypoderm, ovary in injection infection group. It deduced that WSSV first a ppears in haemolymph and then goes into heart, muscle and other tissues and prol iferates in them. Once again, WSSV is released into heamolymph resulting in syst emic infection till crawfishes' death.

  10. Characterization of Melon necrotic spot virus Occurring on Watermelon in Korea. (United States)

    Kwak, Hae-Ryun; Kim, Jeong-Soo; Cho, Jeom-Deog; Lee, Joong-Hwan; Kim, Tae-Sung; Kim, Mi-Kyeong; Choi, Hong-Soo


    Melon necrotic spot virus (MNSV) was recently identified on watermelon (Citrullus vulgaris) in Korea, displaying as large necrotic spots and vein necrosis on the leaves and stems. The average occurrence of MNSV on watermelon was found to be 30-65% in Hapcheon and Andong City, respectively. Four isolates of the virus (MNSV-HW, MNSV-AW, MNSV-YW, and MNSV-SW) obtained from watermelon plants in different areas were non-pathogenic on ten general indicator plants, including Chenopodium quinoa, while they infected systemically six varieties of Cucurbitaceae. The virus particles purified by 10-40% sucrose density gradient centrifugation had a typical ultraviolet spectrum, with a minimum at 245 nm and a maximum at 260 nm. The morphology of the virus was spherical with a diameter of 28-30 nm. Virus particles were observed scattered throughout the cytoplasm of watermelon cells, but no crystals were detected. An ELISA was conducted using antiserum against MNSV-HW; the optimum concentrations of IgG and conjugated IgG for the assay were 1 μl/ml and a 1:8,000-1:10,000 dilutions, respectively. Antiserum against MNSV-HW could capture specifically both MNSV-MN from melon and MNSV-HW from watermelon by IC/RT-PCR, and they were effectively detected with the same specific primer to produce product of 1,172 bp. The dsRNA of MNSV-HW had the same profile (4.5, 1.8, and 1.6 kb) as that of MNSV-MN from melon. The nucleotide sequence of the coat protein of MNSV-HW gave a different phylogenetic tree, having 17.2% difference in nucleotide sequence compared with MNSV isolates from melon. PMID:26673673

  11. Characterization of Melon necrotic spot virus Occurring on Watermelon in Korea

    Directory of Open Access Journals (Sweden)

    Hae-Ryun Kwak


    Full Text Available Melon necrotic spot virus (MNSV was recently identified on watermelon (Citrullus vulgaris in Korea, displaying as large necrotic spots and vein necrosis on the leaves and stems. The average occurrence of MNSV on watermelon was found to be 30–65% in Hapcheon and Andong City, respectively. Four isolates of the virus (MNSV-HW, MNSV-AW, MNSV-YW, and MNSV-SW obtained from watermelon plants in different areas were non-pathogenic on ten general indicator plants, including Chenopodium quinoa, while they infected systemically six varieties of Cucurbitaceae. The virus particles purified by 10–40% sucrose density gradient centrifugation had a typical ultraviolet spectrum, with a minimum at 245 nm and a maximum at 260 nm. The morphology of the virus was spherical with a diameter of 28–30 nm. Virus particles were observed scattered throughout the cytoplasm of watermelon cells, but no crystals were detected. An ELISA was conducted using antiserum against MNSV-HW; the optimum concentrations of IgG and conjugated IgG for the assay were 1 μl/ml and a 1:8,000–1:10,000 dilutions, respectively. Antiserum against MNSV-HW could capture specifically both MNSV-MN from melon and MNSV-HW from watermelon by IC/RT-PCR, and they were effectively detected with the same specific primer to produce product of 1,172 bp. The dsRNA of MNSV-HW had the same profile (4.5, 1.8, and 1.6 kb as that of MNSV-MN from melon. The nucleotide sequence of the coat protein of MNSV-HW gave a different phylogenetic tree, having 17.2% difference in nucleotide sequence compared with MNSV isolates from melon.

  12. Children with severe early childhood caries: streptococci genetic strains within carious and white spot lesions

    Directory of Open Access Journals (Sweden)

    Kenneth Gilbert


    Full Text Available Background and objectives: Mutans streptococci (MS are one of the major microbiological determinants of dental caries. The objectives of this study are to identify distinct MS and non-MS streptococci strains that are located at carious sites and non-carious enamel surfaces in children with severe early childhood caries (S-ECC, and assess if cariogenic MS and non-cariogenic streptococci might independently exist as primary bacterial strains on distinct sites within the dentition of individual children. Design: Dental plaque from children (N=20; aged 3–6 with S-ECC was collected from carious lesions (CLs, white spot lesions (WSLs and non-carious enamel surfaces. Streptococcal isolates (N=10–20 from each site were subjected to polymerase chain reaction (PCR to identify MS, and arbitrarily primed-PCR for assignment of genetic strains. Primary strains were identified as ≥50% of the total isolates surveyed at any site. In several cases, strains were characterized for acidurity using ATP-driven bioluminescence and subjected to PCR-determination of potential MS virulence products. Identification of non-MS was determined by 16S rRNA gene sequencing. Results: Sixty-four independent MS or non-MS streptococcal strains were identified. All children contained 1–6 strains. In many patients (N=11, single primary MS strains were identified throughout the dentition. In other patients (N=4, primary MS strains were identified within CLs that were distinct from primary strains found on enamel. Streptococcus gordonii strains were identified as primary strains on enamel or WSLs in four children, and in general were less aciduric than MS strains. Conclusions: Many children with S-ECC contained only a single primary MS strain that was present in both carious and non-carious sites. In some cases, MS and non-cariogenic S. gordonii strains were found to independently exist as dominant strains at different locations within the dentition of individual children, and

  13. Possible involvement of eEF1A in Tomato spotted wilt virus RNA synthesis. (United States)

    Komoda, Keisuke; Ishibashi, Kazuhiro; Kawamura-Nagaya, Kazue; Ishikawa, Masayuki


    Tomato spotted wilt virus (TSWV) is a negative-strand RNA virus in the family Bunyaviridae and propagates in both insects and plants. Although TSWV can infect a wide range of plant species, host factors involved in viral RNA synthesis of TSWV in plants have not been characterized. In this report, we demonstrate that the cell-free extract derived from one of the host plants can activate mRNA transcriptional activity of TSWV. Based on activity-guided fractionation of the cell-free extract, we identified eukaryotic elongation factor (eEF) 1A as a possible host factor facilitating TSWV transcription and replication. The RNA synthesis-supporting activity decreased in the presence of an eEF1A inhibitor, suggesting that eEF1A plays an important role in RNA synthesis of TSWV. PMID:25151062

  14. Factors Affecting the Formation, Severity and Location of White Spot Lesions during Orthodontic Treatment with Fixed Appliances

    Directory of Open Access Journals (Sweden)

    Khaled Khalaf


    Full Text Available Objectives: The purpose of the present study was to investigate factors affecting the formation, severity and location of white spot lesions in patients completing fixed appliance therapy. Material and Methods: A total of 45 patients (19 males and 26 females, mean age 15.81 years, standard deviation 2.89 years attending consecutively Aberdeen Dental Hospital (ADH between January and June 2013 to have their fixed appliances removed were given a questionnaire to elicit information regarding their dental care and diet. They were then examined clinically as well as their pre-treatment photographs to record treatment data and white spot lesion (WSL location and severity using a modified version of Universal Visual Scale for Smooth Surfaces (UniViSS Smooth. Absolute risk (AR and risk ratios (RR were also calculated. Results: The incidence of at least one WSL observed in patients was 42%, with males displaying a higher incidence than females. The highest incidence of WSLs was recorded on the maxillary canines and lateral incisors, and on the maxillary and mandibular premolars and first molars. The gingival areas of the maxillary and mandibular teeth were the most affected surfaces. Significant (P < 0.05 relationships were found between the presence of WSLs and the following factors: poor oral hygiene (OH, males, increased treatment length, lack of use of fluoride supplements, use of carbonated soft drinks and/or fruit juices and the use of sugary foods. Poor OH posed the highest risk of developing WSL (RR = 8.55. Conclusions: 42% of patients have developed white spot lesions during fixed appliance therapy. Various contributing risk factors were identified with the greatest risk posed by a poor oral hygiene.

  15. Immunity to nervous necrosis virus infections of orange-spotted grouper (Epinephelus coioides) by vaccination with virus-like particles. (United States)

    Lin, Kebing; Zhu, Zhihuang; Ge, Hui; Zheng, Leyun; Huang, Zhongchi; Wu, Shuiqing


    Nervous necrosis virus (NNV) is a kind of the betanodaviruses, which can cause viral nervous necrosis (VNN) and massive mortality in larval and juvenile stages of orange-spotted grouper (Epinephelus coioides). Due to the lack of viral genomes, virus-like particles (VLPs) are considered as one of the most promising candidates in vaccine study to control this disease. In this study, a type of VLPs, which was engineered on the basis of orange-spotted grouper nervous necrosis virus (OGNNV), was produced from prokaryotes. They possessed the similar structure and size to the native NNV. In addition, synthetic oligodeoxynucleotide (ODN) containing CpG motif was added in vaccines, and the expression patterns of several genes were analyzed after injecting with VLP and VLP with adjuvant (VA) to assess the regulation effect of vaccine for inducing immune responses. RT-PCR assays showed that six related genes in healthy tissues were ubiquitously expressed in all nine tested tissues. The vaccine alone was able to enhance the expression of genes, including MHCIa, MyD88, TLR3, TLR9 and TLR22 after vaccination, indicating that the vaccine was able to induce immune response in grouper. In liver, spleen and kidney, the gene expressions of VA group were all significantly higher than that of VLP group at 72 h post-stimulation, showing that the fish of VA challenge group obtained the longer-lasting protective immunity and resistance to pathogen challenge than that of VLP group. The data indicated that the efficacy of vaccine could be further enhanced by CpG ODN after vaccination and provided the reference for the development of future viral vaccine in grouper. PMID:27394969

  16. Induction of necrosis via mitochondrial targeting of Melon necrotic spot virus replication protein p29 by its second transmembrane domain

    International Nuclear Information System (INIS)

    The virulence factor of Melon necrotic spot virus (MNSV), a virus that induces systemic necrotic spot disease on melon plants, was investigated. When the replication protein p29 was expressed in N. benthamiana using a Cucumber mosaic virus vector, necrotic spots appeared on the leaf tissue. Transmission electron microscopy revealed abnormal mitochondrial aggregation in these tissues. Fractionation of tissues expressing p29 and confocal imaging using GFP-tagged p29 revealed that p29 associated with the mitochondrial membrane as an integral membrane protein. Expression analysis of p29 deletion fragments and prediction of hydrophobic transmembrane domains (TMDs) in p29 showed that deletion of the second putative TMD from p29 led to deficiencies in both the mitochondrial localization and virulence of p29. Taken together, these results indicated that MNSV p29 interacts with the mitochondrial membrane and that p29 may be a virulence factor causing the observed necrosis.

  17. Role of Oxalis corniculata L. as plant virus reservoir with special regard to Tomato Spotted Wilt Virus (TSWV-RB strain occurrence in rock-wool cultivation in Hungary

    Directory of Open Access Journals (Sweden)

    Hodi, Anna Maria


    Full Text Available The creeping wood sorrel (Oxalis corniculata L. in Central Europe occurs mainly in anthropogenic areas, where it grows in parks and landfill sites or in protected cultivation sites like greenhouses and nurseries. In Hungary O. corniculata has been spreading since the 19th century. In glass- and greenhouses it is the only weed species that was able to settle and flourish on hydroponic rock-wool and coconut fibre growing media. Among virus pathogens of forced tomato (LYPES and paprika crops (CPSAN in Hungary the Tomato Spotted Wilt Virus (TSWV has become an important one, severely affecting the plants and on occasions causing 100% yield losses. The spread of the virus was largely assisted by its effective vector the Western Flower Thrips (Frankliniella occidentalis Pergande. Initially the control of the disease was based on the control of the thrips, later, virus-resistant varieties were introduced. This however proved insufficient to fight the disease as it was discovered, quite recently, that in certain white pepper (CPSAN varieties the virus was able to break up the resistance. According to data of the year 2012, those varieties that were considered resistant, showed up to 50% virus infection. Considering the wide spread of O. corniculata and increasing occurrence of the resistance-breaking TSWV isolates, surveys in greenhouses were conducted to examine whether the weed could serve as reservoir for TSWV. Samples were collected of the virus infected crop plants and O. corniculata growing in the same coconut fibre cubes. The samples were examined using test-plants, serological and RT-PCR methods. In result it was found that the symptoms were indeed caused by resistance-breaking TSWV isolates. However, no virus was found in the suspected O. corniculata samples. Therefore it was concluded that in this particular case the O. corniculata cannot be considered reservoir for the virus, in the hydroponic culture.

  18. Hypoxia increases susceptibility of Pacific white shrimp to whitespot syndrome virus (WSSV

    Directory of Open Access Journals (Sweden)

    M. Lehmann


    Full Text Available The present study aimed to evaluate the mortality, reactive oxygen species production (ROS and total hemocyte counts (THC of the marine shrimp Litopenaeus vannamei infected with the white spot syndrome virus (WSSV at three levels of oxygen saturation. For this, 360 shrimp (20±2g were distributed in 24 tanks (60L, divided in two groups (infected and non-infected, which were subjected to 30, 60 and 100% of dissolved oxygen saturation (in quadruplicate. During 96 hours after infection, daily hemolymph samples were collected for hemato-immunological parameter evaluation (THC and ROS and dead animals were removed and computed to assess cumulative mortality rates. In the infected group, animals subjected to 100% saturation showed higher ROS production (P<0.05 after 48 hours, while THC was significantly reduced (P<0.05, regardless of oxygen saturation. The hypoxia resulted in high mortality when compared to 100% saturation condition. In the uninfected group, no significant differences were observed in all evaluated parameters. Thus, the hypoxia condition increased the susceptibility of shrimp to the infection of WSSV, which may be partly related to the low ROS production showed by the animals subjected to 30% oxygen saturation.

  19. Differences in organotin accumulation in relation to life history in the white-spotted charr Salvelinus leucomaenis

    International Nuclear Information System (INIS)

    Research highlights: → Otolith Sr:Ca ratios in sea-run type were higher than those in freshwater-residents. → TBT and TPT concentrations in sea-run type were higher than those in freshwater-residents. → Sea-run type have higher risk of TBT and TPT than freshwater-residents in white-spotted charr. - Abstract: To examine the accumulation pattern of organotins (OTs) in relation to the migration of diadromous fish, tributyltin (TBT) and triphenyltin (TPT) and their derivatives were determined in the muscle tissue of both sea-run (anadromous) and freshwater-resident (nonanadromous) types of the white-spotted charr Salvelinus leucomaenis. Ontogenic changes in otolith strontium (Sr) and calcium (Ca) concentrations were examined along life history transect to discriminate migration type. Mean Sr:Ca ratio from the core to the edge of the otolith in sea-run individuals was significantly higher than those in freshwater-resident one. There were no significant correlations in S. leucomaenis between OT accumulation and various biological characteristics. It is noteworthy that TBT and TPT concentrations in sea-run type were significantly higher than those in freshwater-resident individuals, although they are both of the same species. These results suggest that sea-run S. leucomaenis have a higher ecological risk of OT exposure than freshwater-residents during their life histories.

  20. Susceptibility of Chinese Perch Brain (CPB) Cell and Mandarin Fish to Red-Spotted Grouper Nervous Necrosis Virus (RGNNV) Infection


    Jiagang Tu; Wenjie Chen; Xiaozhe Fu; Qiang Lin; Ouqin Chang; Lijuan Zhao; Jiangfeng Lan; Ningqiu Li; Li Lin


    Nervous necrosis virus (NNV) is the causative agent of viral encephalopathy and retinopathy (VER), a neurological disease responsible for high mortality of fish species worldwide. Taking advantage of our established Chinese perch brain (CPB) cell line derived from brain tissues of Mandarin fish (Siniperca chuatsi), the susceptibility of CPB cell to Red-Spotted Grouper nervous necrosis virus (RGNNV) was evaluated. The results showed that RGNNV replicated well in CPB cells, resulting in cellula...

  1. Complete genome sequence of an emerging melon necrotic spot virus isolate infecting greenhouse cucumber in North America (United States)

    The complete genome (4,267 nt) of an Melon necrotic spot virus (MNSV) isolate (ABCA13-01) infecting greenhouse cucumber in Canada was determined through deep sequencing of small RNAs. Its genome sequence was most closely related to MNSV-N (97%), but lacking a 55-nt insertion at the 3’UTR for resista...

  2. Immunological-based assays for specific detection of shrimp viruses


    Chaivisuthangkura, Parin; Longyant, Siwaporn; Sithigorngul, Paisarn


    Among shrimp viral pathogens, white spot syndrome virus (WSSV) and yellow head virus (YHV) are the most lethal agents, causing serious problems for both the whiteleg shrimp, Penaeus (Litopenaeus) vannamei, and the black tiger shrimp, Penaeus (Penaeus) monodon. Another important virus that infects P. vannamei is infectious myonecrosis virus (IMNV), which induces the white discoloration of affected muscle. In the cases of taura syndrome virus and Penaeus stylirostris densovirus (PstDNV; formerl...

  3. Surveillance for West Nile Virus in American White Pelicans, Montana, USA, 2006–2007


    Johnson, Gregory; Nemeth, Nicole; Hale, Kristina; Lindsey, Nicole; Panella, Nicholas; Komar, Nicholas


    West Nile virus (WNV)–associated deaths of American white pelican (Pelecanus erythrorhynchos) chicks have been recognized at various nesting colonies in the United States since 2002. We evaluated American white pelican nesting colonies in Sheridan County, Montana, USA, for an association between WNV-positive pelican carcasses and human West Nile neuroinvasive disease. Persons in counties hosting affected colonies had a 5× higher risk for disease than those in counties with unaffected colonies...

  4. Genome Sequences of Three Apple chlorotic leaf spot virus Isolates from Hawthorns in China. (United States)

    Guo, Wei; Zheng, Wenyan; Wang, Mei; Li, Xiaohong; Ma, Yue; Dai, Hongyan


    The genome sequences of Apple chlorotic leaf spot virus (ACLSV) isolates from three accessions of hawthorns (Crataegus pinnatifida) grown at Shenyang Agricultural University were determined using Illumina RNA-seq. To confirm the assembly data from the de novo sequencing, two ACLSV genomic sequences (SY01 and SY02) were sequenced using the Sanger method. The SY01 and SY02 sequences obtained with the Sanger method showed 99.5% and 99.7% nucleotide identity with the transcriptome data, respectively. The genome sequences of the hawthorn isolates SY01, SY02 and SY03 (GenBank accession nos. KM207212, KU870524 and KU870525, respectively) consisted of 7,543, 7,561 and 7,545 nucleotides, respectively, excluding poly-adenylated tails. Sequence analysis revealed that these hawthorn isolates shared an overall nucleotide identity of 82.8-92.1% and showed the highest identity of 90.3% for isolate YH (GenBank accession no. KC935955) from pear and the lowest identity of 67.7% for isolate TaTao5 (GenBank accession no. EU223295) from peach. Hawthorn isolate sequences were similar to those of 'B6 type' ACLSV. The relationship between ACLSV isolates largely depends upon the host species. This represents the first comparative study of the genome sequences of ACLSV isolates from hawthorns. PMID:27519059

  5. Immunofluorescence of bovine virus diarrhea viral antigen in white blood cells from experimentally infected immunocompetent calves.


    Bezek, D M; Baker, J. C.; Kaneene, J B


    A study to evaluate the detection of bovine virus diarrhea viral antigen using immunofluorescence testing of white blood cells was conducted. Five colostrum-deprived calves were inoculated intravenously with a cytopathic strain of the virus. Lymphocyte and buffy coat smears were prepared daily for direct immunofluorescent staining for detection of antigen. Lymphocytes were separated from heparinized blood using a Ficoll density procedure. Buffy coat smears were prepared from centrifuged blood...

  6. A novel polymerase chain reaction method for detection of human immunodeficiency virus in dried blood spots on filter paper.


    Yourno, J; Conroy, J.


    A method for detection of proviral human immunodeficiency virus DNA in dried blood spots on filter paper by direct polymerase chain reaction (PCR) has been developed. To develop the method, a standard system was used which was prepared from cells each containing a single integrated provirus and titrated with normal donor blood. This rapid procedure provides virtually quantitative yields of nuclear DNA and exploits most of the standard methodology described for blood specimens. A nested PCR us...

  7. Control of White Spot Lesion Adjacent to Orthodontic Bracket with Use of Fluoride Varnish or Chlorhexidine Gel

    Directory of Open Access Journals (Sweden)

    Manuel Restrepo


    Full Text Available The aims of this study were to compare the effectiveness of fluoride varnish and chlorhexidine gel in controlling white spot lesions (WSLs adjacent to orthodontic brackets and to compare the ability of Quantitative Light-Induced Fluorescence (QLF to measure mineral uptake with that of transverse microradiography (TMR. Thirty premolars with artificially induced WSLs were randomly assigned to three groups: (1 two applications of 5% NaF-varnish (F, with one-week interval, (2 two applications of 2% chlorhexidine gel (CHX, with one-week interval, and (3 control (CO, no treatment. QLF was used to measure changes in fluorescence before and after caries induction, 1 week after each application and 1, 2, and 3 months after the last application of F or CHX. TMR was performed to quantify lesion depth and mineral content after caries induction to evaluate the effects of F, CHX, and CO 3 months after the last application of agents. The data were analyzed by repeated measures ANOVA and Tukey’s test. All treatments increased the mineral content during the experimental period; however, F induced faster remineralization than CHX. The correlation between QLF and TMR was significantly moderate. Two applications of fluoride varnish or 2% chlorhexidine gel at one-week intervals were effective in controlling WSLs.

  8. Role of casein phosphopeptide amorphous calcium phosphate in remineralization of white spot lesions and inhibition of Streptococcus mutans?

    Directory of Open Access Journals (Sweden)

    Ruchi Vashisht


    Full Text Available Introduction: To promote the remineralization by ionic exchange mechanism instead of invasive techniques many remineralizing agents can be used. Objective: To evaluate the remineralization effects of casein phosphopeptide-amorphous calcium phosphate (CPP-ACP on white spot lesions (WSLs and its inhibitory effect on Streptococcus mutans colonization. Materials and Methods: The study group consisted of 60 subjects exhibiting at least 1-WSL. Subjects were randomly divided into 2 groups: A test group using CPP-ACP cream (GC-Tooth Mousse, Leuven, Belgium and a control group using only fluoride containing toothpaste for a period of 3-month. Baseline WSLs were scored using DIAGNOdent device (KaVo Germany and the saliva samples were collected to measure S. mutans counts. After the 3-month period the WSLs were again recorded and the saliva collection was repeated. Result: DIAGNOdent measurements were increased by time (P = 0.002 in the control group and no statistically significant difference (P = 0.217 was found in the test group by the 3-month period. In both groups, the mutans counts were decreased in the 3-month experimental period. Conclusion: These clinical and laboratory results suggested that CPP-ACP containing cream had a slight remineralization effect on the WSL in the 3-month evaluation period however, longer observation is recommended to confirm whether the greater change in WSLs is maintained.

  9. A Review on Prevention and Treatment of Post-Orthodontic White Spot Lesions – Evidence-Based Methods and Emerging Technologies


    Bergstrand, Fredrik; Twetman, Svante


    Objective: The aim of this paper was to update the evidence for primary and secondary prevention (treatment) of white spot lesions (WSL) adjacent to fixed orthodontic appliances. Material and methods: A search for relevant human clinical trials published in English between 2004 and March 2011 retrieved 25 publications that fulfilled the inclusion criteria. The papers were assessed for prevented fraction and/or absolute risk reduction when possible. Results and conclusions: The findings consol...

  10. Global Deletion of Trp53 Reverts Ovarian Tumor Phenotype of the Germ Cell–Deficient White Spotting Variant (Wv) Mice1


    Cai, Kathy Qi; Wang, Ying(School of Physics, Shandong University, Jinan, 250100, PR China); Elizabeth R Smith; Smedberg, Jennifer L.; Yang, Dong-Hua; Yang, Wan-Lin; Xu, Xiang-Xi


    White spotting variant (Wv) mice are spontaneous mutants attributed to a point mutation in the c-Kit gene, which reduces the tyrosine kinase activity to around 1% and affects the development of melanocytes, mast cells, and germ cells. Homozygous mutant mice are sterile but can live nearly a normal life span. The female Wv mice have a greatly reduced ovarian germ cell and follicle reserve at birth, and the remaining follicles are largely depleted soon after the females reach reproductive stage...

  11. Products of different chemical groups to control maize white spot
    Produtos de diferentes grupos químicos no controle da mancha branca do milho


    Eliseu dos Santos Pedro; Ricardo Marcelo Gonçalves; Walter Fernandes Meirelles; Luzia Doretto Paccola-Meirelles


    The aim of this work was the evaluation of different products used to control maize white spot, a leaf disease caused by the bacterium Pantoea ananatis. Six products from different chemical groups were used for this experiment, and they were tested on the susceptible hybrid HS200. Parameters, such as severity (%), area under disease progress curve (AUDPC), and productivity, have been estimated. The treatment with oxytetracyline resulted higher grain productivity for maize. Natural products, s...

  12. Bovine Viral Diarrhea Virus (BVDV) in White-Tailed Deer (Odocoileus virginianus). (United States)

    Passler, Thomas; Ditchkoff, Stephen S; Walz, Paul H


    Bovine viral diarrhea virus (BVDV) is the prototypic member of the genus Pestivirus in the family Flaviviridae. Infections with BVDV cause substantial economic losses to the cattle industries, prompting various organized control programs in several countries. In North America, these control programs are focused on the identification and removal of persistently infected (PI) cattle, enhancement of BVDV-specific immunity through vaccination, and the implementation of biosecure farming practices. To be successful, control measures must be based on complete knowledge of the epidemiology of BVDV, including the recognition of other potential sources of the virus. BVDV does not possess strict host-specificity, and infections of over 50 species in the mammalian order Artiodactyla have been reported. Over 50 years ago, serologic surveys first suggested the susceptibility of white-tailed deer (Odocoileus virginianus), the most abundant free-ranging ruminant in North America, to BVDV. However, susceptibility of white-tailed deer to BVDV infection does not alone imply a role in the epidemiology of the virus. To be a potential wildlife reservoir, white-tailed deer must: (1) be susceptible to BVDV, (2) shed BVDV, (3) maintain BVDV in the population, and (4) have sufficient contact with cattle that allow spillback infections. Based on the current literature, this review discusses the potential of white-tailed deer to be a reservoir for BVDV. PMID:27379074

  13. Characterization of Tomato yellow spot virus, a novel tomato-infecting begomovirus in Brazil Caracterização do Tomato yellow spot virus, um novo begomovírus isolado de tomateiro no Brasil

    Directory of Open Access Journals (Sweden)

    Renata Faier Calegario


    Full Text Available The objective of this work was the biological and molecular characterization of a begomovirus detected in São Joaquim de Bicas, Minas Gerais, Brazil, named TGV-[Bi2], by determining its host range, complete nucleotide sequence and phylogenetic relationships with other begomoviruses. Biological characterization consisted of a host range study using either sap inoculation or particle bombardment as inoculation methods. The yellow spot virus can infect plants in Solanaceae and Amaranthaceae, including economically importat crops as sweet pepper, and weeds as Datura stramonium and Nicotiana silvestris. For the molecular characterization, the full-length genome (DNA-A and DNA-B was amplified, cloned and completely sequenced. Sequence comparisons and phylogenetic analyses indicated that TGV-[Bi2] constitutes a novel begomovirus species named Tomato yellow spot virus (ToYSV, closely related to Sida mottle virus (SiMoV.O objetivo deste trabalho foi a caracterização biológica e molecular de um begomovírus detectado em tomateiros em São Joaquim de Bicas, Minas Gerais, denominado TGV-[Bi2]. A caracterização biológica consistiu em teste de gama de hospedeiros, realizado por meio de inoculação via extrato foliar tamponado ou bombardeamento de partículas. O isolado TGV-[Bi2] infecta plantas das famílias Solanaceae e Amaranthaceae, inclusive espécies economicamente importantes como o pimentão, e algumas plantas daninhas como Datura stramonium e Nicotiana silvestris. A caracterização molecular consistiu na clonagem e seqüenciamento de seu genoma completo (DNA-A e DNA-B. A comparação de seqüências e análise filogenética indicaram que o TGV-[Bi2] constitui uma nova espécie de begomovírus, denominada Tomato yellow spot virus (ToYSV, filogeneticamente relacionado ao Sida mottle virus (SiMoV.

  14. New Mexico and the southwestern US are affected by a unique population of tomato spotted wilt virus (TSWV) strains. (United States)

    French, J M; Goldberg, N P; Randall, J J; Hanson, S F


    Tomato spotted wilt virus (TSWV) is an important pathogen of many ornamental, greenhouse and agronomic crops worldwide. TSWV also causes sporadic problems in a number of crops in New Mexico (NM). Nucleocapsid gene sequences obtained from six different crop species across the state over four different years were used to characterize the NM TSWV population. This analysis shows that NM is affected by a unique TSWV population that is part of larger independent population present in the southwestern US. This population likely arose due to geographic isolation and is related to other TSWV populations from the US, Spain, and Italy. PMID:26721573

  15. Susceptibility of Chinese Perch Brain (CPB Cell and Mandarin Fish to Red-Spotted Grouper Nervous Necrosis Virus (RGNNV Infection

    Directory of Open Access Journals (Sweden)

    Jiagang Tu


    Full Text Available Nervous necrosis virus (NNV is the causative agent of viral encephalopathy and retinopathy (VER, a neurological disease responsible for high mortality of fish species worldwide. Taking advantage of our established Chinese perch brain (CPB cell line derived from brain tissues of Mandarin fish (Siniperca chuatsi, the susceptibility of CPB cell to Red-Spotted Grouper nervous necrosis virus (RGNNV was evaluated. The results showed that RGNNV replicated well in CPB cells, resulting in cellular apoptosis. Moreover, the susceptibility of Mandarin fish to RGNNV was also evaluated. Abnormal swimming was observed in RGNNV-infected Mandarin fish. In addition, the cellular vacuolation and viral particles were also observed in brain tissues of RGNNV-infected Mandarin fish by Hematoxylin-eosin staining or electronic microscopy. The established RGNNV susceptible brain cell line from freshwater fish will pave a new way for the study of the pathogenicity and replication of NNV in the future.

  16. Treatment of white spot syndrome virus (WSSV) in penaeid shrimp aquaculture using plant extract

    Digital Repository Service at National Institute of Oceanography (India)

    Achuthankutty, C.T.; Desai, U.M.

    concentrations were found to be effective in controlling and treating the viral infection. However, 15 ppm concentration was found to be more effective as improvements in both clinical and behavioural aspects were noticed within two days of the treatment...

  17. Differential expression of tomato spotted wilt virus-derived viral small RNAs in infected commercial and experimental host plants.

    Directory of Open Access Journals (Sweden)

    Neena Mitter

    Full Text Available BACKGROUND: Viral small RNAs (vsiRNAs in the infected host can be generated from viral double-stranded RNA replicative intermediates, self-complementary regions of the viral genome or from the action of host RNA-dependent RNA polymerases on viral templates. The vsiRNA abundance and profile as well as the endogenous small RNA population can vary between different hosts infected by the same virus influencing viral pathogenicity and host response. There are no reports on the analysis of vsiRNAs of Tomato spotted wilt virus (TSWV, a segmented negative stranded RNA virus in the family Bunyaviridae, with two of its gene segments showing ambisense gene arrangement. The virus causes significant economic losses to numerous field and horticultural crops worldwide. PRINCIPAL FINDINGS: Tomato spotted wilt virus (TSWV-specific vsiRNAs were characterized by deep sequencing in virus-infected experimental host Nicotiana benthamiana and a commercial, susceptible host tomato. The total small (s RNA reads in TSWV-infected tomato sample showed relatively equal distribution of 21, 22 and 24 nt, whereas N. benthamiana sample was dominated by 24 nt total sRNAs. The number of vsiRNA reads detected in tomato was many a magnitude (~350:1 higher than those found in N. benthamiana, however the profile of vsiRNAs in terms of relative abundance 21, 22 and 24 nt class size was similar in both the hosts. Maximum vsiRNA reads were obtained for the M RNA segment of TSWV while the largest L RNA segment had the least number of vsiRNAs in both tomato and N. benthamiana. Only the silencing suppressor, NSs, of TSWV recorded higher antisense vsiRNA with respect to the coding frame among all the genes of TSWV. SIGNIFICANCE: Details of the origin, distribution and abundance of TSWV vsiRNAs could be useful in designing efficient targets for exploiting RNA interference for virus resistance. It also has major implications toward our understanding of the differential processing of vsi

  18. Persistence of hepatitis C virus in a white population: associations with human leukocyte antigen class 1.

    LENUS (Irish Health Repository)

    Fanning, Liam J


    The aim of this study was to define novel associations between human leukocyte antigen (HLA) class 1 alleles and persistence or clearance of the hepatitis C virus (HCV) in a white population. All individuals in the study were seropositive for anti-HCV antibodies. Viral status was determined by the Roche HCV Amplicor test. HLA-A, -B, -C allelic group profile was molecularly defined by reverse line probe hybridization. The strongest individual allelic group associations with persistent HCV infection were HLA A*11 (p = 0.044) and Cw*04 (p = 0.006). However, only the HLA C*04 association survived correction for multiple comparisons. Further analysis of alleles in linkage with HLA Cw*04 revealed that the haplotype HLA A*11, Cw*04 was present in 11 individuals, 10 of whom were viremic (p = 0.05). No gene dosage effect was observed. No association between HLA class 1 allelic groups and aviremia and virus load was evident in this white population. HLA B*44 is associated with low virus load in human immunodeficiency virus disease, but this association was not evident in this HCV-infected population. Novel HLA class 1 alleles associated with persistence of HCV have been identified.

  19. First report of tomato spotted wilt virus causing potato tuber necrosis in Texas (United States)

    In the summer of 2008, potato tubers (cv FL1867, FL2053, and FL1922) from commercial fields near Dalhart, Texas were observed with distinct external erumpent rings and severe internal discolorations including blotches, spots, and dry, cork-like tissue. The presence of rings suggested the possible i...

  20. Remineralization effect of casein phosphopeptide-amorphous calcium phosphate on enamel white spot lesions. A quantitative energy dispersive X ray elemental analysis: An in vitro study

    Directory of Open Access Journals (Sweden)

    Fabrizio Guerra


    Full Text Available Background: The objective of this study was to evaluate, by means of elemental analysis the mineral density, calcium, and phosphorus weight percent of sound enamel, demineralized and CPP-ACP treated enamel. Elemental analysis allows elemental and isotopic composition of a biologic sample. It can be qualitative (determining what elements are present, and quantitative (determining how much of each are present. INCA Energy 250, Oxford Analytical Instruments Ltd. (UK, energy-dispersive X-ray spectroscopy system for elemental analysis was performed on random assigned samples. Methods: 12 sound premolars were extracted for orthodontic reason. Each tooth was sectioned by using a double-faced diamond microtome under water cooling into three section for a total of 36 samples and randomly assigned to three groups: Group 1 (control, Group 2 (WS: white spot , Group 3 (WST white spot treated of 12 samples each. Samples (Group 2 and Group 3 underwent equally to 24 h and 48 h of acid bath duration. Then all the treated samples (Group 3 were coated with CPP-ACP for 5 min before immersion into water twice a day. Group 2 served as control for enamel damage evaluation. Inca Point & ID, an analytic platform software for SEM was used for elemental analysis on samples from Group 1 (C, 2 (WS and Group 3 (WST in order to determine the weight % and atomic % presence of Ca and P. Results: The results of the samples analysis from the three Groups show different weight % and atomic% of Ca and P, and clearly reflect the different mineralization rates. Conclusions: 10% Casein phosphopeptide-amorphous calcium phosphate (CPP-ACP complex, promotes remineralization in vitro. The results of this in vitro study completely agree with this statement. Clinical studies to investigate the intraoral effectiveness of topical applications of CPP-ACP on white spot lesions are required to confirm these results.

  1. Surveillance for West Nile virus in American white pelicans, Montana, USA, 2006-2007. (United States)

    Johnson, Gregory; Nemeth, Nicole; Hale, Kristina; Lindsey, Nicole; Panella, Nicholas; Komar, Nicholas


    West Nile virus (WNV)-associated deaths of American white pelican (Pelecanus erythrorhynchos) chicks have been recognized at various nesting colonies in the United States since 2002. We evaluated American white pelican nesting colonies in Sheridan County, Montana, USA, for an association between WNV-positive pelican carcasses and human West Nile neuroinvasive disease. Persons in counties hosting affected colonies had a 5x higher risk for disease than those in counties with unaffected colonies. We also investigated WNV infection and blood meal source among mosquitoes and pelican tissue type for greatest WNV detection efficacy in carcasses. WNV-infected Culex tarsalis mosquitoes were detected and blood-engorged Cx. tarsalis contained pelican DNA. Viral loads and detection consistency among pelican tissues were greatest in feather pulp, brain, heart, and skin. Given the risks posed to wildlife and human health, coordinated efforts among wildlife and public health authorities to monitor these pelican colonies for WNV activity are potentially useful. PMID:20202414

  2. The nucleoprotein of Tomato spotted wilt virus as protein tag for easy purification and enhanced production of recombinant proteins in plants

    NARCIS (Netherlands)

    Lacorte, C.C.; Ribeiro, S.G.; Lohuis, H.; Goldbach, R.W.; Prins, M.W.


    Upon infection, Tomato spotted wilt virus (TSWV) forms ribonucleoprotein particles (RNPs) that consist of nucleoprotein (N) and viral RNA. These aggregates result from the homopolymerization of the N protein, and are highly stable in plant cells. These properties feature the N protein as a potential

  3. Products of different chemical groups to control maize white spotProdutos de diferentes grupos químicos no controle da mancha branca do milho

    Directory of Open Access Journals (Sweden)

    Eliseu dos Santos Pedro


    Full Text Available The aim of this work was the evaluation of different products used to control maize white spot, a leaf disease caused by the bacterium Pantoea ananatis. Six products from different chemical groups were used for this experiment, and they were tested on the susceptible hybrid HS200. Parameters, such as severity (%, area under disease progress curve (AUDPC, and productivity, have been estimated. The treatment with oxytetracyline resulted higher grain productivity for maize. Natural products, such as Rocksil and Pyroligneous acid, even though they are used as supplement for plants, were not effective in controlling the maize white spot. O objetivo deste trabalho foi avaliar a eficiência de diferentes produtos no controle da mancha branca do milho, doença foliar causada pela bactéria Pantoea ananatis. Para o experimento foram utilizados seis produtos pertencentes a diferentes grupos químicos, testados no híbrido suscetível HS200. Avaliaramse as variáveis severidade, área abaixo da curva de progresso da doença (AACPD e a produtividade de grãos. O tratamento com oxitetraciclina resultou maior produtividade de grãos da cultura do milho. Produtos naturais testados no experimento, como Rocksil e Ácido Pirolenhoso, utilizados como suplementos nutricionais para as plantas, não foram eficientes no controle da mancha branca do milho.

  4. Small RNA profiles of wild-type and silencing suppressor-deficient tomato spotted wilt virus infected Nicotiana benthamiana. (United States)

    Margaria, Paolo; Miozzi, Laura; Rosa, Cristina; Axtell, Michael J; Pappu, Hanu R; Turina, Massimo


    Tospoviruses are plant-infecting viruses belonging to the family Bunyaviridae. We used a collection of wild-type, phylogenetically distinct tomato spotted wilt virus isolates and related silencing-suppressor defective mutants to study the effects on the small RNA (sRNA) accumulation during infection of Nicotiana benthamiana. Our data showed that absence of a functional silencing suppressor determined a marked increase of the total amount of viral sRNAs (vsRNAs), and specifically of the 21 nt class. We observed a common under-representation of vsRNAs mapping to the intergenic region of S and M genomic segments, and preferential mapping of the reads against the viral sense open reading frames, with the exception of the NSs gene. The NSs-mutant strains showed enrichment of NSm-derived vsRNA compared to the expected amount based on gene size. Analysis of 5' terminal nucleotide preference evidenced a significant enrichment in U for the 21 nt- and in A for 24 nt-long endogenous sRNAs in all the samples. Hotspot analysis revealed a common abundant accumulation of reads at the 5' end of the L segment, mostly in the antiviral sense, for the NSs-defective isolates, suggesting that absence of the silencing suppressor can influence preferential targeting of the viral genome. PMID:26047586



    M.P.Pratap Rudra; N.Veerababu; Ramchander Merugu


    Riboflavin carrier protein has been isolated and purified from the Indian spotted owlet. The protein was purified to its homogeneity. Purification was achieved successfully by DEAE_ Sepharose column chromatography and gel filtration chromatography on Sephadex G-100. The protein content was estimated with Lowry method. The purity of the proteins was judged by SDS-PAGE technique. The molecular weight of the protein was found to be 29 Kd. The protein was characterized using absorption, fluoresce...

