Directory of Open Access Journals (Sweden)
Giuliano Grici Zacarin
2004-06-01
Full Text Available The reproductive capacity of females of Apanteles galleriae (Wilkinson, 1932 was evaluated in fifth instar caterpillars of Galleria mellonella (Linnaeus, 1758 and Achroia grisella (Fabricius, 1754 fed on standard diet and diets enriched with protein. The reproductive capacity of parasitoid females on fifth instar caterpillars of G. mellonella and A. grisella with variable weight was also evaluated. The host weight interfered in the sex ratio of the obtained parasitoids. In heavier caterpillars, the investment in female descendants was greater than in males, and in lighter caterpillars the inverse occurred.
Van Gheem, Nathan
2013-01-01
Get to grips with a new technology, understand what it is and what it can do for you, and then get to work with the most important features and tasks. This is a how-to book with practical recipes to make you an expert user of Galleria.This book is for Javascript developers and designers looking to learn how to create beautiful galleries for their web projects. It's assumed you know some JavaScript, JQuery, HTML, and CSS. Readers are expected to have images available to use with the galleries, a text editor, and a modern web browser to develop with.
Anti-Legionella dumoffii Activity of Galleria mellonella Defensin and Apolipophorin III
Directory of Open Access Journals (Sweden)
Małgorzata Cytryńska
2012-12-01
Full Text Available The gram-negative bacterium Legionella dumoffii is, beside Legionella pneumophila, an etiological agent of Legionnaires’ disease, an atypical form of pneumonia. The aim of this study was to determine the antimicrobial activity of Galleria mellonella defense polypeptides against L. dumoffii. The extract of immune hemolymph, containing a mixture of defense peptides and proteins, exhibited a dose-dependent bactericidal effect on L. dumoffii. The bacterium appeared sensitive to a main component of the hemolymph extract, apolipophorin III, as well as to a defense peptide, Galleria defensin, used at the concentrations 0.4 mg/mL and 40 μg/mL, respectively. L. dumoffii cells cultured in the presence of choline were more susceptible to both defense factors analyzed. A transmission electron microscopy study of bacterial cells demonstrated that Galleria defensin and apolipophorin III induced irreversible cell wall damage and strong intracellular alterations, i.e., increased vacuolization, cytoplasm condensation and the appearance of electron-white spaces in electron micrographs. Our findings suggest that insects, such as G. mellonella, with their great diversity of antimicrobial factors, can serve as a rich source of compounds for the testing of Legionella susceptibility to defense-related peptides and proteins.
Liao, Chunli; Gao, Along; Li, Bingbing; Wang, Mengjun; Shan, Linna
2017-03-01
The entomopathogenic nematode Heterorhabditis spp. is considered a promising agent in the biocontrol of injurious insects of agriculture. However, different symbiotic bacteria associated with the nematode usually have different specificity and virulence toward their own host. In this study, two symbiotic bacteria, LY2W and NK, were isolated from the intestinal canals of two entomopathogenic nematode Heterorhabditis megidis 90 (PDSj1 and PDSj2) from Galleria mellonela, separately. To determine their species classification, we carried out some investigations on morphology, culture, biochemistry, especially 16S rDNA sequence analyses. As a result, both of them belong to Enterobacter spp., showing the closest relatedness with Enterobacter gergoviae (LY2W) and Enterobacter cloacae (NK), respectively. Moreover, the toxicity to Galleria mellonella was examined using both the metabolites and washed cells (primary and secondary) of these two strains. The results indicated both metabolites and cells of the primary-type bacteria could cause high mortalities (up to 97%) to Galleria mellonella, while those of the primary-type bacteria only killed 20%. These findings would provide new symbiotic bacteria and further references for biological control of the agricultural pest. Copyright © 2016 Elsevier Ltd. All rights reserved.
Effect of reserpine on development and its neuro-endocrine regulation in Galleria mellonella
DEFF Research Database (Denmark)
Cymborowski, B.; Sørensen, Ilona Kryspin
1975-01-01
1. Studies were made on the effect of reserpine on development and its neuro-endocrine regulation in Galleria mellonella. It was shown that resperine greatly restricts the development of this insect. 2. Reserpine causes inhibition of the activity of the neurosecretory cells of pars intercerebralis...
Hearing and evasive behavior in the greater wax moth, Galleria mellonella (Pyralidae)
DEFF Research Database (Denmark)
Skals, Niels; Surlykke, Annemarie
2000-01-01
Greater wax moths (Galleria mellonella L., Pyraloidea) use ultrasound sensitive ears to detect clicking conspeci®cs and echolocating bats. Pyralid ears have four sensory cells, A1±4. The audiogram of G. mellonella has best frequency at 60 kHz with a threshold around 47 dB sound pressure level. A1...
Vertyporokh, Lidiia; Wojda, Iwona
2017-01-01
The inducible metalloproteinase inhibitor (IMPI) discovered in Galleria mellonella is currently the only specific inhibitor of metalloproteinases found in animals. Its role is to inhibit the activity of metalloproteinases secreted by pathogenic organisms as virulence factors to degrade immune-relevant polypeptides of the infected host. This is a good example of an evolutionary arms race between the insect hosts and their natural pathogens. In this report, we analyze the expression of a gene encoding an inducible metalloproteinase inhibitor (IMPI) in fat bodies of the greater wax moth larvae Galleria mellonella infected with an entomopathogenic fungus Beauveria bassiana. We have used a natural infection, i.e. covering larval integument with fungal aerospores, as well as injection of fungal blastospores directly into the larval hemocel. We compare the expression of IMPI with the expression of genes encoding proteins with fungicidal activity, gallerimycin and galiomycin, whose expression reflects the stimulation of Galleria mellonella defense mechanisms. Also, gene expression is analyzed in the light of survival of animals after spore injection.
76 FR 24080 - Houston District Office Advisory Committee
2011-04-29
... SMALL BUSINESS ADMINISTRATION Houston District Office Advisory Committee AGENCY: U.S. Small... Houston District Office Advisory committee. The meeting will be open to the public. DATES: The meeting...; located at 8701 South Gessner, Houston, TX 77074. SUPPLEMENTARY INFORMATION: Pursuant to section 10(a)(2...
76 FR 64990 - Houston District Office Advisory Committee
2011-10-19
... SMALL BUSINESS ADMINISTRATION Houston District Office Advisory Committee AGENCY: U.S. Small... Houston District Office Advisory committee. The meeting will be open to the public. DATES: The meeting...; located at 8701 South Gessner, Houston, TX. 77074. SUPPLEMENTARY INFORMATION: Pursuant to section 10(a)(2...
76 FR 2431 - Houston District Office Advisory Committee
2011-01-13
... SMALL BUSINESS ADMINISTRATION Houston District Office Advisory Committee AGENCY: U.S. Small... issuing this notice to announce the location, date, time, and agenda for the next meeting of the Houston..., located at 8701 South Gessner, Suite 1200, Houston, TX. 77074. SUPPLEMENTARY INFORMATION: Pursuant to...
33 CFR 117.457 - Houston River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of the...
75 FR 51473 - Houston/Galveston Navigation Safety Advisory Committee
2010-08-20
... DEPARTMENT OF HOMELAND SECURITY Coast Guard [Docket No. USCG-2010-0656] Houston/Galveston... Houston/Galveston Navigation Safety Advisory Committee (HOGANSAC) and its working groups will meet in Houston, Texas, to discuss waterway improvements, aids to navigation, area projects impacting safety on...
75 FR 23793 - Houston/Galveston Navigation Safety Advisory Committee
2010-05-04
... DEPARTMENT OF HOMELAND SECURITY Coast Guard [Docket No. USCG-2010-0032] Houston/Galveston... Houston/Galveston Navigation Safety Advisory Committee (``HOGANSAC'' or ``the Committee'') and its working groups will meet in Houston, Texas to discuss waterway improvements, aids to navigation, area projects...
76 FR 27337 - Houston/Galveston Navigation Safety Advisory Committee
2011-05-11
... DEPARTMENT OF HOMELAND SECURITY Coast Guard [USCG-2010-1116] Houston/Galveston Navigation Safety...: The Houston/Galveston Navigation Safety Advisory Committee postponed its originally scheduled February... Houston Ship Channel, and various other navigation safety matters in the Galveston Bay area. The meeting...
Houston Pre-Freshman Enrichment Program (Houston PREP). Final report, June 9, 1997--July 25, 1997
Energy Technology Data Exchange (ETDEWEB)
NONE
1997-10-01
The 1997 Houston Pre-Freshman Enrichment Program (PREP) was conducted at the campus of the University of Houston-Downtown from June 9 to July 25, 1997. Program participants were recruited from the Greater Houston Area. All participants were identified as high-achieving students with an interest in learning about the engineering and science professions. The goal of the program was to better prepare our pre-college youth prior to entering college as mathematics, science and engineering majors. The program participants were middle school and high school students from the Aldine, Alief, Channel View, Clear Creek, Cypress-Fairbanks, Fort Bend, Galena Park, Houston, Humble, Katy, Klein, North Forest, Pasadena, Private, and Spring Branch Independent School Districts. Of the 194 students starting the program, 165 students were from economically and socially disadvantage groups under-represented in the engineering and science professions, and 118 of the 194 were women. Our First Year group for 1997 composed of 96% minority and women students. Second and Third Year students combined were 96% minority or women. With financial support from the Center for Computational Sciences and Advanced Distributed Simulation, the Fourth Year Program was added to PREP this year. Twelve students completed the program (83% minority or women).
Rendon, Samuel H.; Lee, Michael T.
2015-12-08
Lake Houston, an important water resource for the Houston, Texas, area, receives inflows from seven major tributaries that compose the San Jacinto River Basin upstream from the reservoir. The effects of different inflows from the watersheds drained by these tributaries on the residence time of water in Lake Houston and closely associated physical and chemical properties including lake elevation, salinity, and water temperature are not well known. Accordingly, the U.S. Geological Survey (USGS), in cooperation with the City of Houston, developed a three-dimensional hydrodynamic model of Lake Houston as a tool for evaluating the effects of different inflows on residence time of water in the lake and associated physical and chemical properties. The Environmental Fluid Dynamics Code (EFDC), a grid-based, surface-water modeling package for simulating three-dimensional circulation, mass transport, sediments, and biogeochemical processes, was used to develop the model of Lake Houston. The Lake Houston EFDC model was developed and calibrated by using 2009 data and verified by using 2010 data. Three statistics (mean error, root mean square error, and the Nash-Sutcliffe model efficiency coefficient) were used to evaluate how well the Lake Houston EFDC model simulated lake elevation, salinity, and water temperature. The residence time of water in reservoirs is associated with various physical and chemical properties (including lake elevation, salinity, and water temperature). Simulated and measured lake-elevation values were compared at USGS reservoir station 08072000 Lake Houston near Sheldon, Tex. The accuracy of simulated salinity and water temperature values was assessed by using the salinity (computed from measured specific conductance) and water temperature at two USGS monitoring stations: 295826095082200 Lake Houston south Union Pacific Railroad Bridge near Houston, Tex., and 295554095093401 Lake Houston at mouth of Jack’s Ditch near Houston, Tex. Specific conductance
76 FR 2916 - Houston/Galveston Navigation Safety Advisory Committee; Meetings
2011-01-18
... DEPARTMENT OF HOMELAND SECURITY Coast Guard [USCG-2010-1116] Houston/Galveston Navigation Safety Advisory Committee; Meetings AGENCY: Coast Guard, DHS. ACTION: Notice of Meetings. SUMMARY: The Houston... will meet in Texas City, Texas and Houston, Texas to discuss waterway improvements, aids to navigation...
77 FR 29875 - Establishment of Class E Airspace; Houston, MO
2012-05-21
...-0903; Airspace Docket No. 11-ACE-20] Establishment of Class E Airspace; Houston, MO AGENCY: Federal... at Houston, MO. Controlled airspace is necessary to accommodate new Area Navigation (RNAV) Standard Instrument Approach Procedures at Houston Memorial Airport. The FAA is taking this action to enhance the...
DEFF Research Database (Denmark)
Nogueira-Silva, L; Da Hora, G. C.A.; Soares, Goncalo Teofilo Afonso Pinheiro
2017-01-01
Staphylococcus aureus is an opportunistic pathogen related to a variety of life-threatening infections but for which antimicrobial resistance is liming the treatment options. We report here that myricetin, but not its glycosylated form, can remarkably decrease the production of several S. aureus ...... in the Galleria mellonella model. The present findings reveal the potential of Myr as an alternative multi-target antivirulence candidate to control S. aureus pathogenicity....
Houston prefreshman enrichment program (Houston PREP). Final report, June 10, 1996--August 1, 1996
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-10-01
The 1996 Houston Pre-freshman Enrichment Program (PREP) was conducted on the campus of the University of Houston-Downtown from June 10 to August 1, 1996. Program Participants were recruited from the Greater Houston area. All participants were identified as high achieving students with an interest in learning about the engineering and science professions. The goal of the program was to better prepare our pre-college youth prior to entering college as mathematics, science and engineering majors. The program participants were middle school and high school students from the Aldine, Alief, Channel View, Crockett, Cypress-Fairbanks, Fort Bend, Galena Park, Houston, Humble, Katy, Klein, North Forest, Pasadena, Private, and Spring Branch Independent School Districts. Of the 197 students starting the program, 170 completed, 142 students were from economically and socially disadvantage groups underrepresented in the engineering and science professions, and 121 of the 197 were female. Our First Year group for 1996 composed of 96% minority and women students. Our Second and Third Year students were 100% and 93.75% minority or women respectively. This gave an overall minority and female population of 93.75%. This year, special efforts were again made to recruit students from minority groups, which caused a significant increase in qualified applicants. However, due to space limitations, 140 applicants were rejected. Investigative and discovery learning were key elements of PREP. The academic components of the program included Algebraic Structures, Engineering, Introduction to Computer Science, Introduction to Physics, Logic and Its Application to Mathematics, Probability and Statistics, Problem Solving Seminar using computers and PLATO software, SAT Preparatory Seminars, and Technical Writing.
Characterization of cry1Cb3 and cry1Fb7 from Bacillus thuringiensis subsp. galleriae
Czech Academy of Sciences Publication Activity Database
Huang, T.; Xiao, Y.; Pan, J.; Zhang, L.; Gelbič, Ivan; Guan, X.
2015-01-01
Roč. 10, č. 1 (2015), s. 521-528 ISSN 2391-5412 Institutional support: RVO:60077344 Keywords : Bacillus thuringiensis subsp. galleriae * PCR-RFLP * cloning Subject RIV: EB - Genetics ; Molecular Biology http://www.degruyter.com/view/j/biol.2015.10.issue-1/biol-2015-0054/biol-2015-0054.xml
78 FR 8492 - Foreign-Trade Zone 84-Houston, TX Application for Expansion
2013-02-06
..., industrial parks and warehouse facilities in Houston and the Harris County area. The sites--which are in Houston unless otherwise stated--are as follows: Site 1 (421 acres)--Houston Ship Channel Turning Basin, Clinton Drive at Highway 610 East Loop; Site 2 (97 acres)--Houston Ship Channel (Bulk Materials Handling...
Directory of Open Access Journals (Sweden)
Antonio Tubelis
1999-05-01
Full Text Available O trabalho estuda a correlação entre a produção de um pomar de laranja, plantado no altiplano de Botucatu, SP, com as precipitações que ocorrem dezesseis meses antes da colheita e a idade do pomar. As plantas eram de laranjeira doce (Citrus sinensis (L. Osbeck, variedade Westin, de clone nucelar, enxertadas em porta-enxerto de limoeiro 'Cravo' (Citrus limonia Osbeck, plantadas em solo Terra Roxa Estruturada, a 810 m de altitude e em região de clima do tipo Cwb. A cultura foi conduzida de modo convencional e sem irrigação. Coletaram-se dados de produção, nos períodos entre o 3º e o 17º e entre o 21º e o 27º ano de idade do pomar, para análise do comportamento da produção e o efeito da idade e das precipitações na produção. Calcularam-se equações lineares múltiplas de regressão, entre a produção, idade do pomar e as precipitações mensais, nos períodos de pomar juvenil, adulto, senescente e adulto-senescente. A produção correlacionou-se com a idade e com valores mensais de precipitação. Os pequenos desvios observados entre os valores medidos e estimados de produção revelaram que as equações de regressão poderiam ser usadas na previsão de safra ou no controle de irrigação suplementar do pomar.This paper deals with the existence of correlation between the production of a sweet orange orchard, planted at the plateau of Botucatu, São Paulo State, Brazil, with the orchard age and the rainfall that occurred in the sixteen months before the picking season. The plants were of sweet orange trees (Citrus sinensis (L. Osbeck, variety Westin, budded on 'Rangpur' lime (Citrus limonia Osbeck rootstock, grown on "Terra Roxa Estruturada" soil, at an altitude of 810 m above sea level and in a region with Cwb climatic type. The orchard was conducted by conventional ways and no irrigation was applied. The production of the orchard was recorded, during the period from the 3rd until the 17th and from the 21st until the 27th
33 CFR 165.813 - Security Zones; Ports of Houston and Galveston, TX.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Security Zones; Ports of Houston... Security Zones; Ports of Houston and Galveston, TX. (a) Location. Within the Ports of Houston and Galveston... yards of a cruise ship unless expressly authorized by the Coast Guard Captain of the Port Houston...
Jorjão, Adeline Lacerda; de Oliveira, Felipe Eduardo; Leão, Mariella Vieira Pereira; Jorge, Antonio Olavo Cardoso; de Oliveira, Luciane Dias
2018-04-01
This study evaluated the prophylactic effects of the live or heat-killed probiotic strain Lactobacillus rhamnosus ATCC 7469 in Galleria mellonella, inoculated with Staphylococcus aureus or Escherichia coli. L. rhamnosus suspension was prepared and a part of it was autoclaved to obtain heat-killed lactobacilli. The larvae were inoculated of these suspensions and pathogenic. The survival of the larvae was observed during 7 days and after 24 h of inoculation haemocytes counted, melanization and nitric oxide production were analyzed. Larvae survival rate increased in the group inoculated with heat-killed L. rhamnosus, however, with no statistical difference. There was a significant increase in total haemocyte counts in all test groups. Haemolymph melanization and nitric oxide production were higher in the group inoculated with L. rhamnosus and infected with S. aureus. It was concluded that, in this model of infection, heat-killed L. rhamnosus ATCC 7469 promoted greater protection in Galleria mellonella infected with S. aureus or E. coli.
Lee, Michael T.
2012-01-01
Since December 2005, the U.S. Geological Survey, in cooperation with the City of Houston, Texas, has been assessing the quality of the water flowing into Lake Houston. Continuous in-stream water-quality monitors measured streamflow and other physical water quality properties at stations in Spring Creek near Spring, Tex., and East Fork San Jacinto River near New Caney, Tex. Additionally, discrete water-quality samples were periodically collected on these tributaries and analyzed for selected constituents of concern. Data from the discrete water-quality samples collected during 2005-9, in conjunction with the real-time streamflow data and data from the continuous in-stream water-quality monitors, provided the basis for developing regression equations for the estimation of concentrations of water-quality constituents of these source watersheds to Lake Houston. The output of the regression equations are available through the interactive National Real-Time Water Quality Web site (http://nrtwq.usgs.gov).
77 FR 4711 - Proposed Establishment of Class E Airspace; Houston, MO
2012-01-31
...-0903; Airspace Docket No. 11-ACE-20] Proposed Establishment of Class E Airspace; Houston, MO AGENCY... action proposes to establish Class E airspace at Houston, MO. Controlled airspace is necessary to accommodate new Standard Instrument Approach Procedures (SIAP) at Houston Memorial Airport. The FAA is taking...
Beussink, Amy M.; Burnich, Michael R.
2009-01-01
Lake Houston, a reservoir impounded in 1954 by the City of Houston, Texas, is a primary source of drinking water for Houston and surrounding areas. The U.S. Geological Survey, in cooperation with the City of Houston, developed a continuous water-quality monitoring network to track daily changes in water quality in the southwestern quadrant of Lake Houston beginning in 2006. Continuous water-quality data (the physiochemical properties water temperature, specific conductance, pH, dissolved oxygen concentration, and turbidity) were collected from Lake Houston to characterize the in-lake processes that affect water quality. Continuous data were collected hourly from mobile, multi-depth monitoring stations developed and constructed by the U.S. Geological Survey. Multi-depth monitoring stations were installed at five sites in three general locations in the southwestern quadrant of the lake. Discrete water-quality data (samples) were collected routinely (once or twice each month) at all sites to characterize the chemical and biological (phytoplankton and bacteria) response to changes in the continuous water-quality properties. Physiochemical properties (the five continuously monitored plus transparency) were measured in the field when samples were collected. In addition to the routine samples, discrete water-quality samples were collected synoptically (one or two times during the study period) at all sites to determine the presence and levels of selected constituents not analyzed in routine samples. Routine samples were measured or analyzed for acid neutralizing capacity; selected major ions and trace elements (calcium, silica, and manganese); nutrients (filtered and total ammonia nitrogen, filtered nitrate plus nitrite nitrogen, total nitrate nitrogen, filtered and total nitrite nitrogen, filtered and total orthophosphate phosphorus, total phosphorus, total nitrogen, total organic carbon); fecal indicator bacteria (total coliform and Escherichia coli); sediment
33 CFR 165.814 - Security Zones; Captain of the Port Houston-Galveston Zone.
2010-07-01
... Port Houston-Galveston Zone. 165.814 Section 165.814 Navigation and Navigable Waters COAST GUARD... § 165.814 Security Zones; Captain of the Port Houston-Galveston Zone. (a) Location. The following areas are designated as security zones: (1) Houston, Texas. The Houston Ship Channel and all associated...
78 FR 69078 - Houston Pipe Line Company LP; Notice of Application
2013-11-18
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP14-13-000] Houston Pipe Line Company LP; Notice of Application Take notice that on October 28, 2013, Houston Pipe Line Company LP (HPL), 1300 Main Street, Houston, Texas 77002, filed an application in Docket No. CP14-13-000...
78 FR 53426 - Expansion of Foreign-Trade Zone 84; Houston, Texas
2013-08-29
... 84; Houston, Texas Pursuant to its authority under the Foreign-Trade Zones Act of June 18, 1934, as..., the Port of Houston Authority, grantee of Foreign-Trade Zone 84, submitted an application to the Board for authority to expand FTZ 84 to include a site in Brazos County, Texas, adjacent to the Houston...
75 FR 22168 - Region VI-Houston District; Advisory Council Meeting; Public Meeting
2010-04-27
... SMALL BUSINESS ADMINISTRATION Region VI--Houston District; Advisory Council Meeting; Public Meeting The Small Business Administration-Region VI--Houston Advisory Council, located in the geographical Area of Houston, Texas will hold a federal public meeting on--Thursday, May 20, 2010, starting at 10:30...
40 CFR 81.38 - Metropolitan Houston-Galveston Intrastate Air Quality Control Region.
2010-07-01
... 40 Protection of Environment 17 2010-07-01 2010-07-01 false Metropolitan Houston-Galveston... Designation of Air Quality Control Regions § 81.38 Metropolitan Houston-Galveston Intrastate Air Quality Control Region. The Metropolitan Houston-Galveston Intrastate Air Quality Control Region (Texas) has been...
Ground-water resources of the Houston district, Texas
White, Walter N.; Rose, N.A.; Guyton, William F.
1944-01-01
This report covers the current phase of an investigation of the supply of ground water available for the Houston district and adjacent region, Texas,- that has been in progress during the past 10 years. The field operations included routine inventories of pumpage, measurements of water levels in observation wells and collection of other hydrologic data, pumping tests on 21 city-owned wells to determine coefficients of permeability and storage, and the drilling of 13 deep test wells in unexplored parts of the district. Considerable attention has been given to studies of the location of areas or beds of sand that contain salt water. The ground water occurs in beds of sand, sandstone, and gravel of Miocene, Pliocene, and Pleistocene age. These formations crop out in belts that dip southeastward from their outcrop areas and are encountered by wells at progressively greater depths toward the southeast. The beds throughout the section are lithologically similar, and there is little agreement among geologists as to their correlation. -In this investigation, however, the sediments, penetrated by the wells are separated into six zones, chiefly on the basis of electrical logs. Most of the water occurs in zone 3, which ranges in thickness from 800 to 1,200 feet. Large quantities of ground water are pumped in three areas in the Houston district, as follows: The Houston tromping area, which includes Houston and the areas immediately adjacent; the Pasadena pumping area, which includes the industrial section extending along the ship channel from the Houston city limits eastward to Deer Park; and the Katy pumping area, an irregular-shaped area of several hundred square miles, which is roughly centered around the town of Katy, 30 miles west of Houston. In 1930 the total combined withdrawal of ground water in the Houston and Pasadena pumping areas averaged about 50 million gallons a day. It declined somewhat during 1932 and 1933 and then gradually increased, until in 1935 the total
Czech Academy of Sciences Publication Activity Database
Vašíček, Ondřej; Papežíková, Ivana; Hyršl, P.
2011-01-01
Roč. 108, č. 3 (2011), s. 481-485 ISSN 1210-5759 Grant - others:GA ČR(CZ) GP206/09/P470 Program:GP Institutional research plan: CEZ:AV0Z50040507; CEZ:AV0Z50040702 Keywords : Galleria mellonella * fluorescence * hydrogen peroxide Subject RIV: BO - Biophysics Impact factor: 1.061, year: 2011
Directory of Open Access Journals (Sweden)
Hedayat-allah M. Salem
2014-01-01
Full Text Available The ultrastructure studies on the haemolymph of 5th larval instar of Galleria mellonella showed five types of haemocytes; Prohaemocytes, Plasmatocytes, Granulocytes, Oenocytoids and Spherulocytes. After treatment with Steinernema carpocapsae BA2, the haemocytes underwent considerable structural changes. More destructive effects were observed in the haemocytes of G. mellonella treated with gamma irradiated S. carpocapsae.
Solar Leasing Summary, Houston Texas
Energy Technology Data Exchange (ETDEWEB)
Hammer, Mary [City of San Antonio, TX (United States)
2013-02-14
A relatively new option for homeowners looking to add solar to their home is the solar lease. At present, the solar lease option can be found in California, Arizona, Texas, Colorado, Hawaii, New York and Oregon. The most active companies currently offering solar leases are NRG Energy, Sungevity, Solar City and Sun Run. With the uncertainty and/or lack of subsidies the states participating in these programs have ebbed and flowed over the last few years. However, there is an expectation that in the current market solar leasing will make solar viable without the utility and federal subsidies. NRG Energy is currently testing this expectation in Houston, TX where currently no subsidies or incentives beyond the federal tax incentives, exist. Following is an explanation on the state of solar leasing in Houston, TX and explanation of the current financing options.
77 FR 1077 - Houston/Galveston Navigation Safety Advisory Committee; Vacancies
2012-01-09
... letter and resume to the following address: USCG Sector Houston-Galveston, Waterway Management Division... utilize the port facilities at Galveston, Houston, and Texas City. (b) One member representing labor... support of the Coast Guard policy on gender and ethnic nondiscrimination, we encourage qualified men and...
Texas Solar Collaboration DOE Rooftop Solar Challenge City of Houston Project Summary
Energy Technology Data Exchange (ETDEWEB)
Ronk, Jennifer [Houston Advanced Research Center, TX (United States)
2013-02-14
The City of Houston is committed to achieving a sustainable solar infrastructure. In 2008, Houston was named a United States Department of Energy (DOE) Solar America City. As a Solar America City, Houston teamed with the Houston Advanced Research Center (HARC), Sandia National Laboratory (Sandia), industry, and academia, to implement the Solar Houston Initiative and prepare the Solar Houston Plan. The Solar Houston initiative was focused on identifying and overcoming barriers associated with establishing a solar infrastructure that is incorporated into the City of Houston’s overall energy plan. A broad group of Houston area stakeholders, facilitated by HARC, came together to develop a comprehensive solar plan that went beyond technology to address barriers and establish demonstrations, public outreach, education programs and other activities. The plan included proposed scopes of work in four program areas: policies, solar integration, public outreach, and education. Through the support of the DOE SunShot Rooftop Solar Challenge (RSC) grant to the Texas Collaboration (San Antonio, Austin, and Hosuton), Houston has been able to implement several of the recommendations of the Solar Houston Plan. Specific recommendations that this project was able to support include; Working with the other Texas Solar America Cities (San Antonio and Austin), to harmonize permitting and inspection processes to simplify for installers and lower soft costs of installation; Participating in state level solar policy groups such as the Texas Renewable Energy Industries Association (TRIEA); Continued coordination with the local transmission and distribution utility (CenterPoint) and retail electric providers (REP); Identification of opportunities to improve permitting and interconnection; Providing training on PV systems to City inspectors; Educating the public by continuing outreach, training, and workshops, particularly using the the Green Building Resources Center; Evaluating methods of
Laulja Whitney Houston sõlmis rekordlepingu
2001-01-01
Popstaar Whitney Houston pikendas oma plaadifirmaga Arista lepingut ja tegi artistina popmuusika ajaloo kõige kallima tehingu, mis garanteerib talle kuue stuudioalbumi ja kahe hitikogumiku eest 100 miljonit dollarit
Alenizi, Dhahi; Ringwood, Tamara; Redhwan, Alya; Bouraha, Bouchra; Wren, Brendan W; Prentice, Michael; McNally, Alan
2016-08-01
Yersinia enterocolitica is a zoonotic pathogen and a common cause of gastroenteritis in humans. The species is composed of six diverse phylogroups, of which strains of phylogroup 1 are considered non-pathogenic to mammals due to the lack of the major virulence plasmid pYV, and their lack of virulence in a mouse infection model. In the present report we present data examining the pathogenicity of strains of Y. enterocolitica across all six phylogroups in a Galleria mellonellla model. We have demonstrated that in this model strains of phylogroup 1 exhibit severe pathogenesis with a lethal dose of as low as 10 c.f.u., that this virulence is an active process and that flagella play a major role in the virulence phenotype. We have also demonstrated that the complete lack of virulence in Galleria of the mammalian pathogenic phylogroups is not due to carriage of the pYV virulence plasmid. Our data suggest that all Y. enterocolitica can be pathogenic, which may be a reflection of the true natural habitat of the species, and that we may need to reconsider the eco-evo perspective of this important bacterial species.
Oden, Timothy D.; Asquith, William H.; Milburn, Matthew S.
2009-01-01
In December 2005, the U.S. Geological Survey in cooperation with the City of Houston, Texas, began collecting discrete water-quality samples for nutrients, total organic carbon, bacteria (total coliform and Escherichia coli), atrazine, and suspended sediment at two U.S. Geological Survey streamflow-gaging stations upstream from Lake Houston near Houston (08068500 Spring Creek near Spring, Texas, and 08070200 East Fork San Jacinto River near New Caney, Texas). The data from the discrete water-quality samples collected during 2005-07, in conjunction with monitored real-time data already being collected - physical properties (specific conductance, pH, water temperature, turbidity, and dissolved oxygen), streamflow, and rainfall - were used to develop regression models for predicting water-quality constituent concentrations for inflows to Lake Houston. Rainfall data were obtained from a rain gage monitored by Harris County Homeland Security and Emergency Management and colocated with the Spring Creek station. The leaps and bounds algorithm was used to find the best subsets of possible regression models (minimum residual sum of squares for a given number of variables). The potential explanatory or predictive variables included discharge (streamflow), specific conductance, pH, water temperature, turbidity, dissolved oxygen, rainfall, and time (to account for seasonal variations inherent in some water-quality data). The response variables at each site were nitrite plus nitrate nitrogen, total phosphorus, organic carbon, Escherichia coli, atrazine, and suspended sediment. The explanatory variables provide easily measured quantities as a means to estimate concentrations of the various constituents under investigation, with accompanying estimates of measurement uncertainty. Each regression equation can be used to estimate concentrations of a given constituent in real time. In conjunction with estimated concentrations, constituent loads were estimated by multiplying the
A comprehensive study of benzene concentrations and emissions in Houston
Müller, Markus; Eichler, Philipp; Berk Knighton, W.; Estes, Mark; Crawford, James H.; Mikoviny, Tomas; Wisthaler, Armin
2014-05-01
The Houston Metropolitan Area (Greater Houston) has a population of over 6 million people, it ranks among the three fastest growing metropolises in the developed world and population growth scenarios predict it to reach megacity status in the coming two to four decades. Greater Houston is home to the largest petrochemical-manufacturing complex in the world with important consequences for the environment in the region. Direct and fugitive emissions of hydrocarbons adversely affect Houston's air quality which has been subject to intense studies over the past two decades. In 2013, NASA conducted the DISCOVER-AQ field campaign in support of developing a satellite-based capability to assess Houston's air quality in the future. Amongst other measurements, airborne, mobile ground-based and stationary ground-based measurements of benzene were carried out. Benzene is a carcinogenic air toxic with strict exposure regulations in the U.S. and in Europe. We have used the obtained comprehensive dataset to map benzene concentrations in the Houston metropolitan area, locate and identify point sources, compare industrial and traffic emissions and put them in relation to previous measurements and emission inventories. The obtained data will allow a better assessment of health risks associated with benzene exposure in a large metropolitan area that includes both traffic and industrial benzene sources. This work was funded by BMVIT / FFG-ALR in the frame of the Austrian Space Application Programme (ASAP 8, project 833451). PE was funded through the PIMMS ITN (EU-FP7, agreement number 287382). Additional resources were provided through NASA's Earth Venture program (EV-1) and the NASA Postdoctoral Program (NPP). We want to thank Scott Herndon and Aerodyne Research for their support.
78 FR 14909 - Amendment of Class B Airspace Description; Houston, TX
2013-03-08
...-0079; Airspace Docket No. 13-AWA-1] RIN 2120-AA66 Amendment of Class B Airspace Description; Houston.... SUMMARY: This action amends the description of the Houston, TX, Class B airspace area by changing the... 14910
World of Learning: Houston Independent School District 2014 Annual Report and 2015 Calendar
Houston Independent School District, 2015
2015-01-01
No other city in the nation more clearly exemplifies the dramatically changing social, political, and economic landscape of America's urban centers than Houston. Houston has transformed from a bi-racial southern city on the bayou to one of the most ethnically and culturally diverse communities in the nation. Houston Independent School District…
Hurricane Harvey & Houston: Hell or High Water
Bedient, P. B.