  6. Perceptions of White Spot Lesions During Fixed Orthodontic Treatment of Patients, Parents, Orthodontists and Dentists%不同人群对正畸固定矫治中白垩斑的认知调查

    Institute of Scientific and Technical Information of China (English)

    林佳强; 程晶晶; 毛美清; 林非欧


    Objective To assess the perceptions of patients , parents, orthodontists and general dentists on the development of white spot lesions during fixed orthodontic treatment , to prevent the development of white spot lesions and provide a reference for doctor -patient communication .Methods A survey about the perceptions of white spot lesions within orthodontic patients ( n =323 ) , parents ( n =295 ) , orthodontists (n=63) and dentists (n=117) was carried out, then analyzed.Results Four surveyed populations indicated that white spot lesions detracted the appearance of teeth .The major responsibility for the prevention of white spot lesions was owed to the patient , but not the general dentists .There is significant difference as regards the treatment of white spot lesions between dental professionals and laypeople ( P<0.01 ) .Conclusions Four populations had similar perception that white spot lesions detracted the appearance of teeth and the major responsibility for the prevention of white spot lesions was due to the patient .The patients , parents , orthodontists , and general dentists should strengthen the communication , eliminate the doctor-patient contradiction hidden dangers .%目的:调查正畸患者、患者家长、正畸医生和全科牙医对固定正畸矫治中白垩斑的认知度,为正畸治疗中白垩斑的防治及医患沟通提供参考。方法对323名正畸患者、295名患者家长、63名正畸医生及117名全科牙医进行白垩斑认知度的问卷调查,对结果进行统计分析。结果4组人群均认为白垩斑使矫治后牙齿的美观度降低,患者要对白垩斑的发生负最主要责任,患者和家长与正畸医师和牙医对白垩斑的治疗看法迥异。结论不同人群均认为白垩斑降低了牙齿的美观度,其主要责任在于患者自身,医患双方应当加强沟通,消除医患矛盾隐患。


    Directory of Open Access Journals (Sweden)

    M.P.Pratap Rudra


    Full Text Available Riboflavin carrier protein has been isolated and purified from the Indian spotted owlet. The protein was purified to its homogeneity. Purification was achieved successfully by DEAE_ Sepharose column chromatography and gel filtration chromatography on Sephadex G-100. The protein content was estimated with Lowry method. The purity of the proteins was judged by SDS-PAGE technique. The molecular weight of the protein was found to be 29 Kd. The protein was characterized using absorption, fluorescence and CD spectral analysis. Significance of the above results are discussed in the present communication.

  8. Modified expression of alternative oxidase in transgenic tomato and petunia affects the level of tomato spotted wilt virus resistance

    Directory of Open Access Journals (Sweden)

    Ma Hao


    Full Text Available Abstract Background Tomato spotted wilt virus (TSWV has a very wide host range, and is transmitted in a persistent manner by several species of thrips. These characteristics make this virus difficult to control. We show here that the over-expression of the mitochondrial alternative oxidase (AOX in tomato and petunia is related to TSWV resistance. Results The open reading frame and full-length sequence of the tomato AOX gene LeAox1au were cloned and introduced into tomato 'Healani' and petunia 'Sheer Madness' using Agrobacterium-mediated transformation. Highly expressed AOX transgenic tomato and petunia plants were selfed and transgenic R1 seedlings from 10 tomato lines and 12 petunia lines were used for bioassay. For each assayed line, 22 to 32 tomato R1 progeny in three replications and 39 to 128 petunia progeny in 13 replications were challenged with TSWV. Enzyme-Linked Immunosorbent Assays showed that the TSWV levels in transgenic tomato line FKT4-1 was significantly lower than that of wild-type controls after challenge with TSWV. In addition, transgenic petunia line FKP10 showed significantly less lesion number and smaller lesion size than non-transgenic controls after inoculation by TSWV. Conclusion In all assayed transgenic tomato lines, a higher percentage of transgenic progeny had lower TSWV levels than non-transgenic plants after challenge with TSWV, and the significantly increased resistant levels of tomato and petunia lines identified in this study indicate that altered expression levels of AOX in tomato and petunia can affect the levels of TSWV resistance.



    Aneliya BORISOVA


    The survey was carried out mostly in one of the main fruit tree growing regions of Bulgaria - Kyustendil, during the period of 2004-2005. A total of 632 trees corresponding to 50 apple, 27 pear, 19 plum, 4 peach, 9 sweet cherry and 4 sour cherry cultivars and 21 apricot elites were tested for the presence of Apple chlorotic leaf spot virus (ACLSV) and six other viruses by ELISA. Samples for analyses were collected from different organs of plants: flowers, leaves or phloem tissues. In the pres...

  10. A new Capsicum baccatum accession shows tolerance to wild-type and resistance-breaking isolates of Tomato spotted wilt virus


    Soler Aleixandre, Salvador; DEBRECZENI, DIANA ELVIRA; Vidal, Eduardo; Aramburu, José; López Del Rincón, Carmelo; Galipienso Torregrosa, Luis; RUBIO MIGUELEZ, LUIS


    [EN] Tomato spotted wilt virus (TSWV) causes economically important losses in many crops, worldwide. In pepper (Capsicum annuum), the best method for disease control has been breeding resistant cultivars by introgression of gene Tsw from Capsicum chinense. However, this resistance has two drawbacks: (a) it is not efficient if plants are infected at early growth stages and under prolonged high temperatures, and (b) it is rapidly overcome by TSWV evolution. In this work, we se...

  11. Detection of West Nile virus in stable flies (Diptera: Muscidae) parasitizing juvenile American white pelicans. (United States)

    Johnson, Gregory; Panella, Nicholas; Hale, Kristina; Komar, Nicholas


    Stable flies, Stomoxys calcitrans (L.) (Diptera: Muscidae), an economically important pest of livestock and humans, were observed parasitizing prefledged American white pelicans, Pelecanus erythrorhynchos (Pelecaniformes: Pelecanidae), in a pelican breeding colony in northeastern Montana where die-offs attributed to West Nile virus (family Flaviviridae, genus Flavivirus, WNV) have occurred since 2002. Engorged and unengorged flies were collected off nine moribund chicks. Of 29 blood-engorged flies testing positive for vertebrate DNA, all 29 contained pelican DNA. Virus isolation was performed on 60 pools (1,176 flies) of unengorged flies using Vero cell plaque assay. Eighteen pools were positive for WNV for an estimated infection rate of 18.0 per 1,000 flies. Fifty-four percent (36/67) of abdomens from blood-engorged flies tested positive for WNV. Pelican viremia levels from the blood-engorged fly abdomens revealed that at least one of the ill pelicans circulated a viremia capable of infecting Culex mosquito vectors. Stable flies may be involved in WNV transmission within the pelican breeding colony by serving as either a mechanical vector or as a source for oral infection if ingested by predators. PMID:21175073

  12. The incidence of caries and white spot lesions in orthodontically treated adolescents with a comprehensive caries prophylactic regimen--a prospective study. (United States)

    Hadler-Olsen, Sigurd; Sandvik, Kristin; El-Agroudi, Mohammad A; Øgaard, Bjørn


    The aim of the study was to assess the effect of a comprehensive prophylactic regimen in reducing the incidence of white spot lesions (WSL) and caries during orthodontic treatment. Eighty consecutive patients, scheduled for fixed appliance treatment in both jaws were compared with a non-orthodontic matched-control group. The oral hygiene regimen consisted of brushing two to three times daily, flossing, fluoride rinse, and plaque disclosing tablets. Patients were requested to avoid carbonated soft drinks/acidic juices and candies. The WSL index of Gorelick et al. (Gorelick L, Geiger A M, Gwinnett A J 1982 Incidence of white spot formation after bonding and banding. American Journal of Orthodontics 81: 93-98) was used. Caries were scored according to Amarante et al. (Amarante E, Raadal M, Espelid I 1998 Impact of diagnostic criteria on the prevalence of dental caries in Norwegian children aged 5, 12 and 18 years. Community Dental Oral Epidemiology 26: 87-94). We collected data from all finished cases. It comprised 40 subjects in the orthodontic group (mean age: 13.6 years, range: 12-16 years) and 40 matched controls. The average treatment time was 18 months (range: 9-25 months). The mean increase in WSL index in the orthodontic group was 1.9 and 0.4 in the control group (P = 0.001). The mean increase in dentine caries was 0.5 lesions and 0.7 lesions in the in the orthodontic group and control group, respectively (P = 0.62). Twenty-three per cent of treated patients showed good compliance, 68 per cent moderate compliance, and 9 per cent poor compliance. The mean increase in WSL was 1.0, 1.4, and 3.3 in the good, moderate, and poor compliance group, respectively (P = 0.155). Orthodontically treated patients have significantly higher risk for developing WSL than untreated patients, while there is no difference with respect to development of new dentinal caries lesions. This study showed that a possible relationship between compliance and WSL development existed. PMID

  13. Inactivation of Anisakis simplex L3 in the flesh of white spotted conger (Conger myriaster) by high hydrostatic pressure and its effect on quality. (United States)

    Lee, Ki-Hoon; Park, Shin Young; Ha, Sang-Do


    Koreans consume much seafood; the country is surrounded on the east, west and south by the sea. Koreans have eaten raw sashimi for a long time. However, a concern in the raw sea food industry is that the parasitic nematode Anisakis simplex L3 occurs naturally in marine fish. Thus, the fishery industry needs a non-thermal processing method. High hydrostatic pressure (HPP) has been demonstrated to be effective. White spotted conger flesh containing 20 live larvae was exposed to different pressures (150 and 200 MPa for 1 and 5 min; 250 and 300 MPa each for 1 min). The viability of A. simplex L3 was significantly (p  0.05) in any of the Hunter colour ('L', 'a' and 'b') values were found after HPP at 200 MPa for 5 min. The fresh treated at 300 MPa for 1 min scored sensory evaluation using a seven-point hedonic scale. However, the flesh treated at 200 MPa for 5 min scored > 5.0 ('like') for all sensory parameters. This study suggested that HPP at 200 MPa for 5 min could potentially be used for the inactivation of A. simplex L3 in raw fishery food products without any concomitant changes in their colour or sensory qualities. PMID:27117731

  14. Southern rice black-streaked dwarf virus: a white-backed planthopper transmitted fijivirus threadening rice production in Asia

    Directory of Open Access Journals (Sweden)



    Full Text Available Southern rice black-streaked dwarf virus (SRBSDV, a nonenveloped icosahedral virus with a genome of 10 double-stranded RNA segments, is a novel species in the genus Fijivirus (family Reoviridae first recognized in 2008. Rice plants infected with this virus exhibit symptoms similar to those caused by Rice black-streaked dwarf virus. Since 2009, the virus has rapidly spread and caused serious rice losses in East and Southeast Asia. Significant progress has been made in recent years in understanding this disease, especially about the functions of the viral genes, rice–virus–insect interactions, and epidemiology and control measures. The virus can be efficiently transmitted by the white-backed planthopper (WBPH, Sogatella furcifera in a persistent circulative propagative manner but cannot be transmitted by the brown planthopper (Nilaparvata lugens and small brown planthopper (Laodelphax striatellus. Rice, maize, Chinese sorghum (Coix lacryma-jobi and other grass weeds can be infected via WBPH. However, only rice plays a major role in the virus infection cycle because of the vector's preference. In Southeast Asia, WBPH is a long-distance migratory rice pest. The disease cycle can be described as follows: SRBSDV and its WBPH vector overwinter in warm tropical or sub-tropical areas; viruliferous WBPH adults carry the virus from south to north via long-distance migration in early spring, transmit the virus to rice seedlings in the newly colonized areas, and lay eggs on the infected seedlings; the next generation of WBPHs propagate on infected seedlings, become viruliferous, disperse, and cause new disease outbreaks. Several molecular and serological methods have been developed to detect SRBSDV in plant tissues and individual insects. Control measures based on protection from WBPH, including seedbed coverage, chemical seed treatments, and chemical spraying of seedlings, have proven effective in China.

  15. Liver spots (United States)

    Sun-induced skin changes - liver spots; Senile or solar lentigines; Skin spots - aging; Age spots ... your skin by using skin bleaching lotions or creams. Most bleaching lotions use hydroquinone. This medicine is ...

  16. Diagnosis of nervous necrosis virus in orange-spotted grouper, Epinephelus coioides, by a rapid and convenient RT-PCR method

    Institute of Scientific and Technical Information of China (English)

    MU Yinnan; LIN Kebing; CHEN Xinhua; AO Jingqun


    Viral nervous necrosis (VNN) causes high mortality in marine fish, especially in the grouper, worldwide and in China. Since there is no effective vaccine or drug to deal with VNN, early detection and prevention is important to block its outbreak. In this study, a reverse transcription-polymerase chain reaction (RT-PCR) was developed for the rapid, convenient, and sensitive detection of the VNN pathogen, nervous necro-sis virus (NNV ), in the grouper. The whole process was completed within 3.5 h from the RNA extraction to PCR product visualization. The detection limit of this method was 200 copies of NNV RNA standard, which corresponded to 200 copies of virus particles. This RT-PCR method was specific to the NNV detection with no cross-reactivity to other fish viral disease pathogens, such as infectious pancreatic necrosis virus (IPNV ), infectious hematopoietic necrosis virus (IHNV ), spring viraemia of carp virus (SVCV ), epizootic haematopoietic necrosis virus (EHNV ), and large yellow croaker iridovirus (LYCIV ). With this method, the orange-spotted grouper (Epinephelus coioides) fry from hatcheries with or without incidence of the VN-N epidemic in Fujian Province were detected. The results showed that all or 93%of the fry from the two hatcheries with incidence of the epidemic were diagnosed as positive, while 40%or 25%of fry from the t-wo hatcheries without the VNN epidemic were also detected as NNV positive, indicating that this RT-PCR method can be used for rapid, sensitive detection of NNV infection and applied in the VNN epidemic alert.

  17. Detection and sequence comparsion of blackcurrant reversion virus in black, red and white current

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Jaroslava; Špak, Josef; Kubelková, Darina; Špaková, Vlastimila

    Ankara : Mustafa Kemal University, 2006, s. 140. [XXth International Symposium on Virus and Virus-like Diseases of Temperate Fruit Crops and XIth International Symposium of Small Fruit Virus Diseases. Antalya (TR), 22.05.2006-26.05.2006] R&D Projects: GA MŠk 1P05OC051 Institutional research plan: CEZ:AV0Z50510513 Keywords : blackcurrant reversion virus * Detection Subject RIV: EE - Microbiology, Virology

  18. Detection and occurrence of Melon yellow spot virus in Ecuador: an emergent threat to melon and watermelon production (United States)

    Worldwide, more than fifty viruses have been reported in cucurbit crops. In Ecuador, approximately 3000 Ha of watermelon, melon and cucumbers are cultivated annually. However, very few studies have been conducted to identify viruses responsible for important epidemics in this crop in Ecuador. During...

  19. Quantitative relationship of two viruses (MrNV and XSV) in white-tail disease of Macrobrachium rosenbergii


    Zhang, Hj; Wang, Hm; Yuan, Jf; Li, LJ; Zhang, JH; Bonami, Jean-Robert; Shi, Zl


    Macrobrachium rosenbergii nodavirus (MrNV) and extra small virus (XSV) were purified from diseased freshwater prawns M rosenbergii and used to infect healthy post-larvae (PL) by an immersion method. Three groups of prawns were challenged with various combined doses of MrNV and XSV. Signs of white-tail disease (WTD) were observed in Groups 1 and 2, which had been challenged with combinations containing relatively high proportions of MrNV and low proportions of XSV. By contrast there was little...


    Directory of Open Access Journals (Sweden)

    Aneliya BORISOVA


    Full Text Available The survey was carried out mostly in one of the main fruit tree growing regions of Bulgaria - Kyustendil, during the period of 2004-2005. A total of 632 trees corresponding to 50 apple, 27 pear, 19 plum, 4 peach, 9 sweet cherry and 4 sour cherry cultivars and 21 apricot elites were tested for the presence of Apple chlorotic leaf spot virus (ACLSV and six other viruses by ELISA. Samples for analyses were collected from different organs of plants: flowers, leaves or phloem tissues. In the present research, ACLSV was not found in pear, plum, apricot and sour cherry. The highest infection rate of the virus among the infected fruit tree species was in apple (73 % followed by sweet cherry (13.3 % and peach (11.76 %. The frequency of mixed infection was 43.2 % in the infected apple, 33.4 % in sweet cherry and 12.5 % in peach trees. The highest concentrations of ACLSV, measured by ELISA, were observed in naturally grown flower petals of apple and sweet cherry trees in May.

  1. Sequence diversity of the nucleoprotein gene of iris yellow spot virus (genus Tospovirus, family Bunyaviridae) isolates from the western region of the United States. (United States)

    Pappu, H R; du Toit, L J; Schwartz, H F; Mohan, S K


    Iris yellow spot virus (IYSV), a tentative virus species in the genus Tospovirus and family Bunyaviridae, is considered a rapidly emerging threat to onion production in the western United States (US). The present study was undertaken to determine the sequence diversity of IYSV isolates from infected onion plants grown in California, Colorado, Idaho, Oregon, Utah and Washington. Using primers derived from the small RNA of IYSV, the complete sequence of the nucleoprotein (NP) gene of each isolate was determined and the sequences compared. In addition, a shallot isolate of IYSV from Washington was included in the study. The US isolates of IYSV shared a high degree of sequence identity (95 to 99%) with one another and to previously reported isolates. Phylogenetic analyses showed that with the exception of one isolate from central Oregon and one isolate from California, all the onion and shallot isolates from the western US clustered together. This cluster also included onion and lisianthus isolates from Japan. A second distinct cluster consisted of isolates from Australia (onion), Brazil (onion), Israel (lisianthus), Japan (alstroemeria), The Netherlands (iris) and Slovenia (leek). The IYSV isolates evaluated in this study appear to represent two distinct groups, one of which largely represents isolates from the western US. Understanding of the population structure of IYSV would potentially provide insights into the molecular epidemiology of this virus. PMID:16320007

  2. Virus Survey of Commercial Cowpea Fields in the U. S. and Evaluation of the Core of the USDA Cowpea Germplasm Collection for Resistance to Tomato Spotted Wilt Virus (United States)

    Cowpea (Vigna unguiculata) is an important vegetable crop in the southern United States. Cowpea plants are susceptible to over 20 viruses and many of them are seed-borne. A survey was carried out to evaluate the current virus status in commercial cowpea fields in five States (MO, NM, SC, TN and TX...

  3. Detection and sequence comparison of the Blackcurrant reversion virus in black, red and white currant

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Jaroslava; Špak, Josef; Petrzik, Karel; Kubelková, Darina; Špaková, Vlastimila

    Leueven 1 : ISHS Acta Horticulturea, 2008 - (Martin, R.), s. 61-65 ISBN 978-90-6605-038-9. ISSN 0567-7572. [International Symposium on Small Fruit Virus Diseases /11./. Antalya (TR), 22.05.2006-26.05.2006] Institutional research plan: CEZ:AV0Z50510513 Keywords : Blackcurrant reversion virus * curran * RT-PCR Subject RIV: EF - Botanics

  4. Comparative evaluation of remineralization potential of casein phosphopeptide-amorphous calcium phosphate and casein phosphopeptide-amorphous calcium phosphate fluoride on artificial enamel white spot lesion: An in vitro light fluorescence study

    Directory of Open Access Journals (Sweden)

    R Mehta


    Results: As compared with artificial saliva both CPP-ACP and CPP-ACFP produced significant amount of remineralization of the artificial enamel white spot lesion (P < 0.001, however when the remineralizing effect of CPP-ACP was compared with the remineralizing effect of CPP-ACFP there was no significant difference. Significant amount of remineralization was produced by CPP-ACP and CPP-ACFP only after the 7 th day. After the 14 th day, the remineralization produced by both CPP-ACP and CPP-ACFP as compared to artificial saliva was non-significant.

  5. Molecular linkage of hantavirus pulmonary syndrome to the white-footed mouse, Peromyscus leucopus: genetic characterization of the M genome of New York virus.


    Hjelle, B; Lee, S. W.; Song, W.; Torrez-Martinez, N; Song, J. W.; Yanagihara, R; Gavrilovskaya, I; Mackow, E R


    The complete M segment sequences of hantaviruses amplified from tissues of a patient with hantavirus pulmonary syndrome in the northeastern United States and from white-footed mice, Peromyscus leucopus, from New York were 99% identical and differed from those of Four Corners virus by 23%. The serum of this patient failed to recognize a conserved, immunodominant epitope of the Four Corners virus G1 glycoprotein. Collectively, these findings indicate that P. leucopus harbors a genetically and a...

  6. Caracterização do Tomato chlorotic spot virus isolado de jiló no Vale do Paraíba, Estado de São Paulo Characterization of a Tomato chlorotic spot virus isolated from gilo in Paraíba Valley, São Paulo, Brazil

    Directory of Open Access Journals (Sweden)



    Full Text Available Os tospovírus são responsáveis por perdas significativas em diversas culturas, principalmente solanáceas. No município de São José dos Campos (SP, plantas de jiló (Solanum gilo apresentando sintomas de mosaico, bolhosidades, nanismo e queda acentuada da produção foram coletadas para análise. Visando a caracterização do agente causador dos sintomas, testes biológicos, elétrono microscópicos, sorológicos e moleculares foram realizados. Através de inoculação mecânica em plantas indicadoras das famílias Amaranthaceae, Chenopodiaceae e Solanaceae obtiveram-se resultados típicos aos esperados para tospovírus. Ao microscópio eletrônico de transmissão, observaram-se, em contrastação negativa, partículas pleomórficas com diâmetro entre 80 e 110 nm e em cortes ultra-finos partículas presentes em vesículas do retículo endoplasmático. Através de DAS-ELISA, identificou-se o Tomato chlorotic spot virus (TCSV. A partir de RNA total extraído de folhas infetadas, amplificaram-se, via RT-PCR, fragmentos correspondentes ao gene da proteína do capsídeo (cp os quais foram seqüenciados e comparados com outros depositados no "GenBank". A homologia de nucleotídeos e aminoácidos deduzidos foi respectivamente de 99 e 95% quando comparada com seqüências de isolados de TCSV. A comparação com as outras espécies do gênero Tospovirus apresentou valores de homologia entre 72 e 84%. Estes resultados confirmam a identidade deste vírus como pertencente à espécie TCSV, que é predominante no Estado de São Paulo e importante patógeno de outras plantas cultivadas. Além disso, variedades de jiló quando inoculadas foram susceptíveis tanto ao TCSV como às espécies Tomato spotted wilt virus (TSWV e Groundnut ringspot virus (GRSV.Tospoviruses are responsible for important losses in most crops, mainly Solanaceae. Gilo (Solanum gilo plants showing mosaic, blistering, stunting and 100% production losses were collected for analysis

  7. Analysis of resistance to Yam mosaic virus, genus Potyvirus in white guinea yam (Dioscorea rotundata Poir. genotypes

    Directory of Open Access Journals (Sweden)

    Babajide Odu O.


    Full Text Available Resistance to Yam mosaic virus (YMV, genus Potyvirus was studied in 10 populations of selected white Guinea yam (Dioscorea rotundata. Plants of resistant genotypes: TDr 35, TDr 1621, TDr 93-1, TDr 93-32, TDr 95-107, TDr 93-23, and susceptible ones: TDr 87/00211, TDr 87/00571 and TDr 95-127 were screened for their reaction to the pathogen by symptom severity scoring scale of 1-5, and by quantifying virus multiplication by triple antibody sandwich enzyme-linked immunosorbent assay (TAS-ELISA. Controlled crosses were made among the genotypes within and between the groups according to reactions to the pathogen. The resultant F1 progenies were evaluated for the infection by disease symptom development and by TAS ELISA to detect a symptomless infection in an insect-proof screenhouse for the assessment of inheritance of resistance to YMV. A genetic analysis of the reactions of progenies derived from the D. rotundata genotypes to inoculation with YMV strongly suggests that resistance to the virus is a dominantly inherited trait. Segregation ratios obtained from the families indicate that at least two dominant genes are involved.

  8. The movement protein (NSm) of Tomato spotted wilt virus is the avirulence determinant in the tomato Sw-5 gene-based resistance. (United States)

    Peiró, Ana; Cañizares, M Carmen; Rubio, Luis; López, Carmelo; Moriones, Enrique; Aramburu, José; Sánchez-Navarro, Jesús


    The avirulence determinant triggering the resistance conferred by the tomato gene Sw-5 against Tomato spotted wilt virus (TSWV) is still unresolved. Sequence comparison showed two substitutions (C118Y and T120N) in the movement protein NSm present only in TSWV resistance-breaking (RB) isolates. In this work, transient expression of NSm of three TSWV isolates [RB1 (T120N), RB2 (C118Y) and non-resistance-breaking (NRB)] in Nicotiana benthamiana expressing Sw-5 showed a hypersensitive response (HR) only with NRB. Exchange of the movement protein of Alfalfa mosaic virus (AMV) with NSm supported cell-to-cell and systemic transport of the chimeric AMV RNAs into N. tabacum with or without Sw-5, except for the constructs with NBR when Sw-5 was expressed, although RB2 showed reduced cell-to-cell transport. Mutational analysis revealed that N120 was sufficient to avoid the HR, but the substitution V130I was required for systemic transport. Finally, co-inoculation of RB and NRB AMV chimeric constructs showed different prevalence of RB or NBR depending on the presence or absence of Sw-5. These results indicate that NSm is the avirulence determinant for Sw-5 resistance, and mutations C118Y and T120N are responsible for resistance breakdown and have a fitness penalty in the context of the heterologous AMV system. PMID:24690181

  9. Prevalence of Taura syndrome virus (TSV) and Infectious hypodermal and haematopoietic necrosis virus (IHHNV) in white shrimp (Penaeus vannamei) populations and susceptibility to infection of some aquatic species native to Thailand


    Supamattaya, K.; Klowklieng, T.; Arunrat, S.; Kasornchandra, J.; Sukasem, N.; Sukrakanchana, N.; Kiriratnikom, S.; Ruangsri, J.


    This study aimed to survey the prevalence of some infectious diseases e.g. Taura syndrome virus (TSV) and Infectious hypodermal and haematopoietic necrosis virus (IHHNV) in white shrimp (Penaeus vannamei) populations and to assess the impact of such infectious agents to indigenous aquatic animals in Thailand. Samples of both larval and juvenile or adult shrimp from each region of the country were collected and screened for TSV and IHHNV using the polymerase chain reaction (PCR) technique. Vir...

  10. Disparities in herpes simplex virus type 2 infection between black and white men who have sex with men in Atlanta, GA. (United States)

    Okafor, Netochukwu; Rosenberg, Eli S; Luisi, Nicole; Sanchez, Travis; del Rio, Carlos; Sullivan, Patrick S; Kelley, Colleen F


    HIV disproportionately affects black men who have sex with men, and herpes simplex virus type 2 is known to increase acquisition of HIV. However, data on racial disparities in herpes simplex virus type 2 prevalence and risk factors are limited among men who have sex with men in the United States. InvolveMENt was a cohort study of black and white HIV-negative men who have sex with men in Atlanta, GA. Univariate and multivariate cross-sectional associations with herpes simplex virus type 2 seroprevalence were assessed among 455 HIV-negative men who have sex with men for demographic, behavioural and social determinant risk factors using logistic regression. Seroprevalence of herpes simplex virus type 2 was 23% (48/211) for black and 16% (38/244) for white men who have sex with men (p = 0.05). Education, poverty, drug/alcohol use, incarceration, circumcision, unprotected anal intercourse, and condom use were not associated with herpes simplex virus type 2. In multivariate analyses, black race for those ≤25 years, but not >25 years, and number of sexual partners were significantly associated. Young black men who have sex with men are disproportionately affected by herpes simplex virus type 2, which may contribute to disparities in HIV acquisition. An extensive assessment of risk factors did not explain this disparity in herpes simplex virus type 2 infection suggesting differences in susceptibility or partner characteristics. PMID:25246424

  11. P3N-PIPO of Clover yellow vein virus exacerbates symptoms in pea infected with white clover mosaic virus and is implicated in viral synergism. (United States)

    Hisa, Yusuke; Suzuki, Haruka; Atsumi, Go; Choi, Sun Hee; Nakahara, Kenji S; Uyeda, Ichiro


    Mixed infection of pea (Pisum sativum) with Clover yellow vein virus (ClYVV) and White clover mosaic virus (WClMV) led to more severe disease symptoms (a phenomenon called viral synergism). Similar to the mixed ClYVV/WClMV infection, a WClMV-based vector encoding P3N-PIPO of ClYVV exacerbated the disease symptoms. Infection with the WClMV vector encoding ClYVV HC-Pro (a suppressor of RNA silencing involved in potyviral synergisms), also resulted in more severe symptoms, although to a lesser extent than infection with the vector encoding P3N-PIPO. Viral genomic RNA accumulated soon after inoculation (at 2 and 4 days) at higher levels in leaves inoculated with WClMV encoding HC-Pro but at lower levels in leaves inoculated with WClMV encoding P3N-PIPO than in peas infected with WClMV encoding GFP. Our results suggest that ClYVV P3N-PIPO is involved in the synergism between ClYVV and WClMV during pea infection through an unknown mechanism different from suppression of RNA silencing. PMID:24418553

  12. Virus infection decreases the attractiveness of white clover plants for a non-vectoring herbivore

    DEFF Research Database (Denmark)

    van Mölken, Tamara; Caluwe, Hannie de; Hordijk, Cornelis A.;


    Plant pathogens and insect herbivores are prone to share hosts under natural conditions. Consequently, pathogen-induced changes in the host plant can affect herbivory, and vice versa. Even though plant viruses are ubiquitous in the field, little is known about plant-mediated interactions between...

  13. Experimental infection of white-tailed deer with bluetongue virus serotype 8

    NARCIS (Netherlands)

    Drolet, B.S.; Reister, L.M.; Mecham, J.O.; Wilson, W.C.; Nol, P.; Vercauteren, K.C.; Rijn, van P.A.; Bowen, R.A.


    Bluetongue (BT) is an insect-transmitted, economically important disease of domestic and wild ruminants. Although only five of the 26 reported bluetongue virus (BTV) serotypes are considered endemic to the USA, 10 exotic serotypes have been isolated primarily in the southeastern region of the countr

  14. Phylogenetic analysis of Tomato spotted wilt virus (TSWV) NSs protein demonstrates the isolated emergence of resistance-breaking strains in pepper. (United States)

    Almási, Asztéria; Csilléry, Gábor; Csömör, Zsófia; Nemes, Katalin; Palkovics, László; Salánki, Katalin; Tóbiás, István


    Resurgence of Tomato spotted wilt virus (TSWV) worldwide as well as in Hungary causing heavy economic losses directed the attention to the factors contributing to the outbreak of this serious epidemics. The introgression of Tsw resistance gene into various pepper cultivars seemed to solve TSWV control, but widely used resistant pepper cultivars bearing the same, unique resistance locus evoked the rapid emergence of resistance-breaking (RB) TSWV strains. In Hungary, the sporadic appearance of RB strains in pepper-producing region was first observed in 2010-2011, but in 2012 it was detected frequently. Previously, the non-structural protein (NSs) encoded by small RNA (S RNA) of TSWV was verified as the avirulence factor for Tsw resistance, therefore we analyzed the S RNA of the Hungarian RB and wild type (WT) isolates and compared to previously analyzed TSWV strains with RB properties from different geographical origins. Phylogenetic analysis demonstrated that the different RB strains had the closest relationship with the local WT isolates and there is no conserved mutation present in all the NSs genes of RB isolates from different geographical origins. According to these results, we concluded that the RB isolates evolved separately in geographic point of view, and also according to the RB mechanism. PMID:25331341

  15. Strategies to facilitate the development of uncloned or cloned infectious full-length viral cDNAs: Apple chlorotic leaf spot virus as a case study

    Directory of Open Access Journals (Sweden)

    Marais Armelle


    Full Text Available Abstract Background Approaches to simplify and streamline the construction of full-length infectious cDNA clones (FL-cDNAs are needed. Among desirable improvements are the ability to use total nucleic acids (TNA extracts from infected hosts (to bypass viral purification limitations for the direct one-step amplification of large FL-cDNAs, the possibility to inoculate plants with uncloned FL-cDNAs and the simplified cloning of these large molecules. Results Using the 7.55 kb genome of Apple chlorotic leaf spot trichovirus (ACLSV approaches allowing the rapid generation from TNA extracts of FL-cDNAs under the control of the T7 promoter and the successful inoculation of plants using in vitro transcripts obtained from these uncloned amplification products have been developed. We also show that the yeast homologous recombination system permits efficient cloning of FL-cDNAs and the simultaneous one-step tailoring of a ternary Yeast-Escherichia coli-Agrobacterium tumefaciens shuttle vector allowing efficient inoculation of both herbaceous and woody host plants by agroinfiltration. Conclusions The fast and efficient strategies described here should have broad applications, in particular for the study of "difficult" plant viruses, such as those infecting woody hosts, and potentially for other, non plant-infecting viral agents.

  16. The Cucumber leaf spot virus p25 auxiliary replicase protein binds and modifies the endoplasmic reticulum via N-terminal transmembrane domains

    International Nuclear Information System (INIS)

    Cucumber leaf spot virus (CLSV) is a member of the Aureusvirus genus, family Tombusviridae. The auxiliary replicase of Tombusvirids has been found to localize to endoplasmic reticulum (ER), peroxisomes or mitochondria; however, localization of the auxiliary replicase of aureusviruses has not been determined. We have found that the auxiliary replicase of CLSV (p25) fused to GFP colocalizes with ER and that three predicted transmembrane domains (TMDs) at the N-terminus of p25 are sufficient for targeting, although the second and third TMDs play the most prominent roles. Confocal analysis of CLSV infected 16C plants shows that the ER becomes modified including the formation of punctae at connections between ER tubules and in association with the nucleus. Ultrastructural analysis shows that the cytoplasm contains numerous vesicles which are also found between the perinuclear ER and nuclear membrane. It is proposed that these vesicles correspond to modified ER used as sites for CLSV replication. - Highlights: • The CLSV p25 auxiliary replicase targets the endoplasmic reticulum (ER). • Targeting of CLSV p25 is associated with ER restructuring. • Restructuring of the ER occurs during CLSV infection. • CLSV p25 contains 3 predicted transmembrane domains 2 of which are required for ER targeting. • Vesicles derived from the ER may be sites of CLSV replication

  17. The Cucumber leaf spot virus p25 auxiliary replicase protein binds and modifies the endoplasmic reticulum via N-terminal transmembrane domains

    Energy Technology Data Exchange (ETDEWEB)

    Ghoshal, Kankana [University of British Columbia, Faculty of Land and Food Systems, Vancouver, British Columbia, Canada V6T 1Z4 (Canada); Theilmann, Jane; Reade, Ron; Sanfacon, Helene [Agriculture and Agri-Food Canada Pacific Agri-Food Research Centre, 4200 Hwy 97, Summerland, British Columbia, Canada V0H 1Z0 (Canada); Rochon, D’Ann, E-mail: [University of British Columbia, Faculty of Land and Food Systems, Vancouver, British Columbia, Canada V6T 1Z4 (Canada); Agriculture and Agri-Food Canada Pacific Agri-Food Research Centre, 4200 Hwy 97, Summerland, British Columbia, Canada V0H 1Z0 (Canada)


    Cucumber leaf spot virus (CLSV) is a member of the Aureusvirus genus, family Tombusviridae. The auxiliary replicase of Tombusvirids has been found to localize to endoplasmic reticulum (ER), peroxisomes or mitochondria; however, localization of the auxiliary replicase of aureusviruses has not been determined. We have found that the auxiliary replicase of CLSV (p25) fused to GFP colocalizes with ER and that three predicted transmembrane domains (TMDs) at the N-terminus of p25 are sufficient for targeting, although the second and third TMDs play the most prominent roles. Confocal analysis of CLSV infected 16C plants shows that the ER becomes modified including the formation of punctae at connections between ER tubules and in association with the nucleus. Ultrastructural analysis shows that the cytoplasm contains numerous vesicles which are also found between the perinuclear ER and nuclear membrane. It is proposed that these vesicles correspond to modified ER used as sites for CLSV replication. - Highlights: • The CLSV p25 auxiliary replicase targets the endoplasmic reticulum (ER). • Targeting of CLSV p25 is associated with ER restructuring. • Restructuring of the ER occurs during CLSV infection. • CLSV p25 contains 3 predicted transmembrane domains 2 of which are required for ER targeting. • Vesicles derived from the ER may be sites of CLSV replication.

  18. Bier spots

    Directory of Open Access Journals (Sweden)

    Ahu Yorulmaz,


    Full Text Available Also called as physiologic anemic macules, Bier spots are small, hypopigmented irregularly shaped macules against a background of diffuse erythema, which creates an appearance of speckled vascular mottling of the skin. Bier spots most commonly appear on distal portions of the limbs though there are case reports describing diffuse involvement, which also affect trunk and mucous membranes of the patient. Although the exact pathophysiological mechanisms underlying Bier spots still need to be elucidated, Bier spots have been suggested to be a vascular anomaly caused by vasoconstriction of small vessels. In addition, several diseases have been proposed to be associated with Bier spots, including scleroderma renal crisis, cryoglobulinemia, Peutz-Jeghers syndrome, alopecia areata and hypoplasia of the aorta, although it has not been shown whether these associations are casual or coincidental. The clinical presentation of Bier spots is quite typical. These tiny whitish macules easily become prominent when the affected limb is placed in a dependent position and fade away when the limb is raised. Here we report a case of Bier spots in a 32-year-old male patient with characteristical clinical manifestations.

  19. Effect of infiltration resin on the color masking of labial enamel white spot lesions%渗透树脂对前牙唇面白垩斑治疗效果的临床评价

    Institute of Scientific and Technical Information of China (English)

    冯朝华; 刘荣芳; 赵奇; 楚小玉


    Objective To evaluate the effect of infiltration resin on masking white spot lesions by assessing the change in the white spot area. Methods Seventy-four maxillary anterior teeth with post-orthodontic decalcification teeth were investi-gated in this study. All teeth were treated with infiltration resin according to manufacturer recommendation. Standardized digital images were taken before, immediately after, and one week after treatment. The results were classified into three groups: com-pletely masked, partially masked and unchanged. The images of partially masked teeth were analyzed using an image analysis software. The size of the white spot lesion (W) and the whole-tooth facial surface (T) were measured, and the W︰T ratio(%) was calculated. Statistical evaluation of the lesions was performed using Kruskal-Wallis and Mann-Whitney tests. Results Among the 74 teeth, 20 (27%) teeth were classified as completely masked and 54 (73%) teeth were classified as partially masked; no tooth was unchanged. The W︰T ratio significantly decreased from 39.28% before treatment to 9.46% after treat-ment (P<0.05). Conclusion Resin infiltration is an effective treatment for masking white spot lesion. However, the masking effect depends on the lesion depth and activity.%目的: 评价渗透树脂对白垩斑颜色的改善效果。方法 选取正畸治疗后前牙白垩斑患牙74颗进行渗透树脂治疗。术前、术后即刻、术后1周拍摄照片。效果分为3级:有效、部分有效和无效。部分有效的患牙测量术前、术后白垩斑面积(W)及患牙唇面的面积(T),计算出W︰T比值(%)。采用Kruskal-Wallis and Mann-Whitney统计方法进行分析。结果 有效的患牙20颗(27%),部分有效的患牙54颗(73%),无效的患牙0颗。部分有效的患牙术前W︰T平均值是39.28%,术后W︰T平均值是9.46%(P<0.05)。结论 渗透树脂能明显改善白垩斑患牙的美观,改善程度与患牙脱矿程度有关。



    Jacob RUB


    Money laundering is a leading factor in white-collar criminality, with a big effect upon Gross National Product of the Israeli and Moldova economies. Israel and Moldova have made the first steps In order to cope with money laundering phenomenon. The model of handling the phenomenon in the USA has been studied that constitutes a role model of fighting money laundering. The vast majority (77%) of all frauds were committed by individuals working in one of six departments: accounting, operations,...

  1. Febre maculosa das Montanhas Rochosas: ensaios negativos de transmissão experimental do virus por Triatomideos Rocky Mountain spotted fever: failure of Triatomid bugs to transmit the virus experimentally

    Directory of Open Access Journals (Sweden)

    Cornelius B. Philip


    das Montanhas Rochosas, ou retel-o em seu organismo, em estado virulento, por mais de 2 a 4 dias.1. - The following species of blood-sucking triatomids failed to transmit the virus of Rocky Mountain spotted fever to susceptible guinea pigs by feeding at the following respective time intervals after the infective feeding: Eutriatoma uhleri, 33, 47, 75, and 141 days (one bug; Triatoma protracta, 15 and 37 days (one bug; T. infestans, 8 days (15 bugs; and Rhodnius prolixus, 2 days (1 bug. The last was shown to contain virus. 2. - Mechanical transmission tests by undelayed, interrupted feedings of 3 species, T. protracta and R. prolixus, were also negative. One insect of the former species accepted 2 infective and 2 normal (test feedings, while 22 bugs of the latter species accepted alternate blood-meals one to 3 times each on infected and normal guinea pigs. 3. - Fecal droplets collected from one R. prolixus 2 days after an infected feeding failed to infect when injected into a susceptible guinea pig, although virus was shown to be present inthe bug by subsequent injection of the viscera into another test animal. 4. - The period of survival of the virus in the bugs was determined by injection of gut contents at various short intervals after infected feedings. T. infestans: Positive once a 24 hours and twice at 48 hours; negative twice at 72, 96, 120 and 192 hours each. Panstrongylus megistus: Positive 3 times at 24 hours, twice at 48 hours, and once at 72 hours; negative once each at 72 and 96 hours; tests doubtful or valueless once at 48 hours, and twice each at 72, 96 and 144 hours. R. prolixus: Positive once each at 24, 48 and 72 hours, and negative at 96 hours. 5. - From these data, involving species of 4 genera of the Triatomidae, it appears unlikely that triatomids can either transmit Rocky Mountain spotted fever by their bites, or retain virulent virus within their bodies for longer than 2 to 4 days.