2017-12-01
Harvey was the largest rainfall and most damaging flood event in US history. By all measures the widespread impact was a devastating blow to all of Houston and surrounding areas. It dropped between 36 and 52 inches along the Texas coast over 5 days, exceeding all previous rainfall records, with up to 20 inches in a day. However, two earlier events from 2015 and 2016 also brought widespread flooding to many parts of Houston, especially concentrated in a few watersheds. Most bayous during Harvey were over bank by as much as 10 ft, and flooded an estimated 136000 homes in Harris county alone, greatly exceeding the massive TS Allison impact of 2001. While the area deals with a significant recovery effort, there is a massive call to action on the part of politicians, governmental agencies, and those affected by this event. There is need for a better statistical basis of rainfalls and floodplain mapping in Houston. Development patterns and density have come into question, as homes have been either built in 100 yr floodplains or taken into those floodplains over time. Estimates say > 47 % of homes flooded in TS Allison were outside the floodplain. Many homes were built behind Addicks/Barker reservoirs that protect downtown, many with no knowledge that they were in harms way (over 8000 were flooded there alone), and flooded as water reached record setting levels. New technologies have allowed the measurement and prediction of floods to make great strides since the mid 1990s, (Radar, LIDAR, GIS, hydrologic models, floodplain updates) and the Houston area has benefited from these efforts. While the plan going forward is daunting, there are a number of positive steps that are occurring and should lead to more resiliency. There needs to be policy changes on storage and detention requirements, green space & infrastructure improvements, and perhaps a third regional reservoir above Addicks. Also there is a renewed interest in flood warning systems to better inform the public
2011-05-25
... Advisory Services LLP, Real Estate Consulting, Houston, TX; Amended Certification Regarding Eligibility To... Financial Advisory Services LLP, Real Estate Consulting, Houston, Texas (subject firm). The Department's... Services LLP, Real Estate Consulting, Houston, Texas who were adversely affected by a shift in services to...
Treatment for cracked and permeable Houston clay
International Nuclear Information System (INIS)
Vipulanandan, C.; Leung, M.
1991-01-01
In this study, the treatability of a field clay (obtained from Houston, Texas) and a clay-sand mixture to reduce their hydraulic conductivity was evaluated. Remolded field clay and clay-sand mixture with and without methanol contamination were treated to reduce their hydraulic conductivity by permeating very dilute grout solutions. The concentration of sodium silicate in the grout solution was 8%, while the solid content in the cement grout was 0.3%. The hydraulic conductivity of permeable Houston clay (hydraulic conductivity >10 -5 cm/sec) could be reduced to less than 10 -7 cm/sec (U.S. EPA limit for soil barriers) by permeating with a selected combination of grout solutions
Monitoring and Mapping the Hurricane Harvey Flooding in Houston, Texas.
Balaji Bhaskar, M. S.
2017-12-01
Monitoring and Mapping the Hurricane Harvey Flooding in Houston, Texas.Urban flooding is a hazard that causes major destruction and loss of life. High intense precipitation events have increased significantly in Houston, Texas in recent years resulting in frequent river and bayou flooding. Many of the historical storm events such as Allison, Rita and Ike have caused several billion dollars in losses for the Houston-Galveston Region. A category 4 Hurricane Harvey made landfall on South Texas resulting in heavy precipitation from Aug 25 to 29 of 2017. About 1 trillion gallons of water fell across Harris County over a 4-day period. This amount of water covers Harris County's 1,800 square miles with an average of 33 inches of water. The long rain event resulted in an average 40inch rainfall across the area in several rain gauges and the maximum rainfall of 49.6 inches was recorded near Clear Creek. The objectives of our study are to 1) Process the Geographic Information System (GIS) and satellite data from the pre and post Hurricane Harvey event in Houston, Texas and 2) Analyze the satellite imagery to map the nature and pattern of the flooding in Houston-Galveston Region. The GIS data of the study area was downloaded and processed from the various publicly available resources such as Houston Galveston Area Council (HGAC), Texas Commission of Environmental Quality (TCEQ) and Texas Natural Resource Information Systems (TNRIS). The satellite data collected soon after the Harvey flooding event were downloaded and processed using the ERDAS image processing software. The flood plain areas surrounding the Brazos River, Buffalo Bayou and the Addicks Barker reservoirs showed severe inundation. The different watershed areas affected by the catastrophic flooding in the wake of Hurricane Harvey were mapped and compared with the pre flooding event.
75 FR 16336 - Establishment of Low Altitude Area Navigation Route (T-284); Houston, TX
2010-04-01
... (T-284); Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action establishes a low altitude area navigation (RNAV) route, designated T-284, in the Houston... navigable airspace in the Houston, TX, terminal area. DATES: Effective date 0901 UTC, July 29, 2010. The...
75 FR 39149 - Establishment of Low Altitude Area Navigation Route (T-284); Houston, TX
2010-07-08
... (T-284); Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule... area navigation (RNAV) route T-284 for the Houston, TX, terminal area, is being withdrawn. As a result of Houston Area Air Traffic System (HAATS) Project, Phase 3C, program actions, the route is pending...
75 FR 18047 - Amendment of Low Altitude Area Navigation Route T-254; Houston, TX
2010-04-09
...-254; Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION: Final rule. SUMMARY: This action amends low altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by... Houston, TX, terminal area. DATES: Effective Dates: 0901 UTC, June 3, 2010. The Director of the Federal...
Ünsal, Sadettin; Güner, Emine
2016-01-01
The chitin synthesis inhibitory (CSI) effects of azadirachtin on the fifth instar Galleria mellonella L. larval integument were investigated. Using probit analysis, the LC95 value for G. mellonella larvae was detected as 3991 ppm. In this study, 3991 ppm and the reduced 1995, 997, and 498 ppm concentrations were used. It was observed that azadirachtin had different effects on the integument when the larvae were fed semi-synthetic feed containing 498, 997, 1995, or 3991 ppm azadirachtin. Morph...
2011-01-25
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9256-8] Adequacy Status of the Houston-Galveston-Brazoria... vehicle emissions budgets (MVEBs) in the Houston-Galveston-Brazoria, Texas (HGB) Reasonable Further... Progress (RFP) SIP and an Attainment Demonstration SIP for the Houston- Galveston-Brazoria (HGB) ozone...
Directory of Open Access Journals (Sweden)
Michell Stephen L
2011-01-01
Full Text Available Abstract Background Burkholderia pseudomallei is the causative agent of melioidosis, a tropical disease of humans with a variable and often fatal outcome. In murine models of infection, different strains exhibit varying degrees of virulence. In contrast, two related species, B. thailandensis and B. oklahomensis, are highly attenuated in mice. Our aim was to determine whether virulence in mice is reflected in macrophage or wax moth larvae (Galleria mellonella infection models. Results B. pseudomallei strains 576 and K96243, which have low median lethal dose (MLD values in mice, were able to replicate and induce cellular damage in macrophages and caused rapid death of G. mellonella. In contrast, B. pseudomallei strain 708a, which is attenuated in mice, showed reduced replication in macrophages, negligible cellular damage and was avirulent in G. mellonella larvae. B. thailandensis isolates were less virulent than B. pseudomallei in all of the models tested. However, we did record strain dependent differences. B. oklahomensis isolates were the least virulent isolates. They showed minimal ability to replicate in macrophages, were unable to evoke actin-based motility or to form multinucleated giant cells and were markedly attenuated in G. mellonella compared to B. thailandensis. Conclusions We have shown that the alternative infection models tested here, namely macrophages and Galleria mellonella, are able to distinguish between strains of B. pseudomallei, B. thailandensis and B. oklahomensis and that these differences reflect the observed virulence in murine infection models. Our results indicate that B. oklahomensis is the least pathogenic of the species investigated. They also show a correlation between isolates of B. thailandensis associated with human infection and virulence in macrophage and Galleria infection models.
SU-E-P-02: Imaging and Radiation Oncology Core (IROC) Houston QA Center (RPC) Credentialing
International Nuclear Information System (INIS)
Amador, C; Keith, T; Nguyen, T; Molineu, A; Followill, D
2014-01-01
Purpose: To provide information pertaining to IROC Houston QA Center's (RPC) credentialing process for institutions participating in NCI-sponsored clinical trials. Methods: IROC Houston issues credentials for NCI sponsored study groups. Requirements for credentialing might include any combination of questionnaires, knowledge assessment forms, benchmarks, or phantom irradiations. Credentialing requirements for specific protocols can be found on IROC Houston's website (irochouston.mdanderson.org). The website also houses the credentialing status inquiry (CSI) form. Once an institution has reviewed the protocol's credentialing requirements, a CSI form should be completed and submitted to IROC Houston. This form is used both to request whether requirements have been met as well as to notify IROC Houston that the institution requests credentialing for a specific protocol. IROC Houston will contact the institution to discuss any delinquent requirements. Once the institution has met all requirements IROC Houston issues a credentialing letter to the institution and will inform study groups and other IROC offices of the credentials. Institutions can all phone the IROC Houston office to initiate credentialing or ask any credentialing related questions. Results: Since 2010 IROC has received 1313 credentialing status inquiry forms. We received 317 in 2010, 266 in 2011, 324 in 2012, and 406 in 2013. On average we receive 35 phone calls per week with multiple types of credentialing questions. Decisions regarding credentialing status are based on the protocol specifications and previous completed credentialing by the institution. In some cases, such as for general IMRT credentialing, up to 5 sites may be credentialed based on the credentialing of one main center. Each of these situations is handled individually. Conclusion: IROC Houston will issue radiation therapy credentials for the NCI trials in the National Clinical Trials Network. Credentialing requirements and the CSI form
2013-06-18
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-17-2013] Foreign-Trade Zone 84--Houston, Texas; Authorization of Production Activity; Toshiba International Corporation; (Hybrid Electric Vehicle Motors and Generators Production); Houston, Texas On February 11, 2013, the Port of Houston Authority, grantee of FTZ 84...
2013-08-02
... ENVIRONMENTAL PROTECTION AGENCY [FRL-9841-2] Adequacy Status of the Houston-Galveston-Brazoria... has found that the motor vehicle emissions budgets (MVEBs) in the Houston-Galveston-Brazoria, Texas... 2: Table 1-- Houston-Galveston-Brazoria 1997 8-Hour Ozone Reasonable Further Progress NOX and VOC...
Silverman, Earl D
2017-05-01
The 72nd Annual Meeting of The Canadian Rheumatology Association (CRA) was held at The Westin Ottawa, Ottawa, Ontario, Canada, February 8-11, 2017. The program consisted of presentations covering original research, symposia, awards, and lectures. Highlights of the meeting include the following 2017 award winners: Dr. Vinod Chandran, Young Investigator; Dr. Jacques P. Brown, Distinguished Investigator; Dr. David Robinson, Teacher-Educator; Dr. Michel Zummer, Distinguished Rheumatologist; Ms. Rebecca Gole, Best Abstract on SLE Research by a Trainee - Ian Watson Award; Ms. Bailey Russell, Best Abstract on Clinical or Epidemiology Research by a Trainee - Phil Rosen Award; Dr. Sahil Koppikar and Dr. Henry Averns, Practice Reflection Award; Dr. Shirine Usmani, Best Abstract on Basic Science Research by a Trainee; Ms. Carol Dou, Best Abstract for Research by an Undergraduate Student; Dr. Dania Basodan, Best Abstract on Research by a Rheumatology Resident; Dr. Claire Barber, Best Abstract on Adult Research by Young Faculty; Ms. Audrea Chen, Best Abstract by a Medical Student; Dr. Kun Huang, Best Abstract by a Post-Graduate Resident; and Dr. Ryan Lewinson, Best Abstract by a Post-Graduate Research Trainee. Lectures and other events included a Keynote Lecture by Jonathon Fowles: Exercise is Medicine: Is Exercise a Good or Bad Thing for People with Arthritis?; State of the Art Lecture by Matthew Warman: Insights into Bone Biology and Therapeutics Gleaned from the Sustained Investigation of Rare Diseases; Dunlop-Dottridge Lecture by Allen Steere: Lyme Disease: A New Problem for Rheumatologists in Canada; and the Great Debate: Be it Resolved that the Least Expensive Treatment Should be Chosen. Switch, Switch, Switch! Arguing for: Jonathan Chan and Antonio Avina, and against: Marinka Twilt and Glen Hazlewood. Topics such as rheumatoid arthritis, systemic lupus erythematosus, systemic sclerosis, Sjögren syndrome, psoriatic arthritis, spondyloarthritis, vasculitis, osteoarthritis
Lyondell plans to hike heavy crude runs at Houston
International Nuclear Information System (INIS)
Land, R.
1992-01-01
Lyondell Petrochemical Co. has outlined a venture that would allow increased runs of heavy crude oil at its 265,000 b/cd Houston refiner. Preliminary plans call for Lyondell, Houston, to ally with subsidiaries of Venezuela's Petroleos de Venezuela SA to upgrade heavy crude processing capabilities of the refiner and obtain supplies of heavy crude feedstock. Lyondell proposes to form a jointly owned company with Pdvsa's Citgo Petroleum Corp. subsidiary to take over ownership of the Houston plant. This paper reports that upgrades would not significantly change the plant's crude capacity but would allow the refiner to process as much as 200,000 b/d of heavy crude feedstock, up from 120,000 b/d at present. Following completion of the upgrade, Citgo could increase its interest to 50% with Lyondell retaining remaining venture interest. Upgrade design and engineering are to begin immediately, with regulatory permitting and construction expected to be complete in 3-4 years
2013-03-12
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-88-2012] Foreign-Trade Zone 84--Houston, Texas, Authorization of Production Activit, Mitsubishi Caterpillar Forklift America Inc. (Forklift Trucks), Houston, TX On November 2, 2012, the Port of Houston Authority, grantee of FTZ 84, submitted a notification of...
2013-08-13
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [B-77-2013] Foreign-Trade Zone 84--Houston, Texas; Application for Subzone; Toshiba International Corporation; Houston, Texas An application has been submitted to the Foreign-Trade Zones (FTZ) Board by the Port of Houston Authority, grantee of FTZ 84...
75 FR 6319 - Proposed Amendment of Low Altitude Area Navigation Route T-254; Houston, TX
2010-02-09
... Amendment of Low Altitude Area Navigation Route T-254; Houston, TX AGENCY: Federal Aviation Administration... altitude Area Navigation (RNAV) route T-254 in the Houston, TX, terminal area by eliminating the segment... safety and the efficient use of the navigable airspace in the Houston, TX, terminal area. DATES: Comments...
SU-E-P-02: Imaging and Radiation Oncology Core (IROC) Houston QA Center (RPC) Credentialing
Energy Technology Data Exchange (ETDEWEB)
Amador, C; Keith, T; Nguyen, T; Molineu, A; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)
2014-06-01
Purpose: To provide information pertaining to IROC Houston QA Center's (RPC) credentialing process for institutions participating in NCI-sponsored clinical trials. Methods: IROC Houston issues credentials for NCI sponsored study groups. Requirements for credentialing might include any combination of questionnaires, knowledge assessment forms, benchmarks, or phantom irradiations. Credentialing requirements for specific protocols can be found on IROC Houston's website (irochouston.mdanderson.org). The website also houses the credentialing status inquiry (CSI) form. Once an institution has reviewed the protocol's credentialing requirements, a CSI form should be completed and submitted to IROC Houston. This form is used both to request whether requirements have been met as well as to notify IROC Houston that the institution requests credentialing for a specific protocol. IROC Houston will contact the institution to discuss any delinquent requirements. Once the institution has met all requirements IROC Houston issues a credentialing letter to the institution and will inform study groups and other IROC offices of the credentials. Institutions can all phone the IROC Houston office to initiate credentialing or ask any credentialing related questions. Results: Since 2010 IROC has received 1313 credentialing status inquiry forms. We received 317 in 2010, 266 in 2011, 324 in 2012, and 406 in 2013. On average we receive 35 phone calls per week with multiple types of credentialing questions. Decisions regarding credentialing status are based on the protocol specifications and previous completed credentialing by the institution. In some cases, such as for general IMRT credentialing, up to 5 sites may be credentialed based on the credentialing of one main center. Each of these situations is handled individually. Conclusion: IROC Houston will issue radiation therapy credentials for the NCI trials in the National Clinical Trials Network. Credentialing requirements
European astronaut training in Houston.
Chiarenza, O
1993-11-01
Three European astronauts are currently training as Space Shuttle Mission Specialists at NASA's Johnson Space Center in Houston. Two of the astronauts, Maurizio Cheli and Jean-Francois Clervoy, recently became members of NASA's 'astronaut pool' and have entered the Advanced Training phase. The third one, Claude Nicollier, is now preparing for the mission to service the Hubble Space Telescope in December.
Houston-Galveston Navigation Channel Shoaling Study
2014-12-01
Roads, which is bordered by Bolivar Peninsula to the northeast and Galveston Island to the southwest (Figure 1). Two jetties approximately 6,900 ft...USACE SWG. In 2008, the USACE SWG, and the Port of Houston tasked a joint venture formed by Turner Collie & Braden, Inc., and Gahagan & Bryant
Maxwell, Philip W.; Chen, Genhui; Webster, John M.; Dunphy, Gary B.
1994-01-01
Xenorhabdus nematophilus subsp. dutki, an entomopathogenic bacterium, is vectored by steinernematid nematodes into insects, where it produces broad-spectrum antibiotics. The use of the nematode-bacterium complex against soil-dwelling pest insects could introduce antibiotics into the soil via the dead insect fragments during the emergence phase of the nematodes. Studies on the stability and activities of these antibiotics produced in the insect Galleria mellonella may contribute to assessing t...
RadNet Air Data From Houston, TX
This page presents radiation air monitoring and air filter analysis data for Houston, TX from EPA's RadNet system. RadNet is a nationwide network of monitoring stations that measure radiation in air, drinking water and precipitation.
78 FR 39254 - Foreign-Trade Zone 84-Houston, Texas; Application for Expansion
2013-07-01
...). FTZ 84 currently consists of 25 sites (2,756.74 acres total) at port facilities, industrial parks and... stated--are as follows: Site 1 (420.70 acres)--Houston Ship Channel Turning Basin, Clinton Drive at Highway 610 East Loop; Site 2 (97 acres)--Houston Ship Channel (Bulk Materials Handling Plant), north bank...
Susceptibility of irradiated Galleria mellonella F1Larvae to Entomopathogenic Nematodes
International Nuclear Information System (INIS)
Salem, H.M.; Rizk, S.A.; Sayed, R.M.; Hussein, M.A; Hafez, S.E
2008-01-01
Combined effect of substerilizing doses of gamma radiation (40 and 100 Gy) and different concentrations of entomopathogenic nematodes (20, 40, 60, and 80 IJs) on the greater wax moth, Galleria mellonella was studied. The 4th larval instar resulted from irradiated male parent pupae mated with normal female were tested for susceptibility to Heterorhabditis bacteriophora BA1 and Steinernema carpocapsae BA2. The mortality rate of the larvae increased by increrasing radiation dose and nematode concentrations. The reproduction of both nematode strains decreased significantly with increasing the treatments (radiation dose and nematode concentrations). In addition, exposure to gamma radiation and entomopathogenic nematodes significantly decreased the total haemocyte count (THC) of the larvae with increasing radiation doses (40 and 100 Gy) and both nematode strains concentrations (20 and 40 IJs) and reached the minimal count at the combiend effect. Finally, larvae were more susceptible to Steinernema carpocapsa than Heterorhabditis bacteriophora. (author)
2016-09-01
AFRL-AFOSR-VA-TR-2016-0303 Tools to Study Interfaces for Superconducting ,Thermoelectric, and Magnetic Materials Paul C. W. Chu UNIVERSITY OF HOUSTON...8/28/2014 - 8/27/2016 Title: Tools to Study Interfaces for Superconducting , Thermoelectric, and Magnetic Materials at the University of Houston...effort. Tools to Study Interfaces for Superconducting , Thermoelectric, and Magnetic Materials at the University of Houston Grant/Contract Number AFOSR
2011-11-14
...] Draft Environmental Assessment and Safe Harbor Agreement for the Houston Toad Within Nine Texas Counties... of the endangered Houston toad (Bufo houstonensis) as a result of conservation actions, land...: [email protected] . Include ``Clear Lake Ecological Services Field Office draft Houston Toad...
Rossoni, Rodnei Dennis; Dos Santos Velloso, Marisol; Figueiredo, Lívia Mara Alves; Martins, Carolina Pistille; Jorge, Antonio Olavo Cardoso; Junqueira, Juliana Campos
2018-05-01
Candida albicans is the most common human fungal pathogen and can grow as yeast or filaments, depending on the environmental conditions. The filamentous form is of particular interest because it can play a direct role in adherence and pathogenicity. Therefore, the purpose of this study was to evaluate the effects of three clinical strains of Lactobacillus on C. albicans filamentation as well as their probiotic potential in pathogen-host interactions via an experimental candidiasis model study in Galleria mellonella. We used the reference strain Candida albicans ATCC 18804 and three clinical strains of Lactobacillus: L. rhamnosus strain 5.2, L. paracasei strain 20.3, and L. fermentum strain 20.4. First, the capacity of C. albicans to form hyphae was tested in vitro through association with the Lactobacillus strains. After that, we verified the ability of these strains to attenuate experimental candidiasis in a Galleria mellonella model through a survival curve assay. Regarding the filamentation assay, a significant reduction in hyphae formation of up to 57% was observed when C. albicans was incubated in the presence of the Lactobacillus strains, compared to a control group composed of only C. albicans. In addition, when the larvae were pretreated with Lactobacillus spp. prior to C. albicans infection, the survival rate of G. mellonela increased in all experimental groups. We concluded that Lactobacillus influences the growth and expression C. albicans virulence factors, which may interfere with the pathogenicity of these microorganisms.
The state of public transportation in Houston
1994-12-14
This full text of a speech delivered at a luncheon in Harris County,Texas on December 14, 1994, gives a status report on METRO and how Houston's key transportation providers plan to meet the challenges of the twenty-first century. Many improvements h...
2012-11-23
... Assessment for Expansion of Liquefied Gas Terminals; Houston and Texas City, TX AGENCY: Coast Guard, DHS... Assessment to the Coast Guard Captain of the Port, Sector Houston-Galveston regarding the company's proposed expansion of its Liquefied Hazardous Gas (LHG) facilities in Houston and Texas City, Texas, and increased...
75 FR 6215 - Houston/Galveston Navigation Safety Advisory Committee
2010-02-08
... groups will meet in Houston, Texas to discuss waterway improvements, aids to navigation, area projects...; (b) Dredging subcommittee report; (c) Technology subcommittee report; (d) Waterways Optimization...
A pilot study to assess tobacco use among sexual minorities in Houston, Texas.
Tamí-Maury, Irene; Lin, Mi-Ting; Lapham, Hillary L; Hong, Judy H; Cage, Catherine; Shete, Sanjay; Gritz, Ellen R
2015-08-01
To assess tobacco use among lesbian, gay, bisexual, and transgender (LGBT) individuals from the 2014 Houston Pride Parade and Festival in Houston, Texas (TX). Cross-sectional study using convenience sample of LGBT individuals (n = 99) examining tobacco use, sexual orientation, and other socio-demographic factors through survey participation. Findings showed a high prevalence of tobacco and electronic cigarettes use. White LGBT individuals had greater odds of using any type of tobacco product. Despite a high smoking prevalence among the surveyed LGBT individuals, this study sample did not identify tobacco use as a health issue. Supports the need for further investigation on tobacco-related disparities among LGBT individuals in Houston, TX. © American Academy of Addiction Psychiatry.
Analysis of lustred ceramics of the Galleria Regionale di Palazzo Bellomo di Siracusa, Italy
International Nuclear Information System (INIS)
Politi, Giuseppe; Bouquillon, Anne; Aucouturier, Marc; Gueli, Anna; Troja, Sebastiano Olindo; Vella, Carmela; Pacheco, Claire; Pichon, Laurent; Moignard, Brice; Lemasson, Quentin
2014-01-01
Several fragments of lustred pottery coming from the collection of the Galleria Regionale di Palazzo Bellomo and excavated in Siracusa, were studied through non-invasive ion beam techniques in the Centre de Recherche et de Restauration des Musees de France in Paris. Up to now only aesthetic and stylistic analysis were available for these objects, and their provenances and dating were unknown or uncertain; moreover, the question concerning a possible local production was still debated. Compositions of pottery and glazed parts were thus obtained by Particle Induced X-ray Emission analysis, while the depth distribution of element of the lustre was analyzed by the Rutherford Backscattering Spectrometry technique. The obtained results provided important information on possible origin and production period of the objects
Energy Technology Data Exchange (ETDEWEB)
Cardoso, Aline C.; Prezoto, Fabio [Universidade Federal de Juiz de Fora (UFJF), MG (Brazil). Programa de Pos-Graduacao em Ciencias Biologicas]. E-mail: ac-bio@bol.com.br; fprezoto@icb.ufjf.br; Prata, Marcia C. de A.; Furlong, John [EMBRAPA Gado de Leite, Juiz de Fora, MG (Brazil)]. E-mail: mprata@cnpgl.embrapa.br, john@cnpgl.embrapa.br
2007-09-15
The rearing of Galleria mellonella L. in laboratory is important for multiplication of entomopathogenic nematodes, mandatory for biological control studies. The objective of this study was to evaluate the effect of three thermal profiles on development stages of this insect, allowing synchronization of cycle production. Two distinct rearing phases were done: firstly, using nucleous of incubation for development of eggs and, secondly, using circular-aluminum manifolds for development of larvae and pupae. The time necessary for development of the immature stages decreased with higher temperatures. Incubation periods lasted 13.4 days at 22 deg C, 8.3 at 27 deg C and 6.8 days at 32 deg C, while periods for larvae development lasted 40.4, 27.2, and 23.4 days, respectively, for the same temperatures. Development to pupal stage was observed 18.2, 15.0, and 12.2 days, respectively, for the same temperatures. Larval survival was higher at 32 deg C, however embryonic stages and pupae survival were higher at 27 deg C and 22 deg C, respectively. The threshold temperature was 11.209167 deg C for the embryonic development stage, 7.695869 deg C for larval stage, and 1.943050 deg C for pupal stage of G. mellonella. Thermal constants were 138.380533 DG (degree day) for egg, 554.968830 DG for larvae, and 369.054080 DG for pupae. (author)
International Nuclear Information System (INIS)
Ali, R.M.S.
2008-01-01
The greater wax moth, Galleria mellonella (L.), is a lepidoptera insect; its larval stage, feeds on wax and pollen stored in combs of active honey bee colonies (Milam, 1970). It does not attack adult bees but destructs combs of a weak colony by chewing the comb; spinning silk-lined tunnels through the cell wall and over the face of the comb, which prevent the bees to emerge by their abdomen from their cell, so they die by starvation as they unable to escape from their cell. They also eat out a place to spin their cocoons in the soft wood of the bee hive. Galleria mellonella can also destroy stored honey combs. Therefore, it is considered a major pest of the honeybee. Damage will vary with the level of infestation and the time that has elapsed since the infestation first began. In time, stored combs may be completely destroyed and the frames and combs become filled with a mass of tough, silky web. In ideal conditions for wax moth development, a box (super) of combs may be rendered useless in about a week. Damage occurs mainly in the warm and hot months of the year when wax moths are most active. However, considerable damage can still occur during the cool part of late autumn and early spring as greater wax moth can produce a large amount of metabolic heat which can raise the immediate temperature around them by up to 25 degree C above the normal environment temperature. At the time of storage, combs that are apparently free of wax moth may contain eggs that will hatch later. They should be monitored
Simulation of atmospheric oxidation capacity in Houston, Texas
Air quality model simulations are performed and evaluated for Houston using the Community Multiscale Air Quality (CMAQ) model. The simulations use two different emissions estimates: the EPA 2005 National Emissions Inventory (NEI) and the Texas Commission on Environmental Quality ...
Kao, Dennis; Carvalho Gulati, Amy; Lee, Rebecca E
2016-12-01
This study used the 2010 Health of Houston Survey to examine the physical activity of Asian American adults living in Houston, Texas. Multivariate regression models were conducted to examine the number of moderate leisure physical activity days in the past week and likelihood of having sufficient levels of physical activity. The results showed that Asians were among the least physically active of the major racial/ethnic groups. Most notably, Asians were less likely than whites to have sufficient levels of physical activity and had similarly lower expected numbers of physical activity minutes and days. Within the Asian American population, Vietnamese adults had more physical activity minutes and days than their Chinese counterparts-after controlling for other sociodemographic and health factors. Age- and gender-adjusted rates suggested a significant gender disparity among the Vietnamese and South Asian adults (less so for the Chinese adults), but this varied across different age groups. Several factors emerged as significant predictors of physical activity for Asian Americans, including age, immigration status, speaking a non-English language at home, marital status, and neighborhood incivilities. Findings highlight the need for targeted, culturally appropriate interventions to promote physical activity in Asian American communities.
78 FR 11639 - Houston Pipe Line Company LP; Notice of Petition for Rate Approval
2013-02-19
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR13-31-000] Houston Pipe Line Company LP; Notice of Petition for Rate Approval Take notice that on February 1, 2013, Houston Pipe Line Company LP (HPL) filed for approval of rates for transportation service pursuant to section...
Houston Community College 2011-2012 Fact Book
Houston Community College System, Office of Institutional Research, 2012
2012-01-01
The Houston Community College (HCC) 2011-2012 Fact Book provides statistical information about the college district. It is important for the reader to be aware that data presented in this publication may differ slightly from statistics found in other district reports. Such variances may result from differences methodology including the source of…
Houston Community College 2010-2011 Fact Book
Houston Community College System, Office of Institutional Research, 2011
2011-01-01
The Houston Community College (HCC) 2010-2011 Fact Book provides statistical information about the college district. It is important for the reader to be aware that data presented in this publication may differ slightly from statistics found in other district reports. Such variances may result from differences methodology including the source of…
WE-G-BRA-05: IROC Houston On-Site Audits and Parameters That Affect Performance
International Nuclear Information System (INIS)
Kry, S; Dromgoole, L; Alvarez, P; Lowenstein, J; Molineu, A; Taylor, P; Followill, D
2015-01-01
Purpose: To highlight the IROC Houston on-site dosimetry audit program, and to investigate the impact of clinical conditions on the frequency of errors/recommendations noted by IROC Houston. Methods: The results of IROC Houston on-site audits from 2000-present were abstracted and compared to clinical parameters, this included 409 institutions and 1020 linacs. In particular, we investigated the frequency of recommendations versus year, and the impact of repeat visits on the number of recommendations. We also investigated the impact on the number of recommendations of several clinical parameters: the number and age of the linacs, the linac/TPS combination, and the scope of the QA program. Results: The number of recommendations per institution (3.1 average) has shown decline between 2000 and present, although the number of recommendations per machine (0.89) has not changed. Previous IROC Houston site visits did not Result in fewer recommendations on a repeat visit, but IROC Houston tests have changed substantially during the last 15 years as radiotherapy technology has changed. There was no impact on the number of recommendations based on the number of machines at the institution or the age of a given machine. The fewest recommendations were observed for Varian-Eclipse combinations (0.71 recs/machine), while Elekta- Pinnacle combinations yielded the most (1.62 recs/machine). Finally, in the TG-142 era (post-2010), those institutions that had a QA recommendation (n=77) had significantly more other recommendations (1.83 per institution) than those that had no QA rec (n=12, 1.33 per institution). Conclusion: Establishing and maintaining a successful radiotherapy program is challenging and areas of improvement can routinely be identified. Clinical conditions such as linac-TPS combinations and the establishment of a good QA program impact the frequency of errors/deficiencies identified by IROC Houston during their on-site review process
WE-G-BRA-05: IROC Houston On-Site Audits and Parameters That Affect Performance
Energy Technology Data Exchange (ETDEWEB)
Kry, S; Dromgoole, L; Alvarez, P; Lowenstein, J; Molineu, A; Taylor, P; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)
2015-06-15
Purpose: To highlight the IROC Houston on-site dosimetry audit program, and to investigate the impact of clinical conditions on the frequency of errors/recommendations noted by IROC Houston. Methods: The results of IROC Houston on-site audits from 2000-present were abstracted and compared to clinical parameters, this included 409 institutions and 1020 linacs. In particular, we investigated the frequency of recommendations versus year, and the impact of repeat visits on the number of recommendations. We also investigated the impact on the number of recommendations of several clinical parameters: the number and age of the linacs, the linac/TPS combination, and the scope of the QA program. Results: The number of recommendations per institution (3.1 average) has shown decline between 2000 and present, although the number of recommendations per machine (0.89) has not changed. Previous IROC Houston site visits did not Result in fewer recommendations on a repeat visit, but IROC Houston tests have changed substantially during the last 15 years as radiotherapy technology has changed. There was no impact on the number of recommendations based on the number of machines at the institution or the age of a given machine. The fewest recommendations were observed for Varian-Eclipse combinations (0.71 recs/machine), while Elekta- Pinnacle combinations yielded the most (1.62 recs/machine). Finally, in the TG-142 era (post-2010), those institutions that had a QA recommendation (n=77) had significantly more other recommendations (1.83 per institution) than those that had no QA rec (n=12, 1.33 per institution). Conclusion: Establishing and maintaining a successful radiotherapy program is challenging and areas of improvement can routinely be identified. Clinical conditions such as linac-TPS combinations and the establishment of a good QA program impact the frequency of errors/deficiencies identified by IROC Houston during their on-site review process.
Huelga Schools in Houston: Community-Based Education in the Struggle for Legal Recognition, 1970
San Miguel, Guadalupe, Jr.
2016-01-01
This essay provides an overview of the huelga schools established in Houston, Texas, in 1970. For 2 years, from 1970 to 1972, the Mexican American community opposed the Houston Independent School District's plan to integrate the schools by pairing so-called White Mexican Americans with African American students. While they protested this decision,…
Castro, G A; Bouldin, P A; Farver, D W; Maugans, L A; Sanders, L C; Booker, J
1999-04-01
The University of Texas-Houston Health Science Center (UT-Houston) has created programs and activities to address the state's pressing needs in minority education. Through InterCon, a network of universities and K-12 schools, UT-Houston works with its partners to identify competitive candidates in the current pool of minority graduates with bachelor's degrees and to help them--along with their non-minority counterparts--progress in their education. Another objective is to expand the pool of minorities underrepresented in medicine who complete high school and go to college. In 1994 UT-Houston and Prairie View A&M University created a collaborative venture to provide new educational opportunities at UT-Houston for Prairie View's predominantly African American students. A three-track summer internship program--a result of that collaboration--has since been expanded to partnerships with other minority and majority universities throughout Texas. In 1998, for example, 108 undergraduate students from these universities (and 40 other universities nationwide) participated in research, professional, and administrative summer internships at UT-Houston. The InterCon network also has partnerships with K-12 schools. UT-Houston works with inner-city, suburban, and rural school districts to develop education models that can be transferred throughout the state. The partnerships deal with helping to teach basic academic skills and computer literacy, improve science-related instruction, meet demands for health promotion materials and information for school-initiated health and wellness programs, and develop distance-learning paradigms. UT-Houston views InterCon as a program helping Texas institutions to engage and adapt to the socioeconomic factors, demographic changes, and technology explosion that currently challenge public education.
Bee moth (Galleria mellonella) allergic reactions are caused by several thermolabile antigens.