  2. Real-time polymerase chain reaction optimised for hepatitis C virus detection in dried blood spots from HIV-exposed infants, KwaZulu-Natal, South Africa

    Directory of Open Access Journals (Sweden)

    Anneta Naidoo


    Full Text Available Background: There is a paucity of data on the prevalence of hepatitis C virus (HCV in children, particularly in sub-Saharan Africa. A major obstacle in resource-limited settings for polymerase chain reaction (PCR testing is the necessity for specimen transportation and storage at low temperatures. There are numerous recent studies of using real-time HCV PCR for diagnosis and screening of plasma and serum, but few have looked at using dried blood spot (DBS specimens.Objectives: The aim of this study was to optimise a real-time HCV PCR method to detect HCV RNA from infant DBS specimens for use as a tool for HCV surveillance in KwaZulu-Natal, South Africa.Method: The LightCycler® 2.0 instrument was used for the HCV PCR using the LightCycler® RNA Master SYBR Green I kit. Template volume, primer concentration and primer annealing temperatures were optimised and the method was used on 179 DBS specimens from HIV-exposed infants in KwaZulu-Natal.Results: Primer concentrations adjusted to 0.25 µM and a template volume of 10 µL improved the PCR amplification. Primer annealing temperatures lowered from 65 °C to 58 °C resulted in higher quantities of amplified PCR product. The limit of detection of the optimised HCV PCR assay was between 1200 IU/mL and 3580 IU/mL of HCV RNA. HCV was not detected in any of the 179 DBS specimens.Conclusion: The optimised real-time HCV PCR on infant DBS specimens performed well, but HCV was not found in this surveillance study. HIV infection may have little impact on the vertical transmission of HCV in this region.

  3. Virus-phytoplankton adhesion: a new WSSV transmission route to zooplankton

    Institute of Scientific and Technical Information of China (English)


    The pathogenicity of white spot syndrome virus (WSSV) to zooplankton species, rotifer Brachionus urceus (Linnaeus), copepod Acartia clausi (Giesbrecht) and mysid shrimp Neomysis awatschensis (Brandt), was estimated by immersion challenge and virus-phytoplankton adhesion route to investigate a potential new transmission route of WSSV to zooplankton. WSSV succeeded in infecting these zooplankton species and nested-PCR revealed positive results for the virus-phytoplankton adhesion route, whereas WSSV cannot infect zooplankton by immersion challenge. These results indicated that virus-phytoplankton adhesion route is a successful new transmission route of WSSV to zooplankton and also implied that phytoplankton could be a carrier in WSSV transmission.

  4. Age Spots (United States)

    ... for treating age spots include: Improved appearance. Enhanced self-esteem. Promotion of better skin health. What you need ... 480px View Render 320px View Connect with ASDS: Facebook LinkedIn YouTube Twitter Quick Links About ASDS Advocacy ...

  5. Efficacy of CMX001 as a Prophylactic and Presymptomatic Antiviral Agent in New Zealand White Rabbits Infected with Rabbitpox Virus, a Model for Orthopoxvirus Infections of Humans

    Directory of Open Access Journals (Sweden)

    Richard W. Moyer


    Full Text Available CMX001, a lipophilic nucleotide analog formed by covalently linking 3‑(hexdecyloxypropan-1-ol to cidofovir (CDV, is being developed as a treatment for smallpox. CMX001 has dramatically increased potency versus CDV against all dsDNA viruses and, in contrast to CDV, is orally available and has shown no evidence of nephrotoxicity in healthy volunteers or severely ill transplant patients to date. Although smallpox has been eliminated from the environment, treatments are urgently being sought due to the risk of smallpox being used as a bioterrorism agent and for monkeypox virus, a zoonotic disease of Africa, and adverse reactions to smallpox virus vaccinations. In the absence of human cases of smallpox, new treatments must be tested for efficacy in animal models. Here we first review and discuss the rabbitpox virus (RPV infection of New Zealand White rabbits as a model for smallpox to test the efficacy of CMX001 as a prophylactic and early disease antiviral. Our results should also be applicable to monkeypox virus infections and for treatment of adverse reactions to smallpox vaccination.

  6. The two envelope membrane glycoproteins of Tomato spotted wilt virus show differences in lectin-binding properties and sensitivities to glycosidases

    International Nuclear Information System (INIS)

    Tomato spotted wilt virus (TSWV, Genus: Tospovirus, Family: Bunyaviridae) is a major constraint to the production of several different crops of agronomic and horticultural importance worldwide. The amino acid sequence of the two envelope membrane glycoproteins, designated as GN (N-terminal) and GC (C-terminal), of TSWV contain several tripeptide sequences, Asn-Xaa-Ser/Thr, suggesting that the proteins are N-glycosylated. In this study, the lectin-binding properties of the viral glycoproteins and their sensitivities to glycosidases were examined to obtain information on the nature of potential oligosaccharide moieties present on GN and GC. The viral proteins were separated by sodium dodecyl sulphate-polyacrylamide gel electrophoresis (SDS-PAGE) and probed by affinoblotting using a battery of biotinylated lectins with specificity to different oligosaccharide structures. GC showed strong binding with five mannose-binding lectins, four N-acetyllactosamine-binding lectins and one fucose-binding lectin. GN was resolved into two molecular masses and only the slow migrating form showed binding, albeit to a lesser extent than GC, with three of the five mannose-binding lectins. The N-acetyllactosamine- and fucose-specific lectins did not bind to either molecular mass form of GN. None of the galactose-, N-acetylgalactosamine-, or sialic acid-binding lectins tested showed binding specificity to GC or GN. Treatment of the denatured virions with endoglycosidase H and peptide:N-glycosidase F (PNGase F) resulted in a significant decrease in the binding of GC to high mannose- and N-acetyllactosamine-specific lectins. However, no such differences in lectin binding were apparent with GN. These results indicate the presence of N-linked oligosaccharides of high mannose- and complex-type on GC and possibly high mannose-type on GN. Differences in the extent of binding of the two envelope glycoproteins to different lectins suggest that GC is likely to be more heavily N-glycosylated than

  7. Efficacy of one year treatment of icon infiltration resin on post-orthodontic white spots%渗透树脂治疗正畸后牙面白垩斑的一年疗效观察

    Institute of Scientific and Technical Information of China (English)

    冯朝华; 楚小玉


    To clinically evaluate the effectiveness of icon infiltration resin on masking post-orthodontic white spots. Methods; Eight post-orthodontic patients with 6 maxillary anterior teeth showing signs of decalcification (total 48 teeth) were enrolled in this study. All teeth were treated with icon resin infiltration according to manufacturer' s recommendation. Standardized digital photographs were taken before, immediately after and 1 week, 6 and 12 months after treatment. Before taking pictures the assigned teeth were cleaned using pumice and rubber polishing cups. The results were classified into three groups: completely masked, partially masked, and unchanged. Pictures of partially masked teeth were analyzed using image analysis software (Image-pro plus 6.0) , size of the white spot lesion (W) and the whole tooth facial surface (T) were measured, then W/T ratio (in % ) was calculated. The images were imported into image analysis software ( Photoshop) which presented the images into histograms of gray scale from (0 to 255). Results; Among the 48 teeth, 11 teeth (22. 9% , 11/48) were classified as completely masked, whereas 37 teeth (11. I % , 37/48) were classified as partially masked and no tooth unchanged. For partially masked teeth, W/T ratio decreased significantly after treatment from 31. 37% to 7.99% (by Wilcoxon's signed rank test, P 0. 05) in comparison to 1 week after treatment. Conclusion: Resin infiltration was proven to be an effective treatment for masking white spot lesions. The surface color of infiltrated lesions remained stable after 12 months.%目的:评价渗透树脂对正畸后牙面脱矿(白垩斑)的治疗效果及颜色稳定性.方法:对正畸治疗后6颗上颌前牙均出现脱矿的患者8名(患牙共48颗)进行渗透树脂治疗.术前、术后即刻、术后1周、6个月和12个月分别在同等条件下拍摄照片.效果分为3级:有效、部分有效和无效.部分有效的患牙测量术前、术后白垩斑(white spot,W)及


    Directory of Open Access Journals (Sweden)

    Jacob RUB


    Full Text Available Money laundering is a leading factor in white-collar criminality, with a big effect upon Gross National Product of the Israeli and Moldova economies. Israel and Moldova have made the first steps In order to cope with money laundering phenomenon. The model of handling the phenomenon in the USA has been studied that constitutes a role model of fighting money laundering. The vast majority (77% of all frauds were committed by individuals working in one of six departments: accounting, operations, sales, executive/upper management, customer service and purchasing. In Moldova, money laundering for the most part is connected to traditional forms and activities sources of illegal proceeds .Moldova is a transit country for money laundering. A money-laundering scandal is casting Moldova’s judiciary in an unfavorable light and is raising concerns about the government’s commitment to reforms needed to keep European Union integration on track. It is a need to address corruption as a national priority, and the priority of the relations between the EU and Moldova. The money laundering scandal indicates that Moldova is reluctant to wade deeply into judicial reform. In fact, the laundered of $20 billion, is an amount more than twice the size of Moldova’s GDP in 2013, and may be that it is just the tip of the iceberg, probably. White-collar criminality in Israel and Moldova means success of coping of the enforcement and judicial systems. In order to cope with this phenomenon, Israel makes its first steps. Anyway, the message must pave the way through a creation of a new model for dealing with reduction the isolated phenomenon of money laundering in both states.SPĂLAREA DE BANI, UN FENOMEN IZOLAT ŞI UN FACTOR IMPORTANT ÎN CRIMINALITATEA GULERELOR ALBE, PUNE PRACTICA JUDICIARĂ DIN REPUBLICA MOLDOVA INTR-O SITUAŢIE DIFICILĂSpălarea de bani este un factor important în criminalitatea gulerelor albe, având un efect semnificativ asupra produ-sului na

  9. Analysis of the populations genetic variability of Tagosodes orizicolus (Homoptera: Delphacidae), virus vector of the rice white leaf

    International Nuclear Information System (INIS)

    Tagosodes orizicolus (Homoptera: Delphacidae), is a monophagous insect of the rice and virus vector of the white leaf (RHBV). It is distributed in America Central, El Caribe, part of the America del Sur and in Costa Rica it is in all the producing zones of rice. The genetic variability was analyzed by means of RAPD-PCR of individuals from three populations of Costa Rica: Parrita, Guanacaste (Liberia) y San Carlos (Santa Clara), that they are found separated geographically. The technique consisted of amplifying regions at random of the genome of these insects utilizing five primers. A total of 72 polymorphic bands were obtained, that upon being analyzed statistically by means of the multivariate analysis program of numerical taxonomy could show a clear genetic distancing among said populations. The genetic distance observed in the molecular analysis can be explained for the climatic and/or geographical isolation of the populations or by the incident of Wolbachia, riquettsia that induces cytoplasmic sterility in insects. These symbionts are transmitted of generation in generation, of the mother to their offspring and they cause reproductive alterations as cytoplasmic incompatibility, parthenogenesis and feminization. The presence of Wolbachia was determined by means of transmission electronic microscopy being observed in the greasy and muscular weave of the abdomen of T. orizicolus. Rickettsias present pleomorphic morphology and form small groups, that are characterized for the presence of electrondense material semidetached to the cell wall with an interior electronlucent. Its size in transverse cuts ranged between 520 nm of length X 470 nm of width. In addition, its presence was detected by means of the amplification by PCR of the genomic DNA of the insects; a specific primer for the DNA ribosomal 16S of Wolbachia was utilized for it. A 86% of insects of the San Carlos population were positive, a 96% was determined for Guanacaste, a 37% for Parrita and a 100% for

  10. Mongolian spots

    Directory of Open Access Journals (Sweden)

    Divya Gupta


    Full Text Available Mongolian spots (MS are birthmarks that are present at birth and their most common location is sacrococcygeal or lumbar area. Lesions may be single or multiple and usually involve < 5% total body surface area. They are macular and round, oval or irregular in shape. The color varies from blue to greenish, gray, black or a combination of any of the above. The size varies from few to more than 20 centimetres. Pigmentation is most intense at the age of one year and gradually fades thereafter. It is rarely seen after the age of 6 years. Aberrant MS over occiput, temple, mandibular area, shoulders and limbs may be confused with other dermal melanocytoses and bruises secondary to child abuse, thus necessitating documentation at birth. Although regarded as benign, recent data suggest that MS may be associated with inborn errors of metabolism and neurocristopathies. Mongolian spots usually resolve by early childhood and hence no treatment is generally needed if they are located in the sacral area. However, sometimes it may be required for extrasacral lesions for cosmesis.

  11. Histophathologic and Immunohistochemical Findings in Two White-tail Deer Fawns Persistently Infected with Bovine Viral Diarrhea Virus (United States)

    Bovine viral diarrhea virus (BVDV) is an important pathogen of domestic cattle. Serological, experimental and individual case studies have explored the presence and pathogenesis of the virus in wild ungulates; however there remain large gaps in knowledge regarding BVDV infection in non-bovine speci...

  12. Pathogenesis of spring viremia of carp virus in emerald shiner Notropis atherinoides Rafinesque, fathead minnow Pimephales promelas Rafinesque and white sucker Catostomus commersonii (Lacepede). (United States)

    Misk, E; Garver, K; Nagy, E; Isaac, S; Tubbs, L; Huber, P; Al-Hussinee, L; Lumsden, J S


    Spring viremia of carp (SVC) is a reportable disease to the World Organization of Animal Health (OIE) as it is known to cause significant international economic impact. In Canada, the first and only isolation of SVC virus (SVCV) was in 2006, from common carp Cyprinus carpio L., at Hamilton Harbour, Lake Ontario. The susceptibility of fathead minnow Pimephales promelas Rafinesque, emerald shiner Notropis atherinoides Rafinesque and white sucker Catostomus commersonii (Lacepede) to intraperitoneal injection of the Canadian isolate (HHOcarp06) was evaluated using experimental infection, virus isolation, quantitative reverse transcription polymerase chain reaction (qRT-PCR), histopathology and immunohistochemistry (IHC). Emerald shiner and fathead minnow were most susceptible with 43 and 53% cumulative mortality, respectively, compared with koi at 33%. Quantitative RT-PCR demonstrated that koi had high viral loads throughout the experiment. At 34 days post-infection, SVCV was detected from sampled emerald shiner and white sucker in very low titre and was not detected from fathead minnow. Koi, fathead minnow and emerald shiner had gross lesions typical of SVC disease. The histopathological picture was mostly dominated by necrotic changes in kidney, spleen, liver, pancreas and intestine. IHC further confirmed SVCV infection, and staining was largely correlated with histological lesions. PMID:26411333

  13. Immunological-based assays for specific detection of shrimp viruses. (United States)

    Chaivisuthangkura, Parin; Longyant, Siwaporn; Sithigorngul, Paisarn


    Among shrimp viral pathogens, white spot syndrome virus (WSSV) and yellow head virus (YHV) are the most lethal agents, causing serious problems for both the whiteleg shrimp, Penaeus (Litopenaeus) vannamei, and the black tiger shrimp, Penaeus (Penaeus) monodon. Another important virus that infects P. vannamei is infectious myonecrosis virus (IMNV), which induces the white discoloration of affected muscle. In the cases of taura syndrome virus and Penaeus stylirostris densovirus (PstDNV; formerly known as infectious hypodermal and hematopoietic necrosis virus), their impacts were greatly diminished after the introduction of tolerant stocks of P. vannamei. Less important viruses are Penaeus monodon densovirus (PmDNV; formerly called hepatopancreatic parvovirus), and Penaeus monodon nucleopolyhedrovirus (PemoNPV; previously called monodon baculovirus). For freshwater prawn, Macrobrachium rosenbergii nodavirus and extra small virus are considered important viral pathogens. Monoclonal antibodies (MAbs) specific to the shrimp viruses described above have been generated and used as an alternative tool in various immunoassays such as enzyme-linked immunosorbent assay, dot blotting, Western blotting and immunohistochemistry. Some of these MAbs were further developed into immunochromatographic strip tests for the detection of WSSV, YHV, IMNV and PemoNPV and into a dual strip test for the simultaneous detection of WSSV/YHV. The strip test has the advantages of speed, as the result can be obtained within 15 min, and simplicity, as laboratory equipment and specialized skills are not required. Therefore, strip tests can be used by shrimp farmers for the pond-side monitoring of viral infection. PMID:24567913

  14. Evaluation of an immunodot test to manage white spot syndrome virus (WSSV) during cultivation of the giant tiger shrimp Penaeus monodon

    Digital Repository Service at National Institute of Oceanography (India)

    Patil, R.; Palaksha, K.J.; Anil, T.M.; Guruchannabasavanna; Patil, P.; Shankar, K.M.; Mohan, C.V.; Sreepada, R.A.

    , of Karnataka on the west coast of India. Of 12 grow-out farms in Kundapur, 6 (F1 to F6) yielded shrimp samples that were negative for WSSV by both immunodot test and 1-step PCR from stocking to successful harvest. Samples from the other 6 farms (F7 to F12) were...

  15. Planning for Rift Valley fever virus: use of geographical information systems to estimate the human health threat of white-tailed deer (Odocoileus virginianus-related transmission

    Directory of Open Access Journals (Sweden)

    Sravan Kakani


    Full Text Available Rift Valley fever (RVF virus is a mosquito-borne phlebovirus of the Bunyaviridae family that causes frequent outbreaks of severe animal and human disease in sub-Saharan Africa, Egypt and the Arabian Peninsula. Based on its many known competent vectors, its potential for transmission via aerosolization, and its progressive spread from East Africa to neighbouring regions, RVF is considered a high-priority, emerging health threat for humans, livestock and wildlife in all parts of the world. Introduction of West Nile virus to North America has shown the potential for “exotic” viral pathogens to become embedded in local ecological systems. While RVF is known to infect and amplify within domestic livestock, such as taurine cattle, sheep and goats, if RVF virus is accidentally or intentionally introduced into North America, an important unknown factor will be the role of local wildlife in the maintenance or propagation of virus transmission. We examined the potential impact of RVF transmission via white-tailed deer (Odocoileus virginianus in a typical north-eastern United States urban-suburban landscape, where livestock are rare but where these potentially susceptible, ungulate wildlife are highly abundant. Model results, based on overlap of mosquito, human and projected deer densities, indicate that a significant proportion (497/1186 km2, i.e. 42% of the urban and peri-urban landscape could be affected by RVF transmission during the late summer months. Deer population losses, either by intervention for herd reduction or by RVF-related mortality, would substantially reduce these likely transmission zones to 53.1 km2, i.e. by 89%.

  16. Investigation into the incidence and severity of white spot lesions after fixed orthodontic treatment through Medical Image J software%医学图像处理软件Image J在评估正畸固定矫治后牙釉质脱矿白斑程度中的作用

    Institute of Scientific and Technical Information of China (English)

    于海涛; 古力巴哈·买买提力; 陈文君


    Objective The purpose of this study was to investigate the incidence and the mean coverage rate of white spot lesions through medical Image J software and to evaluate the severity of enamel demineraliza-tion exactly.Methods 208 clinical digital photos of patients who received fixed orthodontic treatment and the gingival index of patients examined in oral were collected.Then the incidence and the mean coverage rate of white spot lesions of the labial surface of 8 maxillary anterior teeth were evaluated through medical Image J software.Based on the data,this paper analyzed and compared whether the white spot lesions would appear on the particular tooth positions and whether the area of the white spot lesions would be lar-ger on the particular tooth positions.Whether the difference of the incidence and the mean coverage rate of white spot lesions between different genders exist or not would be examined.Comprehensive evaluation of relationship would be carried out between the incidence and the mean coverage rate of white spot lesions and the gingival index of patients.Results The incidence of at least 1 white spot lesion on the labial sur-face of the maxillary anterior teeth was 31.3% and the average white spot lesion coverage was 8.4%.The order of incidence was lateral incisor(34.8%),canine (28.8%),premolar (26.9%),and central incisor (20.7%).It was no difference between sex .The higher the gingival index of patients was,the higher the grade of white spot lesion was.Conclusion The incidence and severity of white spot lesions on the maxil-lary anterior teeth could be evaluated effectively through medical Image J software.%目的:探讨医学图像处理软件 Image J在评估正畸固定矫治后牙釉质脱矿白斑的发生率、平均覆盖率及严重程度中的作用。方法收集208例患者完成固定正畸矫治后的临床数码照片和口内检查患者的牙龈指数,应用医学图像处理软件 Image J评估8颗上颌前牙颊面的牙釉质脱

  17. Evidence for Lettuce big-vein associated virus as the causal agent of a syndrome of necrotic rings and spots in lettuce

    NARCIS (Netherlands)

    Verbeek, M.; Dullemans, A.M.; Bekkum, van P.J.; Vlugt, van der R.A.A.


    Lettuce big-vein associated virus (LBVaV, genus Varicosavirus) was shown to be responsible for characteristic necrotic symptoms observed in combination with big-vein symptoms in lettuce breeding lines when tested for their susceptibility to lettuce big-vein disease (BVD) using viruliferous Olpidium

  18. Molecular breeding of transgenic white clover (Trifolium repens L.) with field resistance to Alfalfa mosaic virus through the expression of its coat protein gene. (United States)

    Panter, S; Chu, P G; Ludlow, E; Garrett, R; Kalla, R; Jahufer, M Z Z; de Lucas Arbiza, A; Rochfort, S; Mouradov, A; Smith, K F; Spangenberg, G


    Viral diseases, such as Alfalfa mosaic virus (AMV), cause significant reductions in the productivity and vegetative persistence of white clover plants in the field. Transgenic white clover plants ectopically expressing the viral coat protein gene encoded by the sub-genomic RNA4 of AMV were generated. Lines carrying a single copy of the transgene were analysed at the molecular, biochemical and phenotypic level under glasshouse and field conditions. Field resistance to AMV infection, as well as mitotic and meiotic stability of the transgene, were confirmed by phenotypic evaluation of the transgenic plants at two sites within Australia. The T(0) and T(1) generations of transgenic plants showed immunity to infection by AMV under glasshouse and field conditions, while the T(4) generation in an agronomically elite 'Grasslands Sustain' genetic background, showed a very high level of resistance to AMV in the field. An extensive biochemical study of the T(4) generation of transgenic plants, aiming to evaluate the level and composition of natural toxicants and key nutritional parameters, showed that the composition of the transgenic plants was within the range of variation seen in non-transgenic populations. PMID:21947755

  19. Prevalence of Taura syndrome virus (TSV and Infectious hypodermal and haematopoietic necrosis virus (IHHNV in white shrimp (Penaeus vannamei populations and susceptibility to infection of some aquatic species native to Thailand

    Directory of Open Access Journals (Sweden)

    Supamattaya, K.


    Full Text Available This study aimed to survey the prevalence of some infectious diseases e.g. Taura syndrome virus (TSV and Infectious hypodermal and haematopoietic necrosis virus (IHHNV in white shrimp (Penaeus vannamei populations and to assess the impact of such infectious agents to indigenous aquatic animals in Thailand. Samples of both larval and juvenile or adult shrimp from each region of the country were collected and screened for TSV and IHHNV using the polymerase chain reaction (PCR technique. Viruses isolated from affected shrimp were used for determine the susceptibility to infection of some aquatic species native to Thailand.A total of 163 samples of larval shrimp from hatcheries were screened. The results showed infection with TSV and IHHNV in 3.68 and 44.17%, respectively. As high as 7.32% TSV infection was detected in shrimp samples collected from the South Eastern coast, followed by the Eastern and Central regions with percentages of 5.56 and 4.53, respectively. Shrimp with the highest rate of IHHNV infection, 55.56% were collected from the Eastern region. A total of 192 samples of shrimp reared in grow-out ponds were also collected. The results showed shrimp were infected with TSV and IHHNV with percentages of 6.67 and 67.19, respectively. The highest prevalence of IHHNV (up to 90% was found in samples collected from the lower Southern region. The highest prevalence of TSV infection (11.29% was reported in shrimp from the Central region. A study of the susceptibility to TSV and IHHNV infection of some indigenous aquatic species of Thailand was also carried out. The results showed many aquatic species native to Thailand e.g. black tiger shrimp (Penaeus monodon, speckled shrimp (Metapenaeus monoceros, dwarf prawn (Macrobrachium equideus, krill (Acetes sp., mantis lobster (Chloridopsis immaculatus, freshwater prawn (Macrobrachium lanchesteri and M. rosenbergii, mangrove crab (Sesarma sp. and mud crab (Scylla serrata were susceptible to viruses and

  20. Varnish XT和ICON渗透树脂对釉质龋白斑微硬度的影响%Effect of Varnish XT and ICON resin infiltration treatment on the microhardness of white spot lesions

    Institute of Scientific and Technical Information of China (English)

    郭静; 赵晓一; 吴佩玲


    背景:早期龋的治疗方法中,可以采用氟化物对龋白斑进行再矿化处理。长效释氟玻璃离子保护膜(Varnish XT)和ICON渗透树脂是两种新型的材料,Varnish XT是一种新型的树脂加强型玻璃离子,可以作为再矿化材料的新选择。ICON渗透树脂是一种流动性较好的高渗透系数树脂,借助毛细作用渗入到脱矿釉质的微孔中,利用低黏性的渗透树脂取代由于脱矿而丧失的硬组织并占据微孔的空间,填补釉质脱矿区并阻止病损的进一步发展。目的:观察Varnish XT和ICON渗透树脂两种微创治疗材料对釉质龋白斑微硬度的影响。方法:选择牛门齿100颗,将唇面向下作为观察面,环氧树脂包埋,打磨。暴露至少6 mm×10 mm的釉质牙面,由切端至颈部依次分A,B,C,D,E 5个区,E区用抗酸指甲油封闭。分别采用人工龋脱矿液后,A区不做处理,B区经Varnish XT处理,C区经ICON渗透树脂处理,D区经氟化物处理后,用韦氏硬度仪测量表面显微硬度值。结果与结论:脱矿样本经处理后A,B,C,D区的表面显微硬度值较E区均明显降低(P B区、D区(P 0.05)。说明ICON渗透树脂、Varnish XT和氟化物对龋白斑的微硬度都有明显的改善,ICON渗透树脂的改善较Varnish XT和氟化物明显,Varnish XT和氟化物之间无明显差异。%BACKGROUND:In the treatment of early caries, fluoride can be used for remineralization of white spot lesions. Varnish XT (durable fluoride-releasing coating) and ICON penetration resins are two new materials. Varnish XT as a new type of resin reinforced glass ionomer can be selected as mineralized material. ICON penetration resin is a high-permeability resin with good liquidity that can infiltrate by capilary action into the pores created by enamel demineralization. Low-viscosity resin is used to replace the lost hard tissue due to demineralization and occupy the micropores, so as

  1. Scientific Opinion on the risk to plant health posed by Tomato spotted wilt virus to the EU territory with identification and evaluation of risk reduction options

    Directory of Open Access Journals (Sweden)

    EFSA Panel on Plant Health (PLH


    Full Text Available The Panel on Plant Health conducted a pest risk assessment for Tomato spotted wilt virus (TSWV including the identification and evaluation of risk reduction options. The plants for planting pathway is considered the most important one and rated as likely, with medium uncertainty. TSWV, reported in many Member States, has one of the widest host range for plant viruses and has three widely distributed thrips vector species in the risk assessment area. For countries falling under the provisions of 2000/29/EC Annex IIAII legislation, the probability of establishment is rated as very likely, with low uncertainty. For Finland and Sweden, protected zone under the 2000/29/EC Annex IB legislation, the probability of establishment is rated unlikely to moderately likely. Spread can occur through the activity of thrips vectors and through trade of infected hosts. The probability of spread in Member States under Annex IIAII provisions is evaluated as likely, with low uncertainty. In Finland and Sweden, spread is rated as unlikely to moderately likely, with medium uncertainty. Since TSWV may cause both yield and quality losses in a wide range of hosts, a major impact is predictable in the absence of appropriate control measures, with medium uncertainty. The risk reduction options evaluated by the Panel are those addressing either the sanitary status of the propagation material (including the provisions of 2000/29/EC Annex IIAII and Annex IB, statutory certification system and the use of voluntary industry standards or those addressing the control of TSWV epidemic development through actions directed at the virus or at its vectors (including cultural methods to reduce crop infestation and chemical or biological control of thrips vectors. Limitations of the current measures and the potential consequences of repealing the current legislation are discussed.

  2. Presence and Distribution of Tobacco Viruses in Montenegro


    Jelena Zindović; Nataša Dukić; Aleksandra Bulajić; Jelena Latinović; Ivana Đekić; Bojan Duduk; Branka Krstić


    Seven important tobacco viruses were investigated in Montenegro in 2005: Tobacco Mosaic Virus (TMV), Tomato Spotted Wilt Virus (TSWV), Cucumber Mosaic Virus (CMV), Potato Virus Y (PVY), Alfalfa Mosaic Virus (AMV), Tobacco Ring Spot Virus (TRSV) and Potato Virus X(PVX). This investigation included sample collection from four tobacco growing regions in Montenegro and their serological testing by DAS-ELISA test. Presence of different strains of PVY was investigated as well using DAS ELISA test w...

  3. H9N2 Influenza A Virus Isolated from a Greater White-Fronted Wild Goose (Anser albifrons) in Alaska Has a Mutation in the PB2 Gene, Which Is Associated with Pathogenicity in Human Pandemic 2009 H1N1. (United States)

    Reeves, Andrew B; Ip, Hon S


    We report here the genomic sequence of an H9N2 influenza A virus [A/greater white-fronted goose/Alaska/81081/2008 (H9N2)]. This virus shares ≥99.8% identity with a previously reported virus. Both strains contain a G590S mutation in the polymerase basic 2 (PB2) gene, which is a pathogenicity marker in the pandemic 2009 H1N1 virus when combined with R591. PMID:27587808

  4. [Genetic characterization of the Sakhalin virus (SAKV), Paramushir virus (PMRV) (Sakhalin group, Nairovirus, Bunyaviridae), and Rukutama virus (RUKV) (Uukuniemi group, Phlebovirus, Bunyaviridae) isolated from the obligate parasites of the colonial sea-birds ticks Ixodes (Ceratixodes) uriae, White 1852 and I. signatus Birulya, 1895 in the water area of sea of the Okhotsk and Bering sea]. (United States)

    L'vov, D K; Al'khovskiĭ, S V; Shchelkanov, M Iu; Shchetinin, A M; Deriabin, P G; Aristova, V A; Gitel'man, A K; Samokhvalov, E I; Botikov, A G


    Full-length genomes of the Sakhalin virus (SAKH) and Paramushir virus (PRMV) (Sakhalin group, Nairovirus, Bunyaviridae) isolated from the ticks Ixodes uriae White 1852 were sequenced using the next-generation sequencing (Genbank ID: KF801659, KF801656). SAKV and PRMV have 81% identity for the part of RNA-dependent RNA-polymerase (RdRp) on the nucleotide level and 98.5% on the amino acid level. Full-length genome comparison shows that SAKV have, in average, from 25% (N-protein, S-segment) to 50% (RdRp, L-segment) similarity with the nairoviruses. The maximum value of the amino acid similarity (50.3% for RdRp) SAKV have with the Crimean-Congo hemorrhagic fever virus (CCHFV) and Dugbe virus (DUGV), which are also associated with the Ixodidae ticks. Another virus studied is Rukutama virus (RUKV) (isolated from ticks I. signatus Birulya, 1895) that recently was classified (based on morphology and antigenic reaction) to the Nairovirus genus, presumably to the Sakhalin group. In this work the genome of the RUKV was sequenced (KF892052-KF892054) and RUKV was classified as a member of the Uukuniemi group (Phlebovirus, Bunyaviridae). RUKV is closely related (93.0-95.5% similarity) with our previously described Komandory virus (KOMV). RUKV and KOMV form separate phylogenetic line neighbor of Manawa virus (MWAV) isolated from the ticks Argas abdussalami Hoogstraal et McCarthy, 1965 in Pakistan. The value of the similarity between RUCV and MWAV is 65-74% on the amino acid level. PMID:25335413

  5. Presence and Distribution of Tobacco Viruses in Serbia


    Nataša Duduk; Aleksandra Bulajić; Janoš Berenji; Ivana Đekić; Bojan Duduk; Branka Krstić


    Infection with a large number of plant viruses could imperil tobacco yield and quality. Tobacco is a natural host for more than 20 viruses, among which the most important and economically harmful are tobacco mosaic virus (TMV), tomato spotted wilt virus (TSWV), cucumber mosaic virus (CMV), potato virus Y (PVY), alfalfa mosaic virus (AMV), tobacco ringspot virus (TRSV), tobacco each virus (TEV) and tobacco vein mottling virus (TVMV).The occurence and distribution of tobacco viruses were invest...

  6. Characterization of the yeast form symbiant of Togosodes orizicolus (Hemiptera: delphacidae), vector of the rice white leaf virus

    International Nuclear Information System (INIS)

    The purpose of this investigation was to characterize the yeast forms symbionts of Togo soles Orizicolus (YLSTo), through its morphologic description and locating in situ through microscopy of light, electronic microscopy of transmission and of sweeping and immuno microscopy. Likewise, molecular tests were carried out to classify phylogenetically the symbionts, utilizing partial sequences of the ribosomal DNA 18S. This study will permit to determine, the existence or not of interactions among the YLSTo and the insect vector, in the future. The paper of that interaction in the mechanism of trans ovarial transmission of the virus and the search of alternatives for the control of the disease in the rice. (S. Grainger)

  7. Standardized RT-PCR conditions for detection and identification of eleven viruses of potato and Potato spindle tuber viroid (United States)

    Standardized RT-PCR procedures were developed and validated for detection of Alfalfa mosaic virus (AMV), Impatiens necrotic spot virus (INSV), Tobacco rattle virus (TRV), Tomato spotted wilt virus (TSWV), Potato leaf roll virus (PLRV), Potato mop top virus (PMTV), Potato virus A (PVA), Potato viru...

  8. Rocky Mountain spotted fever (United States)

    ... page: // Rocky Mountain spotted fever To use the sharing features on this page, please enable JavaScript. Rocky Mountain spotted fever is a disease caused by a ...

  9. Role of Oxalis corniculata L. as plant virus reservoir with special regard to Tomato Spotted Wilt Virus (TSWV-RB) strain occurrence in rock-wool cultivation in Hungary


    Hodi, Anna Maria; Bese, Gabor; Hodi, Laszlo; Palkovics, Laszlo


    The creeping wood sorrel (Oxalis corniculata L.) in Central Europe occurs mainly in anthropogenic areas, where it grows in parks and landfill sites or in protected cultivation sites like greenhouses and nurseries. In Hungary O. corniculata has been spreading since the 19th century. In glass- and greenhouses it is the only weed species that was able to settle and flourish on hydroponic rock-wool and coconut fibre growing media. Among virus pathogens of forced tomato (LYPES) and paprika crops (...

  10. SpotADAPT

    DEFF Research Database (Denmark)

    Kaulakiene, Dalia; Thomsen, Christian; Pedersen, Torben Bach;


    Amazon Web Services (AWS). The users aiming for the spot market are presented with many instance types placed in multiple datacenters in the world, and thus it is difficult to choose the optimal deployment. In this paper, we propose the framework SpotADAPT (Spot-Aware (re-)Deployment of Analytical...... Processing Tasks) which is designed to help users by first, estimating the workload execution time on different AWS instance types, and, second, proposing the deployment (i.e., specific availability zone, instance type, pricing model) aligned with user-provided optimization goals (fastest or cheapest...... execution within boundaries). Moreover, during the execution of the workload, SpotADAPT suggests a redeployment if the current spot instance gets terminated by Amazon or a better deployment becomes possible due to fluctuations of the spot prices. The approach is evaluated using the actual execution times of...

  11. Combining rapid diagnostic tests and dried blood spot assays for point-of-care testing of human immunodeficiency virus, hepatitis B and hepatitis C infections in Burkina Faso, West Africa. (United States)

    Kania, D; Bekalé, A M; Nagot, N; Mondain, A-M; Ottomani, L; Meda, N; Traoré, M; Ouédraogo, J B; Ducos, J; Van de Perre, P; Tuaillon, E


    People screened for human immunodeficiency virus (HIV) using rapid diagnostic tests (RDTs) in Africa remain generally unaware of their status for hepatitis B (HBV) and hepatitis C (HCV) infections. We evaluated a two-step screening strategy in Burkina Faso, using both HIV RDTs and Dried Blood Spot (DBS) assays to confirm an HIV-positive test, and to test for HBV and HCV infections. HIV counselling and point-of-care testing were performed at a voluntary counselling and testing centre with HBV, HCV status and HIV confirmation using DBS specimens, being assessed at a central laboratory. Serological testing on plasma was used as the reference standard assay to control for the performance of DBS assays. Nineteen out of 218 participants included in the study were positive for HIV using RDTs. A fourth-generation HIV ELISA and immunoblot assays on DBS confirmed HIV status. Twenty-four out of 25 participants infected with HBV were found positive for hepatitis B surface antigen (HBsAg) using DBS. One sample with a low HBsAg concentration on plasma was not detected on DBS. Five participants tested positive for HCV antibodies were confirmed positive with an immunoblot assay using DBS specimens. Laboratory results were communicated within 7 days to participants with no loss to follow up of participants between the first and second post-test counselling sessions. In conclusion, DBS collection during HIV point-of-care testing enables screening and confirmation of HBV, HCV and HIV infections. Diagnosis using DBS may assist with implementation of national programmes for HBV, HCV and HIV screening and clinical care in middle- to low-income countries. PMID:23902574

  12. What's West Nile Virus? (United States)

    ... Help White House Lunch Recipes What's West Nile Virus? KidsHealth > For Kids > What's West Nile Virus? Print A A A Text Size en español ¿Qué es el Virus del Nilo Occidental? What exactly is the West ...

  13. Watermarking spot colors (United States)

    Alattar, Osama M.; Reed, Alastair M.


    Watermarking of printed materials has usually focused on process inks of cyan, magenta, yellow and black (CMYK). In packaging, almost three out of four printed materials include spot colors. Spot colors are special premixed inks, which can be produced in a vibrant range of colors, often outside the CMYK color gamut. In embedding a watermark into printed material, a common approach is to modify the luminance value of each pixel in the image. In the case of process color work pieces, the luminance change can be scaled to the C, M, Y and K channels using a weighting function, to produce the desired change in luminance. In the case of spot color art designs, there is only one channel available and the luminance change is applied to this channel. In this paper we develop a weighting function to embed the watermark signal across the range of different spot colors. This weighting function normalizes visibility effect and signal robustness across a wide range of different spot colors. It normalizes the signal robustness level over the range of an individual spot color"s intensity levels. Further, it takes into account the sensitivity of the capturing device to the different spot colors.

  14. Investigation of likely causes of white patch formation on irradiated WWER fuel rod claddings

    International Nuclear Information System (INIS)

    The information concerning white patches observed on fuel cladding surfaces has been analytically treated. The analysis shows at least three kinds of the white patch appearance: bright white spots which appear to be loose corrosion product deposits disclosing corrosion pits upon spalling; indistinct streaks with separate pronounced spots 1-2 in dia. The spots seem to be thin superficial deposits; light-coloured dense uniform crud distributed over the surface of fuel claddings and fuel assembly jackets. (author)

  15. Mononucleosis spot test (United States)

    Monospot test; Heterophile antibody test; Heterophile agglutination test; Paul-Bunnell test; Forssman antibody test ... The mononucleosis spot test is done when symptoms of mononucleosis are ... Fatigue Fever Large spleen (possibly) Sore throat Tender ...

  16. Spotted Seal Distribution Map (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains GIS layers that depict the known spatial distributions (i.e., ranges) and reported breeding areas of spotted seals (Phoca largha). It was...

  17. Reactor hot spot analysis

    Energy Technology Data Exchange (ETDEWEB)

    Vilim, R.B.


    The principle methods for performing reactor hot spot analysis are reviewed and examined for potential use in the Applied Physics Division. The semistatistical horizontal method is recommended for future work and is now available as an option in the SE2-ANL core thermal hydraulic code. The semistatistical horizontal method is applied to a small LMR to illustrate the calculation of cladding midwall and fuel centerline hot spot temperatures. The example includes a listing of uncertainties, estimates for their magnitudes, computation of hot spot subfactor values and calculation of two sigma temperatures. A review of the uncertainties that affect liquid metal fast reactors is also presented. It was found that hot spot subfactor magnitudes are strongly dependent on the reactor design and therefore reactor specific details must be carefully studied. 13 refs., 1 fig., 5 tabs.

  18. Arc cathode spots

    International Nuclear Information System (INIS)

    Arc spots are usually highly unstable and jump statistically over the cathode surface. In a magnetic field parallel to the surface, preferably they move in the retrograde direction; i.e., opposite to the Lorentzian rule. If the field is inclined with respect to the surface, the spots drift away at a certain angle with respect to the proper retrograde direction (Robson drift motion). These well-known phenomena are explained by one stability theory

  19. Development of a Liquid Chip Technique to Simultaneously Detect Taura Syndrome Virus( TSV) and Yellow Head Disease Virus( YHDV)

    Institute of Scientific and Technical Information of China (English)

    Yin; Weili; Zhang; Sihua; Yue; Zhiqin; Zheng; Xiaolong; Liu; Hong


    The aim is to develop a liquid chip technique to detect Taura syndrome virus( TSV) and yellow head disease virus( YHDV) on Penaeus orientalis simultaneously. The CP2 gene of TSV and N gene of YHDV in Gen Bank was analysed by using the software DNAStar 7. 0 to design the TSV-and YHDV-specific primers. The primers were labeled with biotin and subjected to amination modification. They were then coupled with fluorescence-coded microspheres and then used for hybridization with RT- PCR products of TSV and YHDV. The liquid chip detection technique for detection of TSV and YHDV was established by using BD FACSArray to detect fluorescence signal in the reaction system. This assay system had a high sensitivity to TSV and YHDV,with the detection of limit of 100 pg. Moreover,the assay was specific for the detection of TSV,YHDV and was not susceptible to cross with other viruses,including white spot syndrome virus( WSSV),spring viremia of carp virus( SVCV),infectious haematopoietic necrosis virus( IHNV). In conclusion,the liquid chip assay technique established in this study is highly sensitive and specific to TSV and YHDV detection. Moreover,it provides a novel,convenient and rapid approach for the detection of TSV and YHDV.

  20. PPR Great Red Spot Temperature Map (United States)


    This map shows temperature for the region around Jupiter's Great Red Spot and an area to the northwest. It corresponds to a level in Jupiter's atmosphere where the pressure is 1/2 of the of the Earth's at sea level (500 millibars), the same as it is near 6000 meters (20,000 feet) above sea level on Earth. The center of Great Red Spot appears colder than the surrounding areas, where air from below is being brought up. The 'panhandle' to the northwest is warmer and drier, and the gases there are descending, so it is much clearer of clouds. Compare this map to one released earlier at a higher place in the atmosphere (250 millibars or 12000 meters). The center of the Great Red Spot is warmer lower in the atmosphere, and a white 'hot spot' appears in this image that is not present at the higher place. This map was made from data taken by the Photopolarimeter/Radiometer (PPR) instrument on June 26, 1996.Launched in October 1989, Galileo entered orbit around Jupiter on December 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet, its largest moons and the Jovian magnetic environment.JPL manages the Galileo mission for NASA's Office of Space Science, Washington, D.C.This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL

  1. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae transmitted virus Mancha clorótica do Clerodendrum, uma enfermidade causada por um vírus do tipo nuclear, transmitido pelo ácaro Brevipalpus phoenicis (Acari:Tenuipalpidae

    Directory of Open Access Journals (Sweden)

    Elliot Watanabe Kitajima


    Full Text Available Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae mite-transmitted viruses (BTrV. Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi and Tetragonia expansa causing chlorotic spots on their leaves. Mechanical inoculation using leaf extracts from infected C. x speciosum resulted in chlorotic spots on inoculated C. x speciosum, Chenopodium quinoa, C. amaranticolor, G. globosa, H. cannabinus, H. coccineus and T. expansa leaves. C. amaranticolor and C. quinoa kept at 28 - 30°C became systemically infected. The same cytopathic effects caused by the nuclear type of BTrV were seen in tissues from all infected test plants by electron microscopy. The virus was purified from systemically infected leaves of C. amaranticolor and C. quinoa. A polyclonal antiserum obtained from an immunized rabbit presented a strong reaction with the homologous antigen in ELISA tests. The results suggest that this chlorotic spot disease of C. x speciosum is caused by a new species of the nuclear type of BTrV, tentatively named Clerodendrum chlorotic spot virus (ClCSV.Manchas cloróticas e necróticas foram observadas em folhas de várias plantas de coração-sangrento (Clerodendrum x speciosum cultivadas em parques e jardins em Piracicaba, SP, associadas à infestação pelo ácaro tenuipalpídeo Brevipalpus phoenicis. Exames preliminares de secções de tecido das manchas cloróticas ao microscópio eletrônico revelaram a ocorrência de efeitos citopáticos característicos dos induzidos pelos vírus do tipo nuclear, transmitido

  2. Alightment of Spotted Wing Drosophila (Diptera: Drosophilidae) on Odorless Disks Varying in Color


    Kirkpatrick, D. M.; McGhee, P. S.; Hermann, S. L.; Gut, L. J.; Miller, J. R.


    Methods for trapping spotted wing drosophila, Drosophila suzukii (Matsmura) (Diptera: Drosophilidae), have not yet been optimized for detecting this devastating pest of soft-skinned fruits. Here, we report outcomes of choice and no-choice laboratory bioassays quantifying the rates of spotted wing drosophila alightment on 5-cm-diameter sticky disks of various colors, but no fruit odors. Red, purple, and black disks captured the most spotted wing drosophila when presented against a white backgr...

  3. A possible dominant white gene in Jersey cattle

    Directory of Open Access Journals (Sweden)

    Sponenberg D Phillip


    Full Text Available Abstract A white heifer ("Snow" was born in 1991 from coloured registered Jersey parents. She produced six calves sired by coloured Jersey bulls: three white bull calves, two white heifer calves, and one coloured bull calf. One of the white bull calves was mated with 40 Hereford × Friesian yearling heifers (white face, predominantly black body with some white patches. The 38 resulting calves included 16 white and 22 coloured calves. Twelve of the 16 white calves were heifers and four were bulls. Red or black spotting was recorded on some white calves. The results are consistent with an autosomal dominant mutant causing the white phenotype. The mutation appears to have arisen spontaneously in Snow, then passing to her white progeny and white grand-progeny. The white individuals varied from entirely white in a few cases, to most having some residual small areas of red or black pigmentation in patterns not typical of other reported white spotting patterns of cattle.

  4. A New Definition of Virus

    Institute of Scientific and Technical Information of China (English)

    HE Hongjun; CAO Sihua; LUO Li; FENG Tao; PAN Li; ZOU Zhiji


    Security experts have not formally defined the distinction between viruses and normal programs. The paper takes user's intension as the criteria for malice, gives a formal definition of viruses that aim at stealing or destroying files, and proposes an algorithm to detect virus correctly. Compared with traditional definitions, this new definition is easy to understand, covers more malwares, adapts development of virus technology, and defines virus on the spot. The paper has also analyzed more than 250 real viruses and finds that they are all in the domain of the new definition, this implies that the new definition has great practical significance.

  5. Identification of Potato Virus Y Strains in Tobacco Crops


    Jelena Zindović; Janoš Berenji; Milena Pauković; Ivana Đekić; Aleksandra Bulajić; Branka Krstić


    Five viruses: Potato Virus Y (PVY), Tomato Spotted Wilt Virus, Cucumber Mosaic Virus, Tobacco Mosaic Virus and Alfalfa Mosaic Virus, of which PVY was predominant, were detected by serological testing of tobacco samples collected from many localities in Vojvodina in 2006. Viruses are the most important pathogens in tobacco and PVY causes considerable economic damages all over the world. A PVY population comprises several different strain groups, strain subgroups and recombinant strains. Among ...

  6. Meteorology of Jupiter's Equatorial Hot Spots and Plumes from Cassini (United States)

    Choi, David Sanghun; Showman, Adam P.; Vasavada, Ashwin R.; Simon-Miller, Amy A.


    We present an updated analysis of Jupiter's equatorial meteorology from Cassini observations. For two months preceding the spacecraft's closest approach, the Imaging Science Subsystem (ISS) onboard regularly imaged the atmosphere. We created time-lapse movies from this period in order to analyze the dynamics of equatorial hot spots and their interactions with adjacent latitudes. Hot spots are relatively cloud-free regions that emit strongly at 5 lm; improved knowledge of these features is crucial for fully understanding Galileo probe measurements taken during its descent through one. Hot spots are quasistable, rectangular dark areas on visible-wavelength images, with defined eastern edges that sharply contrast with surrounding clouds, but diffuse western edges serving as nebulous boundaries with adjacent equatorial plumes. Hot spots exhibit significant variations in size and shape over timescales of days and weeks. Some of these changes correspond with passing vortex systems from adjacent latitudes interacting with hot spots. Strong anticyclonic gyres present to the south and southeast of the dark areas appear to circulate into hot spots. Impressive, bright white plumes occupy spaces in between hot spots. Compact cirrus-like 'scooter' clouds flow rapidly through the plumes before disappearing within the dark areas. These clouds travel at 150-200 m/s, much faster than the 100 m/s hot spot and plume drift speed. This raises the possibility that the scooter clouds may be more illustrative of the actual jet stream speed at these latitudes. Most previously published zonal wind profiles represent the drift speed of the hot spots at their latitude from pattern matching of the entire longitudinal image strip. If a downward branch of an equatorially-trapped Rossby wave controls the overall appearance of hot spots, however, the westward phase velocity of the wave leads to underestimates of the true jet stream speed.

  7. Correlation between circulating white blood cell counts and level of protective immune response against bovine viral diarrhea virus elicited by a modified live vaccine (United States)

    Two trials (T1 and T2) were conducted to examine the range of responses elicited against bovine viral diarrhea virus (BVDV) by vaccination with modified live vaccine and to determine the level of response required for prevention of clinical disease. For T1, BVDV neutralizing (BVDV VN) titers were de...

  8. Sequence comparison and trasmission of Blackcurrant reversion virus isolates in black, red and white currants with black currant reversion disease and full blossom disease symptoms

    Czech Academy of Sciences Publication Activity Database

    Přibylová, Jaroslava; Špak, Josef; Petrzik, Karel; Kubelková, Darina; Špaková, Vlastimila


    Roč. 121, č. 1 (2008), s. 67-75. ISSN 0929-1873 R&D Projects: GA MŠk 1P05OC051 Institutional research plan: CEZ:AV0Z50510513 Keywords : plant diseases * reversion virus * Sequence comparison Subject RIV: EE - Microbiology, Virology Impact factor: 1.648, year: 2008

  9. Measuring microfocal spots using digital radiography

    Energy Technology Data Exchange (ETDEWEB)

    Fry, David A [Los Alamos National Laboratory; Ewert, Uwe [BAM


    Measurement of microfocus spot size can be important for several reasons: (1) Quality assurance during manufacture of microfocus tubes; (2) Tracking performance and stability of microfocus tubes; (3) Determining magnification is especially important for digital radiography where the native spatial resolution of the digital system is not adequate for the application; and (4) Knowledge of unsharpness from the focal spot alone. The European Standard EN 12543-5 is based on a simple geometrical method of calculating focal spot size from unsharpness of high magnification film radiographs. The following equations are used for the focal spot size measurement: By similar triangles the following equations are presupposed: f/a = U/b and M = (a+b)/a. These equations can be combined to yield the well known expression: U = f(M - 1). Solving for f, f = U/(M-1). Therefore, the focal spot size, f, can be calculated by measuring the radiographic unsharpness and magnification of a known object. This is the basis for these tests. The European standard actually uses one-half of the unsharpness (which are then added together) from both sides of the object to avoid additional unsharpness contributions due to edge transmission unsharpness of the round test object (the outside of the object is measured). So the equation becomes f = (1/2 U{sub 1} + 1/2 U{sub 2})/(M-1). In practice 1/2 U is measured from the 50% to the 90% signal points on the transition profile from ''black'' to ''white,'' (positive image) or attenuated to unattenuated portion of the image. The 50% to 90% points are chosen as a best fit to an assumed Gaussian radiation distribution from the focal spot and to avoid edge transmission effects. 1/2 U{sub 1} + 1/2 U{sub 2} corresponds about to the full width at half height of a Gaussian focal spot. A highly absorbing material (Tungsten, Tungsten Alloy, or Platinum) is used for the object. Either wires or a sphere are used as the object to

  10. Spotting a fake

    International Nuclear Information System (INIS)

    Diamonds are highly prized for their dazzling appearance and hardness, but would you be able to spot one that had been created in the laboratory? Simon Lawson describes how physics-based techniques can distinguish between natural and synthetic stones. For the last 50 years or so we have been able to make synthetic diamonds that replicate the superlative physical and chemical properties of natural diamonds, and these are used largely for industrial applications. But in the mind of the consumer, there is far more to a diamond than its hardness or brilliance. Research commissioned by the Diamond Trading Company (DTC) has shown that 94% of women surveyed prefer natural diamonds over synthetic ones as a symbol of love, possibly as a result of the immense age of natural stones. One of the key research activities at the DTC is therefore to ensure that synthetic diamonds can be spotted easily. (U.K.)

  11. Poisson Spot with Magnetic Levitation (United States)

    Hoover, Matthew; Everhart, Michael; D'Arruda, Jose


    In this paper we describe a unique method for obtaining the famous Poisson spot without adding obstacles to the light path, which could interfere with the effect. A Poisson spot is the interference effect from parallel rays of light diffracting around a solid spherical object, creating a bright spot in the center of the shadow.

  12. Flying spot scanner

    International Nuclear Information System (INIS)

    An improved flying spot x-ray scanning equipment is described which includes a grid controlled x-ray tube and associated collimators for producing a pencil beam of x-rays. It is possible to control the position of the scan field relative to the patient, to control the width of the scan field and also to independently achieve an arbitary variation in the longitudinal dimension of the scan field. (U.K.)

  13. Spot- Zombie Filtering System

    Directory of Open Access Journals (Sweden)

    Arathy Rajagopal


    Full Text Available A major security challenge on the Internet is the existence of the large number of compromised machines. Such machines have been increasingly used to launch various security attacks including spamming and spreading malware, DDoS, and identity theft. These compromised machines are called "Zombies". In general E-mail applications and providers uses spam filters to filter the spam messages. Spam filtering is a technique for discriminating the genuine message from the spam messages. The attackers send the spam messages to the targeted machine by exalting the filters, which causes the increase in false positives and false negatives. We develop an effective spam zombie detection system named SPOT by monitoring outgoing messages of a network. SPOT focuses on the number of outgoing messages that are originated or forwarded by each computer on a network to identify the presence of Zombies. SPOT is designed based on a powerful statistical tool called Sequential Probability Ratio Test, which has bounded false positive and false negative error rates.

  14. Spot- Zombie Filtering System

    Directory of Open Access Journals (Sweden)

    Arathy Rajagopal


    Full Text Available A major security challenge on the Internet is the existence of the large number of compromised machines. Such machines have been increasingly used to launch various security attacks including spamming and spreading malware, DDoS, and identity theft. These compromised machines are called “Zombies”. In general E-mail applications and providers uses spam filters to filter the spam messages. Spam filtering is a technique for discriminating the genuine message from the spam messages. The attackers send the spam messages to the targeted machine by exalting the filters, which causes the increase in false positives and false negatives. We develop an effective spam zombie detection system named SPOT by monitoring outgoing messages of a network. SPOT focuses on the number of outgoing messages that are originated or forwarded by each computer on a network to identify the presence of Zombies. SPOT is designed based on a powerful statistical tool called Sequential Probability Ratio Test, which has bounded false positive and false negative error rates.

  15. 闽南近海条纹斑竹鲨的求偶、交配和产卵行为%The Spousing, Mating and Reproductive Behavior of the White-spotted Bamboo Shark (Chiloscyllium plagiosum) from South Fujian Coastal Waters

    Institute of Scientific and Technical Information of China (English)

    陈林; 陈明茹; 杨圣云


    The captive white-spotted bamboo sharks were kept to observe their courting, mating and spawning behavior, and their mating and reproductive behavior were discussed. The courtship and copulation process of the white-spotted bamboo shark can be divided into four parts:cruising,bend of male's clasper,copulation and extract of male's clasper. Cruising took most of the time of the whole process. After the mating information was confirmed between the male and the female, the clasper of the male began to bend and then they copulated. After the copulation, the clasper was extracted from the cloaca of the female. When the female ovulated, she rubbed her abdomen with pipes , stub in order to speed up the deposition process. After the egg case deposited out of the body , the female held it in the mauth circling around the pipes , stubs or stones , finally,the egg cases were entangled firmly with them by tendrils.The time of the female deposited was not fixed,which most happened at night and in the day occasionally. The female produced two eggs at most time,one occasionally. Deposition of eggs extended for 60 days or so and the eggs were produced every 7 to 9 days. One female produced 11 eggs on average in a single breeding season with the parent-fish sex ratio of keeping was 2 : 1(♂: ♀ ).%观察和记录了条纹斑竹鲨(Chiloscyllium plagiosum)在圈养条件下求偶、交配和产卵的过程,并就鲨鱼的交配和生殖行为进行了讨论.条纹斑竹鲨的求偶和交配过程可以分为游弋、雄性鳍脚弯曲、雌雄交配和雄性鳍脚抽离4部分.游弋在整个过程中占的时间最长,雌、雄鱼在确认交配信息后,雄鱼鳍脚发生弯曲;随后不久,进行交配;交配完毕后,雄鱼鳍脚便抽离雌鱼泄殖腔.条纹斑竹鲨产卵时,雌鱼腹部持续地磨擦或挤压水池中的水管和木桩等物体从而加快排卵的速度.卵鞘从体内排出后,雌鱼用口叼住卵鞘绕着水管、树桩和石头等来回游动,利用

  16. China White

    DEFF Research Database (Denmark)

    Arnoldi, Jakob; Lash, Scott


    ’. We maintain a distinction, with White and with Frank Knight, of risk, on the one hand, and uncertainty, on the other, where ‘risk’ has to do with entities that are in principle insurable or calculable and ‘uncertainty’ has to do with what is not calculable/insurable. An entrepreneur’s decision...... to enter a market, to invest in and enter a production market, entails what White calls a ‘commitment to facilities’. This, for White and Knight, is inherently incalculable, and hence uncertain....

  17. The Spotting Distribution of Wildfires

    Directory of Open Access Journals (Sweden)

    Jonathan Martin


    Full Text Available In wildfire science, spotting refers to non-local creation of new fires, due to downwind ignition of brands launched from a primary fire. Spotting is often mentioned as being one of the most difficult problems for wildfire management, because of its unpredictable nature. Since spotting is a stochastic process, it makes sense to talk about a probability distribution for spotting, which we call the spotting distribution. Given a location ahead of the fire front, we would like to know how likely is it to observe a spot fire at that location in the next few minutes. The aim of this paper is to introduce a detailed procedure to find the spotting distribution. Most prior modelling has focused on the maximum spotting distance, or on physical subprocesses. We will use mathematical modelling, which is based on detailed physical processes, to derive a spotting distribution. We discuss the use and measurement of this spotting distribution in fire spread, fire management and fire breaching. The appendix of this paper contains a comprehensive review of the relevant underlying physical sub-processes of fire plumes, launching fire brands, wind transport, falling and terminal velocity, combustion during transport, and ignition upon landing.

  18. Immune response to Newcastle disease virus vaccine, fowl-pox vaccine, and Escherichia coli vaccine in Bedouin and White Leghorn chickens. (United States)

    Heller, D; Soller, M; Peleg, B A; Ron-Kuper, N; Hornstein, K


    Immune response to Newcastle disease virus (NDV) vaccine, fowl pox, and E. coli vaccine was compared in the native Bedouin fowl of the Sinai desert, in a commercial Leghorn layer strain, and in the reciprocal crosses between them. Differences were not found in antibody titer levels to attenuated or inactivated NDV vaccines, in the proportion of birds showing post-vaccination immunity to fowl pox, or in the kinetics of postvaccination NDV titer levels. Rate of development of titer to Escherichia coli from day 1 to day 4, however, was significantly more rapid in Bedouin chicks than in the purebred Leghorn or the reciprocal crosses. PMID:6262741

  19. Identification of potential hot spots in the carboxy-terminal part of the Epstein-Barr virus (EBV) BNLF-1 gene in both malignant and benign EBV-associated diseases

    DEFF Research Database (Denmark)

    Sandvej, K; Peh, S C; Andresen, B S; Pallesen, G


    In this study, we have sequenced the C-terminal part of the Epstein-Barr virus (EBV)-BNLF-1 gene encoding for the latent membrane protein-1 from tissues of EBV-positive Danish Hodgkin's disease (HD) and of Danish and Malaysian peripheral T-cell lymphomas (PTLs) and from tonsils of Danish infectious...

  20. White Lies

    Institute of Scientific and Technical Information of China (English)



    Lillian Carter, the President s mother, once set up an interview with an aggressive reporter without benefitfrom the press office. "Your son," the reporter said, "has been travelling the country, telling people not to vote for him if he everlies to them. Can you, knowing a son as only a mother can, honestly say he s never lied?" "Well, perhaps a little white lie now and then," Mrs. Carter replied. "And what," retorted the reporter, "is the difference between a white lie and any other? Define a whi...

  1. European Whiteness?

    DEFF Research Database (Denmark)

    Blaagaard, Bolette


    Born out of the United States’ (U.S.) history of slavery and segregation and intertwined with gender studies and feminism, the field of critical whiteness studies does not fit easily into a European setting and the particular historical context that entails. In order for a field of European...... critical whiteness studies to emerge, its relation to the U.S. theoretical framework, as well as the particularities of the European context need to be taken into account.. The article makes a call for a multi-layered approach to take over from the identity politics so often employed in the fields of U...

  2. White Nights


    Shani, Michal


    “How can you sleep at night after you ruined my life?” Arthur, a veteran patient of mine, implored after receiving his test results. This essay recounts my experience as a physician in coping with an extremely anxious patient, its influence on me, and some of my reflections on the ensuing white nights.

  3. Advances in spot curing technology

    International Nuclear Information System (INIS)

    A brief review of spot curing technology was presented. The process which a spot of energy of a specific wavelength bandwidth and irradiance is used to cause a coating, encapsulant or adhesive to change from a liquid to a solid state

  4. Avaliação de produtos químicos comerciais, in vitro e in vivo, no controle da doença foliar, mancha branca do milho, causada por Pantoea ananatis Evaluation of commercial chemical products, in vitro and in vivo in the control of foliar disease, maize white spot, caused by Pantoea ananais

    Directory of Open Access Journals (Sweden)

    Cleide Aparecida Bomfeti


    Full Text Available Uma bactéria identificada como Pantoea ananatis foi recentemente isolada de lesões jovens da doença mancha branca do milho de plantas naturalmente infectadas. Esta bateria reproduziu sintomas semelhantes aos da doença quando inoculada em plantas de milho em casa de vegetação. Estudos anteriores realizados por outros autores demonstraram que o controle desta doença em condições de campo foi obtido pelo uso de fungicidas, principalmente o Mancozeb, nas fases iniciais de seu desenvolvimento. O objetivo deste estudo foi avaliar a freqüência de isolamento da bactéria P. ananatis a partir de plantas infectadas coletadas na região de Londrina, Estado do Paraná, e reproduzir sintomas da doença através de inoculações artificiais em plantas de milho em casa de vegetação. Utilizando os produtos químicos testados anteriormente por outros autores para o controle desta doença a campo, foi também objetivo deste trabalho avaliar o potencial destes produtos na inibição da bactéria tanto em condições de laboratório como em condições de infecção natural. Os resultados mostraram que P. ananatis foi isolada em 40% das lesões jovens coletadas a campo e quando inoculada em casa de vegetação sob condições controladas reproduziu sintomas semelhantes aos observados a campo. Entre os produtos químicos testados, o fungicida Mancozeb mostrou-se eficiente no controle da doença a campo, em concordância com os relatos anteriores. Este produto inibiu completamente o crescimento da bactéria em laboratório, explicando os resultados obtidos a campo. Os demais produtos não foram eficientes no controle a campo e eles também não inibiram a bactéria em laboratório. Estes resultados representam evidências adicionais de que a bactéria P. ananatis é o agente causal da doença mancha branca do milho.A bacterium identified as Pantoea ananatis was recently isolated from young lesions of the disease maize white spot from infected plants in

  5. First Report of a Leaf Spot Caused by Alternaria brassicae on the Invasive Weed Lepidium draba in North America (United States)

    A second leaf spot disease on the perennial invasive weed white top, aka hoary cress, was found in a stand of white top in south central Montana. The plant pathogen causing the lesions was identified as the fungus Alternaria brassicae. It was isolated, purified grown on a V-8 agar growth medium and ...

  6. Obama Asks Congress for $1.9 Billion to Battle Zika Virus (United States)

    ... Congress for $1.9 Billion to Battle Zika Virus Money would go toward mosquito-control programs, vaccine development and tests to better spot the virus To use the sharing features on this page, ...

  7. Coulomb explosion of "hot spot"

    CERN Document Server

    Oreshkin, V I; Chaikovsky, S A; Artyomov, A P


    The study presented in this paper has shown that the generation of hard x rays and high-energy ions, which are detected in pinch implosion experiments, may be associated with the Coulomb explosion of the hot spot that is formed due to the outflow of the material from the pinch cross point. During the process of material outflow, the temperature of the hot spot plasma increases, and conditions arise for the plasma electrons to become continuously accelerated. The runaway of electrons from the hot spot region results in the buildup of positive space charge in this region followed by a Coulomb explosion. The conditions for the hot spot plasma electrons to become continuously accelerated have been revealed and estimates have been obtained for the kinetic energy of the ions generated by the Coulomb explosion.

  8. How to Spot Health Fraud (United States)

    ... Bioterrorism and Drug Preparedness How to Spot Health Fraud Share Tweet Linkedin Pin it More sharing options ... health fraud. --P.K. Joining Forces to Fight Fraud Health fraud isn't confined to the United ...

  9. Alightment of Spotted Wing Drosophila (Diptera: Drosophilidae) on Odorless Disks Varying in Color. (United States)

    Kirkpatrick, D M; McGhee, P S; Hermann, S L; Gut, L J; Miller, J R


    Methods for trapping spotted wing drosophila, Drosophila suzukii (Matsmura) (Diptera: Drosophilidae), have not yet been optimized for detecting this devastating pest of soft-skinned fruits. Here, we report outcomes of choice and no-choice laboratory bioassays quantifying the rates of spotted wing drosophila alightment on 5-cm-diameter sticky disks of various colors, but no fruit odors. Red, purple, and black disks captured the most spotted wing drosophila when presented against a white background. Male and female spotted wing drosophila responded identically in these tests. Significantly more D. suzukii were captured on the red and yellow disks than those presenting the corresponding grayscale for that color, proving that D. suzukii perceives colors and not just the level of target brightness. Fluorescent red is the best candidate for trap color, while clear and white are the least desirable. However, when the background was switched to black, all nonfluorescent colors were equally acceptable to spotted wing drosophila, suggesting that background must be specified when reporting spotted wing drosophila color preference. Additional spotted wing drosophila research is justified on the effects of target color against natural backgrounds. PMID:26475826

  10. Performance of an Early Infant Diagnostic Test, AmpliSens DNA-HIV-FRT, Using Dried Blood Spots Collected from Children Born to Human Immunodeficiency Virus-Infected Mothers in Ukraine. (United States)

    Chang, Joy; Tarasova, Tetyana; Shanmugam, Vedapuri; Azarskova, Marianna; Nguyen, Shon; Hurlston, Mackenzie; Sabatier, Jennifer; Zhang, Guoqing; Osmanov, Saladin; Ellenberger, Dennis; Yang, Chunfu; Vitek, Charles; Liulchuk, Maria; Nizova, Natalya


    An accurate accessible test for early infant diagnosis (EID) is crucial for identifying HIV-infected infants and linking them to treatment. To improve EID services in Ukraine, dried blood spot (DBS) samples obtained from 237 HIV-exposed children (≤18 months of age) in six regions in Ukraine in 2012 to 2013 were tested with the AmpliSens DNA-HIV-FRT assay, the Roche COBAS AmpliPrep/COBAS TaqMan (CAP/CTM) HIV-1 Qual test, and the Abbott RealTime HIV-1 Qualitative assay. In comparison with the paired whole-blood results generated from AmpliSens testing at the oblast HIV reference laboratories in Ukraine, the sensitivity was 0.99 (95% confidence interval [CI], 0.95 to 1.00) for the AmpliSens and Roche CAP/CTM Qual assays and 0.96 (95% CI, 0.90 to 0.98) for the Abbott Qualitative assay. The specificity was 1.00 (95% CI, 0.97 to 1.00) for the AmpliSens and Abbott Qualitative assays and 0.99 (95% CI, 0.96 to 1.00) for the Roche CAP/CTM Qual assay. McNemar analysis indicated that the proportions of positive results for the tests were not significantly different (P > 0.05). Cohen's kappa (0.97 to 0.99) indicated almost perfect agreement among the three tests. These results indicated that the AmpliSens DBS and whole-blood tests performed equally well and were comparable to the two commercially available EID tests. More importantly, the performance characteristics of the AmpliSens DBS test meets the World Health Organization EID test requirements; implementing AmpliSens DBS testing might improve EID services in resource-limited settings. PMID:26447114

  11. Hot spots in fiber pinches

    International Nuclear Information System (INIS)

    Results are presented on the behavior of ''bright spots'' in carbon and deuterium fiber Z-pinches using the MAGPIE generator at the I MA current level. The experimental diagnosis was carried out using optical and X-ray framing and streak images, along with Schlieren and shadowgraphy laser probing. After a short (∼4 ns) duration formation phase, these bright spots exhibit highly dynamic behavior. Bifurcation of the bright spots gives rise to rapid axial motion at 1-3x105 m/sec. The post-bifurcation bright spots persist for up to 40 ns. The important features of bright spot evolution can be reproduced using a 2-D MHD code incorporating LTE ionization dynamics and cold start conditions. Construction of ''artificial'' diagnostic images from the simulation data allows direct comparison to experiment. From the close agreement between experiment and 2-D simulation we infer that the observed bright spot behavior can be explained entirely in terms of the non-linear evolution of the m=0 instability

  12. The Genetic Inheritance of the Blue-eyed White Phenotype in Alpacas (Vicugna pacos)


    Jackling, Felicity C.; Warren E. Johnson; Appleton, Belinda R


    White-spotting patterns in mammals can be caused by mutations in the gene KIT, whose protein is necessary for the normal migration and survival of melanocytes from the neural crest. The alpaca (Vicugna pacos) blue-eyed white (BEW) phenotype is characterized by 2 blue eyes and a solid white coat over the whole body. Breeders hypothesize that the BEW phenotype in alpacas is caused by the combination of the gene causing gray fleece and a white-spotting gene. We performed an association study usi...

  13. Chronic active Epstein-Barr virus infection with cutaneous and sinus lymphoproliferation in a white female patient with 25 years' follow-up: an original case report. (United States)

    Picard, C; Gouarin, S; Comoz, F; Barreau, M; Verneuil, L; Troussard, X; Dompmartin, A


    Chronic active Epstein-Barr virus infection (CAEBV) is characterized by chronic infectious mononucleosis-like symptoms associated with very high viral load, as assessed by quantitative polymerase chain reaction. We present an unusual case in a French woman who was followed up over 25 years with cutaneous and sinus lymphoproliferation. This white woman presented with a long history of recurrent cutaneous necrotic papules of the skin, which started during childhood and healed spontaneously with depressed scars. The lesions spread to the left maxillary sinus and were associated with hepatomegaly and splenomegaly with no other visceral locations. Pathological examination of the skin and sinus revealed a dermal monoclonal T-cell lymphoproliferative disorder, CD7(+) and CD20(-) , with no epidermotropism. T-cell receptor rearrangement was positive, showing the monoclonality from the first biopsy. This T-cell proliferation was positive for EBV-encoded small RNA and was associated with a high EBV viral load. Since then, the patient has been in good health, despite a permanently high EBV viral load. Hydroa vacciniforme (HV)-like lymphoma and natural killer/T-cell lymphoma were discussed, but none really fit our case. Natural killer cell lymphoma was ruled out because of the indolent course, but sinus lesions do not exist in HV-like lymphoma. A therapeutic approach is difficult because of the coexistence of viral infection and monoclonal T-cell proliferation. Chemotherapy is not efficient and induces immunosuppression, which may worsen the prognosis. Although rituximab may have an immunomodulatory function, it was not effective in our case. PMID:26148205

  14. Heartland Virus (United States)

    ... Vector-Borne Diseases (DVBD) NCEZID Share Compartir Heartland virus On this Page What is Heartland virus? How ... Do I Need to Know? What is Heartland virus? Heartland virus belongs to a family of viruses ...

  15. Scanning electron microscopy of superficial white onychomycosis*


    de Almeida Jr., Hiram Larangeira; Boabaid, Roberta Oliveira; Timm, Vitor; Silva, Ricardo Marques e; de Castro, Luis Antonio Suita


    Superficial white onychomycosis is characterized by opaque, friable, whitish superficial spots on the nail plate. We examined an affected halux nail of a 20-year-old male patient with scanning electron microscopy. The mycological examination isolated Trichophyton mentagrophytes. Abundant hyphae with the formation of arthrospores were found on the nail's surface, forming small fungal colonies. These findings showed the great capacity for dissemination of this form of onychomycosis.

  16. Scanning electron microscopy of superficial white onychomycosis. (United States)

    Almeida, Hiram Larangeira de; Boabaid, Roberta Oliveira; Timm, Vitor; Silva, Ricardo Marques E; Castro, Luis Antonio Suita de


    Superficial white onychomycosis is characterized by opaque, friable, whitish superficial spots on the nail plate. We examined an affected halux nail of a 20-year-old male patient with scanning electron microscopy. The mycological examination isolated Trichophyton mentagrophytes. Abundant hyphae with the formation of arthrospores were found on the nail's surface, forming small fungal colonies. These findings showed the great capacity for dissemination of this form of onychomycosis. PMID:26560225

  17. Scanning electron microscopy of superficial white onychomycosis* (United States)

    de Almeida Jr., Hiram Larangeira; Boabaid, Roberta Oliveira; Timm, Vitor; Silva, Ricardo Marques e; de Castro, Luis Antonio Suita


    Superficial white onychomycosis is characterized by opaque, friable, whitish superficial spots on the nail plate. We examined an affected halux nail of a 20-year-old male patient with scanning electron microscopy. The mycological examination isolated Trichophyton mentagrophytes. Abundant hyphae with the formation of arthrospores were found on the nail's surface, forming small fungal colonies. These findings showed the great capacity for dissemination of this form of onychomycosis. PMID:26560225

  18. Efficiency Tests of the Agricultural Futures Exchange of Thailand: A Case of White Rice 5%.


    Suphansa Yuenyoung; Apichat Daloonpate


    The better reflection of future price on spot price indicates the higher efficiency of futures market because such market is able to respond rapidly to the market information. This research studies the efficiency of white rice 5% in the Agricultural Futures Exchange of Thailand (AFET). The relationship between the AFET prices and spot prices of white rice 5% was analyzed. Weekly data from August 2004 to December 2009 were used for the analysis. The results showed a long-term equilibrium relat...

  19. Preliminary Study on RNA Interference Against Red-Spotted Grouper Nervous Necrosis Virus-Optimization of Transfection Condition and Comparison of Interference Effect Based on FHM Cell%石斑鱼神经坏死病毒RNA干扰的

    Institute of Scientific and Technical Information of China (English)

    黄桂菊; 喻达辉; 柳明; 潘俐玲; 王晓宁; 曾令兵; 龙华


    克隆了石斑鱼神经坏死病毒(Nervous necrosis virus,NNV)的衣壳蛋白(Major capsid protein,MCP)基因序列并构建了绿色荧光蛋白(EGFP)基因与MCP基因的融合真核表达载体pEGFP-MCP,设计了3对针对MCP基因序列的小片段干扰性RNA(Small interrering RNA,siRNA)序列(NNV-001、NNV-002、NNV-003),开展了转染方法、转染剂量与转染效果的研究,用脂质体转染法将pEGFP-MCP和不同剂量的siRNA共转染导入黑头呆鱼肌肉(FHM)细胞.结果表明,用无血清培养基转染、4~6 h后换液的转染方法,比不换液、只将转染混合物代替同体积培养基的转染方法效率高;当质粒的转染量为50、70、100和150ng时,100ng的转染量为最合适;在pEGFP-MCP与siRNA共转染组,3对siRNA序列都有干扰效果,均能干扰绿色荧光蛋白的表达,其中NNV-002效果最好.当siRNA终浓度为200 mol/L时,显示出了较好的沉默效果.%Grouper is one of the most valuable commercial marine fish and viral nervous necrosis (VNN) is the most harmful disease of this fish. Capsid protein ( major caps id protein,MCP) of NNV is a major pathogenic factor and currently there is no effective drug available for its treatment. This paper is intended to provide a preliminary study of the RNAi control technology for NNV. The gronper nervous necrosis virus MCP sene was cloned and eukaryotic expression vector pEGFP-MCP was constructed with a green fluorescent protein (EGFP) fusion gene and the MCP gene. Three pairs of siRNA (NNV-001 ,NNV-002,NNV-003) against the gene sequence designed, were transfected into FHM cells( muscle cells of fathead minnow)with Lipofectamine2000 in order to detect EGFP expression and comparison of transfection method, dose and efficiency. The results showed that the transfection efficiency with serum-free medium after 4 - 6 h is higher than the rate of transfection with mixture medium. 100 ng was found to be the most appropriate amount when the plasmid was transfected with

  20. Highly Specific Detection of Five Exotic Quarantine Plant Viruses using RT-PCR


    Choi, Hoseong; Cho, Won Kyong; Yu, Jisuk; Lee, Jong-Seung; Kim, Kook-Hyung


    To detect five plant viruses (Beet black scorch virus, Beet necrotic yellow vein virus, Eggplant mottled dwarf virus, Pelargonium zonate spot virus, and Rice yellow mottle virus) for quarantine purposes, we designed 15 RT-PCR primer sets. Primer design was based on the nucleotide sequence of the coat protein gene, which is highly conserved within species. All but one primer set successfully amplified the targets, and gradient PCRs indicated that the optimal temperature for the 14 useful prime...

  1. Laser based spot weld characterization (United States)

    Jonietz, Florian; Myrach, Philipp; Rethmeier, Michael; Suwala, Hubert; Ziegler, Mathias


    Spot welding is one of the most important joining technologies, especially in the automotive industry. Hitherto, the quality of spot welded joints is tested mainly by random destructive tests. A nondestructive testing technique offers the benefit of cost reduction of the testing procedure and optimization of the fabrication process, because every joint could be examined. This would lead to a reduced number of spot welded joints, as redundancies could be avoided. In the procedure described here, the spot welded joint between two zinc-coated steel sheets (HX340LAD+Z100MB or HC340LA+ZE 50/50) is heated optically on one side. Laser radiation and flash light are used as heat sources. The melted zone, the so called "weld nugget" provides the mechanical stability of the connection, but also constitutes a thermal bridge between the sheets. Due to the better thermal contact, the spot welded joint reveals a thermal behavior different from the surrounding material, where the heat transfer between the two sheets is much lower. The difference in the transient thermal behavior is measured with time resolved thermography. Hence, the size of the thermal contact between the two sheets is determined, which is directly correlated to the size of the weld nugget, indicating the quality of the spot weld. The method performs well in transmission with laser radiation and flash light. With laser radiation, it works even in reflection geometry, thus offering the possibility of testing with just one-sided accessibility. By using heating with collimated laser radiation, not only contact-free, but also remote testing is feasible. A further convenience compared to similar thermographic approaches is the applicability on bare steel sheets without any optical coating for emissivity correction. For this purpose, a proper way of emissivity correction was established.

  2. Color tunable LED spot lighting (United States)

    Hoelen, C.; Ansems, J.; Deurenberg, P.; van Duijneveldt, W.; Peeters, M.; Steenbruggen, G.; Treurniet, T.; Valster, A.; ter Weeme, J. W.


    A new trend in illumination is to use dynamic light to set or dynamically vary the ambience of a room or office. For this we need color tunable spots that can reliably vary over at least a wide range of color temperatures, and preferably also more saturated colors. LEDs are in principle ideally suited for this application thanks to their nature of emitting light in a relatively narrow band. For color tunable spot lighting based on the concept of mixing RGB LED colors, the key results have been presented before. Limitations of these 3-intrinsic-color mixing systems with high color rendering properties are found in a limited operating temperature range due to wavelength shifts, a limited color temperature range, and a low maximum operating temperature due to a strong flux decrease with increasing temperature. To overcome these limitations, a 3-color R pcGB system with phosphor-converted red (R pc) and a 4-color RAGB system have been investigated. With both systems, a CRI of at least 80 can be maintained over the relevant color temperature range of approximately 2700 K to 6500 K. In this paper we compare these concepts on overall system aspects and report on the performance of prototype spot lamps. The main features of the RAGB and R pcGB spot lamp concepts can be summarized as: 1) The RAGB spot overcomes CRI and gamut shortcomings of RGB light sources and gives much freedom in wavelength selection, but suffers from temperature sensitivity and complex controls; 2) The R pcGB spot overcomes shortcomings concerning CRI and thermal dependence of RGB sources and enables relatively simple controls, but needs an improved overall red efficacy. With both color concepts, prototype spot lamps have been built. The amber to red emitting nitridosilicate-based phosphors can be wavelength-tuned for optimal performance, which is found at a peak emission around 610 nm for high color quality systems. This results in a simple and very robust system with good color consistency. For the

  3. Is this Red Spot the Blue Spot (locus ceruleum)?

    Energy Technology Data Exchange (ETDEWEB)

    Choe, Won Sick; Lee, Yu Kyung; Lee, Min Kyung; Hwang, Kyung Hoon [Gachon University Gil Hospital, Incheon (Korea, Republic of)


    The authors report brain images of 18F-FDG-PET in a case of schizophrenia. The images showed strikingly increased bilateral uptake in the locus ceruleum. The locus ceruleum is called the blue spot and known to be a center of the norepinephrinergic system.

  4. Fatal Spotted Fever Rickettsiosis, Kenya


    Rutherford, Jeremiah S.; Macaluso, Kevin; Smith, Nathaniel; Zaki, Sherif R.; Paddock, Christopher D.; Davis, Jon; Peterso, Norman; Azad, Abdu F.; Rosenberg, Ronald


    We report a fatal case of rickettsiosis in a woman from the United States living in Kenya, who had a history of tick exposure. Immunohistochemical staining of skin, kidney, and liver demonstrated spotted fever group rickettsiae. The clinical findings, severity, and fatal outcome are most consistent with Rickettsia conorii infection.