Villalta, D; Martelli, P; Mistrello, G; Roncarolo, D; Zanoni, D
2004-09-01
Exposure and contact with bee moth (Galleria mellonella) larvae (Gm) can cause an allergic reaction both in anglers and breeders. We described the case of an amateur fisherman who experienced an allergic reaction using Gm but not using heat-treated Gm (h-Gm) (mummies). The aim of this study was to demonstrate by immunoblotting and radioallergosorbent test (RAST)-inhibition experiments the loss of allergenic epitopes in h-Gm extracts. Galleria mellonella larvae and h-Gm were homogenized and extracted at 10% (w/v) in 0.5 M phosphate-buffered saline, pH 7.4 containing 0.5% NaN(3) for 16 h at 4 degrees C. Gm and h-Gm extracts were electrophoresed in a 10% polyacrylamide precast Nupage Bis-Tris gel at 180 mA for 1 h and the resolved proteins stained with 0.1% Coomassie brilliant blue and the molecular weight calculated. For the immunoblotting detection of allergenic components the resolved extracts were transferred onto a nitrocellulose membrane and incubated with the patient's serum. Bound specific-IgE was detected by peroxidase-conjugated anti-human IgE. RAST inhibition experiments were performed according to the Ceska method. The protein profile of Gm and h-Gm extracts resulted markedly different in number, intensity and the position of bands, indicating that heat-treatment modifies the chemical-physical characteristics of the protein contents. The Gm extract showed a strong-coloured band at 73 kDa and more than 20 components ranging from 12 to 133 kDa; h-Gm showed two main band at 77 and 38 kDa and about 15 faint bands between 20 and 133 kDa apparently without any correspondence to the bands present in the Gm extract. Immunoblotting with the patient's serum demonstrated several bands of reactivity with the Gm extract ranging from 20 to 100 kDa and no recognizable bands, but only a diffuse smear with h-Gm. When used in a RAST inhibition experiment the h-Gm extract demonstrated an inability to compete with the Gm one for the binding to patient's IgE serum. The h
the Underestimation of Isorene in Houston during the Texas 2013 DISCOVER-AQ Campaign
Choi, Y.; Diao, L.; Czader, B.; Li, X.; Estes, M. J.
2014-12-01
This study applies principal component analysis to aircraft data from the Texas 2013 DISCOVER-AQ (Deriving Information on Surface Conditions from Column and Vertically Resolved Observations Relevant to Air Quality) field campaign to characterize isoprene sources over Houston during September 2013. The biogenic isoprene signature appears in the third principal component and anthropogenic signals in the following two. Evaluations of the Community Multiscale Air Quality (CMAQ) model simulations of isoprene with airborne measurements are more accurate for suburban areas than for industrial areas. This study also compares model outputs to eight surface automated gas chromatograph (Auto-GC) measurements near the Houston ship channel industrial area during the nighttime and shows that modeled anthropogenic isoprene is underestimated by a factor of 10.60. This study employs a new simulation with a modified anthropogenic emissions inventory (constraining using the ratios of observed values versus simulated ones) that yields closer isoprene predictions at night with a reduction in the mean bias by 56.93%, implying that model-estimated isoprene emissions from the 2008 National Emission Inventory are underestimated in the city of Houston and that other climate models or chemistry and transport models using the same emissions inventory might also be underestimated in other Houston-like areas in the United States.
The Houston Ship Channel security: a case study
Le, Han Q.; Bellamy, P. A.; Pei, S. S. S.
2007-04-01
The Houston Ship Channel (HSC) is a 50-mile long shipping channel that contains many private ports including the Port of Houston Authority. It has a uniquely critical role with respect to the US petroleum energy supply. The HSC security is currently planned for significant enhancement under the auspices of the Harris County and the Houston-based Port Strategic Security Council. The ultimate objective is to comprehensively address the HSC threat matrix. This paper describes the technical effort in support of this program. The HSC security is a complex system of systems that includes the physical control access system, the command, control, communication, and information (C4I) system, and the telecom infrastructure. The strategy is to coordinate the improvements of different components to achieve a high-impact net effectiveness. A key element is a planned high-capacity backbone optical network for integrating the C4I of many different HSC administrative-jurisdictional authorities, which will allow unified situational awareness for a more effective cooperation and coordination. Enhancement of surveillance and intrusion protection is crucial. A feasibility study was conducted for the HSC assuming common surveillance technologies including visible/IR camera, radar, and sonar. The method includes survey and theoretical modeling to detect threats of concern in the HSC natural environment. The result indicates that the HSC unique river-like geography offers both advantages and challenges. The narrow channel allows ease of waterside surveillance, but likely incurs high cost for its great length. In addition, landside security is also important owing to its location amidst urban-industrial zone. Lastly, limitation of the various technologies is discussed by considering the broader challenges of the intrusion problem.
A Madurella mycetomatis Grain Model in Galleria mellonella Larvae.
Directory of Open Access Journals (Sweden)
Wendy Kloezen
Full Text Available Eumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility towards antifungal agents are not well understood. This is because grain formation cannot be induced in vitro; a mammalian host is necessary to induce its formation. Until now, invertebrate hosts were never used to study grain formation in M. mycetomatis. In this study we determined if larvae of the greater wax moth Galleria mellonella could be used to induce grain formation when infected with M. mycetomatis. Three different M. mycetomatis strains were selected and three different inocula for each strain were used to infect G. mellonella larvae, ranging from 0.04 mg/larvae to 4 mg/larvae. Larvae were monitored for 10 days. It appeared that most larvae survived the lowest inoculum, but at the highest inoculum all larvae died within the 10 day observation period. At all inocula tested, grains were formed within 4 hours after infection. The grains produced in the larvae resembled those formed in human and in mammalian hosts. In conclusion, the M. mycetomatis grain model in G. mellonella larvae described here could serve as a useful model to study the grain formation and therapeutic responses towards antifungal agents in the future.
Faults in parts of north-central and western Houston metropolitan area, Texas
Verbeek, Earl R.; Ratzlaff, Karl W.; Clanton, Uel S.
1979-01-01
Hundreds of residential, commercial, and industrial structures in the Houston metropolitan area have sustained moderate to severe damage owing to their locations on or near active faults. Paved roads have been offset by faults at hundreds of locations, butted pipelines have been distorted by fault movements, and fault-induced gradient changes in drainage lines have raised concern among flood control engineers. Over 150 faults, many of them moving at rates of 0.5 to 2 cm/yr, have been mapped in the Houston area; the number of faults probably far exceeds this figure.This report includes a map of eight faults, in north-central and western Houston, at a scale useful for land-use planning. Seven of the faults, are known, to be active and have caused considerable damage to structures built on or near them. If the eighth fault is active, it may be of concern to new developments on the west side of Houston. A ninth feature shown on the map is regarded only as a possible fault, as an origin by faulting has not been firmly established.Seismic and drill-hold data for some 40 faults, studied in detail by various investigators have verified connections between scarps at the land surface and growth faults in the shallow subsurface. Some scarps, then, are known to be the surface manifestations of faults that have geologically long histories of movement. The degree to which natural geologic processes contribute to current fault movement, however, is unclear, for some of man’s activities may play a role in faulting as well.Evidence that current rates of fault movement far exceed average prehistoric rates and that most offset of the land surface in the Houston area has occurred only within the last 50 years indirectly suggest that fluid withdrawal may be accelerating or reinitiating movement on pre-existing faults. This conclusion, however, is based only on a coincidence in time between increased fault activity and increased rates of withdrawal of water, oil, and gas from
Groundwater quality of the Gulf Coast aquifer system, Houston, Texas, 2010
Oden, Jeannette H.; Brown, Dexter W.; Oden, Timothy D.
2011-01-01
During March–December 2010, the U.S. Geological Survey, in cooperation with the city of Houston, collected source-water samples from 60 municipal supply wells in the Houston area. These data were collected as part of an ongoing study to determine concentrations, spatial extent, and associated geochemical conditions that might be conducive for mobility and transport of selected naturally occurring contaminants (selected trace elements and radionuclides) in the Gulf Coast aquifer system in the Houston area. In the summers of 2007 and 2008, a reconnaissance-level survey of these constituents in untreated water from 28 municipal supply wells was completed in the Houston area. Included in this report are the complete analytical results for 47 of the 60 samples collected in 2010—those results which were received from the laboratories and reviewed by the authors as of December 31, 2010. All of the wells sampled were screened in the Gulf Coast aquifer system; 22 were screened entirely in the Evangeline aquifer, and the remaining 25 wells contained screened intervals that intersected both Evangeline and Chicot aquifers. The data documented in this report were collected as part of an ongoing study to characterize source-water-quality conditions in untreated groundwater prior to drinking-water treatment. An evaluation of contaminant occurrence in source water provides background information regarding the presence of a contaminant in the environment. Because source-water samples were collected prior to any treatment or blending that potentially could alter contaminant concentrations, the water-quality results documented by this report represent the quality of the source water, not the quality of finished drinking water provided to the public.
Houston Community College (HCC)-Mobile Go Center Program
Ramirez, Daniel; Sterling, Cheryl; Grays, Shantay R.
2010-01-01
The Houston Community College Mobile Go Center brings college enrollment assistance to the doorstep of our community. It operates in a variety of settings, offering college-going material and person-to-person assistance at numerous city events. Services include assistance with academic advising, completing the FAFSA, college application process,…
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Sector Houston-Galveston Marine....40-28 Sector Houston-Galveston Marine Inspection Zone and Captain of the Port Zone; Marine Safety Unit Port Arthur. Sector Houston-Galveston's office is located in Galena Park, TX. A subordinate unit...
Ozone production by corona discharges during a convective event in DISCOVER-AQ Houston
Kotsakis, Alexander; Morris, Gary A.; Lefer, Barry; Jeon, Wonbae; Roy, Anirban; Minschwaner, Ken; Thompson, Anne M.; Choi, Yunsoo
2017-07-01
An ozonesonde launched near electrically active convection in Houston, TX on 5 September 2013 during the NASA DISCOVER-AQ project measured a large enhancement of ozone throughout the troposphere. A separate ozonesonde was launched from Smith Point, TX (∼58 km southeast of the Houston site) at approximately the same time as the launch from Houston and did not measure that enhancement. Furthermore, ozone profiles for the descent of both sondes agreed well with the ascending Smith Point profile, suggesting a highly localized event in both space and time in which an anomalously large enhancement of 70-100 ppbv appeared in the ascending Houston ozonesonde data. Compared to literature values, such an enhancement appears to be the largest observed to date. Potential sources of the localized ozone enhancement such as entrainment of urban or biomass burning emissions, downward transport from the stratosphere, photochemical production from lightning NOx, and direct ozone production from corona discharges were investigated using model simulations. We conclude that the most likely explanation for the large ozone enhancement is direct ozone production by corona discharges. Integrating the enhancement seen in the Houston ozone profile and using the number of electrical discharges detected by the NLDN (or HLMA), we estimate a production of 2.48 × 1028 molecules of ozone per flash which falls within the range of previously recorded values (9.89 × 1026-9.82 × 1028 molecules of ozone per flash). Since there is currently no parameterization for the direct production of ozone from corona discharges we propose the implementation of an equation into a chemical transport model. Ultimately, additional work is needed to further understand the occurrence and impact of corona discharges on tropospheric chemistry on short and long timescales.
Poduska, Jeanne; Gomez, Mary Jane; Capo, Zeph; Holmes, Venita
2012-07-01
Moving evidence-based practices into real-world settings is a high priority for education and public health. This paper describes the development of a partnership among the Houston Independent School District, the American Institutes of Research, and the Houston Federation of Teachers to support research on and program sustainability for the Good Behavior Game, a team-based classroom behavior management strategy that has shown positive impact in randomized field trials. The conceptual framework guiding partnership development is presented, followed by an application of the framework in Houston. Lessons learned and implications for the next stage of research and practice are then discussed.
The History of the Austin College Building and Old Main at Sam Houston State University
Singer, Erin; Shields, Samantha
2017-01-01
Austin Hall and Old Main serve as the heart of what is now Sam Houston State University. The buildings' rich histories help one to understand how Sam Houston State University and its proud teacher education heritage came to be. To begin with Austin Hall's story, the University's original building has a unique and interesting tale that journeys…
The Biology and Control of the Greater Wax Moth, Galleria mellonella.
Kwadha, Charles A; Ong'amo, George O; Ndegwa, Paul N; Raina, Suresh K; Fombong, Ayuka T
2017-06-09
The greater wax moth, Galleria mellonella Linnaeus , is a ubiquitous pest of the honeybee, Apis mellifera Linnaeus, and Apis cerana Fabricius . The greater wax moth larvae burrow into the edge of unsealed cells with pollen, bee brood, and honey through to the midrib of honeybee comb. Burrowing larvae leave behind masses of webs which causes galleriasis and later absconding of colonies. The damage caused by G. mellonella larvae is severe in tropical and sub-tropical regions, and is believed to be one of the contributing factors to the decline in both feral and wild honeybee populations. Previously, the pest was considered a nuisance in honeybee colonies, therefore, most studies have focused on the pest as a model for in vivo studies of toxicology and pathogenicity. It is currently widespread, especially in Africa, and the potential of transmitting honeybee viruses has raised legitimate concern, thus, there is need for more studies to find sustainable integrated management strategies. However, our knowledge of this pest is limited. This review provides an overview of the current knowledge on the biology, distribution, economic damage, and management options. In addition, we provide prospects that need consideration for better understanding and management of the pest.
University of Houston: Engagement, Workforce, and Economic Development
Schott, Marshall E.
2012-01-01
At the University of Houston (UH), the arrival of a new chancellor/president in 2007 resulted in a strategic environmental scan to determine areas where the university's efforts should be focused over the next ten years. Several major initiatives were launched, including one that sought to make UH a major energy university. The decision to embrace…
The perceptions of inquiry held by greater Houston area science supervisors
Aoki, Jon Michael
The purpose of this study was to describe the perceptions of inquiry held by responding greater Houston area science supervisors. Leading science organizations proposed that students might be better served if students are mentally and physically engaged in the process of finding out about natural phenomena rather than by didactic modes of teaching and learning. During the past fifty years, inquiry-based instruction has become a significant theme of new science programs. Students are more likely to make connections between classroom exercises and their personal lives through the use of inquiry-based instruction. Learning becomes relevant to students. Conversely, traditional science instruction often has little or no connection to students' everyday lives (Papert, 1980). In short, inquiry-based instruction empowers students to become independent thinkers. The utilization of inquiry-based instruction is essential to a successful reform in science education. However, a reform's success is partly determined by the extent to which science supervisors know and understand inquiry and consequently promote its integration in the district's science curricula. Science supervisors have the role of providing curriculum and instructional support to science teachers and for implementing science programs. There is a fundamental need to assess the perceptions of inquiry held by greater Houston area science supervisors. Science supervisor refers to a class of job titles that include department chairperson, science specialist, science consultant, and science coordinator. The target population was greater Houston area science supervisors in Texas. This study suggests that there are three major implications for educational practice. First, there is the implication that responding greater Houston area science supervisors need an inclusive perception of inquiry. Second, responding greater Houston area science supervisors' perception of inquiry may affect the perceptions and understandings
Bianchi, Catherine M; Johnson, Cassidy B; Howard, Lauren L; Crump, Paul
2014-09-01
Effective disease monitoring and prevention is critical to the success of captive amphibian care. Nematodes, including the genera Rhabdias and Strongyloides, are known to contribute to mortality in captive amphibians and have been identified in the Houston Zoo's endangered Houston toad (Bufo [Anaxyrus] houstonensis) captive assurance colony. Five years of fecal data for the toad colony were compiled and analyzed in order to investigate the efficacy of two anthelminthic medications, fenbendazole (FBZ) and levamisole (LMS), which were used to control nematode infections. Both FBZ (dusted onto food items) and topical LMS (6.5 to 13.5 mg/kg) significantly reduced the number of nematode eggs, larvae, and adults observed by fecal parasitologic examination. There were no significant differences between treatments, and egg reappearance periods were difficult to compare as a result of low sample size. No adverse effects from either anthelminthic treatment were observed. Both topical LMS and oral FBZ appear to be safe and efficacious treatments for the reduction of the internal nematode burden in captive Houston toads.
Hydrocarbon Source Signatures in Houston, Texas: Influence of the Petrochemical Industry
Energy Technology Data Exchange (ETDEWEB)
Jobson, B Tom T; Berkowitz, Carl M; Kuster, W C; Goldan, P D; Williams, E J; Fesenfeld, F; Apel, Eric; Karl, Thomas G; Lonneman, William A; Riemer, D
2004-12-22
Observations of C1-C10 hydrocarbon mixing ratios measured by in-situ instrumentation at the La Porte super site during the TexAQS 2000 field experiment are reported. The La Porte data were compared to a roadway vehicle exhaust signature obtained from canister samples collected in the Houston Washburn tunnel during the same summer to better understand the impact of petrochemical emissions of hydrocarbons at the site. It is shown that the abundance of ethene, propene, 1-butene, C2-C4 alkanes, hexane, cyclohexane, methylcyclohexane, isopropylbenzene, and styrene at La Porte were systematically impacted by petrochemical industry emissions. Coherent power law relationships between frequency distribution widths of hydrocarbon mixing ratios and their local lifetimes clearly identify two major source groups, roadway vehicle emissions and industrial emissions. Distributions of most aromatics and long chain alkanes were consistent with roadway vehicle emissions as the dominant source. Airmass reactivity was generally dominated by C1-C3 aldehydes. Propene and ethene sometimes dominated air mass reactivity with HO loss frequencies often greater than 10 s-1. Ozone mixing ratios near 200 ppbv were observed on two separate occasions and these air masses appear to have been impacted by industrial emissions of alkenes from the Houston Ship Channel. The La Porte data provide evidence of the importance of industrial emissions of ethene and propene on air masses reactivity and ozone formation in Houston.
The Impact of TexAQS 2000 on Air Quality Planning in Houston
Thomas, J. W.; Price, J. H.