  5. Developing immunological methods for detecting Macrobrachium rosenbergii nodavirus and extra small virus using a recombinant protein preparation. (United States)

    Wang, C-S; Chang, C-Y; Wen, C-M


    Macrobrachium rosenbergii nodavirus (MrNV) and extra small virus (XSV) have been identified as the causative agents for white tail disease (WTD) of M. rosenbergii. In this study, the gene sequences encoding MrNV and XSV capsid proteins were separately ligated into the pGEX-4T-3 expression vector and transformed into Escherichia coli. After induction, glutathione-S-transferase (GST)-tagged MrNV and XSV fusion proteins were obtained with molecular masses of 68 and 43 kDa, respectively. Specific polyclonal antibodies for MrNV and XSV against viral recombinant proteins and infected prawn tissues were verified using Western blotting. According to immunodot blot assay results, the detection sensitivities of antibodies were approximately 5 ng μL(-1) for both recombinant proteins GST-MrNV and GST-XSV. In additional, MrNV and XSV were detected at dilution levels of 1:2560 and 1:640 in the infected prawn tissues, respectively. No cross-reactions with white spot syndrome virus or grouper nervous necrosis virus were observed using immunodot blot assays. MrNV and XSV in infected muscle tissues were detected using immunohistochemistry. Although the detection limit of the immunodot blot assay was lower than that of nested reverse transcription polymerase chain reaction, these polyclonal antibodies can be useful for confirming MrNV and XSV infections in field tests. PMID:26263892

  6. [Zika, a neurotropic virus?]. (United States)

    Del Carpio-Orantes, Luis


    In this paper, the neurotropism potential Zika virus is discussed, by comparison with viruses both RNA and DNA are neurotropic known, also it is said that compared with the new viruses that have affected the Americas, as the chikungunya, Zika has shown great affinity by brain tissue, manifested by a high incidence of acute neurological conditions, such as Guillain-Barré syndrome, among others, as well as the reported incidence of microcephaly that is abnormally high compared with the previous incidence, which, in a stillborn subject necropsied significant alterations demonstrated in brain tissue, identifying viral material and live virus in the fetoplacental complex, and demonstrating the impact both white matter and gray matter as well as basal ganglia, corpus callosum, ventricles and spinal cord, which could explain the microcephaly that concerns him. Although not a direct cause-effect relationship is demonstrated, however current evidence supports that relationship, hoping to be supported scientifically. PMID:27197113

  7. Spot patterns and differential rotation in the eclipsing pre-CV binary,V471 Tau

    CERN Document Server

    Hussain, G A J; Saar, S H; Still, M D


    We present surface spot maps of the K2V primary star in the pre-cataclysmic variable binary system, V471 Tau. The spot maps show the presence of large high latitude spots located at the sub-white dwarf longitude region. By tracking the relative movement of spot groups over the course of four nights (eight rotation cycles), we measure the surface differential rotation rate of the system.Our results reveal that the star is rotating rigidly with a surface shear rate, dOmega = 1.6 +/- 6 mrad/d. The single active star AB Dor has a similar spectral type, rotation period, and activity level as the K star in V471 Tau but displays much stronger surface shear (46 < dOmega < 58 mrad/d). Our results suggest that tidal locking may inhibit differential rotation; this reduced shear, however, does not affect the overall magnetic activity levels in active K dwarfs.

  8. LED downlights with non-circular spots (United States)

    Parkyn, William A.; Pelka, David G.


    The ubiquitous downlight inhabits our ceilings by the millions. Hot, inefficient, and electrically wasteful, it is next in line for replacement by the latest high-brightness, high-efficacy white LEDs. The conventional downlight configuration of a large incandescent spotlight in a low-cost, ceiling-recessed metal can, represents the culmination of old technology, fated never to improve significantly. Incandescent downlights add greatly both to direct and indirect electrical consumption, with the lamps requiring relatively frequent replacement. The small size of LED emitters means small optical elements can produce much higher-quality beams than incandescent spotlight-lamps can produce. Herein we introduce compact high-luminosity LED downlights with lenses that deliver uniform illumination to delimited targets such as tables. One version utilizes circular lenses and micro-diffuser films to deliver square outputs. The other uses lenses cut to the target shape. In particular, one of these lenses is the first to offer a semicircular spot suitable for gambling tables.

  9. Rocky Mountain Spotted Fever: Statistics and Epidemiology (United States)

    ... The CDC Cancel Submit Search The CDC Rocky Mountain Spotted Fever (RMSF) Note: Javascript is disabled or ... please visit this page: About . Rocky Mountain Spotted Fever (RMSF) Symptoms, Diagnosis, and Treatment Statistics ...

  10. Improvements on analytic modelling of stellar spots

    CERN Document Server

    Montalto, M; Oshagh, M; Boisse, I; Bruno, G; Santos, N C


    In this work we present the solution of the stellar spot problem using the Kelvin-Stokes theorem. Our result is applicable for any given location and dimension of the spots on the stellar surface. We present explicitely the result up to the second degree in the limb darkening law. This technique can be used to calculate very efficiently mutual photometric effects produced by eclipsing bodies occulting stellar spots and to construct complex spot shapes.

  11. Interpreting spotted dolphin age distributions


    Barlow, Jay; Hohn, Aleta A.


    Previous work has determined the age distribution from a sample of spotted dolphins (Stenella attenuata) killed in the eastern Pacific tuna purse-seine fishery. In this paper we examine the usefulness of this age distribution for estimating natural mortality rates. The observed age distribution has a deficiency of individuals from 5-15 years and cannot represent a stable age distribution. Sampling bias and errors in age interpretation are examined as possible causes of the "dip" in the obs...

  12. An online real time ultrasonic NDT system for the quality control of spot welding in the automotive industry

    International Nuclear Information System (INIS)

    Resistance spot welding is the main joining technique used for the fabrication of body-in-white structures in the automotive industry. The quality of the welds depends on the profile of the spot welding electrode cap. The increased use of zinc coated steel in the industry increases wear rate of the caps, making quality control more difficult. This paper presents a novel online real time ultrasonic NDE system for resistance spot welding which evaluates every weld as it is formed. SEM results are presented to show the alloying of the electrode caps.

  13. ESA uncovers Geminga's `hot spot' (United States)


    16 July 2004 Astronomers using ESA’s X-ray observatory XMM-Newton have detected a small, bright ‘hot spot’ on the surface of the neutron star called Geminga, 500 light-years away. The hot spot is the size of a football field and is caused by the same mechanism producing Geminga’s X-ray tails. This discovery identifies the missing link between the X-ray and gamma-ray emission from Geminga. hi-res Size hi-res: 1284 kb Credits: ESA, P. Caraveo (IASF, Milan) Geminga's hot spot This figure shows the effects of charged particles accelerated in the magnetosphere of Geminga. Panel (a) shows an image taken with the EPIC instrument on board the XMM-Newton observatory. The bright tails, made of particles kicked out by Geminga’s strong magnetic field, trail the neutron star as it moves about in space. Panel (b) shows how electrically charged particles interact with Geminga’s magnetic field. For example, if electrons (blue) are kicked out by the star, positrons (in red) hit the star’s magnetic poles like in an ‘own goal’. Panel (c) illustrates the size of Geminga’s magnetic field (blue) compared to that of the star itself at the centre (purple). The magnetic field is tilted with respect to Geminga’s rotation axis (red). Panel (d) shows the magnetic poles of Geminga, where charged particles hit the surface of the star, creating a two-million degrees hot spot, a region much hotter than the surroundings. As the star spins on its rotation axis, the hot spot comes into view and then disappears, causing the periodic colour change seen by XMM-Newton. An animated version of the entire sequence can be found at: Click here for animated GIF [low resolution, animated GIF, 5536 KB] Click here for AVI [high resolution, AVI with DIVX compression, 19128 KB] hi-res Size hi-res: 371 kb Credits: ESA, P. Caraveo (IASF, Milan) Geminga's hot spot, panel (a) Panel (a) shows an image taken with the EPIC instrument on board the XMM-Newton observatory. The bright tails, made of

  14. Presence and Distribution of Tobacco Viruses in Serbia

    Directory of Open Access Journals (Sweden)

    Nataša Duduk


    Full Text Available Infection with a large number of plant viruses could imperil tobacco yield and quality. Tobacco is a natural host for more than 20 viruses, among which the most important and economically harmful are tobacco mosaic virus (TMV, tomato spotted wilt virus (TSWV, cucumber mosaic virus (CMV, potato virus Y (PVY, alfalfa mosaic virus (AMV, tobacco ringspot virus (TRSV, tobacco each virus (TEV and tobacco vein mottling virus (TVMV.The occurence and distribution of tobacco viruses were investigated for 4 years (2002-2005. During this period many different tobacco growing localities in Vojvodina and central Serbia were monitored and samples showing virus symptoms were collected. The collected samples were tested by DAS ELISA using polyclonal antisera, specific for the detection of PVY, TSWV, TMV, CMV, AMV and TRSV.The results obtained for the tobacco virus distribution during these four years of investigation proved the presence of four economically important viruses in our country, whose frequencies varied from year to year. In 2002, 2003 and 2004, the most frequent was TSWV(86.84%; 79% and 49.56%, respectively, while in 2005 PVY was prevalent (56.16%. All viruses detected in the samples tested were present in single or mixed infections. A corellation was established between the field symptoms on tobacco and the virus causal agents.The results obtained showed that TSWV and PVY were the most important tobacco viruses in our country, so that further research of tobacco virus diseases should be directed towards their more detailed characterization.

  15. Role of macrophages during Theiler's virus infection.


    Rossi, C P; Delcroix, M; Huitinga, I.; McAllister, A; Van Rooijen, N.; E. Claassen; Brahic, M


    Theiler's virus, a murine picornavirus, causes a persistent infection of the central nervous system with chronic inflammation and primary demyelination. We examined the nature of infected cells at different times postinoculation (p.i.) with a combined immunocytochemistry-in situ hybridization assay. The virus was found in the gray matter of the brain, mostly in neurons, during the first week p.i. During the following weeks, the virus was present in the spinal cord, first in the gray and white...

  16. Watermarking spot colors in packaging (United States)

    Reed, Alastair; Filler, TomáÅ.¡; Falkenstern, Kristyn; Bai, Yang


    In January 2014, Digimarc announced Digimarc® Barcode for the packaging industry to improve the check-out efficiency and customer experience for retailers. Digimarc Barcode is a machine readable code that carries the same information as a traditional Universal Product Code (UPC) and is introduced by adding a robust digital watermark to the package design. It is imperceptible to the human eye but can be read by a modern barcode scanner at the Point of Sale (POS) station. Compared to a traditional linear barcode, Digimarc Barcode covers the whole package with minimal impact on the graphic design. This significantly improves the Items per Minute (IPM) metric, which retailers use to track the checkout efficiency since it closely relates to their profitability. Increasing IPM by a few percent could lead to potential savings of millions of dollars for retailers, giving them a strong incentive to add the Digimarc Barcode to their packages. Testing performed by Digimarc showed increases in IPM of at least 33% using the Digimarc Barcode, compared to using a traditional barcode. A method of watermarking print ready image data used in the commercial packaging industry is described. A significant proportion of packages are printed using spot colors, therefore spot colors needs to be supported by an embedder for Digimarc Barcode. Digimarc Barcode supports the PANTONE spot color system, which is commonly used in the packaging industry. The Digimarc Barcode embedder allows a user to insert the UPC code in an image while minimizing perceptibility to the Human Visual System (HVS). The Digimarc Barcode is inserted in the printing ink domain, using an Adobe Photoshop plug-in as the last step before printing. Since Photoshop is an industry standard widely used by pre-press shops in the packaging industry, a Digimarc Barcode can be easily inserted and proofed.

  17. Identification of Damaged Spot Welds in a Complicated Joined Structure

    International Nuclear Information System (INIS)

    In automotive engineering, spot welds on assembled structures such as Body in White (BiW) have a significant effect on the vehicles' dynamic characteristics. Understandably, imperfections in the spot welds will cause variations in the dynamic properties such as natural frequencies and mode shapes of the structure. In this paper, a complicated welded structure which is a simplified Natural Gas Vehicle (NGV) platform is investigated. The structure fabricated from thin metal sheets consists of ten components. They are jointed together by a number of scattered spot welds. NASTRAN Solution 200 based on sensitivity analysis is used to identify the most sensitive parameters to natural frequencies. The numerical model of the undamaged structure is initially updated in order to minimise the discrepancies between the measured and numerical data using NASTRAN optimisation code. The initial updated model serves as a benchmark for the subsequent structural damage identification. The numerical data of the benchmark model is then compared with the measured data obtained from the damaged structure. The same updating procedure is applied to the benchmark model in order to bring the numerical data as close as possible to the measured data of the damaged structure. The disparity in certain parameter values from the parameter values used in the benchmark model shows a fault or damage in the location of a particular joint, depending on the severity of this disparity. The challenge in this work is to localise damaged area and quantify the damage of the complicated structure with multiple spot welds in the presence of uncertainty in the location and material properties of the welds.

  18. Identification of Damaged Spot Welds in a Complicated Joined Structure (United States)

    Yunus, M. A.; Rani, M. N. Abdul; Ouyang, H.; Deng, H.; James, S.


    In automotive engineering, spot welds on assembled structures such as Body in White (BiW) have a significant effect on the vehicles' dynamic characteristics. Understandably, imperfections in the spot welds will cause variations in the dynamic properties such as natural frequencies and mode shapes of the structure. In this paper, a complicated welded structure which is a simplified Natural Gas Vehicle (NGV) platform is investigated. The structure fabricated from thin metal sheets consists of ten components. They are jointed together by a number of scattered spot welds. NASTRAN Solution 200 based on sensitivity analysis is used to identify the most sensitive parameters to natural frequencies. The numerical model of the undamaged structure is initially updated in order to minimise the discrepancies between the measured and numerical data using NASTRAN optimisation code. The initial updated model serves as a benchmark for the subsequent structural damage identification. The numerical data of the benchmark model is then compared with the measured data obtained from the damaged structure. The same updating procedure is applied to the benchmark model in order to bring the numerical data as close as possible to the measured data of the damaged structure. The disparity in certain parameter values from the parameter values used in the benchmark model shows a fault or damage in the location of a particular joint, depending on the severity of this disparity. The challenge in this work is to localise damaged area and quantify the damage of the complicated structure with multiple spot welds in the presence of uncertainty in the location and material properties of the welds.

  19. Identification of Damaged Spot Welds in a Complicated Joined Structure

    Energy Technology Data Exchange (ETDEWEB)

    Yunus, M A; Rani, M N Abdul; Ouyang, H; Deng, H; James, S, E-mail: [Department of Engineering, Harrison Hughes Building, University of Liverpool, Brownlow Hill, Liverpool L69 3GH (United Kingdom)


    In automotive engineering, spot welds on assembled structures such as Body in White (BiW) have a significant effect on the vehicles' dynamic characteristics. Understandably, imperfections in the spot welds will cause variations in the dynamic properties such as natural frequencies and mode shapes of the structure. In this paper, a complicated welded structure which is a simplified Natural Gas Vehicle (NGV) platform is investigated. The structure fabricated from thin metal sheets consists of ten components. They are jointed together by a number of scattered spot welds. NASTRAN Solution 200 based on sensitivity analysis is used to identify the most sensitive parameters to natural frequencies. The numerical model of the undamaged structure is initially updated in order to minimise the discrepancies between the measured and numerical data using NASTRAN optimisation code. The initial updated model serves as a benchmark for the subsequent structural damage identification. The numerical data of the benchmark model is then compared with the measured data obtained from the damaged structure. The same updating procedure is applied to the benchmark model in order to bring the numerical data as close as possible to the measured data of the damaged structure. The disparity in certain parameter values from the parameter values used in the benchmark model shows a fault or damage in the location of a particular joint, depending on the severity of this disparity. The challenge in this work is to localise damaged area and quantify the damage of the complicated structure with multiple spot welds in the presence of uncertainty in the location and material properties of the welds.

  20. Accretion Flows in Magnetic White Dwarf Systems (United States)

    Imamura, James N.


    We received Type A and B funding under the NASA Astrophysics Data Program for the analysis and interpretation of hard x-ray data obtained by the Rossi X-ray Timing Explorer and other NASA sponsored missions for Intermediate Polars (IPS) and Polars. For some targets, optical data was available. We reduced and analyzed the X-ray spectra and the X-ray and optical (obtained at the Cerro Tololo Inter-American Observatory) timing data using detailed shock models (which we constructed) to place constraints on the properties of the accreting white dwarfs, the high energy emission mechanisms of white dwarfs, and the large-scale accretion flows of Polars and IPS. IPS and Polars are white dwarf mass-transfer binaries, members of the larger class of cata,clysmic variables. They differ from the bulk of the cataclysmic variables in that they contain strongly magnetic white dwarfs; the white dwarfs in Polars have B, = 7 to 230 MG and those in IPS have B, less than 10 MG. The IPS and Polars are both examples of funneled accretion flows in strong magnetic field systems. The IPS are similar to x-ray pulsars in that accretion disks form in the systems which are disrupted by the strong stellar magnetic fields of the white dwarfs near the stellar surface from where the plasma is funneled to the surface of the white dwarf. The localized hot spots formed at the footpoints of the funnels coupled with the rotation of the white dwarf leads to coherent pulsed x-ray emission. The Polars offer an example of a different accretion topology; the magnetic field of the white dwarf controls the accretion flow from near the inner Lagrangian point of the system directly to the stellar surface. Accretion disks do not form. The strong magnetic coupling generally leads to synchronous orbital/rotational motion in the Polars. The physical system in this sense resembles the Io/Jupiter system. In both IPS and Polars, pulsed emission from the infrared to x-rays is produced as the funneled flows merge onto the

  1. Spotted hyena from north China

    Institute of Scientific and Technical Information of China (English)


    @@ Acomplete fossil skeleton of spotted hyena unearthed on 26 July, 2008 in nearly perfect preservation, exhilarates CAS paleontologists, as the discovery in north China might offer new clues about the interactions between prehistoric faunas of Africa and Eurasia, and meanwhile afford a clue to the big extinction of large amount of species occurring about 11,000 years ago. Hinting at possible connections between species from Africa and Eurasia, the discovery would even provide new insights into the "out-of-Africa" model of human origins.

  2. Whiteness and wideness

    DEFF Research Database (Denmark)

    Thau, Carsten

    Katalogartikel til Robert Wilsons og Kaleidoskops forestilling på Bellevue Teatret 'The white town'......Katalogartikel til Robert Wilsons og Kaleidoskops forestilling på Bellevue Teatret 'The white town'...

  3. NCBI nr-aa BLAST: CBRC-OGAR-01-1331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1331 ref|NP_477761.1| wsv239 [Shrimp white spot syndrome virus] gb|AAL...33243.1| wsv239 [shrimp white spot syndrome virus] gb|AAL89163.1| WSSV295 [shrimp white spot syndrome virus] NP_477761.1 7e-05 36% ...

  4. NCBI nr-aa BLAST: CBRC-EEUR-01-1367 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-EEUR-01-1367 ref|NP_477616.1| wsv094 [Shrimp white spot syndrome virus] gb|AAL...33098.1| wsv094 [shrimp white spot syndrome virus] gb|AAL89018.1| WSSV150 [shrimp white spot syndrome virus] NP_477616.1 1.7 37% ...

  5. NCBI nr-aa BLAST: CBRC-DNOV-01-2338 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-2338 ref|NP_477662.1| wsv140 [Shrimp white spot syndrome virus] gb|AAL...33144.1| wsv140 [shrimp white spot syndrome virus] gb|AAL89063.1| WSSV195 [shrimp white spot syndrome virus] NP_477662.1 0.54 32% ...

  6. NCBI nr-aa BLAST: CBRC-CREM-01-1232 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1232 ref|NP_478006.1| wsv484 [Shrimp white spot syndrome virus] gb|AAL...33485.1| wsv484 [shrimp white spot syndrome virus] gb|AAL88879.1| WSSV011 [shrimp white spot syndrome virus] NP_478006.1 8.9 27% ...

  7. NCBI nr-aa BLAST: CBRC-OPRI-01-1405 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-1405 ref|NP_477758.1| wsv236 [Shrimp white spot syndrome virus] gb|AAL...33240.1| wsv236 [shrimp white spot syndrome virus] gb|AAL89160.1| WSSV292 [shrimp white spot syndrome virus] NP_477758.1 2.4 29% ...


    Directory of Open Access Journals (Sweden)

    Octavio Gustavo García-Rodríguez


    Full Text Available La propagación vegetativa del ajo ( Allium sativum es la principal vía de transmisión de virus para este cultivo. No obs - tante, no se debe descartar la dispersión por insectos vectores. El objetivo del presente estudio fue detectar, mediante la prueba de ELISA, la presencia de virus en insectos colectados en plantas de ajo. El experimento se llevó a cabo durante el ciclo Otoño-Invierno 2008-2009. La toma de muestras de insectos se realizó en tres fechas después de la siembra. La identificación de las especies de insectos se realizó utilizando un estereomicroscopio Zeiss de 30X y claves taxonómicas. La detección de virus fue mediante la técnica de DAS-ELISA para los potyvirus Virus del rayado amarillo del puerro ( Leek yellow spot virus : LYSV y Virus del enanismo amarillo de la cebolla ( Onion yellow dwarf virus: OYDV; los carlavirus Virus latente común del ajo ( Garlic common latent virus : GCLV y Virus latente del chalote ( Shallot latent virus : SLV; y el tospovirus Virus del manchado amarillo del iris ( Iris yellow spot virus : IYSV. Se identificaron 19 especies de insectos, de los que destacaron Thrips tabaci Lindeman, como positivo en 18 muestras para GCLV y dos muestras para IYSV, y Collops quadrimaculatus , como positivo en una muestra para GCLV.

  9. ECHO virus (United States)

    ... page: // ECHO virus To use the sharing features on this page, please enable JavaScript. Enteric cytopathic human orphan (ECHO) viruses are a group of viruses that lead to ...

  10. Energy is not Coffee. An assessment of blind spots on energy spot-markets

    Energy Technology Data Exchange (ETDEWEB)

    Jepma, C.J.; Spijker, E.; Van der Gaast, W.; De Jong, F. [Foundation Joint Implementation Network JIN, Paterswolde (Netherlands); Overmars, P. (ed.) [Energy Delta Institute EDI, Groningen (Netherlands)


    This study was to be the first in a series of studies on the title subject. It specifically focuses on the differences and similarities with a number of other spot-markets and aims to frame the energy spot markets and their potential development into a broader perspective. Main conclusion is that energy spot-markets differ from several other physical and non-physical spot-markets in many ways. This implies that 'perfect' energy spot-markets may inherently be (much) less perfect than other spot-markets that have approximated the stage of theoretical perfection.

  11. Energy is not Coffee. An assessment of blind spots on energy spot-markets

    International Nuclear Information System (INIS)

    This study was to be the first in a series of studies on the title subject. It specifically focuses on the differences and similarities with a number of other spot-markets and aims to frame the energy spot markets and their potential development into a broader perspective. Main conclusion is that energy spot-markets differ from several other physical and non-physical spot-markets in many ways. This implies that 'perfect' energy spot-markets may inherently be (much) less perfect than other spot-markets that have approximated the stage of theoretical perfection

  12. Integrating sustainable hunting in biodiversity protection in Central Africa: hot spots, weak spots, and strong spots. (United States)

    Fa, John E; Olivero, Jesús; Farfán, Miguel Ángel; Márquez, Ana Luz; Vargas, Juan Mario; Real, Raimundo; Nasi, Robert


    Wild animals are a primary source of protein (bushmeat) for people living in or near tropical forests. Ideally, the effect of bushmeat harvests should be monitored closely by making regular estimates of offtake rate and size of stock available for exploitation. However, in practice, this is possible in very few situations because it requires both of these aspects to be readily measurable, and even in the best case, entails very considerable time and effort. As alternative, in this study, we use high-resolution, environmental favorability models for terrestrial mammals (N = 165) in Central Africa to map areas of high species richness (hot spots) and hunting susceptibility. Favorability models distinguish localities with environmental conditions that favor the species' existence from those with detrimental characteristics for its presence. We develop an index for assessing Potential Hunting Sustainability (PHS) of each species based on their ecological characteristics (population density, habitat breadth, rarity and vulnerability), weighted according to restrictive and permissive assumptions of how species' characteristics are combined. Species are classified into five main hunting sustainability classes using fuzzy logic. Using the accumulated favorability values of all species, and their PHS values, we finally identify weak spots, defined as high diversity regions of especial hunting vulnerability for wildlife, as well as strong spots, defined as high diversity areas of high hunting sustainability potential. Our study uses relatively simple models that employ easily obtainable data of a species' ecological characteristics to assess the impacts of hunting in tropical regions. It provides information for management by charting the geography of where species are more or less likely to be at risk of extinction from hunting. PMID:25372705

  13. Characterization of a Novel Hepadnavirus in the White Sucker (Catostomus commersonii) from the Great Lakes Region of the United States


    Hahn, Cassidy M.; Luke R. Iwanowicz; Cornman, Robert S; Conway, Carla M.; Winton, James R.; Blazer, Vicki S.


    ABSTRACT The white sucker Catostomus commersonii is a freshwater teleost often utilized as a resident sentinel. Here, we sequenced the full genome of a hepatitis B-like virus that infects white suckers from the Great Lakes Region of the United States. Dideoxy sequencing confirmed that the white sucker hepatitis B virus (WSHBV) has a circular genome (3,542 bp) with the prototypical codon organization of hepadnaviruses. Electron microscopy demonstrated that complete virions of approximately 40 ...

  14. Spot Market Power and Future Market Trading


    Muermann, Alexander; Shore, Stephen H.


    When a spot market monopolist participates in the futures market, he has an incentive to adjust spot prices to make his futures market position more pro…table. Rational futures market makers take this into account when they set prices. Spot market power thus creates a moral hazard problem which parallels the adverse selection problem in models with inside information. This moral hazard not only reduces the optimal amount of hedging for those with and without market power, but also makes compl...

  15. Computational Prediction of Hot Spot Residues


    Morrow, John Kenneth; Zhang, Shuxing


    Most biological processes involve multiple proteins interacting with each other. It has been recently discovered that certain residues in these protein-protein interactions, which are called hot spots, contribute more significantly to binding affinity than others. Hot spot residues have unique and diverse energetic properties that make them challenging yet important targets in the modulation of protein-protein complexes. Design of therapeutic agents that interact with hot spot residues has pr...

  16. A spot market for electricity

    International Nuclear Information System (INIS)

    Electric utilities in many parts of the world are being transformed from regulated monopolies to competitive enterprises. They are buying power from sources they don't control, and experiencing new competitive pressures in selling. In response, utilities have begun to use such techniques as ''active demand-side management'' and ''real-time pricing'' to improve their responsiveness to customers and to create new opportunities for revenue. As an extension of the industry's evolution so far, this article describes how the utilities industry might develop a ''spot market'' for electricity, with the utility providing value in the form of a service for arbitrating requests and demands from various generators and users. The author presents a possible future organization of the electricity market, for which there is no model currently known. Most of its elements do exist in some form at one or more power companies around the world

  17. Ambystoma maculatum (spotted salamander). Reproduction (United States)

    Glorioso, Brad M.; Waddle, Hardin; Hefner, Jeromi


    The Spotted Salamander is a wide-ranging salamander of the eastern United States that typically breeds in winter or early spring in ephemeral pools in lowland forests. Ambystoma maculatum is known to deposit 2-4 egg masses per year, each containing 1-250 eggs. As part of ongoing research into the ecology and reproductive biology of Spotted Salamanders in the Kisatchie District of Kisatchie National Forest in Natchitoches Parish, Louisiana, USA, we have been counting the number of embryos per egg mass. We captured seven female A. maculatum in a small pool, six of which were still gravid. We took standard measurements, including SVL, and then implanted a Passive Integrated Transponder (PIT tag) into each adult female as was the protocol. About an hour after processing these animals we marked new A. maculatum egg masses found in the same small pool using PVC pin flags pushed carefully through the outer jelly. We did not have enough time to process them that evening, and it was not until a few days later that we photographed those masses. We discovered that one of the masses contained a PIT tag in the outer jelly that corresponded to one of the six gravid females that were marked that same evening. To our knowledge, this is the first report of PIT tags being the means, albeit coincidentally, by which a particular egg mass of Ambystoma maculatum has been assigned to a particular female. For our purposes, losing the PIT tag from the adult female is counter to the goals of our study of this population, and we will no longer be implanting PIT tags into gravid females.

  18. Distribution of viral antigen gp85 and provirus in various tissues from commercial meat-type and experimental white leghorn line 0 chickens with different subgroup J avian leukosis virus infection profiles (United States)

    Immunohistochemistry (IHC) and polymerase chain reaction (PCR) were used to test for the presence of subgroup J avian leukosis virus (ALV J) envelope antigen gp85 and provirus, respectively in various tissues (adrenal gland, bone marrow, gonad, heart, kidney, liver, lung, pancreas, proventriculus, s...

  19. Theoretical and functional complexity of white variegation of unripe fleshy fruits


    Lev-Yadun, Simcha


    In many plant species, the bright colors of ripe fruit serve to attract frugivores to enable efficient seed dispersal. Here I show that the fleshy fruit of several dozens of species originating from Asia (southeastern, eastern and central), the Middle East, Africa, America (South, Central and North), Australia, Polynesia and Micronesia, with fruit usually larger than 1 cm, have white or light green spots while they are still unripe. In many of these species, while the spots are conspicuous, t...

  20. Hot Spot Removal System: System description

    International Nuclear Information System (INIS)

    Hazardous wastes contaminated with radionuclides, chemicals, and explosives exist across the Department of Energy complex and need to be remediated due to environmental concerns. Currently, an opportunity is being developed to dramatically reduce remediation costs and to assist in the acceleration of schedules associated with these wastes by deploying a Hot Spot Removal System. Removing the hot spot from the waste site will remove risk driver(s) and enable another, more cost effective process/option/remedial alternative (i.e., capping) to be applied to the remainder of the site. The Hot Spot Removal System consists of a suite of technologies that will be utilized to locate and remove source terms. Components of the system can also be used in a variety of other cleanup activities. This Hot Spot Removal System Description document presents technologies that were considered for possible inclusion in the Hot Spot Removal System, technologies made available to the Hot Spot Removal System, industrial interest in the Hot Spot Removal System''s subsystems, the schedule required for the Hot Spot Removal System, the evaluation of the relevant technologies, and the recommendations for equipment and technologies as stated in the Plan section

  1. Experimental and simulated strength of spot welds

    DEFF Research Database (Denmark)

    Nielsen, Chris Valentin; Bennedbæk, Rune A.K.; Larsen, Morten B.;


    Weld strength testing of single spots in DP600 steel is presented for the three typical testing procedures, i.e. tensile-shear, cross-tension and peel testing. Spot welds are performed at two sets of welding parameters and strength testing under these conditions is presented by load-elongation cu...

  2. Hot Spot Removal System: System description

    Energy Technology Data Exchange (ETDEWEB)



    Hazardous wastes contaminated with radionuclides, chemicals, and explosives exist across the Department of Energy complex and need to be remediated due to environmental concerns. Currently, an opportunity is being developed to dramatically reduce remediation costs and to assist in the acceleration of schedules associated with these wastes by deploying a Hot Spot Removal System. Removing the hot spot from the waste site will remove risk driver(s) and enable another, more cost effective process/option/remedial alternative (i.e., capping) to be applied to the remainder of the site. The Hot Spot Removal System consists of a suite of technologies that will be utilized to locate and remove source terms. Components of the system can also be used in a variety of other cleanup activities. This Hot Spot Removal System Description document presents technologies that were considered for possible inclusion in the Hot Spot Removal System, technologies made available to the Hot Spot Removal System, industrial interest in the Hot Spot Removal System`s subsystems, the schedule required for the Hot Spot Removal System, the evaluation of the relevant technologies, and the recommendations for equipment and technologies as stated in the Plan section.

  3. HotSpot Software Configuration Management Plan

    Energy Technology Data Exchange (ETDEWEB)

    Walker, H; Homann, S G


    This Software Configuration Management Plan (SCMP) describes the software configuration management procedures used to ensure that the HotSpot dispersion model meets the requirements of its user base, which includes: (1) Users of the PC version of HotSpot for consequence assessment, hazard assessment and safety analysis calculations; and (2) Users of the NARAC Web and iClient software tools, which allow users to run HotSpot for consequence assessment modeling These users and sponsors of the HotSpot software and the organizations they represent constitute the intended audience for this document. This plan is intended to meet Critical Recommendations 1 and 3 from the Software Evaluation of HotSpot and DOE Safety Software Toolbox Recommendation for inclusion of HotSpot in the Department of Energy (DOE) Safety Software Toolbox. HotSpot software is maintained for the Department of Energy Office of Emergency Operations by the National Atmospheric Release Advisory Center (NARAC) at Lawrence Livermore National Laboratory (LLNL). An overview of HotSpot and NARAC are provided.

  4. Rocky Mountain spotted fever in Argentina (United States)

    Cases of epidemic typhus have been documented in Argentina since 1919; however, no confirmed reports of spotted fever rickettsiosis were described in this country until 1999. We describe the first molecular confirmation of Rickettsia rickettsii, the etiologic agent of Rocky Mountain spotted fever (R...

  5. Differential spot-size focus servo (United States)

    Milster, T. D.; Wang, M. S.; Froehlich, F. F.; Kann, J. L.; Treptau, J. P.; Erwin, K. E.


    We describe performance of a differential spot-size (wax-wane) focus servo. Crosstalk from the tracks are analyzed in the single detector and differential focus circuits. Magnitude of the crosstalk is reduced by a factor of three in the differential circuit. A false focus-error signal (FES) is present when the spot crosses sector marks at an angle.

  6. Element spots in HgMn stars (United States)

    Korhonen, H.


    A fraction of late B-type stars, the so-called HgMn stars, exhibit enhanced absorption lines of certain chemical elements, notably Hg and Mn, combined with an underabundance of He. For about a decade it has been known that the elements with anomalously high abundances in HgMn stars are distributed inhomogeneously over the stellar surface. Observation of the temporal evolution of those spots has been reported in a few HgMn stars, first of a secular evolution of the mercury spots in α And, and more recently of a fast evolution of yttrium and strontium spots in HD 11753. The fast evolution of spots in HD 11753 is combined with a slower change in the overall abundance of the elements affected. In this paper I review what is known about these ``elemental spots'' in HgMn stars and their secular and fast temporal evolution.

  7. Crack imaging by pulsed laser spot thermography

    International Nuclear Information System (INIS)

    A surface crack close to a spot heated by a laser beam impedes lateral heat flow and produces alterations to the shape of the thermal image of the spot that can be monitored by thermography. A full 3D simulation has been developed to simulate heat flow from a laser heated spot in the proximity of a crack. The modelling provided an understanding of the ways that different parameters affect the thermal images of laser heated spots. It also assisted in the development of an efficient image processing strategy for extracting the scanned cracks. Experimental results show that scanning pulsed laser spot thermography has considerable potential as a remote, non-contact crack imaging technique.

  8. Element spots in HgMn stars

    CERN Document Server

    Korhonen, Heidi


    A fraction of late B-type stars, the so-called HgMn stars, exhibit enhanced absorption lines of certain chemical elements, notably Hg and Mn, combined with an underabundance of He. For about a decade now the elements with anomalously high abundances in HgMn stars are known to be distributed inhomogeneously over the stellar surface. Temporal evolution of these elemental spots have been reported in a few HgMn stars, first secular evolution of the mercury spots in alpha And, and recently also a fast evolution of yttrium and strontium spots in HD 11753. The fast evolution of spots in HD 11753 is combined with a slower change in the overall abundance of the affected elements. In this paper I review what is known of elemental spots in HgMn stars and their secular and fast temporal evolution.

  9. Laser Spot Detection Based on Reaction Diffusion

    Directory of Open Access Journals (Sweden)

    Alejandro Vázquez-Otero


    Full Text Available Center-location of a laser spot is a problem of interest when the laser is used for processing and performing measurements. Measurement quality depends on correctly determining the location of the laser spot. Hence, improving and proposing algorithms for the correct location of the spots are fundamental issues in laser-based measurements. In this paper we introduce a Reaction Diffusion (RD system as the main computational framework for robustly finding laser spot centers. The method presented is compared with a conventional approach for locating laser spots, and the experimental results indicate that RD-based computation generates reliable and precise solutions. These results confirm the flexibility of the new computational paradigm based on RD systems for addressing problems that can be reduced to a set of geometric operations.

  10. Laser Spot Detection Based on Reaction Diffusion. (United States)

    Vázquez-Otero, Alejandro; Khikhlukha, Danila; Solano-Altamirano, J M; Dormido, Raquel; Duro, Natividad


    Center-location of a laser spot is a problem of interest when the laser is used for processing and performing measurements. Measurement quality depends on correctly determining the location of the laser spot. Hence, improving and proposing algorithms for the correct location of the spots are fundamental issues in laser-based measurements. In this paper we introduce a Reaction Diffusion (RD) system as the main computational framework for robustly finding laser spot centers. The method presented is compared with a conventional approach for locating laser spots, and the experimental results indicate that RD-based computation generates reliable and precise solutions. These results confirm the flexibility of the new computational paradigm based on RD systems for addressing problems that can be reduced to a set of geometric operations. PMID:26938537

  11. Diseases of white matter

    International Nuclear Information System (INIS)

    The diagnosis of white matter abnormalities was revolutionized by the advent of computed tomography (CT), which provided a noninvasive method of detection and assessment of progression of a variety of white matter processes. However, the inadequacies of CT were recognized early, including its relative insensitivity to small foci of abnormal myelin in the brain when correlated with autopsy findings and its inability to image directly white matter diseases of the spinal cord. Magnetic resonance imaging (MRI), on the other hand, sensitive to the slight difference in tissue composition of normal gray and white matter and to subtle increase in water content associated with myelin disorders, is uniquely suited for the examination of white matter pathology. Its clinical applications include the evaluation of the normal process of myelination in childhood and the various white matter diseases, including disorders of demyelination and dysmyelination

  12. Robust design of spot welds in automotive structures: A decision-making methodology (United States)

    Ouisse, M.; Cogan, S.


    analyst to plan robust resistance spot welds designs along with quality controls in order to insure a specified level of structural performance. All examples are presented on a full body-in-white structure (one million dofs and thousands spot welds).

  13. Production System of Virus-free Apple Plants Using Heat Treatment and Shoot Tip CultureShoot Tip Culture


    Gunsup Lee; Il Sheob Shin; Kang Hee Cho; Se Hee Kim; Juhee Shin; Dae Hyun Kim; Jeong Hee Kim; Hyun Ran Kim


    In worldwide, viral diseases of apple plants has caused the serious problems like reduced production and malformation of fruits. Also, the damages of apple plants by virus and/or viroid infection (Apple chlorotic leaf spot virus, Apple stem grooving virus, Apple mosaic virus, and Apple scar skin viroid) were reported in Korea. However there is few report about the protection approach against the infection by apple viruses. Therefore, this paper introduced the experimental protocol...

  14. 7 CFR 28.412 - Strict Middling Light Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Strict Middling Light Spotted Color. 28.412 Section 28... Light Spotted Color. Strict Middling Light Spotted Color is color which in spot or color, or both, is between Strict Middling Color and Strict Middling Spotted Color....

  15. 7 CFR 28.413 - Middling Light Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Middling Light Spotted Color. 28.413 Section 28.413... Spotted Color. Middling Light Spotted Color is color which in spot or color, or both, is between Middling Color and Middling Spotted Color....

  16. 7 CFR 28.415 - Low Middling Light Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Low Middling Light Spotted Color. 28.415 Section 28... Spotted Color. Low Middling Light Spotted Color is color which in spot or color, or both, is between Low Middling Color and Low Middling Spotted Color....

  17. 7 CFR 28.411 - Good Middling Light Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Good Middling Light Spotted Color. 28.411 Section 28... Light Spotted Color. Good Middling Light Spotted Color is color which in spot or color, or both, is between Good Middling Color and Good Middling Spotted Color....

  18. White matter dementia


    Filley, Christopher M.


    White matter dementia (WMD) is a syndrome introduced in 1988 to highlight the potential of cerebral white matter disorders to produce cognitive loss of sufficient severity to qualify as dementia. Neurologists have long understood that such a syndrome can occur, but the dominance of gray matter as the locus of higher function has strongly directed neurobehavioral inquiry to the cerebral cortex while white matter has received less attention. Contemporary neuroimaging has been crucial in enablin...

  19. AY Ceti - A flaring, spotted star with a hot companion (United States)

    Simon, T.; Fekel, F. C., Jr.; Gibson, D. M.


    AY Ceti is a late-type single-line spectroscopic binary, a bright X-ray source (L/x/ equal to about 1.5 x 10 to the 31st ergs/s), and a spotted star, as evidenced by its prominent photometric wave. In this paper, observations made with the IUE satellite and the VLA radio interferometer are reported. The 1200-2000 A UV spectrum of AY Cet shows a hot stellar continuum and a very broad Ly-alpha absorption line from a previously unobserved white dwarf secondary. The UV spectrum can be matched to the energy distribution of a (T/eff/ = 18,000 K, log g = 8) model atmosphere. Superposed on this hot continuum are high-excitation emission lines typical of chromospheres and transition regions of active late-type stars, e.g., the spotted RS CVn binaries. It is concluded that the bright lines and soft X-ray emission of AY Cet arise from the cool primary star, rather than from mass transfer and accretion onto the secondary as has recently been proposed for the similar system 56 Peg. Two strong radio flares on AY Cet were observed. The second was rapidly variable and left-hand circularly polarized at levels up to pi(c) = 86 + or - 5 percent at 20 cm wavelength. The most likely emission mechanism is an electron-cyclotron maser.

  20. Bilateral Macular Roth Spots as a Manifestation of Subacute Endocarditis

    Directory of Open Access Journals (Sweden)

    Karolina Ceglowska


    Full Text Available A 42-year-old man presented with a 2-day history of impaired vision in the right eye (OD. The best corrected visual acuity (BCVA (LogMAR was 1.1 for the right eye and 0.0 for the left eye (OS. Fundus examination revealed white-centered hemorrhages resembling Roth spots in both macular regions. The spectral-domain optical coherence tomography (SD-OCT showed intraretinal pseudocysts and hyperreflective deposits in the areas corresponding to the Roth spots. Conducted blood tests revealed elevated D-dimer concentration, increased total number of neutrophils, high C-reactive protein concentration, and elevated erythrocyte sedimentation rate. Procalcitonin concentration, platelet count, and body temperature were within normal ranges. A blood culture was ordered and yielded Streptococcus mitis and intravenous antibiotics were started immediately. The patient started complaining of chest and left calf pain. The systemic examination revealed infective endocarditis accompanied by bicuspid aortic valve and paravalvular abscess formation. The patient underwent cardiac surgery with mechanical aortic valve implantation. After recovery, the patient’s visual acuities improved fully. Control ophthalmic examination, including SD-OCT, showed no abnormalities.

  1. Bilateral Macular Roth Spots as a Manifestation of Subacute Endocarditis. (United States)

    Ceglowska, Karolina; Nowomiejska, Katarzyna; Kiszka, Agnieszka; Koss, Michael J; Maciejewski, Ryszard; Rejdak, Robert


    A 42-year-old man presented with a 2-day history of impaired vision in the right eye (OD). The best corrected visual acuity (BCVA) (LogMAR) was 1.1 for the right eye and 0.0 for the left eye (OS). Fundus examination revealed white-centered hemorrhages resembling Roth spots in both macular regions. The spectral-domain optical coherence tomography (SD-OCT) showed intraretinal pseudocysts and hyperreflective deposits in the areas corresponding to the Roth spots. Conducted blood tests revealed elevated D-dimer concentration, increased total number of neutrophils, high C-reactive protein concentration, and elevated erythrocyte sedimentation rate. Procalcitonin concentration, platelet count, and body temperature were within normal ranges. A blood culture was ordered and yielded Streptococcus mitis and intravenous antibiotics were started immediately. The patient started complaining of chest and left calf pain. The systemic examination revealed infective endocarditis accompanied by bicuspid aortic valve and paravalvular abscess formation. The patient underwent cardiac surgery with mechanical aortic valve implantation. After recovery, the patient's visual acuities improved fully. Control ophthalmic examination, including SD-OCT, showed no abnormalities. PMID:26839725

  2. Whiteness in Social Work Education Authentic White Allies (United States)

    Hornung, Rebecca


    This dissertation is guided by the following questions: How do People of Color define and experience White people as "authentic" allies? What does a White ally look like to People of Color? How do White allies view themselves as "authentic" White allies? What experiences lead White people to anti-racism and anti-racist praxis?…

  3. Parasites, diseases, and health status of sympatric populations of sika deer and white-tailed deer in Maryland and Virginia. (United States)

    Davidson, W R; Crow, C B


    In July 1981, investigations on parasites, diseases, and herd health status were conducted on sympatric populations of sika deer (Cervus nippon) and white-tailed deer (Odocoileus virginianus) from Blackwater National Wildlife Refuge (Maryland) and Chincoteague National Wildlife Refuge (Virginia) on the Delmarva Peninsula. Five adult deer of each species were collected from each location and subjected to thorough necropsy examinations and laboratory tests. White-tailed deer at both locations harbored protozoan, helminth, and arthropod parasites typically associated with this species throughout the southeastern United States. In contrast, sika deer at both locations harbored only light burdens of ticks, chiggers, and sarcocysts. Serologic tests for antibodies to seven infectious disease agents revealed evidence of exposure to bovine virus diarrhea (BVD) virus, infectious bovine rhinotracheitis virus, and parainfluenza3 virus in white-tailed deer, but only BVD virus in sika deer. At both locations the general health status of sika deer was superior to that of white-tailed deer. PMID:6644934

  4. Superluminal Spot Pair Events in Astronomical Settings: Sweeping Beams

    CERN Document Server

    Nemiroff, Robert J


    Sweeping beams of light can cast spots moving with superluminal speeds across scattering surfaces. Such faster-than-light speeds are well-known phenomena that do not violate special relativity. It is shown here that under certain circumstances, superluminal spot pair creation and annihilation events can occur that provide unique information to observers. These spot pair events are {\\it not} particle pair events -- they are the sudden creation or annihilation of a pair of relatively illuminated spots on a scattering surface. Real spot pair illumination events occur unambiguously on the scattering surface when spot speeds diverge, while virtual spot pair events are observer dependent and perceived only when real spot radial speeds cross the speed of light. Specifically, a virtual spot pair creation event will be observed when a real spot's speed toward the observer drops below $c$, while a virtual spot pair annihilation event will be observed when a real spot's radial speed away from the observer rises above $c...

  5. Occurrence of viruses infecting pea in Iran. (United States)

    Esfandiari, N; Kohi-Habibi, M; Mosahebi, Gh


    A survey was conducted to determine the incidence of Alfalfa mosaic virus (AMV), Bean yellow mosaic virus (BYMV), Broad bean wilt virus-1 (BBWV), Pea leafroll virus (PLRV), Pea enation mosaic virus (PEMV), Pea seed borne mosaic virus (PSbMV), Potato virus x(PVX), Tomato mosaic virus (ToMV), Tomato spotted wilt virus (TSWV) on pea (Pisum sativum) in Iran. A Total of 1276 random and 684 symptomatic pea samples were collected during the spring and summer of 2002-2004 in Tehran province of Iran, where pea is grown, and tested by enzyme-linked immunosorbent assay (ELISA) using specific polyclonal antibodies. Serological diagnoses were confirmed by electron microscopy and host range studies. Incidence of viruses in decreasing order was PVX (69%), ToMV (59%), PSbMV (36.6%), BBWV-1 (26.1%), BYMV (20.3%), AMV (17.77%), TSWV (12.6%), PEMV (10.9%), PLRV (6.78%). In this survey, natural occurrence of AMV, BBWV-1, PSbMV, TSWV, PVX and ToMV was reported for the first time on the pea in Iran. PMID:17390891

  6. Modelling turbulent spots in swept boundary layers

    International Nuclear Information System (INIS)

    Highlights: • A linear perturbation method can capture the important flow features within a turbulent spot. • The horseshoe vortex in the perturbed velocity field is the dominant flow feature. • Sweep leads to skewing of the turbulent spot and calmed region. • The effects of pressure gradient are generally reduced by sweep. -- Abstract: A computational technique is presented for determining the fully 3-d viscid unsteady perturbation to a non-developing laminar swept boundary layer. For zero pressure gradient, unswept boundary layers, the perturbation method reveals a strongly three dimensional flow within the turbulent spot and its associated calmed region which is very similar to that observed in experiments and full DNS calculations. The perturbation method cannot predict turbulent motion but nevertheless provides a simple yet accurate means of studying and understanding the development of turbulent spot geometry. The most influential flow feature is the horseshoe vortex observed in the fluctuation velocity field, which is responsible for delivering the fluid found in the calmed region between its trailing legs. The upwards flow around the outer periphery of the vortex is also responsible for delivering low momentum fluid to the spot, but additional high momentum fluid also enters the spot from its rear through the downward sweeping motion of fluid between the vortex legs. The effect of an adverse streamwise pressure gradient is to increase the size of the spot and calmed region whereas a favourable pressure gradient has the opposite effect. When sweep is introduced to the boundary layer the spot is skewed for all non-zero pressure gradients, but the changes in size of the spot and calmed region due to pressure gradient are reduced. For favourable pressure gradients the skew increases monotonically with sweep, but this is not the case for adverse pressure gradients where the effect of sweep is more complex

  7. Creating White Australia

    DEFF Research Database (Denmark)

    McLisky, Claire Louise; Carey, Jane

    Vedtagelsen af White Australien som regeringens politik i 1901 viser, at hvidheden var afgørende for den måde, hvorpå den nye nation i Australien blev konstitueret. Og alligevel har historikere i vid udstrækning overset hvidhed i deres studier af Australiens race fortid. 'Creating White Australia...

  8. White Blood Cell Count (United States)

    ... and does not endorse non-AACC products and services. Advertising & Sponsorship: Policy | Opportunities PLEASE NOTE: Your web browser does not have JavaScript enabled. Unless you enable ... Share this page: Was this page helpful? Also known as: WBC Count; Leukocyte Count; White Count Formal name: White ...

  9. White Dwarf Stars (United States)

    Kawaler, Steven; Dahlstrom, Michael


    A white dwarf is a very dense star: The earth-sized remains of a Sun-like star that has burned all of its nuclear fuel. Although it's unable to carry out the workaday activities of a living star, a white dwarf is still an interesting object to astronomers. For one thing, white dwarfs experience "starquakes"—gentle pulsations that allow astronomers to deduce certain physical qualities of the star, such as its mass, rate of rotation, its structure and the strength of its magnetic field. The authors have been studying the starquakes with a global network of instruments, collectively called the Whole Earth Telescope, which provide around-the-clock observations of a white dwarf's seismic activity. Kawaler and Dahlstrom discuss what we know about white dwarfs and their significance for questions concerning the age of our Galaxy and the composition of dark matter.

  10. White Students Reflecting on Whiteness: Understanding Emotional Responses


    Todd, Nathan R.; Spanierman, Lisa B.; Aber, Mark S.


    In the present investigation, the authors explored potential predictors of White students’ general emotional responses after they reflected on their Whiteness in a semi-structured interview (n = 88) or written reflection (n = 187). Specifically, the authors examined how color-blindness (i.e., awareness of White privilege) and racial affect (i.e., White empathy, White guilt, and White fear), assessed before the interview or written reflection, may predict positive and negative emotional respon...

  11. Formation of white-eye pattern with microdischarge in an air dielectric barrier discharge system


    He, Yafeng; Dong, Lifang; Liu, Weili; Wang, Hongfang; Zhao, Zengchao; FAN, WEILI


    We report on the first observation of white-eye pattern in an air dielectric barrier discharge. The patterned discharges undergo a development as following: random spots - quasihexagonal pattern - hexagonal pattern (type I) - hexagonal pattern (type II) - white-eye pattern - chaos as the voltage is increased. The spatiotemporal characteristics of patterned discharges are investigated by using an optical method. Results show that the two discharge modes, uniform mode and filamentary mode, are ...

  12. Inhibitory effect of Newcastle disease virus on hepatic fibrosis induced by CCl4

    Directory of Open Access Journals (Sweden)

    Ya-lin LI


    Full Text Available Objective To explore the inhibitory effect of Newcastle diseases virus (NDV on CCl4-induced liver fibrosis in mice. Methods Liver fibrosis model was reproduced in 30 Kunming mice by intraperitoneal injection of CCl4/peanut oil solution for 2 times a week, and the total treatment lasted for 8 weeks. Three days after last injection, NDV was injected through tail vein for 1 or 3 times (24h intervals. Twenty-four hours after NDV infusion, mice were sacrificed and the livers were removed for gross morphology observation. The liver tissue sections were stained by HE and Sirius red dyeing. α-smooth muscle actin (α-SMA expression was detected by Western blotting. Results After CCl4 induction for 8 weeks, obvious fibrosis symptoms appeared in the liver of model mice, and the surface of liver tissue became hard with rough, with white patches on it. HE staining showed that there was loosening of tissue and enlarged perisinusoidal spaces in liver with fibrosis. Sirius red dyeing displayed abnormal collagen deposition in the fibrotic liver tissues. After NDV injection for 3 times, white spots on the surface of mouse liver were significantly reduced, and collagen deposition was lowered. Western blotting showed that α-SMA levels decreased with increasing frequency of NDV injection. Conclusion NDV may effectively suppress the development of CCl4-induced liver fibrosis in mice. DOI: 10.11855/j.issn.0577-7402.2013.11.003

  13. A comprehensive overview of the Cold Spot

    CERN Document Server

    Vielva, P


    The report of a significant deviation of the CMB temperature anisotropies distribution from Gaussianity (soon after the public release of the WMAP data in 2003) has become one of the most solid WMAP anomalies. This detection grounds on an excess of the kurtosis of the Spherical Mexican Hat Wavelet coefficients at scales of around 10 degrees. At these scales, a prominent feature --located in the southern Galactic hemisphere-- was highlighted from the rest of the SMHW coefficients: the Cold Spot. This article presents a comprehensive overview related to the study of the Cold Spot, paying attention to the non-Gaussianity detection methods, the morphological characteristics of the Cold Spot, and the possible sources studied in the literature to explain its nature. Special emphasis is made on the Cold Spot compatibility with a cosmic texture, commenting on future tests that would help to give support or discard this hypothesis.

  14. Lupus a Tough Disease to Spot, Treat (United States)

    ... Lupus a Tough Disease to Spot, Treat But experts ... 30, 2016 MONDAY, May 30, 2016 (HealthDay News) -- Lupus is difficult to diagnose and treat, but scientists ...

  15. SPOT Controlled Image Base 10 meter (United States)

    U.S. Geological Survey, Department of the Interior — SPOT Controlled Image Base 10 meter (CIB-10) is a collection of orthorectified panchromatic (grayscale) images. The data were acquired between 1986 and 1993 by the...

  16. Measuring microfocus focal spots using digital radiography

    Energy Technology Data Exchange (ETDEWEB)

    Fry, David A [Los Alamos National Laboratory


    Measurement of microfocus spot size can be important for several reasons: (1) Quality assurance during manufacture of microfocus tubes; (2) Tracking performance and stability of microfocus tubes; (3) Determining magnification (especially important for digital radiography where the native spatial resolution of the digital system is not adequate for the application); (4) Knowledge of unsharpness from the focal spot alone. The European Standard EN 12543-5 is based on a simple geometrical method of calculating focal spot size from unsharpness of high magnification film radiographs. When determining microfocus focal spot dimensions using unsharpness measurements both signal-to-noise (SNR) and magnification can be important. There is a maximum accuracy that is a function of SNR and therefore an optimal magnification. Greater than optimal magnification can be used but it will not increase accuracy.

  17. Plasma spot welding of ferritic stainless steels

    International Nuclear Information System (INIS)

    Plasma spot wedding of ferritic stainless steels studied. The study was focused on welding parameters, plasma and shieldings and the optimum welding equipment. Plasma-spot welded overlap joints on a 0.8 mm thick ferritic stainless steel sheet were subjected to a visual examination and mechanical testing in terms of tension-shear strength. Several macro specimens were prepared Plasma spot welding is suitable to use the same gas as shielding gas and as plasma gas , i. e. a 98% Ar/2% H2 gas mixture. Tension-shear strength of plasma-spot welded joint was compared to that of resistance sport welded joints. It was found that the resistance welded joints withstand a somewhat stronger load than the plasma welded joints due to a large weld sport diameter of the former. Strength of both types of welded joints is approximately the same. (Author) 32 refs

  18. Asparagus Beetle and Spotted Asparagus Beetle


    Erin W Hodgson; Drost, Dan


    Asparagus beetle, Crioceris asparagi, and spotted asparagus beetle, C. duodecimpunctata are leaf beetles in the family Chrysomelidae. These beetles feed exclusively on asparagus and are native to Europe. Asparagus beetle is the more economically injurious of the two species.

  19. Investigations of initiation spot size effects

    Energy Technology Data Exchange (ETDEWEB)

    Clarke, Steven A [Los Alamos National Laboratory; Akinci, Adrian A [Los Alamos National Laboratory; Leichty, Gary [Los Alamos National Laboratory; Schaffer, Timothy [Los Alamos National Laboratory; Murphy, Michael J [Los Alamos National Laboratory; Munger, Alan [Los Alamos National Laboratory; Thomas, Keith A [Los Alamos National Laboratory


    As explosive components become smaller, a greater understanding of the effect of initiation spot size on detonation becomes increasingly critical. A series of tests of the effect of initiation spot size will be described. A series of DOI (direct optical initiation) detonators with initiation spots sizes from {approx}50 um to 1000um have been tested to determine laser parameters for threshold firing of low density PETN pressings. Results will be compared with theoretical predictions. Outputs of the initiation source (DOI ablation) have been characterized by a suite of diagnostics including PDV and schlieren imaging. Outputs of complete detonators have been characterized using PDV, streak, and/or schlieren imaging. At present, we have not found the expected change in the threshold energy to spot size relationship for DOI type detonators found in similar earlier for projectiles, slappers and EBWs. New detonators designs (Type C) are currently being tested that will allow the determination of the threshold for spot sizes from 250 um to 105um, where we hope to see change in the threshold vs. spot size relationship. Also, one test of an extremely small diameter spot size (50um) has resulted in preliminary NoGo only results even at energy densities as much as 8 times the energy density of the threshold results presented here. This gives preliminary evidence that 50um spot may be beyond the critical initiation diameter. The constant threshold energy to spot size relationship in the data to date does however still give some insight into the initiation mechanism of DOI detonators. If the DOI initiation mechanism were a 1D mechanism similar to a slapper or a flyer impact, the expected inflection point in the graph would have been between 300um and 500um diameter spot size, within the range of the data presented here. The lack of that inflection point indicates that the DOI initiation mechanism is more likely a 2D mechanism similar to a sphere or rod projectile. We expect to

  20. Chikungunya Virus (United States)

    ... Gaines, PhD, MPH, MA, CHES Differentiating Chikungunya From Dengue: A Clinical Challenge For Travelers CDC Travelers' Health Chikungunya Virus Home Prevention Transmission Symptoms & Treatment Geographic Distribution Chikungunya virus in ...

  1. Zika Virus (United States)

    Zika is a virus that is spread mostly by mosquitoes. A pregnant mother can pass it to ... through blood transfusions. There have been outbreaks of Zika virus in the United States, Africa, Southeast Asia, ...

  2. Chikungunya virus (United States)

    Chikungunya virus infection; Chikungunya ... Where Chikungunya is found Before 2013, the virus was found in Africa, Asia, Europe, and the Indian and Pacific oceans. In late 2013, outbreaks occurred for the first time in the ...

  3. X-ray spot film device

    International Nuclear Information System (INIS)

    Improvements are described in an X-ray spot film device which is used in conjunction with an X-ray table to make a selected number of radiographic exposures on a single film and to perform fluoroscopic examinations. To date, the spot film devices consist of two X-ray field defining masks, one of which is moved manually. The present device is more convenient to use and speeds up the procedure. (U.K.)

  4. Presence and Distribution of Tobacco Viruses in Montenegro

    Directory of Open Access Journals (Sweden)

    Jelena Zindović


    Full Text Available Seven important tobacco viruses were investigated in Montenegro in 2005: Tobacco Mosaic Virus (TMV, Tomato Spotted Wilt Virus (TSWV, Cucumber Mosaic Virus (CMV, Potato Virus Y (PVY, Alfalfa Mosaic Virus (AMV, Tobacco Ring Spot Virus (TRSV and Potato Virus X(PVX. This investigation included sample collection from four tobacco growing regions in Montenegro and their serological testing by DAS-ELISA test. Presence of different strains of PVY was investigated as well using DAS ELISA test with specific monoclonal antibodies.Serological results proved the presence of four tobacco viruses (TMV, CMV, PVY and AMV, while TSWV, TRSV and PVX were not found in the tested samples of tobacco crops in Montenegro. The results also showed that TMV and CMV were the most frequent (44.6% and 41.5% of tested samples, respectively followed by PVY (15.4% and the least frequent AMV (3.1%. Most samples were infected with one of the examined viruses. In the PVY population found in Montenegro, its necrotic strain (PVYN was absolutely predominant.The results indicated the significance of TMV and CMV concerning tobacco viral infections in Montenegro, as well as a necessity of their detailed characterization at biological and molecular level.

  5. Two plasmolipins from the black tiger shrimp, Penaeus monodon and their response to virus pathogens. (United States)

    Vatanavicharn, Tipachai; Pongsomboon, Siriporn; Tassanakajon, Anchalee


    Two isoforms of plasmolipin were initially identified from the black tiger shrimp (Penaeus monodon) EST database and completed using 50 RACE to reveal complete cDNAs of 558 bp (PmPLP1) and 537 bp(PmPLP2) with 87% nucleotide sequence identity. The deduced amino acid sequences contained four-transmembrane domains and showed the highest amino acid identity (49% and 51%, respectively) to the honey bee (Apis mellifera) chemokine-like factor (CKLF), with a very similar hydrophobic pattern to other plasmolipins. Transcripts of PmPLP1 and PmPLP2 were observed in all tested shrimp tissues with the highest expression levels in the gill and epipodite for PmPLP1 and in the hemocytes and antennal gland for PmPLP2. PmPLP1 transcript levels were significantly upregulated in hemocytes at 24 and 72 h post infection (hpi) with yellow head virus (YHV) (7.4- and 14.7- fold, respectively), but only after 72 hpi by white spot syndrome virus (WSSV). In contrast, PmPLP2 was only slightly (but statistically significant)up-regulated with YHV and WSSV. Thus, PmPLPs have the potential to be a part of viral infection mechanisms or defense response. This is the first characterization of a plasmolipin gene in crustaceans. PMID:22766100

  6. ECHO virus (United States)

    Enteric cytopathic human orphan (ECHO) viruses are a group of viruses that lead to gastrointestinal infection and skin rashes. ... Echovirus is one of several families of viruses that affect the ... are common. In the United States, they are most common in ...

  7. Zika Virus (United States)

    ... Zika Virus | See Q&A —June 21, 2016 Zika Virus Protein Could Be Vaccine Target —May 19, 2016 Research Conducted and Supported by the National Institutes of Health (NIH) in Addressing Zika Virus Disease. Testimony before the House Democratic Steering ...

  8. Chemical composition on cacao leaves infected by viruses

    International Nuclear Information System (INIS)

    Chemical analysis on cacao leaves that have chlorosis spots caused by cocoa swollen shoot viruses were carried out. It can be shown that leaves with chlorosis spots contain less chlorophyl and lipides than those without, but both do not show any significant difference in the concentration of water, glucose, saccharides, amino acid and proteins. It can be concluded that transport systems in the infected leaves are good so that the water and saccharides distribution in them are not disturbed. (author tr.)

  9. Chemical composition on cacao leaves infected by viruses

    Energy Technology Data Exchange (ETDEWEB)

    Mustafa, M.; Delilah, M.; Syafrul, L.; Suryadi


    Chemical analysis on cacao leaves that have chlorosis spots caused by cacao swollen shoot viruses were carried out. It can be shown that leaves with chlorosis spots contain less chlorophyl and lipides than those without, but both do not show any significant difference in the concentration of water, glucose, saccharides, amino acid and proteins. It can be concluded that transport systems in the infected leaves are good so that the water and saccharides distribution in them are not disturbed.

  10. Spot weld arrangement effects on the fatigue behavior of multi-spot welded joints

    International Nuclear Information System (INIS)

    In the present study, the effects of spot weld arrangements in multi-spot welded joints on the fatigue behavior of the joints are studied. Three different four-spot welded joints are considered: one-row four-spot parallel to the loading direction, one-row four-spot perpendicular to the loading direction and two-row four-spot weld specimens. The experimental fatigue test results reveal that the differences between the fatigue lives of three spot welded types in the low cycle regime are more considerable than those in the high cycle regime. However, all kinds of spot weld specimens have similar fatigue strength when approaching a million cycles. A non-linear finite element analysis is performed to obtain the relative stress gradients, effective distances and notch strength reduction factors based on the volumetric approach. The work here shows that the volumetric approach does a very good job in predicting the fatigue life of the multi-spot welded joints

  11. Whiteness Studies I


    Kolchin, Peter


    Whiteness Studies. Over the past two decades, scholars in the social sciences and humanities have increasingly focused on « whiteness » as a new way of exploring race and racism in America. These two articles evaluate the way historians have approached the subject. The first article, originally published in the Journal of American History in 2002, examines the development of whiteness studies in the 1990s, and the second, which appears here for the first time, provides an update on more recen...

  12. Whiteness Studies II


    Kolchin, Peter


    Whiteness Studies. Over the past two decades, scholars in the social sciences and humanities have increasingly focused on « whiteness » as a new way of exploring race and racism in America. These two articles evaluate the way historians have approached the subject. The first article, originally published in the Journal of American History in 2002, examines the development of whiteness studies in the 1990s, and the second, which appears here for the first time, provides an update on more recen...

  13. Physical white chaos generation

    CERN Document Server

    Wang, Anbang; Wang, Bingjie; Li, Lei; Zhang, Mingjiang; Zhang, Wendong


    Physical chaos is a fascinating prospect for high-speed data security by serving as a masking carrier or a key source, but suffers from a colored spectrum that divulges system's intrinsic oscillations and degrades randomness. Here, we demonstrate that physical chaos with a white spectrum can be achieved by the optical heterodyning of two delayed-feedback lasers. A white chaotic spectrum with 1-dB fluctuation in a band of 11 GHz is experimentally obtained. The white chaos also has a perfect delta-like autocorrelation function and a high dimensionality of greater than 10, which makes chaos reconstruction extremely difficult and thus improves security.

  14. Hypermedicalization in White Noise. (United States)

    Benson, Josef


    The Nazis hijacked Germany's medical establishment and appropriated medical language to hegemonize their ideology. In White Noise, shifting medical information stifles the public into docility. In Nazi Germany the primacy of language and medical authority magnified the importance of academic doctors. The muddling of identities caused complex insecurities and the need for psychological doubles. In White Noise, Professor Gladney is driven by professional insecurities to enact a double in Murray. Through the manipulation of language and medical overreach the U.S., exemplified in the novel White Noise, has become a hypermedicalized society where the spirit of the Hippocratic Oath has eroded. PMID:24458659

  15. White Blood Cell Disorders (United States)

    ... where they are needed, and then kill and digest the harmful organism or substance (see White blood ... Patel Hello Everyone! Hello to all of you readers! I know you will be seeing my biography, ...

  16. White Racial Identity Statuses as Predictors of White Privilege Awareness (United States)

    Hays, Danica G.; Chang, Catherine Y.; Havice, Pamela


    This study explored the relationship between White privilege awareness and White racial identity development for 197 counseling trainees. Results indicated that 3 of J. E. Helms's (1984, 1990, 1995) White racial identity statuses (i.e., Contact, Reintegration, and Immersion/Emersian) significantly predicted White privilege awareness. Implications…


    International Nuclear Information System (INIS)

    The nearly continuous timewise coverage of recent photometric surveys is free of the large gaps that compromise attempts to follow starspot growth and decay as well as motions, thereby giving incentive to improve computational precision for modeled spots. Due to the wide variety of star systems in the surveys, such improvement should apply to light/velocity curve models that accurately include all the main phenomena of close binaries and rotating single stars. The vector fractional area (VFA) algorithm that is introduced here represents surface elements by small sets of position vectors so as to allow accurate computation of circle-triangle overlap by spherical geometry. When computed by VFA, spots introduce essentially no noticeable scatter in light curves at the level of one part in 10,000. VFA has been put into the Wilson-Devinney light/velocity curve program and all logic and mathematics are given so as to facilitate entry into other such programs. Advantages of precise spot computation include improved statistics of spot motions and aging, reduced computation time (intrinsic precision relaxes needs for grid fineness), noise-free illustration of spot effects in figures, and help in guarding against false positives in exoplanet searches, where spots could approximately mimic transiting planets in unusual circumstances. A simple spot growth and decay template quantifies time profiles, and specifics of its utilization in differential corrections solutions are given. Computational strategies are discussed, the overall process is tested in simulations via solutions of synthetic light curve data, and essential simulation results are described. An efficient time smearing facility by Gaussian quadrature can deal with Kepler mission data that are in 30 minute time bins.

  18. MR imaging of white matter lesions in AIDS

    International Nuclear Information System (INIS)

    Autopsy reports have shown white-matter abnormalities from infection of the brain by the human immunodeficiency virus (HIV), the agent that causes acquired immunodeficiency syndrome (AIDS). The authors observed abnormal signal on T2-weighted images in the white matter of approximately one third of all AIDS patients. Of 50 patients with white-matter lesions, approximately two thirds had no clinical or biopsy evidence of cytomegalovirus, toxoplasmosis, PML, or lymphoma. Several patients were shown at autopsy to have isolated evidence of HIV encephalitis. The authors conclude that white-matter lesions are common in AIDS and are frequently caused by infection with HIV. Some MR findings may be helpful in characterizing these lesions, but the various etiologies are often indistinguishable

  19. 7 CFR 28.423 - Middling Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Middling Spotted Color. 28.423 Section 28.423... REGULATIONS COTTON CLASSING, TESTING, AND STANDARDS Standards Spotted Cotton § 28.423 Middling Spotted Color. Middling Spotted Color is color which is within the range represented by a set of samples in the custody...

  20. Sunshine virus in Australian pythons. (United States)

    Hyndman, Timothy H; Shilton, Cathy M; Doneley, Robert J T; Nicholls, Philip K


    Sunshine virus is a recently discovered novel paramyxovirus that is associated with illness in snakes. It does not phylogenetically cluster within either of the two currently accepted paramyxoviral subfamilies. It is therefore only distantly related to the only other known genus of reptilian paramyxoviruses, Ferlavirus, which clusters within the Paramyxovirinae subfamily. Clinical and diagnostic aspects associated with Sunshine virus are as yet undescribed. The objective of this paper was to report the clinical presentation, virus isolation, PCR testing and pathology associated with Sunshine virus infection. Clinical records and samples from naturally occurring cases were obtained from two captive snake collections and the archives of a veterinary diagnostic laboratory. The clinical signs that are associated with Sunshine virus infection are localised to the neurorespiratory systems or are non-specific (e.g. lethargy, inappetence). Out of 15 snakes that were infected with Sunshine virus (detected in any organ by either virus isolation or PCR), the virus was isolated from four out of ten (4/10) sampled brains, 3/10 sampled lungs and 2/7 pooled samples of kidney and liver. In these same 15 snakes, PCR was able to successfully detect Sunshine virus in fresh-frozen brain (11/11), kidney (7/8), lung (8/11) and liver (5/8); and various formalin-fixed paraffin-embedded tissues (7/8). During a natural outbreak of Sunshine virus in a collection of 32 snakes, the virus could be detected in five out of 39 combined oral-cloacal swabs that were collected from 23 of these snakes over a 105 day period. All snakes that were infected with Sunshine virus were negative for reovirus and ferlavirus by PCR. Snakes infected with Sunshine virus reliably exhibited hindbrain white matter spongiosis and gliosis with extension to the surrounding grey matter and neuronal necrosis evident in severe cases. Five out of eight infected snakes also exhibited mild bronchointerstitial pneumonia

  1. Formation of white-eye pattern with microdischarge in an air dielectric barrier discharge system

    CERN Document Server

    He, Yafeng; Liu, Weili; Wang, Hongfang; Zhao, Zengchao; Fan, Weili


    We report on the first observation of white-eye pattern in an air dielectric barrier discharge. The patterned discharges undergo a development as following: random spots - quasihexagonal pattern - hexagonal pattern (type I) - hexagonal pattern (type II) - white-eye pattern - chaos as the voltage is increased. The spatiotemporal characteristics of patterned discharges are investigated by using an optical method. Results show that the two discharge modes, uniform mode and filamentary mode, are actually two different spatial presentations of the same origin: the microdischarge. From the viewpoint of pattern dynamics, the white-eye pattern results from a 3-wave resonance interaction.

  2. High luminance low etendue white light source using blue laser over static phosphor (United States)

    Farooq, Tayyab; Qian, KeYuan


    A High Luminance White Light source for Etendue limited application has been demonstrated in this research paper by using blue InGaN laser diode beam over static source of phosphor Ce: YAG layer. Phosphor target has kept static because moving phosphor target light output is not constant and uniform. Different color temperatures had been obtained by varying phosphor concentration and thickness of the layer. When laser beam has focused on phosphor target spot, it induced very high temperature at that spot area. Temperature induced in the layer by laser beam depends on the layer thickness. All the layer thickness, surface temperature, output light flux, efficiency, and light color temperature are interrelate with each other. Uniform laser beam distribution, surface temperature, laser spot size, phosphor layer thickness are successfully calculated. Luminous efficiency, light color temperature, flux, wavelength spectrum, and light output power of laser driven white light source had been successfully observed at different laser beam powers.



    Awater, Holger; Kerlin, Jess R.; Evans, Karla K.; Tong, Frank


    The neural mechanism that mediates perceptual filling-in of the blind spot is still under discussion. One hypothesis proposes that the cortical representation of the blind spot is activated only under conditions that elicit perceptual filling-in, and requires congruent stimulation on both sides of the blind spot. Alternatively, the passive remapping hypothesis proposes that inputs from regions surrounding the blind spot infiltrate the representation of the blind spot in cortex. This theory pr...


    Institute of Scientific and Technical Information of China (English)

    Yoshiharu MAENO; Yukio OHSAWA


    An empty spot refers to an empty hard-to-fill space which can be found in the records of the social interaction, and is the clue to the persons in the underlying social network who do not appear in the records. This contribution addresses a problem to predict relevant empty spots in social interaction. Homogeneous and inhomogeneous networks are studied as a model underlying the social interaction. A heuristic predictor function method is presented as a new method to address the problem. Simulation experiment is demonstrated over a homogeneous network. A test data set in the form of market baskets is generated from the simulated communication. Precision to predict the empty spots is calculated to demonstrate the performance of the presented method.

  5. Simulating acoustic waves in spotted stars

    CERN Document Server

    Papini, Emanuele; Gizon, Laurent; Hanasoge, Shravan M


    Acoustic modes of oscillation are affected by stellar activity, however it is unclear how starspots contribute to these changes. Here we investigate the non-magnetic effects of starspots on global modes with angular degree $\\ell \\leq 2$ in highly active stars, and characterize the spot seismic signature on synthetic light curves. We perform 3D time-domain simulations of linear acoustic waves to study their interaction with a model starspot. We model the spot as a 3D change in the sound speed stratification with respect to a convectively stable stellar background, built from solar Model S. We perform a parametric study by considering different depths and perturbation amplitudes. Exact numerical simulations allow investigation of the wavefield-spot interaction beyond first order perturbation theory. The interaction of the axisymmetric modes with the starspot is strongly nonlinear. As mode frequency increases, the frequency shifts for radial modes exceed the value predicted by linear theory, while the shifts for...

  6. Role Bending: Complex Relationships Between Viruses, Hosts, and Vectors Related to Citrus Leprosis, an Emerging Disease. (United States)

    Roy, Avijit; Hartung, John S; Schneider, William L; Shao, Jonathan; Leon, Guillermo; Melzer, Michael J; Beard, Jennifer J; Otero-Colina, Gabriel; Bauchan, Gary R; Ochoa, Ronald; Brlansky, Ronald H


    Citrus leprosis complex is an emerging disease in the Americas, associated with two unrelated taxa of viruses distributed in South, Central, and North America. The cytoplasmic viruses are Citrus leprosis virus C (CiLV-C), Citrus leprosis virus C2 (CiLV-C2), and Hibiscus green spot virus 2, and the nuclear viruses are Citrus leprosis virus N (CiLV-N) and Citrus necrotic spot virus. These viruses cause local lesion infections in all known hosts, with no natural systemic host identified to date. All leprosis viruses were believed to be transmitted by one species of mite, Brevipalpus phoenicis. However, mites collected from CiLV-C and CiLV-N infected citrus groves in Mexico were identified as B. yothersi and B. californicus sensu lato, respectively, and only B. yothersi was detected from CiLV-C2 and CiLV-N mixed infections in the Orinoco regions of Colombia. Phylogenetic analysis of the helicase, RNA-dependent RNA polymerase 2 domains and p24 gene amino acid sequences of cytoplasmic leprosis viruses showed a close relationship with recently deposited mosquito-borne negevirus sequences. Here, we present evidence that both cytoplasmic and nuclear viruses seem to replicate in viruliferous Brevipalpus species. The possible replication in the mite vector and the close relationship with mosquito borne negeviruses are consistent with the concept that members of the genus Cilevirus and Higrevirus originated in mites and citrus may play the role of mite virus vector. PMID:25775106

  7. White matter diseases

    International Nuclear Information System (INIS)

    There are many causes for white matter lesions on magnetic resonance imaging (MRI), and MRI, though sensitive, is only rarely specific for the etiology. Histologic and pathologic examination are far more specific, however. The purpose of this paper is to discuss the known MR characteristics of white matter diseases and relate them to the underlying pathophysiologic processes. Knowledge of the pathologic basis for demyelination and dysmyelination should improve our understanding of the MR appearance and thereby improve the specificity of diagnoses. Compared with computed tomography (CT), MRI is far superior in detecting and demonstrating the extent of intracerebral white matter diseases. Furthermore, lesions of the optic nerves and spinal cord are frequently seen on MRI, but have only rarely been reported by CT. A limitation of MRI may actually be its high sensitivity, coupled with its lack of specificity, which results in similar-appearing images of diverse white matter processes, some of which are completely benign, and some of which are neurologically devastating. To maximize the MR evaluation of white matter diseases, it is important to acquire an adequate clinical history, to recognize the various disease patterns, as they correspond to pathology, and to understand the response of the diseases to different pulse sequences

  8. White coat, patient gown. (United States)

    Wellbery, Caroline; Chan, Melissa


    Much has been written about the symbolic function of the white coat: its implications of purity, its representation of authority and professionalism, and its role in consolidating a medical hierarchy. By contrast, the medical literature has paid almost no attention to the patient gown. In this article, we argue that in order to understand the full implications of the white coat in the doctor-patient relationship, we must also take into account patients' dress, and even undress. We explore contemporary artistic images of white coat and patient gown in order to reveal the power differential in the doctor-patient relationship. Artistic representations capture some of the cultural ambivalence surrounding the use of the white coat, which confers professional status on its wearer, while undermining his or her personal identity. At the other end of the sartorial spectrum, hospital gowns also strip wearers of their identity, but add to this an experience of vulnerability. Although compelling reasons for continuing to wear the white coat in circumscribed settings persist, physicians should be mindful of its hierarchical implications. Ample room remains for improving patients' privacy and dignity by updating the hospital gown. PMID:24687912

  9. Genome transcription/translation of segmented, negative-strand RNA viruses

    NARCIS (Netherlands)

    Geerts-Dimitriadou, C.


    The requirements for alignment of capped RNA leader sequences along the viral genome during influenza transcription initiation (“cap-snatching”) have long been an enigma. Previous work on Tomato spotted wilt virus (TSWV) transcription initiation has revealed that this virus displays a pr

  10. Mopeia Virus-related Arenavirus in Natal Multimammate Mice, Morogoro, Tanzania

    DEFF Research Database (Denmark)

    Günther, Stephan; Hoofd, Guy; Charrel, Remi; Röser, Christina; Becker-Ziaja, Beate; Lloyd, Graham; Sabuni, Christopher; Verhagen, Ron; van der Groen, Guido; Kennis, Jan; Katakweba, Abdul; Machang'u, Robert; Makundi, Rhodes; Leirs, Herwig


    A serosurvey involving 2,520 small mammals from Tanzania identified a hot spot of arenavirus circulation in Morogoro. Molecular screening detected a new arenavirus in Natal multimammate mice (Mastomys natalensis), Morogoro virus, related to Mopeia virus. Only a small percentage of mice carry...

  11. Statistical Hot Spot Model for Explosive Detonation

    Energy Technology Data Exchange (ETDEWEB)

    Nichols, III, A L


    The Non-local Thermodynamic Equilibrium Statistical Hot Spot Model (NLTE SHS), a new model for explosive detonation, is described. In this model, the formation, ignition, propagation, and extinction of hot spots is explicitly modeled. The equation of state of the explosive mixture is treated with a non-local equilibrium thermodynamic assumption. A methodology for developing the parameters for the model is discussed, and applied to the detonation velocity diameter effect. Examination of these results indicates where future improvements to the model can be made.

  12. Statistical Hot Spot Model for Explosive Detonation

    Energy Technology Data Exchange (ETDEWEB)

    Nichols III, A L


    The Non-local Thermodynamic Equilibrium Statistical Hot Spot Model (NLTE SHS), a new model for explosive detonation, is described. In this model, the formation, ignition, propagation, and extinction of hot spots is explicitly modeled. The equation of state of the explosive mixture is treated with a nonlocal equilibrium thermodynamic assumption. A methodology for developing the parameters for the model is discussed, and applied to the detonation velocity diameter effect. Examination of these results indicates where future improvements to the model can be made.

  13. Element spots in HgMn stars


    Korhonen, Heidi


    A fraction of late B-type stars, the so-called HgMn stars, exhibit enhanced absorption lines of certain chemical elements, notably Hg and Mn, combined with an underabundance of He. For about a decade now the elements with anomalously high abundances in HgMn stars are known to be distributed inhomogeneously over the stellar surface. Temporal evolution of these elemental spots have been reported in a few HgMn stars, first secular evolution of the mercury spots in alpha And, and recently also a ...

  14. Illiquidity transmission from spot to futures markets


    Korn, Olaf; Krischak, Paolo; Theissen, Erik


    We develop a model of the illiquidity transmission from spot to futures markets that formalizes the derivative hedge theory proposed by Cho and Engle (1999). The model shows that spot market illiquidity does not translate one-to-one to the futures market, but rather interacts with price risk, liquidity risk, and the risk aversion of the market maker. The predictions of the model are tested empirically with data from the stock market and the market for single-stock futures. The results support...

  15. TAT improves in vitro transportation of fortilin through midgut and into hemocytes of white shrimp Litopenaeus vannamei (United States)

    Zhou, Yi; Zhang, Wenbing; Mai, Kangsen; Xu, Wei; Zhang, Yanjiao; Ai, Qinghui; Wang, Xiaojie


    Fortilin is a multifunctional protein implicated in many important cellular processes. Since injection of Pm-fortilin reduces shrimp mortality caused by white spot syndrome virus (WSSV), there is potential application of fortilin in shrimp culture. In the present study, in order to improve trans-membrane transportation efficiency, the protein transduction domain of the transactivator of transcription (TAT) peptide was fused to fortilin. The Pichia pastoris yeast expression system, which is widely accepted in animal feeds, was used for production of recombinant fusion protein. Green fluorescence protein (GFP) was selected as a reporter because of its intrinsic visible fluorescence. The fortilin, TAT and GFP fusion protein were constructed. Their trans-membrane transportation efficiency and effects on immune response of shrimp were analyzed in vitro. Results showed that TAT peptide improved in vitro uptake of fortilin into the hemocytes and midgut of Litopenaeus vannamei. The phenoloxidase (PO) activity of hemocytes incubated with GFP-Fortilin or GFP-Fortilin-TAT was significantly increased compared with that in the control without expressed fortilin. The PO activity of hemocytes incubated with 200 μg mL-1 GFP-Fortilin-TAT was significantly higher than that in the group with the same concentration of GFP-Fortilin. Hemocytes incubated with GFP-Fortilin-TAT at all concentrations showed significantly higher nitric oxide synthase (NOS) activity than those in the control or in the GFP-Fortilin treatment. The present in vitro study indicated that TAT fusion protein improved the immune effect of fortilin.