2002-12-01
Before the Texas 2000 Air Quality Study (TexAQS 2000) the State used the Urban Airshed Model to model nine different episodes in Houston with very poor results: only one episode met EPA model performance criteria. Questions existed regarding emissions uncertainties, meteorological modeling, and model chemistry. NOAA, DOE, and SOS led more than 35 organizations and 250 investigators who participated in TexAQS 2000. Major findings from TexAQS 2000 are: 1. There are two types of meteorological patterns that lead to ozone episodes in the Houston area: (i) stagnation associated with the sea breeze flow reversal causes a pool of industrial emissions and ozone to accumulate, then to move across the city as the wind flow picks up and (ii) plumes of ozone form when relatively persistent winds carry the emissions away from the city and industrial areas. 2. The chemistry that produces high ozone concentrations and rapid rises in ozone in the Houston area has been explained: multiple investigators in TexAQS 2000 have documented more rapid and more efficient formation of ozone in the plume from the Houston industrial area than any of them has observed in any previous field study. Houston's exceptionally rapid ozone formation arises from large amounts of anthropogenic VOCs in the atmosphere, often from the same plants that provide sufficient NOx. 3. This rapid and efficient ozone formation results most often from the presence of a specific subclass of hydrocarbons called light olefins, primarily ethylene and propylene. 4. Sometimes it is other specific hydrocarbons that cause the rapid formation of high concentrations of ozone, and sometimes it is just the total mass of a lot of relatively unreactive hydrocarbons. 5. The current emissions inventory for ethylene and propylene, as well as other VOCs, underestimates their routine emissions by a factor of roughly five to ten or perhaps even more. 6. It is not clear whether the emissions causing Houston's rapid ozone formation are
Usenko, Sascha; Clark, Addie; Sheesley, Rebecca
2015-04-01
DISCOVER-AQ (Deriving Information on Surface conditions from Column and Vertically Resolved Observations Relevant to Air Quality) is a NASA-funded air quality research program that focused on Houston, Texas, United States in September 2013. In conjunction with DISCOVER-AQ, particulate matter was collected for the month of September from four ground-based sampling sites across the Houston metropolitan area. The Houston metropolitan area is one of the most populous cities in the United States. Sampling sites included an upwind and downwind site as well as an urban (i.e. downtown) and industrial/port areas (i.e. Houston Ship Channel). Particulate matter samples were collected to examine both spatial and temporal trends (including day versus night). Particulate matter was collected on quartz fiber filters, which were analyzed for emerging classes of concern including organophosphate esters (OPEs; including flame retardants) and pyrethroids. OPEs have in recent years increased in both use and production as they replaced polybrominated diphenyl ethers flame retardants. Permethrin is one of the most commonly used mosquito adulticides in the United States.
2013-12-26
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. CP14-13-000] Houston Pipe Line Company, LP; Notice of Intent to Prepare an Environmental Assessment for the Proposed 24-Inch... Hidalgo County, Texas by Houston Pipe Line Company, LP (HPL). The Commission will use this EA in its...
Fusarium pathogenesis investigated using Galleria mellonella as a heterologous host
Coleman, Jeffrey J.; Muhammed, Maged; Kasperkovitz, Pia V.; Vyas, Jatin M.; Mylonakis, Eleftherios
2011-01-01
Members of the fungal genus Fusarium are capable of manifesting in a multitude of clinical infections, most commonly in immunocompromised patients. In order to better understand the interaction between the fungus and host, we have developed the larvae of the greater wax moth, Galleria mellonella, as a heterologous host for fusaria. When conidia are injected into the hemocoel of this Lepidopteran system, both clinical and environmental isolates of the fungus are able to kill the larvae at 37°C, although killing occurs more rapidly when incubated at 30°C. This killing was dependent on several other factors besides temperature, including the Fusarium strain, the number of conidia injected, and the conidia morphology, where macroconidia are more virulent than their microconidia counterpart. There was a correlation in the killing rate of Fusarium spp. when evaluated in G. mellonella and a murine model. In vivo studies indicated G. mellonella hemocytes were capable of initially phagocytosing both conidial morphologies. The G. mellonella system was also used to evaluate antifungal agents, and amphotericin B was able to confer a significant increase in survival to Fusarium infected-larvae. The G. mellonella-Fusarium pathogenicity system revealed that virulence of Fusarium spp. is similar, regardless of the origin of the isolate, and that mammalian endothermy is a major deterrent for Fusarium infection and therefore provides a suitable alternative to mammalian models to investigate the interaction between the host and this increasingly important fungal pathogen. PMID:22115447
Cell Mergers and Their Impact on Cloud-to-Ground Lightning Over the Houston Area
Gauthier, Michael L.; Petersen, Walter A.; Carey, Lawrence D.
2009-01-01
A previous hypothesis advanced from observational studies such as METROMEX suggests that the intensity, frequency, and organization of cumulus convection may be impacted by the forcing of enhanced merger activity downstream of urban zones. A resulting corollary is that cities may exert an indirect anthropogenic forcing of parameters related to convection and associated phenomena such as lightning and precipitation. This paper investigates the urban merger hypothesis by examining the role of convective cell mergers on the existence and persistence of the Houston lightning "anomaly", a local maximum in cloud-to-ground (CG) lightning activity documented to exist over and east of Houston. Using eight summer seasons of peak columnar radar reflectivity, CG lightning data and a cell-tracking algorithm, a two-dimensional cell merger climatology is created for portions of eastern Texas and Louisiana. Results from the tracking and analysis of over 3.8 million cells indicate that merger-driven enhancements in convection induce a positive response (O 46%) in ground-flash densities throughout the domain, with areas of enhanced lightning typically being co-located with areas of enhanced merger activity. However, while mergers over the Houston area (relative to elsewhere in the domain) do result in more vigorous convective cells that produce larger CG flash densities, we find that CG lightning contributions due to mergers are distributed similarly throughout the domain. Hence while we demonstrate that cell mergers do greatly impact the production of lightning, the urban cell merger hypothesis does not uniquely explain the presence of a local lightning maximum near and downstream of Houston.
2013-04-03
..., and V-548 in the Vicinity of Houston, TX AGENCY: Federal Aviation Administration (FAA), DOT. ACTION... airways V-68, V-76, V-194, and V-548 in the vicinity of Houston, TX. The FAA is taking this action to... vicinity of Houston, TX. Specifically, the FAA amends V-68 and V-76 to reflect the Hobby VOR/DME 289[deg...
Directory of Open Access Journals (Sweden)
Y.S. Zaghloul
2017-07-01
Full Text Available The eggs deposited by oviparous organisms contain large amounts of vitellus, or yolk, which are utilized by the growing embryo. Vitellogenesis is the process of vitellus accumulation involves massive heterosynthetic synthesis of the protein vitellogenin (Vg and its deposition in the oocyte. Vg levels are indicative for the efficiency of the oogenesis process. This work summarizes data on Vg levels in Galleria mellonella females exposed to various doses of gamma radiation. The results stated that vitellogenin was affected by irradiation. The decreased levels of Vg was dose dependent reaching an undetermined level at 160Gy which is the sterileing dose for G. mellonella female that suppress the egg production by them.
Cooley building opens in Houston. Demonstrates value of fully integrated marketing communications.
Rees, Tom
2002-01-01
The Texas Heart Institute at St. Luke's Episcopal HospiTal in Houston dedicated its new 10-story Denton A. Cooley Building in January. The structure opened with a fanfare, thanks to a well-integrated marketing communications program.
University of Houston Undergraduate Student Instrumentation Projects
Bering, E. A., III; Talbot, R. W.; Hampton, D. L.; Molders, N.; Millan, R. M.; Halford, A. J.; Dunbar, B.; Morris, G. A.; Prince, J.; Gamblin, R.; Ehteshami, A.; Lehnen, J. N.; Greer, M.; Porat, I.; Alozie, M.; Behrend, C. C.; Bias, C.; Fenton, A.; Gunawan, B.; Harrison, W.; Martinez, A.; Mathur, S.; Medillin, M.; Nguyen, T.; Nguyen, T. V.; Nowling, M.; Perez, D.; Pham, M.; Pina, M.; Thomas, G.; Velasquez, B.; Victor, L.
2017-12-01
The Undergraduate Student Instrumentation Project (USIP) is a NASA program to engage undergraduate students in rigorous scientific research, for the purposes of innovation and developing the next generation of professionals for an array of fields. The program is student led and executed from initial ideation to research to the design and deployment of scientific payloads. The University of Houston has been selected twice to participate in the USIP programs. The first program (USIP_UH I) ran from 2013 to 2016. USIP_UH II started in January of 2016, with funding starting at the end of May. USIP_UH I (USIP_UH II) at the University of Houston was (is) composed of eight (seven) research teams developing six (seven), distinct, balloon-based scientific instruments. These instruments will contribute to a broad range of geophysical sciences from Very Low Frequency recording and Total Electron Content to exobiology and ozone profiling. USIP_UH I had 12 successful launches with 9 recoveries from Fairbanks, AK in March 2015, and 4 piggyback flights with BARREL 3 from Esrange, Kiruna, Sweden in August, 2015. USIP_UH II had 8 successful launches with 5 recoveries from Fairbanks, AK in March 2017, 3 piggyback flights with BARREL 4 from Esrange, Kiruna, Sweden in August, 2016, and 1 flight each from CSBF and UH. The great opportunity of this program is capitalizing on the proliferation of electronics miniaturization to create new generations of scientific instruments that are smaller and lighter than ever before. This situation allows experiments to be done more cheaply which ultimately allows many more experiments to be done.
Hydrologic data for urban studies in the Houston, Texas, metropolitan area, 1980
Liscum, Fred; Hutchison, J.S.; Bruchmiller, J.P.; Walther, L.S.
1983-01-01
Hydrologic investigations of urban watersheds in Texas were begun by the U.S. Geological Survey in 1954. Studies are now in progress in Austin, and Houston. Studies have been completed in the Dallas-Fort Worth and San Antonio areas.
Hydrologic data for urban studies in the Houston metropolitan area, Texas, 1984
Liscum, Fred; Bruchmiller, J.P.; Brown, D.W.; Paul, E.M.
1987-01-01
Hydrologic investigations of urban watersheds in Texas were begun by the U.S. Geological Survey in 1954. Studies are now in progress in the Austin and Houston areas, and have been completed in the Dallas-Fort Worth and San Antonio areas.
Hydrologic data for urban studies in the Houston, Texas, metropolitan area, 1981
Liscum, Fred
1985-01-01
Hydro! oqic investigations of urban watersheds in Texas were begun by the U.S. Geological Survey in 1954. Studies are now in progress in Austin, and Houston. Studies have been completed in the Dallas-Fort Worth and San Antonio areas.
2010-07-01
... 40 Protection of Environment 4 2010-07-01 2010-07-01 false Control of evaporative losses from the filling of gasoline storage vessels in the Houston and San Antonio areas. 52.2285 Section 52.2285... of gasoline storage vessels in the Houston and San Antonio areas. (a) Definitions: (1) Gasoline means...
Kerns, James R; Stingo, Francesco; Followill, David S; Howell, Rebecca M; Melancon, Adam; Kry, Stephen F
2017-08-01
The anthropomorphic phantom program at the Houston branch of the Imaging and Radiation Oncology Core (IROC-Houston) is an end-to-end test that can be used to determine whether an institution can accurately model, calculate, and deliver an intensity modulated radiation therapy dose distribution. Currently, institutions that do not meet IROC-Houston's criteria have no specific information with which to identify and correct problems. In the present study, an independent recalculation system was developed to identify treatment planning system (TPS) calculation errors. A recalculation system was commissioned and customized using IROC-Houston measurement reference dosimetry data for common linear accelerator classes. Using this system, 259 head and neck phantom irradiations were recalculated. Both the recalculation and the institution's TPS calculation were compared with the delivered dose that was measured. In cases in which the recalculation was statistically more accurate by 2% on average or 3% at a single measurement location than was the institution's TPS, the irradiation was flagged as having a "considerable" institutional calculation error. The error rates were also examined according to the linear accelerator vendor and delivery technique. Surprisingly, on average, the reference recalculation system had better accuracy than the institution's TPS. Considerable TPS errors were found in 17% (n=45) of the head and neck irradiations. Also, 68% (n=13) of the irradiations that failed to meet the IROC-Houston criteria were found to have calculation errors. Nearly 1 in 5 institutions were found to have TPS errors in their intensity modulated radiation therapy calculations, highlighting the need for careful beam modeling and calculation in the TPS. An independent recalculation system can help identify the presence of TPS errors and pass on the knowledge to the institution. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Rocío García-Rodas
Full Text Available We have studied infection of Cryptococcus neoformans in the non-vertebrate host Galleria mellonella with particular interest in the morphological response of the yeast. Inoculation of C. neoformans in caterpillars induced a capsule-independent increase in haemocyte density 2 h after infection. C. neoformans manifested a significant increase in capsule size after inoculation into the caterpillar. The magnitude of capsule increase depended on the temperature, being more pronounced at 37°C than at 30°C, which correlated with an increased virulence of the fungus and reduced phagocytosis at 37°C. Capsule enlargement impaired phagocytosis by haemocytes. Incubation of the yeast in G. mellonella extracts also resulted in capsule enlargement, with the polar lipidic fraction having a prominent role in this effect. During infection, the capsule decreased in permeability. A low proportion of the cells (<5% recovered from caterpillars measured more than 30 µm and were considered giant cells. Giant cells recovered from mice were able to kill the caterpillars in a manner similar to regular cells obtained from in vivo or grown in vitro, establishing their capacity to cause disease. Our results indicate that the morphological transitions exhibited by C. neoformans in mammals also occur in a non-vertebrate host system. The similarities in morphological transitions observed in different animal hosts and in their triggers are consistent with the hypothesis that the cell body and capsular responses represent an adaptation of environmental survival strategies to pathogenesis.
Hydrologic data for urban studies in the Houston metropolitan area, Texas, 1983
Liscum, Fred
1986-01-01
Hydro!ogic investigations of urban watersheds in Texas were begun by the U.S. Geological Survey in 1954. Studies are now in progress in the Austin and Houston areas, and have been completed in the Dallas-Fort Worth and San Antonio areas.
Gidaris, I.; Gori, A.; Panakkal, P.; Padgett, J.; Bedient, P. B.
2017-12-01
The record-breaking rainfall produced over the Houston region by Hurricane Harvey resulted in catastrophic and unprecedented impacts on the region's infrastructure. Notably, Houston's transportation network was crippled, with almost every major highway flooded during the five-day event. Entire neighborhoods and subdivisions were inundated, rendering them completely inaccessible to rescue crews and emergency services. Harvey has tragically highlighted the vulnerability of major thoroughfares, as well as neighborhood roads, to severe inundation during extreme precipitation events. Furthermore, it has emphasized the need for detailed accessibility characterization of road networks under extreme event scenarios in order to determine which areas of the city are most vulnerable. This analysis assesses and tracks the accessibility of Houston's major highways during Harvey's evolution by utilizing road flood/closure data from the Texas DOT. In the absence of flooded/closure data for local roads, a hybrid approach is adopted that utilizes a physics-based hydrologic model to produce high-resolution inundation estimates for selected urban watersheds in the Houston area. In particular, hydrologic output in the form of inundation depths is used to estimate the operability of local roads. Ultimately, integration of hydrologic-based estimation of road conditions with observed data from DOT supports a network accessibility analysis of selected urban neighborhoods. This accessibility analysis can identify operable routes for emergency response (rescue crews, medical services, etc.) during the storm event.
Variations in tropical cyclone-related discharge in four watersheds near Houston, Texas
Directory of Open Access Journals (Sweden)
Laiyin Zhu
2015-01-01
Full Text Available We examined a 60-year record of daily precipitation and river discharge related to tropical cyclones (TCs in four watersheds undergoing land use and land cover change near Houston, Texas. Results show that TCs are responsible for ∼20% of the annual maximum discharge events in the four selected watersheds. Although there are no trends in TC precipitation, increasing trends were observed in daily extreme discharge and TC-related discharge. The more developed watersheds (Whiteoak Bayou and Brays Bayou, tend to have higher extreme discharge and steeper trends in extreme discharge than the less developed watersheds (Cypress Creek. Increases in TC-related extreme discharges correspond with increases in developed land and decreases in vegetated land between 1980 and 2006. Therefore, changes in land cover/use in watersheds near Houston are a major cause of the increased flooding risk in recent years.
Galleria mellonella L. as model organism used in biomedical and other studies
Mikulak, Ewa; Gliniewicz, Aleksandra; Przygodzka, Marta; Solecka, Jolanta
2018-01-01
Comparative of studies of genomes of invertebrates and humans shows that in invertebrates including insects there are numerous homologues of human’s genes coding proteins involved in recognition pathogens or transduction of the expression signal. Thanks this features, insects such as Drosophila melanogaster M., Blattella germanica L., Culex quinquefasciatus S., Bombyx mori L. and Galleria mellonella L. are used in studies on virulence, host resistance or in assessing the in vivo efficacy of antibiotics, fungicides and other biologically active substances. G. mellonella (greater wax moth) are rapid growth, high fertility, size and short life cycle insects- these are features that should be met by good model organisms; therefore the number of researches with larvae of wax moth as the model organism for pathogens assays grows from year to year. This is showing by number of scientific publications about infection’s model of G. mellonella. An obstacle in the wide use of G. mellonella caterpillars as a model in biomedical research is the lack of standardized breeding of these insects, which would guarantee the reproducibility of the obtained results and lack of procedures and standards according to which biomedical research will be carried out. Despite this, the G. mellonella model can be used in the initial analysis before conventional in vivo tests and to reduce the number of tests performed on mammals.
2010-07-21
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Houston Pipe Line Company LP--Bammel Storage, Docket No. PR10-51- 000, et. al.; Notice of Baseline Filings July 14, 2010. Houston Pipe Line..., 2010, respectively the applicants listed above submitted their baseline filing of its Statement of...
The search for adenovirus 14 in children in Houston, Texas.