  16. Computer Virus

    Institute of Scientific and Technical Information of China (English)


    Computer viruses are small software programs that are designed to spread from one computerto another and to interfere with computer operation.A virus might delete data on your computer,use your e-mail program to spread itself to othercomputers,or even erase everything on your hard disk.Viruses are most easily spread by attach-ments in e-mail messages or instant messaging messages.That is why it is essential that you never

  17. White dwarf pulsations

    International Nuclear Information System (INIS)

    The DA white dwarfs are those which show only the Stark-broadened lines of hydrogen in their spectra. They comprise about 80% of the total white dwarf population. A subset of the DA dwarfs, the ZZ Ceti stars, form a highly homogeneous class of nonradially pulsating variable stars. In this paper we shall review the observations from which both the physical properties of the stars and the characteristics of the pulsations have been derived. Data obtained since the last review of these variables (Robinson 1979) is stressed, as these data are forcing a somewhat revised understanding of the ZZ Ceti stars and their relationship to investigations of white dwarfs and to pulsating variable stars, in general. (orig.)


    International Nuclear Information System (INIS)

    We present a spectral analysis of the Far Ultraviolet Spectroscopic Explorer (FUSE) spectra of the eclipsing double-line spectroscopic binary EM Cygni (EM Cyg), a Z Cam DN system. The FUSE spectrum, obtained in quiescence, consists of four individual exposures (orbits): two exposures, at orbital phases φ ∼ 0.65 and φ ∼ 0.90, have a lower flux; and two exposures, at orbital phases φ = 0.15 and 0.45, have a relatively higher flux. The change of flux level as a function of the orbital phase is consistent with the stream material (flowing over and below the disk from the hot spot region to smaller radii) partially masking the white dwarf. We carry out a spectral analysis of the FUSE data, obtained at phase 0.45 (when the flux is maximal), using synthetic spectra generated with the codes TLUSTY and SYNSPEC. Using a single white dwarf spectral component, we obtain a white dwarf temperature of 40, 000 K ± 1000 K, rotating at 100 km s-1. The white dwarf, or conceivably, the material overflowing the disk rim, shows suprasolar abundances of silicon, sulphur, and possibly nitrogen. Using a white dwarf+disk composite model, we obtain that the white dwarf temperature could be even as high as 50,000 K, contributing more than 90% of the FUV flux, and the disk contributing less than 10% must have a mass accretion rate reaching 10-10 Msun yr-1. The single white dwarf model fits the absorption lines better than the white dwarf+disk model, but the white dwarf+disk model fits better the continuum in the shorter wavelengths. In both cases, however, we obtain that the white dwarf temperature is much higher than previously estimated. We emphasize the importance of modeling the spectra of EM Cyg around phase φ < 0.5, when the white dwarf and disk are facing the observer, and we suggest that the discrepancy between the present analysis and previous spectral analysis might be due to the occulting effect of the stream veiling the white dwarf and disk.

  19. White Tower, London, England


    William the Conqueror; William Rufus; Henry I


    White Tower (Tower of London), London, England. Photograph taken by Terry Barry. There is restoration work being carried out on one of the towers. The White Tower is a central tower at the Tower of London. The great central keep was built by William the Conqueror and finished by his sons and successors, William Rufus and Henry I, around 1087. It is 90 feet high and is of massive construction, the walls varying from 15 feet thickness at the base to almost 11 feet in the upper parts. Above ...

  20. White dwarf planets


    Bonsor Amy; Veras Dimitri; Villaver Eva; Mustill Alexander J.; Wyatt Mark C.


    The recognition that planets may survive the late stages of stellar evolution, and the prospects for finding them around White Dwarfs, are growing. We discuss two aspects governing planetary survival through stellar evolution to the White Dwarf stage. First we discuss the case of a single planet, and its survival under the effects of stellar mass loss, radius expansion, and tidal orbital decay as the star evolves along the Asymptotic Giant Branch. We show that, for stars initially of 1 − 5 M⊙...

  1. Spot Weight Adaptation for Moving Target in Spot Scanning Proton Therapy

    Directory of Open Access Journals (Sweden)

    Paul eMorel


    Full Text Available Purpose: This study describes a real-time spot weight adaptation method in spot-scanning proton therapy for moving target or moving patient, so that the resultant dose distribution closely matches the planned dose distribution. Materials and Methods: The method proposed in this study adapts the weight (MU of the delivering pencil beam to that of the target spot it will actually hit during patient/target motion. The target spot a certain delivering pencil beam may hit relies on patient monitoring and/or motion modeling using four-dimensional (4D CT. After the adapted delivery, the required total weight (MU for this target spot is then subtracted from the planned value. With continuous patient motion and continuous spot scanning, the planned doses to all target spots will eventually be all fulfilled. In a proof-of-principle test, a lung case was presented with realistic temporal and motion parameters; the resultant dose distribution using spot weight adaptation was compared to that without using this method. The impact of the real-time patient/target position tracking or prediction was also investigated.Results: For moderate motion (i.e., mean amplitude 0.5 cm, D95% to the planning target volume (PTV was only 81.5% of the prescription (RX dose; with spot weight adaptation PTV D95% achieves 97.7%RX. For large motion amplitude (i.e., 1.5 cm, without spot weight adaptation PTV D95% is only 42.9% of RX; with spot weight adaptation, PTV D95% achieves 97.7%RX. Larger errors in patient/target position tracking or prediction led to worse final target coverage; an error of 3mm or smaller in patient/target position tracking is preferred. Conclusion: The proposed spot weight adaptation method was able to deliver the planned dose distribution and maintain target coverage when patient motion was involved. The successful implementation of this method would rely on accurate monitoring or prediction of patient/target motion.

  2. Variation in T-SPOT.TB Spot Interpretation between Independent Observers from Different Laboratories▿


    Franken, Willeke P. J.; Thijsen, Steven; Wolterbeek, Ron; Bouwman, John J. M.; el Bannoudi, Hanane; Kik, Sandra V; van Dissel, Jaap T.; Arend, Sandra M.


    T-SPOT.TB is a specific assay for the diagnosis of tuberculosis. The assay needs to be performed with freshly isolated cells, and interpretation requires training. T-SPOT.TB has been used in various clinical-epidemiological settings, but so far no studies have evaluated the effect of interobserver variation in test reading. Our aim was to evaluate variation between different observers in reading T-SPOT.TB results. The study was nested within an ongoing cohort study, in which part of the T-SPO...

  3. Detection and Identification of the First Viruses in Chia (Salvia hispanica

    Directory of Open Access Journals (Sweden)

    Marcos G. Celli


    Full Text Available Chia (Salvia hispanica, an herbaceous plant native to Latin America, has become important in the last 20 years due to its beneficial effects on health. Here, we present the first record and identification of two viruses in chia plants. The comparison of the complete nucleotide sequences showed the presence of two viral species with the typical genome organization of bipartite New World begomovirus, identified as Sida mosaic Bolivia virus 2 and Tomato yellow spot virus, according to the ICTV taxonomic criteria for begomovirus classification. DNA-A from Sida mosaic Bolivia virus 2 exhibited 96.1% nucleotide identity with a Bolivian isolate of Sida micrantha, and Tomato yellow spot virus showed 95.3% nucleotide identity with an Argentine bean isolate. This is the first report of begomoviruses infecting chia as well as of the occurrence of Sida mosaic Bolivia virus 2 in Argentina.

  4. Matching Two-dimensional Gel Electrophoresis' Spots

    DEFF Research Database (Denmark)

    Dos Anjos, António; AL-Tam, Faroq; Shahbazkia, Hamid Reza;


    This paper describes an approach for matching Two-Dimensional Electrophoresis (2-DE) gels' spots, involving the use of image registration. The number of false positive matches produced by the proposed approach is small, when compared to academic and commercial state-of-the-art approaches. This ar...

  5. Spotted Locoweed on the Henry Mountains


    Bagley, Verl L.; Ralphs, Michael H; James, Lynn A.


    Spotted locoweed (Astragalus lentlginosus, var. wahweapens) also known as freckled or Wahweap Milkvetch is characterized by blue leguminous flowers, purple speckled seed pods, and leaves resembling those of garden pea. The plant is poisonous to cattle, sheep and horses. It grows on gravely clay loam semi-desert benches and swales supporting desert shrubs and sparse stands of juniper.

  6. Easy Demonstration of the Poisson Spot (United States)

    Gluck, Paul


    Many physics teachers have a set of slides of single, double and multiple slits to show their students the phenomena of interference and diffraction. Thomas Young's historic experiments with double slits were indeed a milestone in proving the wave nature of light. But another experiment, namely the Poisson spot, was also important historically and…

  7. 9 CFR 149.4 - Spot audit. (United States)


    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Spot audit. 149.4 Section 149.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... results as a result of testing of certified swine from that site at the slaughter facility. (b) All...

  8. Ciprofloxacin therapy for Mediterranean spotted fever.


    Raoult, D.; Gallais, H.; De Micco, P; Casanova, P


    We report the treatment of five patients with Mediterranean spotted fever with the antimicrobial agent ciprofloxacin. The treatment was administered intravenously for 2 days and then perorally for 8 days. All five patients were cured. These preliminary data seem to correlate with the in vitro activity of ciprofloxacin against Rickettsia conorii.

  9. A generic method to identify plant viruses by high-resolution tandem mass spectrometry of their coat proteins. (United States)

    Blouin, Arnaud G; Greenwood, David R; Chavan, Ramesh R; Pearson, Michael N; Clover, Gerard R G; MacDiarmid, Robin M; Cohen, Daniel


    Although a number of protocols have been developed for detection of viruses at the genus or family level, universal approaches to detect and identify unknown viruses are still required. High-resolution tandem mass spectrometry was used to identify accurately peptide masses and their constituent sequences from partially purified plant virus preparations. Analysis of the peptide fragment masses against a virus database using pattern-matching algorithms identified sequences with homology to known virus peptides and also predicted peptides using de novo sequence analysis. This method provided sufficient information to confirm the identity of two known viruses that were included as controls (Cucumber mosaic virus and Tomato spotted wilt virus) and to identify unknown viruses in six viral isolates. The unknown viruses have been identified as four common viruses (Alfalfa mosaic virus, Tobacco streak virus, Citrus leaf blotch virus and Ribgrass mosaic virus), and two novel viruses (a potexvirus and a vitivirus). The identification of viruses from five distinct families by the tandem mass spectrometric determination of their coat protein demonstrates that this is a useful method for initial virus identification. This method, complemented with molecular or immunological procedures, provides a rapid and convenient way to identify both known and novel plant viruses. PMID:19712699

  10. Programming balanced optical beam splitters in white paint

    CERN Document Server

    Huisman, S R; Goorden, S A; Mosk, A P; Pinkse, P W H


    Wavefront shaping allows for ultimate control of light propagation in multiple-scattering media by adaptive manipulation of incident waves. We shine two separate wavefront-shaped beams on a layer of dry white paint to create two enhanced output speckle spots of equal intensity. We experimentally confirm by interference measurements that the output speckle spots are almost correlated like the two outputs of an ideal balanced beam splitter. The observed deviations from the phase behavior of an ideal beam splitter are analyzed with a transmission matrix model. Our experiments demonstrate that wavefront shaping in multiple-scattering media can be used to approximate the functionality of linear optical devices with multiple inputs and outputs.

  11. Behavioural and virological studies on a rescued Oriental White-backed Vulture Gyps bengalensis from western Maharashtra, India


    Pande, S.; Pandit, P.; A. Ponkshe; R. Mone; Pawar, S; A. Mishra


    An exhausted Indian White-backed Vulture Gyps bengalensis was rescued in Maharashtra State, India. Examination revealed that it was not injured but was emaciated due to starvation. The vulture was fed in captivity by the Forest Department. To rule out the possibility of viral infections, cloacal, tracheal and serum samples were collected from the vulture. They were negative for Avian Influenza (AI) viruses, Newcastle Disease Virus (NDV), Infectious Bursal Disease Virus by virus isolation. We ...

  12. Efficacy Evaluation of an Inactivated Duck Tembusu Virus Vaccine. (United States)

    Lin, Jian; Liu, Yuehuan; Wang, Xiuqing; Yang, Baoshou; He, Pingyou; Yang, Zhiyuan; Duan, Huijuan; Xie, Jia; Zou, Lihong; Zhao, Jicheng; Pan, Jie


    To evaluate the potential use of an inactivated virus-based vaccine for the control and prevention of the newly emerged duck Tembusu virus infection in China, a duck Tembusu virus isolate, Tembusu-HB, was propagated in 12-day-old duck embryos and inactivated by treatment with formaldehyde. The inactivated viral antigen was emulsified with mineral oil, and five batches of the vaccine were manufactured. The immunogenicity and protection efficacy of the vaccine were evaluated in Beijing ducks and Beijing white geese. Results showed that more than 80% of immunized ducks were protected against virulent virus challenge after two intramuscular or subcutaneous injections of the inactivated vaccine, as evidenced by the negative virus isolation results. The protection is also correlated with a positive virus-specific antibody response as detected by ELISA. In contrast, none of the control ducks and geese had any detectable antibody response. Virus was isolated from all control ducks and geese after virulent virus challenge. Interestingly, a variable level of protection (20%-80%) was observed in Beijing white geese immunized twice with the same batches of vaccine, suggesting a species-specific effect of the vaccine. Overall, the results clearly suggest that the inactivated duck Tembusu virus vaccine is immunogenic and provides protection against virulent virus challenge. PMID:26473674

  13. Peptide inhibitors of dengue virus and West Nile virus infectivity

    Directory of Open Access Journals (Sweden)

    Garry Robert F


    Full Text Available Abstract Viral fusion proteins mediate cell entry by undergoing a series of conformational changes that result in virion-target cell membrane fusion. Class I viral fusion proteins, such as those encoded by influenza virus and human immunodeficiency virus (HIV, contain two prominent alpha helices. Peptides that mimic portions of these alpha helices inhibit structural rearrangements of the fusion proteins and prevent viral infection. The envelope glycoprotein (E of flaviviruses, such as West Nile virus (WNV and dengue virus (DENV, are class II viral fusion proteins comprised predominantly of beta sheets. We used a physio-chemical algorithm, the Wimley-White interfacial hydrophobicity scale (WWIHS 1 in combination with known structural data to identify potential peptide inhibitors of WNV and DENV infectivity that target the viral E protein. Viral inhibition assays confirm that several of these peptides specifically interfere with target virus entry with 50% inhibitory concentration (IC50 in the 10 μM range. Inhibitory peptides similar in sequence to domains with a significant WWIHS scores, including domain II (IIb, and the stem domain, were detected. DN59, a peptide corresponding to the stem domain of DENV, inhibited infection by DENV (>99% inhibition of plaque formation at a concentrations of 99% inhibition at

  14. Host plant affects the sexual attractiveness of the female white-spotted longicorn beetle, Anoplophora malasiaca. (United States)

    Yasui, Hiroe; Fujiwara-Tsujii, Nao


    Anoplophora malasiaca (Coleoptera: Cerambycidae) is a serious pest that destroys various landscape and crop trees in Japan. We evaluated the precopulatory responses of three different A. malasiaca populations collected from mandarin orange, willow and blueberry trees. Most of the males accepted mates from within the same host plant population as well as females from the willow and blueberry populations. However, significant number of males from the blueberry and willow populations rejected females from the mandarin orange population immediately after touching them with their antennae. Because all three of the female populations produced contact sex pheromones on their elytra, the females of the mandarin orange population were predicted to possess extra chemicals that repelled the males of the other two populations. β-Elemene was identified as a key component that was only found in mandarin orange-fed females and induced a rejection response in willow-fed males. Our results represent the first example of a female-acquired repellent against conspecific males of different host plant populations, indicating that the host plant greatly affects the female's sexual attractiveness. PMID:27412452

  15. Seismic Data from the Kane Basin, Northwest Greenland - Insight into a white spot on the map (United States)

    Ehrhardt, Axel; Schnabel, Michael; Damm, Volkmar


    The opening history of the Baffin Bay and the possible extent of oceanic crust within the basin is a key question in order to reconstruct the plate tectonic development of the Arctic region. To contribute to the scientific discussion, a multi-component geophysical and geological survey was carried out in 2010 in the area of the Northern Baffin Bay. Because of the fortunate ice conditions we seized the chance to go to the Kane Basin, half way between the Baffin Bay in the South and the Lincoln Sea in the North, one of a series of basins that are aligned along the Nares Strait. In addition the unclear situation within the Baffin Bay the Nares Strait is one of the most disputed areas in the Arctic. As the opening of the Baffin Bay and the formation of oceanic crust must have been compensated somewhere between Greenland and Ellesmere Island a transform fault was proposed. However, in particular land geological data does not support this thesis and let assume moreover that no lateral displacement occurred between Greenland and Ellesmere Island. In order to shed some more light onto the potential transform fault (the Wegener Fault) two reflection seismic lines were shot within the eastern Kane Basin supported by sonobuoys. Furthermore, magnetic and gravity data is acquired. This paper presents first insight into the eastern side of the Kane Basin. The eastern Kane Basin is characterized by a deeper rim and a more shallow central part of the basin. The term basin is probably misleading as most of it is floored by Proterozoic crust without any sedimentary beds on top of it. Only in the western part of the Kane Basin a sedimentary infill can be recorded which terminates with an erosional truncation on to the seafloor. The significant amount of sediments and debris that is washed into the Kane Basin by rivers and glaciers is transported to the Baffin Bay Fan by the considerably strong N-S current through the Nares Strait. A pull-apart development of the Kane Basin can't be supported, however, the steepening of sedimentary beds towards Ellesmere Island points to a transform boundary.

  16. Bonding brackets on white spot lesions pretreated by means of two methods


    Julia Sotero Vianna; Mariana Marquezan; Thiago Chon Leon Lau; Eduardo Franzotti Sant'Anna


    Abstract Objective: The aim of this study was to evaluate the shear bond strength (SBS) of brackets bonded to demineralized enamel pretreated with low viscosity Icon Infiltrant resin (DMG) and glass ionomer cement (Clinpro XT Varnish, 3M Unitek) with and without aging. Methods: A total of 75 bovine enamel specimens were allocated into five groups (n = 15). Group 1 was the control group in which the enamel surface was not demineralized. In the other four groups, the surfaces were submitted ...

  17. Serial Transmission of Plant Viruses by Cutting During Grafting (United States)

    Reciprocal grafts of two tomato (Solanum lycopersicum L.) cultivars were made by hand using commercial grafting techniques. The razor blade used to cut rootstock or scion was first contaminated by making a single cut on tomato plants infected with either tomato spotted wilt virus (TSWV) or tomato m...

  18. White matter of the brain (United States)

    White matter is found in the deeper tissues of the brain (subcortical). It contains nerve fibers (axons), which are ... or covering called myelin. Myelin gives the white matter its color. It also protects the nerve fibers ...

  19. Wolff-Parkinson-White syndrome (United States)

    Wolff-Parkinson-White syndrome is a condition in which there is an extra electrical pathway of the heart. The ... to periods of rapid heart rate ( tachycardia ). Wolff-Parkinson-White syndrome is one of the most common ...

  20. Mutation hot spots in the canine herpesvirus thymidine kinase gene. (United States)

    Yamada, Shinya; Matsumoto, Yasunobu; Takashima, Yasuhiro; Otsuka, Haruki


    The guanine and cytosine content (GC-content) of alpha-herpesvirus genes are highly variable despite similar genome structures. It is known that drug resistant HSV, which has the genome with a high GC-content (approximately 70%), commonly includes frameshift mutations in homopolymer stretches of guanine (G) and cytosine (C) within the thymidine kinase (TK) gene. However, whether such mutation hotspots exist in the TK gene of canine herpesvirus (CHV) which has a low GC-content was unknown. In this study, we investigated mutations in the TK gene of CHV. CHV was passaged in the presence of iodo-deoxyuridine (IDU), and IDU-resistant clones were isolated. In all IDU-resistant virus clones, mutations in the TK gene were observed. The majority of these mutations were frameshift mutations of an adenine (A) insertion or deletion within either of 2 stretches of eight A's in the TK gene. It was demonstrated that CHV TK mutations frequently occur at a limited number of hot spots within long homopolymer nucleotide stretches. PMID:15965615

  1. The Jung-White Letters


    Frank, Kirsten; Nielsen, Sine Birkedal


    This report is based on the correspondence The Jung-White Letters, between psychotherapist C. G. Jung and theologian Victor White. Their correspondence deals mainly with the relationship between religion and science. The report analyses Jung and White's conflict on the subject of evil as understood in the Christian doctrine privatio boni, investigating the underlying epistemological reasoning behind their disagreement. Theologian White is influenced by the Catholic Dominican order, whose phil...

  2. Plato: White and Non-white Love

    Directory of Open Access Journals (Sweden)

    Amo Sulaiman


    Full Text Available Plato’s dialogues, the Symposium, and Phaedrus, provide a reasonableexplanation of love. G. Vlastos and M. Nussbaum do not share such anopinion. The former contends that Plato’s view of love is about lovingonly a person’s beauty, but not the entire person; thus, it falls short of anappropriate explanation of love. The latter holds that a theory of love should be complete, and that Plato’s one is incomplete on the grounds that it does not account for personal love. These criticisms will be re-evaluated in light of the duality of love (the white and non-white horses—in Phaedrus as well as participants’ views in the Symposium; a re-assessment will weaken the mentioned objections. This paper contends that from the Symposium and Phaedrus, one can have a fruitful understanding of being in love, being out of love, falling inlove, loving for its own sake and being erotically in love. In order to account for these related issues of love it is important to consider Plato’s works in terms of his “official” and “unofficial” views. The former is construed as the doctrine of the lover or loving for its own sake: this is associates with Diotima’s views which are repeated by Socrates. With reference to the latter, it is possible to explain what personal love or being in love, being out of love, falling in love, and being erotically in love involve. Erotic love will be interpreted as an extension of our philosophical conception of love, related to views of love that are mentioned in the Symposium other than Socrates’ report of Diotima’s conceptions. This paper is divided into two parts: the first one will show views of love in the Symposium. That is, being in love, being out of love, falling in love and loving for its own sake will be discussed. In addition, the forementioned criticisms will be re-evaluated. In the second section, we will show that Aristophanes’ speech expresses erotic love, and then Kant’s objections will be

  3. Multiresolution Network Temporal and Spatial Scheduling Model of Scenic Spot


    Peng Ge; Zhixue Liao; Chang Liu; Peiyu Ren; Zhaoxia Guo


    Tourism is one of pillar industries of the world economy. Low-carbon tourism will be the mainstream direction of the scenic spots' development, and the ω path of low-carbon tourism development is to develop economy and protect environment simultaneously. However, as the tourists' quantity is increasing, the loads of scenic spots are out of control. And the instantaneous overload in some spots caused the image phenomenon of full capacity of the whole scenic spot. Therefore, realizing the real-...

  4. 侵染云南白肋烟的中国番茄黄化曲叶病毒及伴随卫星DNA分子的基因组特征%Genomic Characterization of DNA-A and Associated Satellite DNA Molecule of an Isolate of Tomato Yellow Leaf Curl China Virus Infecting Nicotiana tabacum White Burley in Yunnan

    Institute of Scientific and Technical Information of China (English)

    李桂新; 范三微; 李正和; 谢艳; 周雪平


    从中国云南省大理地区表现曲叶症状的白肋烟(Nicotina tabacum White Burley)上分离到病毒分离物Y43,该病毒可经烟粉虱(Bemisia tabaci)及嫁接传播.用15种粉虱传双生病毒的单抗对病样进行TAS-ELISA检测,结果表明,该病毒属菜豆金色花叶病毒属(Begomovirus)病毒.对DNA-A1.7kb基因组序列测定和分析表明,Y43与中国广西报道的中国番茄黄化曲叶病毒(Tomata yellow leaf curl China virus,TYLCCNV)同源性达89%,其中外壳蛋白(CP)氨基酸同源性达96%,因此Y43应为TYLCCNV的一个新分离物.进一步研究发现,Y43还伴随着一个长1 349 nt的卫星DNA分子(DNAβ).Y43DNAβ与AYVVDNAβ、BYVMVDNAβ和CLCuVDNAβ的同源性较低,而与中国分离的烟草曲叶病毒Y5 DNAβ和Y8 DNA β的亲缘关系较近.DNAβ可能编码7个分子量超过3.5kD的ORF,其中C1推测为有功能的ORF.

  5. Egg White Phantoms for HIFU

    International Nuclear Information System (INIS)

    We used fresh egg white and polyacrylamide to create a transparent tissue mimicking phantom. Heating of phantoms by HIFU leads to egg white protein denaturation and creation of visible white lesions. We measured the acoustical and thermal properties and investigated the possibility to use such phantoms to study the lesion formation during the HIFU therapy

  6. White Students' Understanding of Race: An Exploration of How White University Students, Raised in a Predominately White State, Experience Whiteness (United States)

    Smith, Barbara A.


    This study examines White university students' understanding of race. Based in the scholarship on higher education and diversity, and framed in Critical Race Theory (CRT), this study explores the racial awareness of White students. This study contributes to the literature on the racial experience of Whites and an understanding of how White…

  7. Computer viruses (United States)

    Denning, Peter J.


    The worm, Trojan horse, bacterium, and virus are destructive programs that attack information stored in a computer's memory. Virus programs, which propagate by incorporating copies of themselves into other programs, are a growing menace in the late-1980s world of unprotected, networked workstations and personal computers. Limited immunity is offered by memory protection hardware, digitally authenticated object programs,and antibody programs that kill specific viruses. Additional immunity can be gained from the practice of digital hygiene, primarily the refusal to use software from untrusted sources. Full immunity requires attention in a social dimension, the accountability of programmers.


    Directory of Open Access Journals (Sweden)



    Full Text Available compromised machines it is one of the internet key security threats. It is used to identifying thesecurity attacks such as Ddos, spreading malware and spamming threats and identifying networking threats.It is detect the compromised machines that are all involved in networking activities. This type of spammingactivities is known as spam zombies. We implementing the effective attacks are detecting spam zombie systemthat name is spot by monitoring outgoing messages with packages of the network. It is one of the powerfulstatistical tools that is known as sequential probability ratio test, it must be bounded in false negative andfalse positive error rates. The spot protocols are used to filtering the without extension file formats andattachment and also compressed files and eliminated those data in the sender part itself.

  9. Research Hot Spots of Black Peanut

    Institute of Scientific and Technical Information of China (English)


    Taking the research papers on black peanut in National Knowledge Infrastructure(CNKI)as data sources,we determine the research hot spots on black peanut using word frequency analysis,and analyze the main research directions that change over the years.The results show that the relevant researches on black peanut are mainly concentrated in six themes(study of varieties,physiological property,cultivation management,development prospects,relationship with agriculture,and molecular level);varieties,physiology,cultivation and other aspects are the focus of current research hot spots;the researches on selection and breeding of variety and various physiological and ecological mechanisms,still need a breakthrough.

  10. Dynamically variable spot size laser system (United States)

    Gradl, Paul R. (Inventor); Hurst, John F. (Inventor); Middleton, James R. (Inventor)


    A Dynamically Variable Spot Size (DVSS) laser system for bonding metal components includes an elongated housing containing a light entry aperture coupled to a laser beam transmission cable and a light exit aperture. A plurality of lenses contained within the housing focus a laser beam from the light entry aperture through the light exit aperture. The lenses may be dynamically adjusted to vary the spot size of the laser. A plurality of interoperable safety devices, including a manually depressible interlock switch, an internal proximity sensor, a remotely operated potentiometer, a remotely activated toggle and a power supply interlock, prevent activation of the laser and DVSS laser system if each safety device does not provide a closed circuit. The remotely operated potentiometer also provides continuous variability in laser energy output.

  11. 7 CFR 28.421 - Good Middling Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Good Middling Spotted Color. 28.421 Section 28.421 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... Color. Good Middling Spotted Color is color which is better than Strict Middling Spotted Color....

  12. 7 CFR 28.424 - Strict Low Middling Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Strict Low Middling Spotted Color. 28.424 Section 28.424 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... Spotted Color. Strict Low Middling Spotted Color is color which is within the range represented by a...

  13. 7 CFR 28.426 - Strict Good Ordinary Spotted Color. (United States)


    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Strict Good Ordinary Spotted Color. 28.426 Section 28.426 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... Spotted Color. Strict Good Ordinary Spotted Color is color which is within the range represented by a...

  14. On the turbulent spot and calmed region

    Czech Academy of Sciences Publication Activity Database

    Jonáš, Pavel

    Praha: Institute of Thermomechanics AS CR, v. v. i., 2007 - (Zolotarev, I.), s. 109-110 ISBN 978-80-87012-06-2. [Engineering Mechanics 2007. Svratka (CZ), 14.05.2007-17.05.2007] R&D Projects: GA ČR GA101/05/0675; GA AV ČR(CZ) IAA200760614 Institutional research plan: CEZ:AV0Z20760514 Keywords : transition to turbulence * boundary layer * calmed region * turbulent spot Subject RIV: BK - Fluid Dynamics

  15. Friction Stir Spot Welding of Polymer Materials


    Bekir ÇEVİK


    Polymer materials are engineering materials used for various industrial fields. Polymer processing and fabrication techniques have developed with the advancement of technology. Friction Stir Spot Welding (FSSW) is a solid-state process in joining thermoplastic materials. In the present work, the polymeric material (Polyethylene) has been made to join by FSSW process. 3 mm thickness polyethylene materials were used in the experiments. Welding process was carried out by rotating 460 and 900 rpm...

  16. Investigation of Friction Stir Spot Welding Method


    MERT, Şenol; MERT, Sevda


    The Friction Stir Spot Welding (FSSW) method is a derivative of the Friction Stir Welding (FSW) process, which is a new process that recently has received considerable attention from the automotive and other industries. In both methods, the joining mechanism is the same. However, there are several important differences between the applications. The most obvious difference FSSW than FSW that there is no translation of the tool in the vertical direction during the welding. The FSSW process cons...

  17. Rayleigh-Sommerfeld diffraction and Poisson's spot

    International Nuclear Information System (INIS)

    When the Fresnel-Kirchhoff (FK) diffraction integral is evaluated exactly (instead of using the Fresnel approximation), the well-known mathematical inconsistency in the FK boundary conditions leads to unacceptable results for the intensity of Poisson's spot. The Rayleigh-Sommerfeld (RS) integral has no inconsistencies and leads to an accurate description. The case for RS is bolstered by the observation that it is equivalent to Fourier propagation

  18. Characterization of LIL laser UV focal spot

    Energy Technology Data Exchange (ETDEWEB)

    Mangeant, M.; Dubois, J.L.; Behar, G.; Arroyo, P.; Durand, V.; Lahonde, C. [CEA - Centre d' Etudes Scientifiques et Techniques d' Aquitaine, CESTA/DLP, 33 - Le Barp (France)


    One way to get the fusion of hydrogen in laboratory consists in heating and compressing a DT fuel capsule by using a laser. To reach this aim requires a new generation of high power laser facility. Cea (French board for atomic energy) is developing for this purpose a new 240 laser line facility, the LMJ facility. The LIL which is the prototype of four LMJ laser lines is operational now. In order to confirm the technical choices, a systematic characterization of LIL was carried out. A particular effort has been provided to measure the 3{omega} high energy focal spot (1.5 kJ/700 ps and 5 ns for one beam) and the synchronization of laser beams onto the target, which are key issues for the plasma production. An experimental device, SAT-3{omega} (a 3{omega} laser focal spot analysis) has been designed to perform these measures. That diagnostic which is located at the end of the laser lines delivered its first results during the 2004 quadruplet qualification campaigns. The near field imaging showed no diaphony and vignetting. Low power spots allowed us to control we had no ghost. The energy measurement quality showed the photometric transfer function was perfectly known. Our caustic image are given with an average dynamic range of 800, a spatial resolution of 10 {mu}m and diameter accuracy about 1% for 50% and 3% for 90% of encircled energy. The high energy focal spot diameters are in agreement with low and very low energy diameters. The phase plate and 14 GHz effects are similar to what we had expected. For a laser shot completed with a continuous phase plate at 14 GHz, and for an energy level of 1.5 kJ per beam at 351 nm, the focal beam diameter at 3% of the peak level is (875 {+-} 45) {mu}m.

  19. Acuerdos de comercio internacional spot de electricidad


    Mario Ibarburu


    International power trade requires the existence of regulation and a formal agreement between the countries. In South America power trade is mainly a bilateral spot trade decided by system operators, at prices resulting from rules determined in long term agreements between countries. The institutional framework is quite different from other regions’, where the goal is the existence of a single integrated energy market. Very soon Uruguay will be strongly interconnected with its two neighbors, ...

  20. Cerebral white matter hypoplasia

    International Nuclear Information System (INIS)

    This paper demonstrates the MR imaging findings in children with cerebral white matter hypoplasia (CWMH). The MR studies of four children, aged 3-7 y (mean age, 2.3 y) with a diagnosis of CWMH were reviewed. In all cases multiplanar T1-weighted and T2-weighted spin-echo images were obtained. All children had similar histories of severe developmental delay and nonprogressive neurologic deficits despite normal gestational and birth histories. In two cases there was a history of maternal cocaine abuse. Autopsy correlation was available in one child. The MR images of all four children demonstrated diffuse lack of white matter and enlarged ventricles but normal-appearing gray matter. The corpus callosum, although completely formed, was severely thinned. There was no evidence of gliosis or porencephaly, and the distribution of myelin deposition was normal for age in all cases. Autopsy finding in one child correlated exactly with the MR finding

  1. Snow White Trench (Animation) (United States)


    [figure removed for brevity, see original site] Click on image for animation This animation shows the evolution of the trench called 'Snow White' that NASA's Phoenix Mars Lander began digging on the 22nd Martian day of the mission after the May 25, 2008, landing. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  2. White in architecture


    Hašič, Sabina


    Throughout life, human beings are continuously in contact with colours and shapes. Some people are well aware of and understand their influence, while others are not aware or do not pay attention. Our feelings are often associated with certain colours. We tend to paint our living environment in mood-enhancing shades and cover ourselves with our favourite colours and materials. The colour that attracts my emotions is white, therefore I set out to dedicate my research to its nature and to find ...

  3. DNA-nanostructure-assembly by sequential spotting

    Directory of Open Access Journals (Sweden)

    Breitenstein Michael


    Full Text Available Abstract Background The ability to create nanostructures with biomolecules is one of the key elements in nanobiotechnology. One of the problems is the expensive and mostly custom made equipment which is needed for their development. We intended to reduce material costs and aimed at miniaturization of the necessary tools that are essential for nanofabrication. Thus we combined the capabilities of molecular ink lithography with DNA-self-assembling capabilities to arrange DNA in an independent array which allows addressing molecules in nanoscale dimensions. Results For the construction of DNA based nanostructures a method is presented that allows an arrangement of DNA strands in such a way that they can form a grid that only depends on the spotted pattern of the anchor molecules. An atomic force microscope (AFM has been used for molecular ink lithography to generate small spots. The sequential spotting process allows the immobilization of several different functional biomolecules with a single AFM-tip. This grid which delivers specific addresses for the prepared DNA-strand serves as a two-dimensional anchor to arrange the sequence according to the pattern. Once the DNA-nanoarray has been formed, it can be functionalized by PNA (peptide nucleic acid to incorporate advanced structures. Conclusions The production of DNA-nanoarrays is a promising task for nanobiotechnology. The described method allows convenient and low cost preparation of nanoarrays. PNA can be used for complex functionalization purposes as well as a structural element.

  4. First- and second-order Poisson spots (United States)

    Kelly, William R.; Shirley, Eric L.; Migdall, Alan L.; Polyakov, Sergey V.; Hendrix, Kurt


    Although Thomas Young is generally given credit for being the first to provide evidence against Newton's corpuscular theory of light, it was Augustin Fresnel who first stated the modern theory of diffraction. We review the history surrounding Fresnel's 1818 paper and the role of the Poisson spot in the associated controversy. We next discuss the boundary-diffraction-wave approach to calculating diffraction effects and show how it can reduce the complexity of calculating diffraction patterns. We briefly discuss a generalization of this approach that reduces the dimensionality of integrals needed to calculate the complete diffraction pattern of any order diffraction effect. We repeat earlier demonstrations of the conventional Poisson spot and discuss an experimental setup for demonstrating an analogous phenomenon that we call a "second-order Poisson spot." Several features of the diffraction pattern can be explained simply by considering the path lengths of singly and doubly bent paths and distinguishing between first- and second-order diffraction effects related to such paths, respectively.

  5. Word Spotting and Recognition with Embedded Attributes. (United States)

    Almazán, Jon; Gordo, Albert; Fornés, Alicia; Valveny, Ernest


    This paper addresses the problems of word spotting and word recognition on images. In word spotting, the goal is to find all instances of a query word in a dataset of images. In recognition, the goal is to recognize the content of the word image, usually aided by a dictionary or lexicon. We describe an approach in which both word images and text strings are embedded in a common vectorial subspace. This is achieved by a combination of label embedding and attributes learning, and a common subspace regression. In this subspace, images and strings that represent the same word are close together, allowing one to cast recognition and retrieval tasks as a nearest neighbor problem. Contrary to most other existing methods, our representation has a fixed length, is low dimensional, and is very fast to compute and, especially, to compare. We test our approach on four public datasets of both handwritten documents and natural images showing results comparable or better than the state-of-the-art on spotting and recognition tasks. PMID:26353157

  6. Prevalence of infectious agents in free-ranging white-tailed deer in northeastern Mexico. (United States)

    Cantu, Antonio; Ortega-S, J Alfonso; Mosqueda, Juan; Garcia-Vazquez, Zeferino; Henke, Scott E; George, John E


    The objectives of this study were to determine the prevalence of antibodies against brucellosis, leptospirosis, infectious bovine rhinotracheitis virus, and bovine viral diarrhea virus (BVDV) in white-tailed deer (Odocoileus virginianus) in northeastern Mexico. Deer (n=521) were captured from helicopter using a netgun on 15 ranches covering 62,114 ha in the states of Coahuila, Nuevo Leon, and Tamaulipas during spring 2004. The prevalence of antibodies against Leptospira, infectious bovine rhinotracheitis, BVDV, and brucellosis were 5.6, 41.1, 63.5, and 0%, respectively, indicating that white-tailed deer and cattle may share disease agents when cohabiting in northeastern Mexico. PMID:18957659

  7. Zika Virus. (United States)

    Phillips, Jennan A; Neyland, Anavernyel


    Zika virus (ZIKV) infections are the latest global public health emergency. Occupational health nurses can protect society by educating workers, women of childbearing age, and others traveling in ZIKV-infected areas about prevention strategies. PMID:27411846

  8. Evaluation of the human immunodeficiency virus type 1 and 2 antibodies detection in dried whole blood spots (dbs samples Pesquisa de anticorpos contra o vírus da imunodeficiência humana tipos 1 e 2 em amostras de sangue seco coletadas em papel filtro

    Directory of Open Access Journals (Sweden)

    Andréa Cauduro de Castro


    Full Text Available Human Immunodeficiency Vírus Type 1 and 2 antibodies detection was performed in 457 dried whole blood spots samples (S&S 903. Q-Preven HIV 1+2 was the screening test used. The results were compared with the gold standard serum tests by ELISA (Cobas Core e Axsym HIV1/2 gO and imunofluorescence was the definitive confirmatory test. The samples were obtained from the Hospital Nossa Senhora da Conceição in Porto Alegre, RS - Brazil, through whole blood transfer to filter paper card and sent to Caxias do Sul, RS - Brazil where the tests were performed. The dried whole blood spot stability was evaluated with two different panels. The first one was composed of five negative and five positive samples stored at room temperature, 4 ºC, -20 ºC and -70 ºC, while the second was composed of two negative and three positive samples stored at 37 ºC (humidity Foram realizados 457 testes para detectar anticorpos contra o Vírus da Imunodeficiência Humana tipos 1 e 2, em amostras de sangue total seco coletadas em papel filtro (S&S 903, com o teste de triagem Q-Preven HIV 1+2, comparando-se com os resultados dos testes de triagem no soro (Cobas Core e Axsym HIV1/2 gO, sendo a imunofluorescência indireta o teste confirmatório. As amostras foram obtidas no Hospital Conceição em Porto Alegre, pela transferência de sangue total para cartão de papel filtro e encaminhadas para Caxias do Sul para a realização dos testes. Foi analisada a estabilidade da amostra em papel filtro com a utilização de dois painéis: o primeiro com cinco amostras negativas e cinco positivas armazenadas por seis semanas à temperatura ambiente, 4 ºC, -20 ºC e -70 ºC; o segundo com duas negativas e três positivas armazenadas por seis semanas com avaliações semanais a 37 ºC (umidade <50%. Os resultados de todas as amostras testadas foram mantidos. A sensibilidade foi de 100%, a especificidade de 99,6%, o valor preditivo positivo de 99,5% e o valor preditivo negativo de 100

  9. Time Resolved X-Ray Spot Size Diagnostic

    CERN Document Server

    Richardson, Roger; Falabella, Steven; Guethlein, Gary; Raymond, Brett; Weir, John


    A diagnostic was developed for the determination of temporal history of an X-ray spot. A pair of thin (0.5 mm) slits image the x-ray spot to a fast scintillator which is coupled to a fast detector, thus sampling a slice of the X-Ray spot. Two other scintillator/detectors are used to determine the position of the spot and total forward dose. The slit signal is normalized to the dose and the resulting signal is analyzed to get the spot size. The position information is used to compensate for small changes due to spot motion and misalignment. The time resolution of the diagnostic is about 1 ns and measures spots from 0.5 mm to over 3 mm. The theory and equations used to calculate spot size and position are presented, as well as data. The calculations assume a symmetric, Gaussian spot. The spot data is generated by the ETA II accelerator, a 2kA, 5.5 MeV, 60ns electron beam focused on a Tantalum target. The spot generated is typically about 1 mm FWHM. Comparisons are made to an X-ray pinhole camera which images th...

  10. Amorphous-silicon module hot-spot testing (United States)

    Gonzalez, C. C.


    Hot spot heating occurs when cell short-circuit current is lower than string operating current. Amorphous cell hot spot are tested to develop the techniques required for performing reverse bias testing of amorphous cells. Also, to quantify the response of amorphous cells to reverse biasing. Guidelines are developed from testing for reducing hot spot susceptibility of amorphous modules and to develop a qualification test for hot spot testing of amorphous modules. It is concluded that amorphous cells undergo hot spot heating similarly to crystalline cells. Comparison of results obtained with submodules versus actual modules indicate heating levels lower in actual modules. Module design must address hot spot testing and hot spot qualification test conducted on modules showed no instabilities and minor cell erosion.

  11. Star spot location estimation using Kalman filter for star tracker. (United States)

    Liu, Hai-bo; Yang, Jian-kun; Wang, Jiong-qi; Tan, Ji-chun; Li, Xiu-jian


    Star pattern recognition and attitude determination accuracy is highly dependent on star spot location accuracy for the star tracker. A star spot location estimation approach with the Kalman filter for a star tracker has been proposed, which consists of three steps. In the proposed approach, the approximate locations of the star spots in successive frames are predicted first; then the measurement star spot locations are achieved by defining a series of small windows around each predictive star spot location. Finally, the star spot locations are updated by the designed Kalman filter. To confirm the proposed star spot location estimation approach, the simulations based on the orbit data of the CHAMP satellite and the real guide star catalog are performed. The simulation results indicate that the proposed approach can filter out noises from the measurements remarkably if the sampling frequency is sufficient. PMID:21509065

  12. Live Virus Smallpox Vaccine (United States)

    ... A - Z Index SMALLPOX FACT SHEET The Live Virus Smallpox Vaccine The vaccinia virus is the "live ... it cannot cause smallpox. What is a "live virus" vaccine? A "live virus" vaccine is a vaccine ...

  13. Retinoblastoma protein functions as a molecular switch determining white versus brown adipocyte differentiation

    DEFF Research Database (Denmark)

    Hansen, Jacob B; Jørgensen, Claus; Petersen, Rasmus K;


    Adipocyte precursor cells give raise to two major cell populations with different physiological roles: white and brown adipocytes. Here we demonstrate that the retinoblastoma protein (pRB) regulates white vs. brown adipocyte differentiation. Functional inactivation of pRB in wild-type mouse embryo...... fibroblasts (MEFs) and white preadipocytes by expression of simian virus 40 large T antigen results in the expression of the brown fat-specific uncoupling protein 1 (UCP-1) in the adipose state. Retinoblastoma gene-deficient (Rb-/-) MEFs and stem cells, but not the corresponding wild-type cells, differentiate...

  14. Computer Viruses. Technology Update. (United States)

    Ponder, Tim, Comp.; Ropog, Marty, Comp.; Keating, Joseph, Comp.

    This document provides general information on computer viruses, how to help protect a computer network from them, measures to take if a computer becomes infected. Highlights include the origins of computer viruses; virus contraction; a description of some common virus types (File Virus, Boot Sector/Partition Table Viruses, Trojan Horses, and…

  15. 'Snow White' in Color (United States)


    This color image taken by the Surface Stereo Imager on NASA's Phoenix Mars Lander shows the trench dubbed 'Snow White,' after further digging on the 25th Martian day, or sol, of the mission (June 19, 2008). The lander's solar panel is casting a shadow over a portion of the trench. The trench is about 5 centimeters (2 inches) deep and 30 centimeters (12 inches) long. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  16. The White Rabbit project

    CERN Document Server

    Serrano, J; Gousiou, E; van der Bij, E; Wlostowski, T; Daniluk, G; Lipinski, M


    White Rabbit (WR) is a multi-laboratory, multi- company collaboration for the development of a new Ethernet-based technology which ensures sub-nanosecond synchronisation and deterministic data transfer. The project uses an open source paradigm for the development of its hardware, gateware and software components. This article provides an introduction to the technical choices and an explanation of the basic principles underlying WR. It then describes some possible applications and the current status of the project. Finally, it provides insight on current developments and future plans.

  17. The color measurement system for spot color printing basing multispectral camera (United States)

    Liu, Nanbo; Jin, Weiqi; Huang, Qinmei; Song, Li


    Color measurement and control of printing has been an important issue in computer vision technology . In the past, people have used density meter and spectrophotometer to measure the color of printing product. For the color management of 4 color press, by these kind meters, people can measure the color data from color bar printed at the side of sheet, then do ink key presetting. This way have wide application in printing field. However, it can not be used in the case that is to measure the color of spot color printing and printing pattern directly. With the development of multispectral image acquisition, it makes possible to measure the color of printing pattern in any area of the pattern by CCD camera than can acquire the whole image of sheet in high resolution. This essay give a way to measure the color of printing by multispectral camera in the process of printing. A 12 channel spectral camera with high intensity white LED illumination that have driven by a motor, scans the printing sheet. Then we can get the image, this image can include color and printing quality information of each pixel, LAB value and CMYK value of each pixel can be got by reconstructing the reflectance spectra of printing image. By this data processing, we can measure the color of spot color printing and control it. Through the spot test in the printing plant, the results show this way can get not only the color bar density value but also ROI color value. By the value, we can do ink key presetting, that makes it true to control the spot color automatically in high precision.

  18. Dynamical Spot Evolution in HD 11753


    Korhonen, H.; Hubrig, S.; Briquet, Maryline; González, J.F.; Savanov, I.


    Our recent studies of HD 11753, a late B-type star showing a HgMn peculiarity for the first time revealed the presence of a fast dynamical evolution of chemical spots on the surface of this chemically peculiar early-type star. These observations suggest a hitherto unknown physical process operating in stars with outer radiative envelopes. Furthermore, we have also discovered existence of magnetic fields on HgMn stars that were up to now considered non-magnetic. Here we will discuss the dyna...

  19. Modelling of friction stir spot welding


    Reilly, Aidan


    Friction stir spot welding (FSSW) is a solid-state welding process which is especially useful for joining precipitation-hardened aluminium alloys that undergo adverse property changes during fusion welding. It also has potential as an effective method for solid-state joining of dissimilar alloys. In FSSW, heat generation and plastic flow are strongly linked, and the scale of the process in time and space is such that it is difficult to separate and control the influence of all the relevant in...

  20. Dispersion of hot spots in steam generators

    International Nuclear Information System (INIS)

    The streamwise development of hot spots in a helical type heat exchanger has been treated experimentally and theoretically as well. Velocity profiles across the bundle have been measured varying the Reynolds number, Re, from 103 to 1.35 x 105. Pressurized air or helium have been applied as coolant. In an additional series of tests the length scale parameter of the turbulence structure has been determined. It is correlated with the turbulent Peclet number, Pet, which occurs in the basic equation as an unknown parameter. Its value was found to be independent of Re (Pet = 8.2). Introducing this value leads to a good agreement of theoretical and experimental results. (author)

  1. On cold spots in tumor subvolumes

    International Nuclear Information System (INIS)

    Losses in tumor control are estimated for cold spots of various 'sizes' and degrees of 'cold dose'. This question is important in the context of intensity modulated radiotherapy where differential dose-volume histograms (DVHs) for targets that abut a critical structure often exhibit a cold dose tail. This can be detrimental to tumor control probability (TCP) for fractions of cold volumes even as small as 1%, if the cold dose is lower than the prescribed dose by substantially more than 10%. The Niemierko-Goitein linear-quadratic algorithm with γ50 slope 1-3 was used to study the effect of cold spots of various degrees (dose deficit below the prescription dose) and size (fractional volume of the cold dose). A two-bin model DVH has been constructed in which the cold dose bin is allowed to vary from a dose deficit of 1%-50% below prescription dose and to have volumes varying from 1% to 90%. In order to study and quantify the effect of a small volume of cold dose on TCP and effective uniform dose (EUD), a four-bin DVH model has been constructed in which the lowest dose bin, which has a fractional volume of 1%, is allowed to vary from 10% to 45% dose deficit below prescription dose. The highest dose bin represents a simultaneous boost. For fixed size of the cold spot the calculated values of TCP decreased rapidly with increasing degrees of cold dose for any size of the cold spot, even as small as 1% fractional volume. For the four-subvolume model, in which the highest dose bin has a fractional volume of 80% and is set at a boost dose of 10% above prescription dose, it is found that the loss in TCP and EUD is moderate as long as the cold 1% subvolume has a deficit less than approximately 20%. However, as the dose deficit in the 1% subvolume bin increases further it drives TCP and EUD rapidly down and can lead to a serious loss in TCP and EUD. Since a dose deficit to a 1% volume of the target that is larger than 20% of the prescription dose may lead to serious loss of TCP

  2. Gene : CBRC-OGAR-01-1331 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-1331 Novel UN D UNKNOWN EXTN_TOBAC 0.004 34% ref|NP_477761.1| wsv239 [Shrimp white ... spot syndrome virus ] gb|AAL33243.1| wsv239 [shrimp white spot syndrome ... virus ] gb|AAL89163.1| WSSV295 [shrimp white spot syndrom ... e virus ] 7e-05 36% MALDVKTKVLTMTLKTLHALASSRTFVPILFSRRKRSSP ...

  3. Offshoring White-Collar Work

    DEFF Research Database (Denmark)

    Slepniov, Dmitrij; M. Larsen, Marcus; Wæhrens, Brian Vejrum;


    The purpose of this chapter is twofold: to explain why white-collar service work in manufacturing firms is increasingly subject to offshoring and to understand the effects of this process on work integration mechanisms. The empirical part of the study is based on two case studies of Danish...... manufacturers. First, the chapter finds that drivers of white-collar work offshoring in many respects are parallel to those of the earlier wave of blue-collar work offshoring, that is, cost minimisation and resource seeking. Second, due to the interdependence of white-collar tasks with the rest of the...... organisation, our results suggest that white-collar offshoring in manufacturing firms poses higher requirements to the organisational configuration and capabilities compared with blue-collar work. We conceptualise the effects of white-collar work offshoring in a framework relating white-collar work to...

  4. The white dwarf luminosity function

    CERN Document Server

    García-Berro, Enrique


    White dwarfs are the final remnants of low- and intermediate-mass stars. Their evolution is essentially a cooling process that lasts for $\\sim 10$ Gyr. Their observed properties provide information about the history of the Galaxy, its dark matter content and a host of other interesting astrophysical problems. Examples of these include an independent determination of the past history of the local star formation rate, identification of the objects responsible for the reported microlensing events, constraints on the rate of change of the gravitational constant, and upper limits to the mass of weakly interacting massive particles. To carry on these tasks the essential observational tools are the luminosity and mass functions of white dwarfs, whereas the theoretical tools are the evolutionary sequences of white dwarf progenitors, and the corresponding white dwarf cooling sequences. In particular, the observed white dwarf luminosity function is the key manifestation of the white dwarf cooling theory, although other...

  5. Stark Broadening and White Dwarfs

    CERN Document Server

    Dimitrijevic, Milan S; Simic, Zoran; Sahal-Brechot, Sylvie


    White dwarf and pre-white dwarf atmospheres are one of the best examples for the application of Stark broadening research results in astrophysics, due to plasma conditions very favorable for this line broadening mechanism. For example in hot hydrogen-deficient (pre-) white dwarf stars Teff = 75 000 K - 180 000 K and log g = 5.5-8 [cgs]. Even for much cooler DA and DB white dwarfs with typical effective temperatures of 10 000 K - 20 000 K, Stark broadening is usually the dominant broadening mechanism. In this review, Stark broadening in white dwarf spectra is considered and the attention is drawn to the STARK-B database (, containing Stark broadening parameters needed for white dwarf spectra analysis and synthesis, as well as to the new search facilities which will provide the collective effort to develop Virtual Atomic and Molecular Data Center (VAMDC -

  6. The fractal nature of vacuum arc cathode spots

    Energy Technology Data Exchange (ETDEWEB)

    Anders, Andre


    Cathode spot phenomena show many features of fractals, for example self-similar patterns in the emitted light and arc erosion traces. Although there have been hints on the fractal nature of cathode spots in the literature, the fractal approach to spot interpretation is underutilized. In this work, a brief review of spot properties is given, touching the differences between spot type 1 (on cathodes surfaces with dielectric layers) and spot type 2 (on metallic, clean surfaces) as well as the known spot fragment or cell structure. The basic properties of self-similarity, power laws, random colored noise, and fractals are introduced. Several points of evidence for the fractal nature of spots are provided. Specifically power laws are identified as signature of fractal properties, such as spectral power of noisy arc parameters (ion current, arc voltage, etc) obtained by fast Fourier transform. It is shown that fractal properties can be observed down to the cutoff by measurement resolution or occurrence of elementary steps in physical processes. Random walk models of cathode spot motion are well established: they go asymptotically to Brownian motion for infinitesimal step width. The power spectrum of the arc voltage noise falls as 1/f {sup 2}, where f is frequency, supporting a fractal spot model associated with Brownian motion.

  7. Extraction of Spots in DNA Microarrays Using Genetic Algorithm

    Directory of Open Access Journals (Sweden)

    A. Sreedevi


    Full Text Available DNA microarray technology is an eminent tool for ge nomic studies. Accurate extraction of spots is a crucial issue since biological interpretations depe nd on it. The image analysis starts with the format ion of grid, which is a laborious process requiring human intervention. This paper presents a method for opti mal search of the spots using genetic algorithm without formation of grid. The information of every spot i s extracted by obtaining a pixel belonging to that sp ot. The method developed selects pixels of high int ensity in the image, thereby spot is recognized. The objec tive function, which is implemented, helps in ident ifying the exact pixel. The algorithm is applied to differ ent sizes of sub images and features of the spots a re obtained. It is found that there is a tradeoff betw een accuracy in the number of spots identified and time required for processing the image. Segmentation pro cess is independent of shape, size and location of the spots. Background estimation is one step process as both foreground and complete spot are realized. Coding of the proposed algorithm is developed in MA TLAB-7 and applied to cDNA microarray images. This approach provides reliable results for identif ication of even low intensity spots and elimination of spurious spots.

  8. Magnetized White Dwarfs

    CERN Document Server

    Terrero, D Alvear; Martínez, A Pérez


    The purpose of this thesis is to obtain more realistic equations of state to describe the matter forming magnetized white dwarfs, and use them to solve its structure equations. The equations of state are determined by considering the weak magnetic field approximation $Bwhite dwarfs. Also, we consider the energy and pressure correction due to the Coulomb interaction of the electron gas with the ions located in a crystal lattice. Moreover, spherically symmetric Tolman-Oppenheimer-Volkoff structure equations are solved independently for the perpendicular and parallel pressures, confirming the necessity of using axisymmetric structure equations, more adequate to describe the anisotropic system. Therefore, we study the solutions in cylindrical coordinates. In this case, the mass per longitude unit is obtained instead of the total mass of the whit...

  9. Advanced spot quality analysis in two-colour microarray experiments

    Directory of Open Access Journals (Sweden)

    Vetter Guillaume


    Full Text Available Abstract Background Image analysis of microarrays and, in particular, spot quantification and spot quality control, is one of the most important steps in statistical analysis of microarray data. Recent methods of spot quality control are still in early age of development, often leading to underestimation of true positive microarray features and, consequently, to loss of important biological information. Therefore, improving and standardizing the statistical approaches of spot quality control are essential to facilitate the overall analysis of microarray data and subsequent extraction of biological information. Findings We evaluated the performance of two image analysis packages MAIA and GenePix (GP using two complementary experimental approaches with a focus on the statistical analysis of spot quality factors. First, we developed control microarrays with a priori known fluorescence ratios to verify the accuracy and precision of the ratio estimation of signal intensities. Next, we developed advanced semi-automatic protocols of spot quality evaluation in MAIA and GP and compared their performance with available facilities of spot quantitative filtering in GP. We evaluated these algorithms for standardised spot quality analysis in a whole-genome microarray experiment assessing well-characterised transcriptional modifications induced by the transcription regulator SNAI1. Using a set of RT-PCR or qRT-PCR validated microarray data, we found that the semi-automatic protocol of spot quality control we developed with MAIA allowed recovering approximately 13% more spots and 38% more differentially expressed genes (at FDR = 5% than GP with default spot filtering conditions. Conclusion Careful control of spot quality characteristics with advanced spot quality evaluation can significantly increase the amount of confident and accurate data resulting in more meaningful biological conclusions.

  10. Ebola Virus

    Directory of Open Access Journals (Sweden)

    Anusha Rangare Lakshman


    Full Text Available The disease Ebola takes its name from the Ebola River situated near a village in the Democratic Republic of Congo, where the disease first appeared in 1976. It is caused by a virus from the Filoviridae family (filovirus. The present outbreak of Ebola Virus Disease (EVD concerns four countries in West Africa, namely Guinea, Liberia, Sierra Leone and Nigeria till date. Further to widespread transmission of the disease, it has been declared as a Public Health Emergency of International Concern by the World Health Organisation on 8 August 2014. As of 4 August 2014, countries have reported 1,711 cases (1,070 confirmed, 436 probable, 205 suspect, including 932 deaths. This review paper enlightens about the awareness of Ebola virus and its preventive measures. [Archives Medical Review Journal 2015; 24(3.000: 296-305

  11. New Experimental Hosts of Tobacco streak virus and Absence of True Seed Transmission in Leguminous Hosts


    Vemana, K.; Jain, R K


    Of 70 plant species tested, 50 species were susceptible to Tobacco streak virus (TSV) on sap inoculation. Both localized (necrotic and chlorotic spots) and systemic (necrotic spots, axillary shoot proliferation, stunting, total necrosis and wilt) symptoms are observed by majority of plant species. Eleven new experimental hosts were identified viz., Amaranthus blitum var. oleracea (Chaulai sag), Celosia cristata (Cocks comb), Beta vulgaris var. bengalensis (Palak/Indian spinach), Calendula off...

  12. Crude oil spot market pricing: Pearsonian analysis of crude oil spot market prices

    Energy Technology Data Exchange (ETDEWEB)

    Akinnusi, Ayo (Ondo State Polytechnic, Owo (Nigeria))

    This paper presents a brief overview of crude oil pricing before describing a study of sets of 1991 spot market prices, and examining Pearson's model. Empirical distribution characteristics for 14 crude oils are tabulated, and skewness-kurtosis relationship and implication are considered. (UK)

  13. SpotADAPT: Spot Aware (re-)Deployment of Analytical Processing Tasks on Amazon EC2

    DEFF Research Database (Denmark)

    Kaulakiene, Dalia; Thomsen, Christian; Pedersen, Torben Bach;


    Having constantly increasing amounts of data, the analysis of it is often entrusted for a MapReduce framework. The execution of an analytical workload can be cheapened by adopting cloud computing resources, and in particular by using spot instances (cheap, fluctuating price instances) offered by ...

  14. Hot spot exercise: 1975 (HSX-75)

    International Nuclear Information System (INIS)

    A special unannounced exercise, called HOT SPOT Exercise--1975 (HSX-75), was prepared to test the general capability of the LLL ALERT Program to activate and deploy the LLL and Sandia Laboratory, Livermore (SLL) component of the ERDA/ARG. The exercise activities were limited to the LLL facilities in Livermore and the Site 300 explosive test facility located approximately 15 miles southeast of Livermore. The exercise simulated an accident at a U.S. Army storage facility (Site 300). The simulated accident involved two LLL designed weapons (W-70). One weapon was dropped during unloading operations and ignited the gas tank of the weapon transporter. The subsequent fire caused a low-order detonation of the high explosive component. The fire caused dispersal of fissile material downwind from the site. A second weapon was damaged in the explosion by fragments from the first weapon. The extent of damage to the second weapon was initially unknown. The exercise was conducted on September 23, 1975. A complete description of the specific nature of the simulated accident is contained in the scenario. Umpires were assigned to evaluate and subsequently report on the effectiveness of the response. All test objectives were accomplished. The following appendices are included: operational safety procedures, photographs and site map, HOT SPOT equipment, atmospheric release advisory capability, personnel list, chronology of events, and critique comments

  15. Can a supervoid explain the Cold Spot?

    CERN Document Server

    Nadathur, Seshadri; Hotchkiss, Shaun; Räsänen, Syksy


    The discovery of a void of size $\\sim200\\;h^{-1}$Mpc and average density contrast of $\\sim-0.1$ aligned with the Cold Spot direction has been recently reported. It has been argued that, although the first-order integrated Sachs-Wolfe (ISW) effect of such a void on the CMB is small, the second-order Rees-Sciama (RS) contribution exceeds this by an order of magnitude and can entirely explain the observed Cold Spot temperature profile. In this paper we examine this surprising claim using both an exact calculation with the spherically symmetric Lema\\^itre--Tolman--Bondi metric, and perturbation theory about a background Friedmann--Robertson--Walker (FRW) metric. We show that both approaches agree well with each other, and both show that the dominant temperature contribution of the postulated void is an unobservable dipole anisotropy. If this dipole is subtracted, we find that the remaining temperature anisotropy is dominated by the linear ISW signal, which is orders of magnitude larger than the second-order RS ef...

  16. A new index for electricity spot markets

    International Nuclear Information System (INIS)

    Different indexes are used in electricity markets worldwide to represent the daily behavior of spot prices. However, the peculiarities of these markets require a careful choice of the index, based on mathematical formulation and its statistical properties. Choosing a bad index may influence the financial policies of market players, since derivative pricing and hedging performance can be deeply affected. In this paper with an initial theoretical analysis, we intend to show that the most widely used indexes (simple arithmetic average and weighted average with current volumes) are poor representatives of the spot market. We will then perform an analysis of the hedging strategy on a derivative instrument (an Asian option) written on a reference index. The resulting simulations, applied to OMEL (Spain) and EEX (Germany), are sufficiently clear cut to suggest that the decision to adopt an index to represent properly a market must be taken very carefully. Finally we will propose a new index (FAST index) and, after comparing it with the previous indexes, will show that both theoretically and practically this index can be taken as a good electricity market synthetic indicator. (author)

  17. White Faculty Transforming Whiteness in the Classroom through Pedagogical Practice (United States)

    Charbeneau, Jessica


    The primary objective of this qualitative study is to present a conceptual framework of pedagogical practices reported by white faculty that serve to challenge the hegemony of whiteness in the university classroom. These transformative teaching practices surfaced through a review of racialized pedagogies discussed in the literature and in…

  18. Medical students’ attitudes and perspectives regarding novel computer-based practical spot tests compared to traditional practical spot tests (United States)

    Wijerathne, Buddhika; Rathnayake, Geetha


    Background Most universities currently practice traditional practical spot tests to evaluate students. However, traditional methods have several disadvantages. Computer-based examination techniques are becoming more popular among medical educators worldwide. Therefore incorporating the computer interface in practical spot testing is a novel concept that may minimize the shortcomings of traditional methods. Assessing students’ attitudes and perspectives is vital in understanding how students perceive the novel method. Methods One hundred and sixty medical students were randomly allocated to either a computer-based spot test (n=80) or a traditional spot test (n=80). The students rated their attitudes and perspectives regarding the spot test method soon after the test. The results were described comparatively. Results Students had higher positive attitudes towards the computer-based practical spot test compared to the traditional spot test. Their recommendations to introduce the novel practical spot test method for future exams and to other universities were statistically significantly higher. Conclusions The computer-based practical spot test is viewed as more acceptable to students than the traditional spot test. PMID:26451213

  19. Hot spot formation on different tokamak wall materials

    International Nuclear Information System (INIS)

    The thermal contraction phenomenon and generation of 'hot spots' due to thermoemission were described. The paper consider non-linear stages of heat contraction on the graphite, beryllium, tungsten and vanadium wall. It is shown that on the beryllium surface hot spot can't appear due to strong cooling by sublimation. For other materials the conditions of hot spot appearance due to local superheating of the wall have been calculated and their parameters were found: critical surface temperature, size of spots and their temperature profiles, heat fluxes from plasma to the spots. It have been calculated fluxes of sublimating materials from spots to the plasma. It is noticed that nominal temperature of the grafite divertor plate, accepted in ITER's project to being equal 1500 C, is lower then critical temperature of the development heat contraction due to thermoemission. (orig.)

  20. Hot spot formation on different tokamak wall materials

    Energy Technology Data Exchange (ETDEWEB)

    Nedospasov, A.V.; Bezlyudny, I.V. [IVTAN, Moscow (Russian Federation)


    The thermal contraction phenomenon and generation of `hot spots` due to thermoemission were described. The paper consider non-linear stages of heat contraction on the graphite, beryllium, tungsten and vanadium wall. It is shown that on the beryllium surface hot spot can`t appear due to strong cooling by sublimation. For other materials the conditions of hot spot appearance due to local superheating of the wall have been calculated and their parameters were found: critical surface temperature, size of spots and their temperature profiles, heat fluxes from plasma to the spots. It have been calculated fluxes of sublimating materials from spots to the plasma. It is noticed that nominal temperature of the grafite divertor plate, accepted in ITER`s project to being equal 1500 C, is lower then critical temperature of the development heat contraction due to thermoemission. (orig.) 5 refs.

  1. Spot: A Programming Language for Verified Flight Software (United States)

    Bocchino, Robert L., Jr.; Gamble, Edward; Gostelow, Kim P.; Some, Raphael R.


    The C programming language is widely used for programming space flight software and other safety-critical real time systems. C, however, is far from ideal for this purpose: as is well known, it is both low-level and unsafe. This paper describes Spot, a language derived from C for programming space flight systems. Spot aims to maintain compatibility with existing C code while improving the language and supporting verification with the SPIN model checker. The major features of Spot include actor-based concurrency, distributed state with message passing and transactional updates, and annotations for testing and verification. Spot also supports domain-specific annotations for managing spacecraft state, e.g., communicating telemetry information to the ground. We describe the motivation and design rationale for Spot, give an overview of the design, provide examples of Spot's capabilities, and discuss the current status of the implementation.

  2. Eclipse mapping of the accreting magnetic white dwarf in DP Leonis with HST (United States)

    Stockman, H. S.; Schmidt, Gary D.; Liebert, James; Holberg, J. B.


    We present time-resolved ultraviolet spectrophotometry of the AM Her system DP Leo (E1114+182), obtained with the Faint Object Spectrograph on the Hubble Space Telescope (HST) in 1991 October. During this period, the binary was in a low-activity state. Complementary optical spectrophotometry and spectopolarimetry were obtained in 1991 October and December, as well as in 1992 April when the object had entered a high-accretion state. The HST spectrophotometry reveals two UV-emitting components-a hot 'spot' (T approximately 50,000 K, very approximately) near the magnetic pole into which most material is accreted, and the white dwarf photosphere (T approximately 16,000 K), which dominates when the spot is not in view. Both components appear as rapid and gradual components in the ingress and egress of secondary eclipse, the latter indicating a normal white dwarf radius of 0.8 x 10(exp 9) cm. The fractional area of the spot (f approximately 0.006) implied by the eclipse data is consistent with the observed UV flux and a minimum distance of 380 pc is similar to those found in other AM Her systems. The nearly identical eclipse light curves from the HST and earlier optical observations imply that the UV-emitting reprocessing area is not more extended than the cyclotron source of optical radiation in the accretion funnel. The timing of the onset of the bright phase indicated that the spot leads the secondary in orbital azimuth by approximately 3 deg.

  3. Susceptibility of Ten Red Clover (Trifolium pratense) Cultivars to Six Viruses after Artificial Inoculation

    Czech Academy of Sciences Publication Activity Database

    Fránová, Jana; Jakešová, H.


    Roč. 50, č. 3 (2014), s. 113-118. ISSN 1212-2580 R&D Projects: GA MZe QH71145 Institutional support: RVO:60077344 Keywords : Red clover mottle virus * White clover mosaic virus * DAS-ELISA Subject RIV: EE - Microbiology, Virology Impact factor: 0.597, year: 2014

  4. Vector competence of Culicoides sonorensis (Diptera: Ceratopogonidae) to epizootic hemorrhagic disease virus serotype 7 (United States)

    Background: Culicoides sonorensis (Diptera: Ceratopogonidae) is a vector of epizootic hemorrhagic disease virus (EHDV) serotypes 1 and 2 in North America, where these viruses are well-known pathogens of white-tailed deer (WTD) and other wild ruminants. Although historically rare, reports of clinica...

  5. Vector competence of the stable fly (Diptera: Muscidae)for West Nile virus. (United States)

    Stable flies, which are notorious pests of cattle and other livestock, were suspected of transmitting West Nile virus (WNV) among American white pelicans at the Medicine Lake Wildlife Refuge in northeastern Montana in 2006-2007. However the ability of stable flies to transmit the virus was unknown. ...

  6. Protein determinants of meiotic DNA break hot spots


    Fowler, Kyle R.; Gutiérrez-Velasco, Susana; Martín-Castellanos, Cristina; Smith, Gerald R.


    Meiotic recombination, crucial for proper chromosome segregation and genome evolution, is initiated by programmed DNA double-strand breaks (DSBs) in yeasts and likely all sexually reproducing species. In fission yeast, DSBs occur up to hundreds of times more frequently at special sites, called hot spots, than in other regions of the genome. What distinguishes hot spots from cold regions is an unsolved problem, although transcription factors determine some hot spots. We report the discovery th...

  7. Optimal Resource Allocation Between Spot and Package Demands


    Yoram Kinberg; Ambar G. Rao; Ephraim F Sudit


    This paper deals with the problem of allocating fixed resources between two types of demands; (a) spot demand; and (b) package (subscription) demand---demand that is satisfied by selling usage rights over a prespecified time period prior to actual consumption. In Model 1, a probabilistic spot demand for a single resource, stationary over time, is assumed together with externally determined spot and package pricing. It is shown that the optimal (profit maximizing) policy is to sell all the pac...

  8. Inverter DC resistance spot welding of magnesium alloy AZ31


    Hwang, I. S.; D. C. Kim; Kang, M. J.


    Purpose: The welding lobes of AC resistance spot welding and inverter DC resistance spot welding for the magnesium alloy sheet AZ31 were compared and analyzed.Design/methodology/approach: Using the welding lobe in terms of electrode force, weld time, and weld current which are process variables of the resistance spot welding, optimal welding conditions were determined. The lower limit of the range of the optimal welding condition was decided by minimum shear tension strength for the magnesium...

  9. Dominant inheritance of overo spotting in paint horses. (United States)

    Bowling, A T


    Analysis of selected studbook records of the American Paint Horse Association, consisting of 687 foals sired by 13 overo stallions from non-overo mares, supports the inheritance of overo spotting as an autosomal dominant gene. More than one gene may control patterns registered as overo. Additional studies are necessary to explain the sporadic occurrence of overo spotting from nonspotted quarter horse parents and to confirm the inheritance of overo spotting in other breeds. PMID:8014463

  10. White Cliffs: Operating Experience (United States)

    Kaneff, S.


    The fourteen dish white cliffs solar power station area is remote and subject to extreme environmental conditions, solution of the associated problems required careful and thoughtful attention and the application of resources. Notwithstanding the wide range and harshness of conditions, the difficulties caused by remoteness and the lack of a technological base and the need for relatively rapid demonstration of success, the project has had a very positive outcome. Qualitative and quantitative information and lessons are now available to enable considerable simplifications to be made for a new system, reducing both hardware and operation and maintenance costs. Experience and lessons are presented, particularly in relation to: system performance in various environmental conditions; design philosophies for collectors, the array, control systems, engine and plant; operation and maintenance strategies and cost reducing possibilities. Experience so far gives encouragement for the future of such paraboloidal dish systems in appropriate areas.

  11. A monolithic white laser (United States)

    Fan, Fan; Turkdogan, Sunay; Liu, Zhicheng; Shelhammer, David; Ning, C. Z.


    Monolithic semiconductor lasers capable of emitting over the full visible-colour spectrum have a wide range of important applications, such as solid-state lighting, full-colour displays, visible colour communications and multi-colour fluorescence sensing. The ultimate form of such a light source would be a monolithic white laser. However, realizing such a device has been challenging because of intrinsic difficulties in achieving epitaxial growth of the mismatched materials required for different colour emission. Here, we demonstrate a monolithic multi-segment semiconductor nanosheet based on a quaternary alloy of ZnCdSSe that simultaneously lases in the red, green and blue. This is made possible by a novel nanomaterial growth strategy that enables separate control of the composition, morphology and therefore bandgaps of the segments. Our nanolaser can be dynamically tuned to emit over the full visible-colour range, covering 70% more perceptible colours than the most commonly used illuminants.

  12. Passatempo Virus, a Vaccinia Virus Strain, Brazil


    Leite, Juliana A.; Drumond, Betânia P.; Trindade, Giliane S; Zélia I P Lobato; da Fonseca, Flávio G.; dos Santos, João R.; Madureira, Marieta C.; Guedes, Maria I.M.C.; Ferreira, Jaqueline M. S.; Bonjardim, Cláudio A.; Ferreira, Paulo C. P.; Kroon, Erna G.


    Passatempo virus was isolated during a zoonotic outbreak. Biologic features and molecular characterization of hemagglutinin, thymidine kinase, and vaccinia growth factor genes suggested a vaccinia virus infection, which strengthens the idea of the reemergence and circulation of vaccinia virus in Brazil. Molecular polymorphisms indicated that Passatempo virus is a different isolate.

  13. Experimental infection of vertebrates of the Pocomoke Cypress Swamp, Maryland with Keystone and Jamestown Canyon viruses. (United States)

    Watts, D M; Tammariello, R F; Dalrymple, J M; Eldridge, B F; Russell, P K; Top, F H


    Experimental studies were conducted to assess the susceptibility of white-tailed deer (Odocoileus virginianus), gray squirrels (Sciurus carolinensis), and cottontail rabbits (Sylvilagus floridanus) to Jamestown Canyon (JC) and/or Keystone (KEY) virus infection. Viremia occurred in 5 of 6 deer inoculated with JC virus; however, all deer developed KEY virus neutralizing antibody. Based on the observation that antibody elicited by primary infection of deer with either KEY or JC virus exhibited partial heterologous neutralization in vitro, cross-challenge experiments were performed in these animals. Keystone virus failed to infect deer 30 days post primary JC virus infection; however, deer became infected when challenged with KEY virus 80 days after the initial JC virus infection as indicated by a substantial increase in antibody titer. Similarly, JC virus failed to produce viremia in immune animals infected with KEY virus 80 days previously, although 2 of the 3 animals challenged had serological evidence of infection. Three field-collected cottontail rabbits with no evidence of KEY antibody were readily susceptible to KEY virus infection and developed viremias of 1-4 days' duration; rabbits with KEY virus antibody did not develop viremia upon KEY virus challenge. Eight antibody-negative field-collected gray squirrels became viremic following injection with KEY virus; however, a comparable group of squirrels did not become viremic when injected with JC virus. PMID:453437

  14. Genetic and serological characterization of chrysanthemum stem necrosis virus, a member of the genus Tospovirus. (United States)

    Wu, Pei-Ru; Chien, Wan-Chu; Okuda, Mitsuru; Takeshita, Minoru; Yeh, Shyi-Dong; Wang, Yun-Chi; Chen, Tsung-Chi


    Chrysanthemum stem necrosis virus (CSNV) is a member of a tentative tospovirus species. In this study, the complete genomic sequence of the Japanese CSNV isolate TcCh07A was determined. The L RNA is 8960 nt long and encodes the 331.0-kDa RNA-dependent RNA polymerase. The M RNA is 4828 nt long and encodes the 34.1-kDa movement protein (NSm) and the 127.7-kDa glycoprotein precursor (Gn/Gc). The S RNA is 2949 nt long and encodes the 52.4-kDa silencing suppressor protein (NSs) and the 29.3-kDa nucleocapsid (N) protein. The N protein of CSNV-TcCh07A was purified from virus-infected plant tissues and used for production of a rabbit polyclonal antiserum (RAs) and a monoclonal antibody (MAb). Results of serological tests by indirect ELISA and western blotting using the prepared RAs and MAb and a previously produced RAs against the N protein of tomato spotted wilt virus (TSWV) indicated that CSNV-TcCh07A, TSWV, tomato chlorotic spot virus, groundnut ringspot virus, alstroemeria necrotic streak virus and impatiens necrotic spot virus are serologically related. PMID:25427981

  15. Measurement of nugget size of spot weld by digital shearography (United States)

    Yang, Lianxiang; Samala, Praveen R.; Liu, Sheng; Long, Kah Wah; Lee, Yung-Li


    Resistance spot welding is now widely used in the fabrication of sheet metals, mainly due to the cost and time considerations. Friction stir spot welding is getting more and more acceptance in the automotive industries. Such spot welds are found in nearly all products where sheet metal is joined. Obviously the quality of the spot weld has a direct impact on the quality of the product. The most important quality target of spot welds is the size of the weld nuggets. If the weld nuggets are improperly or incompletely formed, or the area surrounding the nugget is smaller than required, the structural integrity of the entire part may be uncertain. Furthermore these inconsistencies are usually internal and are seldom visible to optical inspection. This study is focused on the quality analysis of the spot welds by using "Digital Shearography". The paper mainly focuses on developing a novel, whole field technique for non-destructive inspecting the size of spot-welds, both for the resistance spot weld and the friction stir spot weld.

  16. Granulometric Analysis of Spots in DNA Microarray Images

    Institute of Scientific and Technical Information of China (English)

    Behara Latha; Balasubramanian Venkatesh


    As the topological properties of each spot in DNA microarray images may vary from one another, we employed granulometries to understand the shape-size con tent contributed due to a significant intensity value within a spot. Analysis was performed on the microarray image that consisted of 240 spots by using concepts from mathematical morphology. In order to find out indices for each spot and to further classify them, we adopted morphological multiscale openings, which provided microarrays at multiple scales. Successive opened microarrays were subtracted to identify the protrusions that were smaller than the size of structuring element. Spot-wise details, in terms of probability of these observed protrusions,were computed by placing a regularly spaced grid on microarray such that each spot was centered in each grid. Based on the probability of size distribution functions of these protrusions isolated at each level, we estimated the mean size and texture index for each spot. With these characteristics, we classified the spots in a microarray image into bright and dull categories through pattern spectrum and shape-size complexity measures. These segregated spots can be compared with those of hybridization levels.

  17. Fatigue crack growth retardation in spot heated mild steel sheet

    Indian Academy of Sciences (India)

    B B Verma; P K Ray


    A fatigue crack can be effectively retarded by heating a spot near the crack tip under nil remote stress condition. The subcritical spot heating at a proper position modifies the crack growth behaviour in a way, more or less, similar to specimen subjected to overload spike. It is observed that the extent of crack growth retardation increases with increasing level of overload as well as with increasing spot temperature. It is also observed that modification in crack growth behaviour is a function of location of heating spot and maximum retardation is observed at + 5 position.

  18. Spot diameters for scanning photorefractive keratectomy: a comparative study (United States)

    Manns, Fabrice; Parel, Jean-Marie A.


    Purpose: The purpose of this study was to compare with computer simulations the duration, smoothness and accuracy of scanning photo-refractive keratectomy with spot diameters ranging from 0.2 to 1 mm. Methods: We calculated the number of pulses per diopter of flattening for spot sizes varying from 0.2 to 1 mm. We also computed the corneal shape after the correction of 4 diopters of myopia and 4 diopters of astigmatism with a 6 mm ablation zone and a spot size of 0.4 mm with 600 mJ/cm2 peak radiant exposure and 0.8 mm with 300 mJ/cm2 peak radiant exposure. The accuracy and smoothness of the ablations were compared. Results: The repetition rate required to produce corrections of myopia with a 6 mm ablation zone in a duration of 5 s per diopter is on the order of 1 kHz for spot sizes smaller than 0.5 mm, and of 100 Hz for spot sizes larger than 0.5 mm. The accuracy and smoothness after the correction of myopia and astigmatism with small and large spot sizes were not significantly different. Conclusions: This study seems to indicate that there is no theoretical advantage for using either smaller spots with higher radiant exposures or larger spots with lower radiant exposures. However, at fixed radiant exposure, treatments with smaller spots require a larger duration of surgery but provide a better accuracy for the correction of astigmatism.

  19. Regional Fluctuation in the Functional Consequence of LINE-1 Insertion in the Mitf Gene: The Black Spotting Phenotype Arisen from the Mitfmi-bw Mouse Lacking Melanocytes.

    Directory of Open Access Journals (Sweden)

    Kazuhisa Takeda

    Full Text Available Microphthalmia-associated transcription factor (Mitf is a key regulator for differentiation of melanoblasts, precursors to melanocytes. The mouse homozygous for the black-eyed white (Mitfmi-bw allele is characterized by the white-coat color and deafness with black eyes due to the lack of melanocytes. The Mitfmi-bw allele carries LINE-1, a retrotransposable element, which results in the Mitf deficiency. Here, we have established the black spotting mouse that was spontaneously arisen from the homozygous Mitfmi-bw mouse lacking melanocytes. The black spotting mouse shows multiple black patches on the white coat, with age-related graying. Importantly, each black patch also contains hair follicles lacking melanocytes, whereas the white-coat area completely lacks melanocytes. RT-PCR analyses of the pigmented patches confirmed that the LINE-1 insertion is retained in the Mitf gene of the black spotting mouse, thereby excluding the possibility of the somatic reversion of the Mitfmi-bw allele. The immunohistochemical analysis revealed that the staining intensity for beta-catenin was noticeably lower in hair follicles lacking melanocytes of the homozygous Mitfmi-bw mouse and the black spotting mouse, compared to the control mouse. In contrast, the staining intensity for beta-catenin and cyclin D1 was higher in keratinocytes of the black spotting mouse, compared to keratinocytes of the control mouse and the Mitfmi-bw mouse. Moreover, the keratinocyte layer appears thicker in the Mitfmi-bw mouse, with the overexpression of Ki-67, a marker for cell proliferation. We also show that the presumptive black spots are formed by embryonic day 15.5. Thus, the black spotting mouse provides the unique model to explore the molecular basis for the survival and death of developing melanoblasts and melanocyte stem cells in the epidermis. These results indicate that follicular melanocytes are responsible for maintaining the epidermal homeostasis; namely, the present study

  20. White Wedding and Red Wedding

    Institute of Scientific and Technical Information of China (English)



    @@ The most obvious difference between western wedding and Chinese wedding tradition lies in the main color of the ceremony.Western wedding is known as the white wedding in some sense,for its main color is white from bride's gown(礼服)to the decoration of the wedding hall.While,traditional Chinese wedding ceremony is full of the color of red.