Laham, Federico R; Jewell, Alan M; Schoonover, Shauna L; Demmler, Gail J; Piedra, Pedro A
2008-07-01
Adenovirus (Ad)14 has recently emerged in the United States causing outbreaks of severe respiratory disease. To determine if Ad14 circulated in Houston, Texas, during the same time as an outbreak in military recruits in nearby San Antonio, 215 pediatric adenovirus isolates were serotyped using microneutralization. None were Ad14; Ad1, Ad2, and Ad3 were the most common identified serotypes.
Directory of Open Access Journals (Sweden)
Er Aylin
2017-01-01
Full Text Available The effects of the botanical insecticide azadirachtin were examined on the life history traits, fecundity and immune parameters of Galleria mellonella L. (Lepidoptera: Pyralidae. We determined that for the topical application of azadirachtin, the LC50 was 16.564 ppm; at 100 ppm the adult emergence time was prolonged, however the longevity of adults remained unchanged above sublethal concentrations. The mean number of healthy eggs and the fecundity of adults decreased, whereas the number of defective eggs increased with azadirachtin treatment. At concentrations >50 ppm female G. mellonella adults laid no eggs. Azadirachtin reduced total hemocyte counts at 24 and 48 h posttreatment, however the alterations in differential hemocyte counts were only significant at 100 ppm. Laminarin-induced nodulation response and the spreading ability of hemocytes were also suppressed with azadirachtin treatment. Our results suggest that azadirachtin, as a good candidate for integrated pest control, has the capability to affect the biological parameters and cellular immunity of the model insect G. mellonella.
The True Voice of Whitney Houston: Commodification, Authenticity, and African American Superstardom
Kooijman, J.
2014-01-01
Taking its title from the 1994 AT&T commercial starring Whitney Houston, this article examines how Houston’s voice has functioned in the construction of her star persona from her 1985 debut album to her premature death on 11 February 2012, recognising three phases: the formative years (1985-1991);
Caffeine administration alters the behaviour and development of Galleria mellonella larvae.
Maguire, Ronan; Kunc, Martin; Hyrsl, Pavel; Kavanagh, Kevin
2017-11-01
The effect of feeding caffeine on the behaviour and neural proteome of Galleria mellonella larvae was assessed. Caffeine was administered to larvae by force feeding and the metabolites theobromine and theophylline were subsequently detected by RP-HPLC analysis. Administration of caffeine to larvae resulted in reduced movement and a reduction in the formation of pupae. The production of the muscle relaxant theophylline may contribute to the reduction in larval movement. Analysis of the changes in proteome of the brain and surrounding tissues of caffeine fed larvae revealed an increase in the abundance of immune related proteins such as immune-related Hdd1 (6.28 fold increase) and hemolin (1.68 fold increase), ATPase associated proteins such as H+ transporting ATP synthase O subunit isoform 1 (1.87 fold increase) and H+ transporting ATP synthase delta subunit (1.53 fold increase) and proteins indicative of brain trauma such as troponin T transcript variant B, partial (1.55 fold increase). Proteins involved in development and protein degradation such as SUMO-activating enzyme subunit 1 (3.08 fold decrease) and chitin deacetylase, partial (3.67 fold decrease) were decreased in abundance. The results presented here indicate that caffeine is metabolised in a similar way in G. mellonella larvae to that in mammals and results in a variety of behavioural and developmental alterations. Utilisation of insects for studying the effects of caffeine and other neuroactive compounds may offer new insights into their mode of action and reduce the need to use mammals for this type of analysis. Copyright © 2017 Elsevier Inc. All rights reserved.
Taşkın, Deniz
2010-01-01
Galleria mellonella (L.) kepek, mısır unu, gliserinli mısır unu, petek ve yarı sentetik besin olmak üzere beş ayrı besin kullanılarak kültüre edilmeye çalışılmıştır. Kepek ve mısır ununda G. mellonella gelişmemiştir. Petek, yarı sentetik besin ve gliserinli mısır unu ile beslenen puplarda toplam lipit ve yağ asidi yüzdeleri belirlenmiştir. Toplam lipit ve yağ asidi yüzdesi gliserinli mısır unu ile beslenen grupta, diğer gruptakilere göre daha yüksek bulunmuştur...
Modeling the Impact of CINO2 on Ozone Formation in the Houston Area
During the summer of 2006, nitryl chloride (ClNO2) mixing ratios of over 1 ppb were measured in the Houston urban area. Nitryl chloride is potentially important to atmospheric chemistry in urban environments because its photolysis products include both NO2 a...
West Nile Virus Outbreak in Houston and Harris County, Texas, USA, 2014.
Martinez, Diana; Murray, Kristy O; Reyna, Martin; Arafat, Raouf R; Gorena, Roberto; Shah, Umair A; Debboun, Mustapha
2017-08-01
Since 2002, West Nile virus (WNV) has been detected every year in Houston and the surrounding Harris County, Texas. In 2014, the largest WNV outbreak to date occurred, comprising 139 cases and causing 2 deaths. Additionally, 1,286 WNV-positive mosquito pools were confirmed, the most reported in a single mosquito season.
Directory of Open Access Journals (Sweden)
Anaïs Castagnola
2016-09-01
Full Text Available In this study, we assessed pirAB toxin transcription in Photorhabdus luminescens laumondii (strain TT01 (Enterobacteriaceae by comparing mRNA abundance under in vivo and in vitro conditions. In vivo assays considered both natural and forced infections with two lepidopteran hosts: Galleria mellonella and Manduca sexta. Three portals of entry were utilized for the forced infection assays: (a integument; (b the digestive route (via mouth and anus; and (c the tracheal route (via spiracles. We also assessed plu4093-2 transcription during the course of a natural infection; this is when the bacteria are delivered by Heterorhabditis bacteriophora nematodes. Transcript abundance in G. mellonella was higher than in M. sexta at two of the observed time points: 15 and 18 h. Expression of pirAB plu4093-2 reached above endogenous control levels at 22 h in G. mellonella but not in M. sexta. Overall, pirAB plu4093-2 transcripts were not as highly expressed in M. sexta as in G. mellonella, from 15 to 22 h. This is the first study to directly compare pirAB plu4093-2 toxin transcript production considering different portals of entry.
VOC flux measurements using a novel Relaxed Eddy Accumulation GC-FID system in urban Houston, Texas
Park, C.; Schade, G.; Boedeker, I.
2008-12-01
Houston experiences higher ozone production rates than most other major cities in the US, which is related to high anthropogenic VOC emissions from both area/mobile sources (car traffic) and a large number of petrochemical facilities. The EPA forecasts that Houston is likely to still violate the new 8-h NAAQS in 2020. To monitor neighborhood scale pollutant fluxes, we established a tall flux tower installation a few kilometers north of downtown Houston. We measure energy and trace gas fluxes, including VOCs from both anthropogenic and biogenic emission sources in the urban surface layer using eddy covariance and related techniques. Here, we describe a Relaxed Eddy Accumulation (REA) system combined with a dual-channel GC-FID used for VOC flux measurements, including first results. Ambient air is sampled at approximately 15 L min-1 through a 9.5 mm OD PFA line from 60 m above ground next to a sonic anemometer. Subsamples of this air stream are extracted through an ozone scrubber and pushed into two Teflon bag reservoirs, from which they are transferred to the GC pre-concentration units consisting of carbon-based adsorption traps encapsulated in heater blocks for thermal desorption. We discuss the performance of our system and selected measurement results from the 2008 spring and summer seasons in Houston. We present diurnal variations of the fluxes of the traffic tracers benzene, toluene, ethylbenzene, and xylenes (BTEX) during different study periods. Typical BTEX fluxes ranged from -0.36 to 3.10 mg m-2 h-1 for benzene, and -0.47 to 5.04 mg m-2 h-1 for toluene, and exhibited diurnal cycles with two dominant peaks related to rush-hour traffic. A footprint analysis overlaid onto a geographic information system (GIS) will be presented to reveal the dominant emission sources and patterns in the study area.
1979-08-01
15 March 1979. 59Interview with Wendy L. Farace , Head Nurse, Obstetrics/Gynecology Clinic, Brooke Army Medical Center, Fort Sam Houston, Texas, 8...6 February 1979. Farace , Wendy L. Head Nurse, Obstetrica/Gynecology Clinic, Brooke Army Medical Center, Fort Sam Houston, Texas. Interview, 8 January
Energy Technology Data Exchange (ETDEWEB)
El-Kholy, Eman M.S. [Biological Applications Department, Nuclear Research Center, Atomic Energy Authority, Cairo (Egypt); Abd El-Aziz, Nahla M., E-mail: nahlasalem97@yahoo.co [Entomology Department, Faculty of Science, Cairo University (Egypt)
2010-09-15
This study was carried out on fully grown pupae of greater wax moth, Galleria mellonella L., {gamma}-irradiated to 100, 150, 300 and 400 Gy. The four doses given to male parents in the F{sub 1} generation decreased the average number of eggs per mated female, the percentage of egg hatching and the percentage of mating in both the male and female lines; the effects increased with the dose. Dose dependence of the reduction in the fecundity and the percentage of egg hatching among the female line pairings (female descendants of irradiated parental male pupae) was more significant than among the male line pairings (male descendants of irradiated parental male pupae). We also examined morphological changes in the irradiated blood cells using transmission electron microscopy (TEM). Vacuolization of the cytoplasm, disorganization and swelling of mitochondria were found.
Zhang, Xueying; Craft, Elena; Zhang, Kai
2017-07-01
Mobile emissions are a major source of urban air pollution and have been associated with a variety of adverse health outcomes. The Houston Ship Channel area is the home of a large number of diesel-powered vehicles emitting fine particulate matter (PM2.5; ≤2.5 μm in aerodynamic diameter) and nitrogen oxides (NOx). However, the spatial variability of traffic-related air pollutants in the Houston Ship Channel area has rarely been investigated. The objective of this study is to characterize spatial variability of PM2.5 and NOx concentrations attributable to on-road traffic in the Houston Ship Channel area in the year of 2011. We extracted the road network from the Texas Department of Transportation Road Inventory, and calculated emission rates using the Motor Vehicle Emission Simulator version 2014a (MOVES2014a). These parameters and preprocessed meteorological parameters were entered into a Research LINE-source Dispersion Model (RLINE) to conduct a simulation. Receptors were placed at 50 m resolution within 300 m to major roads and at 150 m resolution in the rest of the area. Our findings include that traffic-related PM2.5 were mainly emitted from trucks, while traffic-related NOx were emitted from both trucks and cars. The traffic contributed 0.90 μg/m3 PM2.5 and 29.23 μg/m3 NOx to the annual average mass concentrations of on-road air pollution, and the concentrations of the two pollutants decreased by nearly 40% within 500 m distance to major roads. The pollution level of traffic-related PM2.5 and NOx was higher in winter than those in the other three seasons. The Houston Ship Channel has earlier morning peak hours and relative late afternoon hours, which indicates the influence of goods movement from port activity. The varied near-road gradients illustrate that proximities to major roads are not an accurate surrogate of traffic-related air pollution.
Maekawa, Lilian Eiko; Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Jorge, Antonio Olavo Cardoso; Junqueira, Juliana Campos; Valera, Marcia Carneiro
2015-01-01
Dried, fresh and glycolic extracts of Zingiber officinale were obtained to evaluate the action against G. mellonella survival assay against Enterococcus faecalis infection. Eighty larvae were divided into: 1) E. faecalis suspension (control); 2) E. faecalis + fresh extract of Z. officinale (FEO); 3) E. faecalis + dried extract of Z. officinale (DEO); 4) E. faecalis + glycolic extract of Z. officinale (GEO); 5) Phosphate buffered saline (PBS). For control group, a 5 μL inoculum of standardized suspension (107 cells/mL) of E. faecalis (ATCC 29212) was injected into the last left proleg of each larva. For the treatment groups, after E. faecalis inoculation, the extracts were also injected, but into the last right proleg. The larvae were stored at 37 °C and the number of dead larvae was recorded daily for 168 h (7 days) to analyze the survival curve. The larvae were considered dead when they did not show any movement after touching. E. faecalis infection led to the death of 85% of the larvae after 168 h. Notwithstanding, in treatment groups with association of extracts, there was an increase in the survival rates of 50% (GEO), 61% (FEO) and 66% (DEO) of the larvae. In all treatment groups, the larvae exhibited a survival increase with statistically significant difference in relation to control group (p=0.0029). There were no statistically significant differences among treatment groups with different extracts (p=0.3859). It may be concluded that the tested extracts showed antimicrobial activity against E. faecalis infection by increasing the survival of Galleria mellonella larvae.
The IROC Houston Quality Assurance Program: Potential benefits of 3D dosimetry
International Nuclear Information System (INIS)
Followill, D S; Molineu, H A; Lafratta, R; Ibbott, G S
2017-01-01
The IROC Houston QA Center has provided QA core support for NCI clinical trials by ensuring that radiation doses delivered to trial patients are accurate and comparable between participating institutions. Within its QA program, IROC Houston uses anthropomorphic QA phantoms to credential sites. It is these phantoms that have the highest potential to benefit from the use of 3D dosimeters. Credentialing is performed to verify that institutions that are using advanced technologies to deliver complex treatment plans that conform to targets. This makes it increasingly difficult to assure the intended calculated dose is being delivered correctly using current techniques that are 2D-based. A 3D dosimeter such as PRESAGE® is able to provide a complete 3D measured dosimetry dataset with one treatment plan delivery. In our preliminary studies, the 3D dosimeters in our H and N and spine phantoms were found to be appropriate for remote dosimetry for relative dose measurements. To implement 3D dosimetry in IROC Houston’s phantoms, the benefit of this significant change to its current infrastructure would have to be assessed and further work would be needed before bringing 3D dosimeters into the phantom dosimetry program. (paper)
OPERATION OF A PUBLIC GEOLOGIC CORE AND SAMPLE REPOSITORY IN HOUSTON TEXAS
Energy Technology Data Exchange (ETDEWEB)
Scott W. Tinker
2003-06-01
In the spring of 2002, the Department of Energy provided an initial 1-year grant to the Bureau of Economic Geology (BEG) at The University of Texas at Austin (UT). The grant covered the one-year operational expenses of a worldclass core and cuttings facility located in Houston, Texas, that BP America donated to the BEG. The DOE investment of $300,000, matched by a $75,000 UT contribution, provided critical first-year funds that were heavily leveraged by the BP gift of $7.0 million in facilities and cash. DOE also provided a one-month extension and grant of $30,000 for the month of May 2003. A 5-year plan to grow a permanent endowment in order to manage the facility in perpetuity is well under way and on schedule. The facility, named the Houston Research Center, represents an ideal model for a strong Federal, university, and private partnership to accomplish a national good. This report summarizes the activities supported by the initial DOE grant during the first 13 months of operation and provides insight into the activities and needs of the facility in the second year of operation.
Chagas Disease Knowledge and Risk Behaviors of the Homeless Population in Houston, TX.
Ingber, Alexandra; Garcia, Melissa N; Leon, Juan; Murray, Kristy O
2018-04-01
Chagas disease is a parasitic infection, caused by Trypanosoma cruzi, endemic in Latin America. Sylvatic T. cruzi-infected triatomine vectors are present in rural and urban areas in the southern USA and may transmit T. cruzi infection to at-risk populations, such as homeless individuals. Our study aimed to evaluate Chagas disease knowledge and behaviors potentially associated with transmission risk of Chagas disease among Houston, Texas' homeless population by performing interviews with 212 homeless individuals. The majority of the 212 surveyed homeless individuals were male (79%), African-American (43%), American-born individuals (96%). About 30% of the individuals reported having seen triatomines in Houston, and 25% had evidence of blood-borne transmission risk (IV drug use and/or unregulated tattoos). The median total time homeless was significantly associated with recognition of the triatomine vector. Our survey responses indicate that the homeless populations may exhibit potential risks for Chagas disease, due to increased vector exposure, and participation in blood-borne pathogen risk behaviors. Our findings warrant additional research to quantify the prevalence of Chagas disease among homeless populations.
Houston Recovery Initiative: A Rich Case Study of Building Recovery Communities One Voice at a Time.
Bitting, Sara; Nash, Angela; Ochoa, Ashley
2016-01-01
Recovery from alcohol and drug problems is a process of change through which an individual achieves control and improved quality of life. Recovery is a primary goal for individuals with substance use disorder as it provides hope that treatment and overall health are possible for every individual. More than 23 million Americans are in recovery from addiction to alcohol and other drugs.Recovery-oriented systems of care (ROSC) are networks of community services and peer support that help individuals and families achieve recovery from substances and improve overall health. ROSC is a strengths-based and person-centered model that leverages existing community resources to address the needs of individuals and families as they progress through the journey of recovery. The ROSC model serves as the foundation of the Houston Recovery Initiative (HRI).The purpose of this article is to describe the history, development, and infrastructure of the HRI, which is a volunteer collaboration whose main goal is to educate the community on recovery and broaden the recovery safety net for people with substance use disorder in Houston, Texas. Since 2010, the HRI has grown to include more than 200 agencies across the spectrum of treatment and recovery support services in Houston so as to provide a resource for the community. Herein, we detail efforts to grow the HRI, lessons learned, future plans, and resources needed to move the HRI forward.
International Nuclear Information System (INIS)
Mohamed, H. F.
2012-12-01
The present study was evaluating the effect of plant extract (Neem) with the concentrations 0, 10, 15, 20, 25, 50, 75 and 100 ppm on the percentage of observed mortality and corrected mortality of the greater wax moth, Galleria mellon ella zeller. Also the effect of the plant extract concentrations 0.25, 50, 75 and 100 ppm on the biology of this insect as percentage larval mortality, percentage larval weight, percentage larval and pupal duration, total development time, fecundity of resulting adults. Furthermore, we examined the effect of gamma irradiation with the doses 0, 100, 200, 300 and 400 Gray on some biological aspects of G. mellon ella. In addition, we studied the combined effect of gamma irradiation and plant extract (Neem) on some biological aspects of G. mellon ella by the doses 0,100, 200, 300, 400 Gray of gamma irradiation and the concentration 15 ppm of Neem as the percentage larval mortality, percentage pupation, percentage pupal mortality, percentage of emergence and the percentage of adult survival. (Author)
Energy Technology Data Exchange (ETDEWEB)
Followill, D; Kry, S; Molineu, A; Lowenstein, J; Alvarez, P; Taylor, P; Nguyen, H; Hernandez, N; Lujano, C; Nguyen, T; Keith, T; Roll, J; Tailor, A [UT MD Anderson Cancer Center, Houston, TX (United States)
2015-06-15
Purpose: To describe the extent of IROC Houston’s (formerly the RPC) QA activities and audit results for radiotherapy institutions outside of North America (NA). Methods: The IROC Houston’s QA program components were designed to audit the radiation dose calculation chain from the NIST traceable reference beam calibration, to inclusion of dosimetry parameters used to calculate tumor doses, to the delivery of the radiation dose. The QA program provided to international institutions includes: 1) remote TLD/OSLD audit of machine output, 2) credentialing for advanced technologies, and 3) review of patient treatment records. IROC Houston uses the same standards and acceptance criteria for all of its audits whether for North American or international sites. Results: IROC Houston’s QA program has reached out to radiotherapy sites in 43 different countries since 2013 through their participation in clinical trials. In the past two years, 2,778 international megavoltage beam outputs were audited with OSLD/TLD. While the average IROC/Inst ratio is near unity for all sites monitored, there are international regions whose results are significantly different from the NA region. In the past 2 years, 477 and 87 IMRT H&N phantoms were irradiated at NA and international sites, respectively. Regardless of the OSLD beam audit results, the overall pass rate (87 percent) for all international sites (no region separation) is equal to the NA sites. Of the 182 international patient charts reviewed, 10.7 percent of the dose calculation points did not meet our acceptance criterion as compared to 13.6 percent for NA sites. The lower pass rate for NA sites results from a much larger brachytherapy component which has been shown to be more error prone. Conclusion: IROC Houston has expanded its QA services worldwide and continues a long history of improving radiotherapy dose delivery in many countries. Funding received for QA audit services from the Korean GOG, DAHANCA, EORTC, ICON and CMIC
International Nuclear Information System (INIS)
Followill, D; Kry, S; Molineu, A; Lowenstein, J; Alvarez, P; Taylor, P; Nguyen, H; Hernandez, N; Lujano, C; Nguyen, T; Keith, T; Roll, J; Tailor, A
2015-01-01
Purpose: To describe the extent of IROC Houston’s (formerly the RPC) QA activities and audit results for radiotherapy institutions outside of North America (NA). Methods: The IROC Houston’s QA program components were designed to audit the radiation dose calculation chain from the NIST traceable reference beam calibration, to inclusion of dosimetry parameters used to calculate tumor doses, to the delivery of the radiation dose. The QA program provided to international institutions includes: 1) remote TLD/OSLD audit of machine output, 2) credentialing for advanced technologies, and 3) review of patient treatment records. IROC Houston uses the same standards and acceptance criteria for all of its audits whether for North American or international sites. Results: IROC Houston’s QA program has reached out to radiotherapy sites in 43 different countries since 2013 through their participation in clinical trials. In the past two years, 2,778 international megavoltage beam outputs were audited with OSLD/TLD. While the average IROC/Inst ratio is near unity for all sites monitored, there are international regions whose results are significantly different from the NA region. In the past 2 years, 477 and 87 IMRT H&N phantoms were irradiated at NA and international sites, respectively. Regardless of the OSLD beam audit results, the overall pass rate (87 percent) for all international sites (no region separation) is equal to the NA sites. Of the 182 international patient charts reviewed, 10.7 percent of the dose calculation points did not meet our acceptance criterion as compared to 13.6 percent for NA sites. The lower pass rate for NA sites results from a much larger brachytherapy component which has been shown to be more error prone. Conclusion: IROC Houston has expanded its QA services worldwide and continues a long history of improving radiotherapy dose delivery in many countries. Funding received for QA audit services from the Korean GOG, DAHANCA, EORTC, ICON and CMIC
Assessment of Listeria monocytogenes virulence in the Galleria mellonella insect larvae model.
Rakic Martinez, Mira; Wiedmann, Martin; Ferguson, Martine; Datta, Atin R
2017-01-01
Several animal models have been used to understand the molecular basis of the pathogenicity, infectious dose and strain to strain variation of Listeria monocytogenes. The greater wax worm Galleria mellonella, as an alternative model, provides some useful advantages not available with other models and has already been described as suitable for the virulence assessment of various pathogens including L. monocytogenes. The objectives of this study are: 1) confirming the usefulness of this model with a wide panel of Listeria spp. including non-pathogenic L. innocua, L. seeligeri, L. welshimeri and animal pathogen L. ivanovii; 2) assessment of virulence of several isogenic in-frame deletion mutants in virulence and stress related genes of L. monocytogenes and 3) virulence assessment of paired food and clinical isolates of L. monocytogenes from 14 major listeriosis outbreaks occurred worldwide between 1980 and 2015. Larvae injected with different concentrations of Listeria were incubated at 37°C and monitored over seven days for time needed to kill 50% of larvae (LT50) and to determine change of bacterial population in G. mellonella, 2 and 24 hours post-inoculation. Non-pathogenic members of Listeria and L. ivanovii showed significantly (P monocytogenes strains. Isogenic mutants of L. monocytogenes with the deletions in prfA, plcA, hly, actA and virR genes, also showed significantly (P monocytogenes strains related to non-invasive (gastroenteritis) outbreaks of listeriosis showed significantly (P < 0.05) lower virulence than isolates of the same serotype obtained from outbreaks with invasive symptoms. The difference, however, was dose and strain- dependent. No significant differences in virulence were observed among the serotype tested in this study.
Impact of the 2011 heat wave on mortality and emergency department visits in Houston, Texas.
Zhang, Kai; Chen, Tsun-Hsuan; Begley, Charles E
2015-01-27
Heat waves have been linked to increased risk of mortality and morbidity, and are projected to increase in frequency and intensity in a changing climate. Houston and other areas in Texas experienced an exceptional heat wave in the summer of 2011 producing the hottest August on record. This study aims to assess the health-related impact of this heat wave. Distributed lag models were used to estimate associations between the 2011 heat wave and all-cause mortality and emergency department (ED) visits from May 1 through September 30 for the five-year period 2007-2011. The 2011 heat wave is defined as a continuous period from August 2 through 30, 2011 according to the heat advisories issued by the local National Weather Service office, and is included in the models as a dummy variable. We compared the estimated excess risk among the models with and without adjustment of continuous temperature and ozone. The 2011 heat wave in Houston was associated with a 3.6% excess risk in ED visits (95% CI: 0.6%, 6.6%) and 0.6% increase in mortality risk (95% CI: -5.5%, 7.1%). The elderly over 65 years of age were at the greatest risk in ED visits. These patterns are consistent across different heat-wave definitions, and results are similar when adjusting for continuous temperature and ozone. The 2011 heat wave in Houston had a substantial impact on ED visits and no significant impact on mortality. Our findings provide insights into local heat-wave and health preparations and interventions.
Everything is bigger in Texas : Reflection program case ‘Houston Galveston Bay, Texas’
Kok, M.; Brand, A.D.; Kothuis, Baukje; Kok, Matthijs
2017-01-01
The saying goes that ‘Everything is bigger in Texas.’ This holds true for both the flood risk in the Houston-Galveston Bay Area, and for the complexity of issues that need to be dealt with in order to reduce it – assuming there is agreement that the current risk is
Development of the Spanish Language Houston Pain Outcome Instrument for Spanish Speakers.
McNeill, Jeanette; Sherwood, Gwen
2017-12-01
To address reported disparities in pain management among Hispanic patients, this article reports the psychometrics of the newly developed Spanish language Houston Pain Outcome Instrument (HPOI) with postoperative Hispanic patients. Findings from qualitative interviews conducted with 35 self-identified Hispanics in Phase 1 of the overall project were used to generate items for a new Spanish language instrument, Cuestionario de Houston Sobre el Dolor (HPOI). The second phase tested the psychometric properties with 95 self-identified Hispanic postoperative inpatients in three Texas hospitals. HPOI subscale reliabilities ranged from .63 to .91, with similar reliabilities for Spanish and English versions. Concurrent validity was demonstrated by moderate significant correlations with similar items on the Brief Pain Inventory. Participants reported moderate and severe worst pain in the last 24 hours; 38% were undertreated for pain according to the Pain Management Index; and 75% reported nonpharmacologic strategies including family support, prayer, and position change as highly effective in managing pain. The HPOI is a reliable instrument for addressing disparities in pain management for the rapidly growing Hispanic population in the United States. Subscales for interference with mood and physical function and patient-reported nonpharmacologic strategies facilitate a more comprehensive assessment of the pain experience.
A histological procedure to study fungal infection in the wax moth Galleria mellonella
Directory of Open Access Journals (Sweden)
F. Perdoni
2014-09-01
Full Text Available The invertebrate model Galleria mellonella is a widely used factitious host to study the microbial pathogenesis in vivo. However, a specific procedure for the recovery and the processing of the infected tissues, important for a better understanding of the host-pathogen interactions, has not been reported to our knowledge. In the present study we describe a new procedure of fixation and processing of larval tissue that allows studying the larval topographic anatomy and assessing the morphological changes due to the fungal infection. Lepidopteran larvae were infected with Candida albicans strains displaying various biofilm-forming abilities. The whole larvae were then examined for tissue changes by histological techniques. We show that comparing cutting planes, serial transversal sections of paraffin-embedded larva result in better accuracy and information recovering. Using this technique, it was possible to preserve the integrity of G. mellonella internal structures allowing the detailed analysis of morphological differences in different experimental groups (i.e., healthy vs infected larvae. We were also able to study strain-related differences in the pathogenesis of C. albicans by observing the immune response elicited and the invasiveness of two isolates within the larval tissues. In general, by processing the whole larva and optimizing routinely histochemical stainings, it is possible to visualize and analyse infected tissues. Various degrees of pathogenicity (strain- or inoculum-related, and the infection time course can be described in details. Moreover, the host immune response events can be followed throughout the infectious process leading to a comprehensive picture of the studied phenomenon.
DEFF Research Database (Denmark)
Astvad, Karen Marie Thyssen; Meletiadis, Joseph; Whalley, Sarah
2017-01-01
The invertebrate model organism Galleria mellonella can be used to assess the efficacy of treatment of fungal infection. The fluconazole dose best mimicking human exposure during licensed dosing is unknown. We validated a bioassay for fluconazole detection in hemolymph and determined...... the fluconazole pharmacokinetics and pharmacodynamics in larval hemolymph in order to estimate a humanized dose for future experiments. A bioassay using 4-mm agar wells, 20 μl hemolymph, and the hypersusceptible Candida albicans DSY2621 was established and compared to a validated liquid chromatography-tandem mass...... spectrometry (LC-MS-MS) method. G. mellonella larvae were injected with fluconazole (5, 10, and 20 mg/kg of larval weight), and hemolymph was harvested for 24 h for pharmacokinetics calculations. The exposure was compared to the human exposure during standard licensed dosing. The bioassay had a linear standard...
Lee, D.; Kearns, T.; Yang, L.; Wang, G.
2014-12-01
Houston and the surrounding Harris County have experienced the detrimental effects of subsidence even prior to World War II, to the extent that the land along Galveston Bay had sunk as much as 20 feet since 1906. One dramatic example is the Brownwood subdivision, a coastal community in Baytown where continuous flooding due to subsidence forced the area to be deemed unlivable and consequently abandoned. Thus, Houston's changes in groundwater and compaction of its aquifers are of relatively high concern to those in the public (infrastructure), private (oil & gas), and international (Port of Houston Authority) sectors. One of the key questions related to the subsidence issue in Houston area is what are the contributions of sediments at different depths, and what particularly is the contribution from shallow sediments? To address these questions, University of Houston has installed a vertical GPS array in the UH Coastal Center in March 2014. The GPS array includes four permanent GPS stations with the antenna pole foundations anchored at different depths below ground surface (-10 m, -7m, -4m, 0 m). A special, double-pipe GPS antenna monument was designed for GPS stations with the array. This project was funded by an NSF grant and a UH internal grant. Five groundwater wells with the depths ranging from 2 m to 100 m below the ground surface were also installed at the UH Coastal Center site. This study will investigate continuous GPS and groundwater level measurements (March-November, 2014) at the UHCC site. It is expected that the GPS array will provide total information on subsidence as well as compaction of aquifers within different depth ranges (0 to -4m, -4 to -7 m, -7 to -10m, and below -10 m). Correlation of land subsidence and groundwater fluctuation will also be investigated.
MO-F-CAMPUS-T-01: IROC Houston QA Center’s Anthropomorphic Proton Phantom Program
International Nuclear Information System (INIS)
Lujano, C; Hernandez, N; Keith, T; Nguyen, T; Taylor, P; Molineu, A; Followill, D
2015-01-01
Purpose: To describe the proton phantoms that IROC Houston uses to approve and credential proton institutions to participate in NCI-sponsored clinical trials. Methods: Photon phantoms cannot necessarily be used for proton measurements because protons react differently than photons in some plastics. As such plastics that are tissue equivalent for protons were identified. Another required alteration is to ensure that the film dosimeters are housed in the phantom with no air gap to avoid proton streaming. Proton-equivalent plastics/materials used include RMI Solid Water, Techron HPV, blue water, RANDO soft tissue material, balsa wood, compressed cork and polyethylene. Institutions wishing to be approved or credentialed request a phantom and are prioritized for delivery. At the institution, the phantom is imaged, a treatment plan is developed, positioned on the treatment couch and the treatment is delivered. The phantom is returned and the measured dose distributions are compared to the institution’s electronically submitted treatment plan dosimetry data. Results: IROC Houston has developed an extensive proton phantom approval/credentialing program consisting of five different phantoms designs: head, prostate, lung, liver and spine. The phantoms are made with proton equivalent plastics that have HU and relative stopping powers similar (within 5%) of human tissues. They also have imageable targets, avoidance structures, and heterogeneities. TLD and radiochromic film are contained in the target structures. There have been 13 head, 33 prostate, 18 lung, 2 liver and 16 spine irradiations with either passive scatter, or scanned proton beams. The pass rates have been: 100%, 69.7%, 72.2%, 50%, and 81.3%, respectively. Conclusion: IROC Houston has responded to the recent surge in proton facilities by developing a family of anthropomorphic phantoms that are able to be used for remote audits of proton beams. Work supported by PHS grant CA10953 and CA081647
MO-F-CAMPUS-T-01: IROC Houston QA Center’s Anthropomorphic Proton Phantom Program
Energy Technology Data Exchange (ETDEWEB)
Lujano, C; Hernandez, N; Keith, T; Nguyen, T; Taylor, P; Molineu, A; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)
2015-06-15
Purpose: To describe the proton phantoms that IROC Houston uses to approve and credential proton institutions to participate in NCI-sponsored clinical trials. Methods: Photon phantoms cannot necessarily be used for proton measurements because protons react differently than photons in some plastics. As such plastics that are tissue equivalent for protons were identified. Another required alteration is to ensure that the film dosimeters are housed in the phantom with no air gap to avoid proton streaming. Proton-equivalent plastics/materials used include RMI Solid Water, Techron HPV, blue water, RANDO soft tissue material, balsa wood, compressed cork and polyethylene. Institutions wishing to be approved or credentialed request a phantom and are prioritized for delivery. At the institution, the phantom is imaged, a treatment plan is developed, positioned on the treatment couch and the treatment is delivered. The phantom is returned and the measured dose distributions are compared to the institution’s electronically submitted treatment plan dosimetry data. Results: IROC Houston has developed an extensive proton phantom approval/credentialing program consisting of five different phantoms designs: head, prostate, lung, liver and spine. The phantoms are made with proton equivalent plastics that have HU and relative stopping powers similar (within 5%) of human tissues. They also have imageable targets, avoidance structures, and heterogeneities. TLD and radiochromic film are contained in the target structures. There have been 13 head, 33 prostate, 18 lung, 2 liver and 16 spine irradiations with either passive scatter, or scanned proton beams. The pass rates have been: 100%, 69.7%, 72.2%, 50%, and 81.3%, respectively. Conclusion: IROC Houston has responded to the recent surge in proton facilities by developing a family of anthropomorphic phantoms that are able to be used for remote audits of proton beams. Work supported by PHS grant CA10953 and CA081647.
Kry, Stephen F; Dromgoole, Lainy; Alvarez, Paola; Leif, Jessica; Molineu, Andrea; Taylor, Paige; Followill, David S
2017-12-01
To review the dosimetric, mechanical, and programmatic deficiencies most frequently observed during on-site visits of radiation therapy facilities by the Imaging and Radiation Oncology Core Quality Assurance Center in Houston (IROC Houston). The findings of IROC Houston between 2000 and 2014, including 409 institutions and 1020 linear accelerators (linacs), were compiled. On-site evaluations by IROC Houston include verification of absolute calibration (tolerance of ±3%), relative dosimetric review (tolerances of ±2% between treatment planning system [TPS] calculation and measurement), mechanical evaluation (including multileaf collimator and kilovoltage-megavoltage isocenter evaluation against Task Group [TG]-142 tolerances), and general programmatic review (including institutional quality assurance program vs TG-40 and TG-142). An average of 3.1 deficiencies was identified at each institution visited, a number that has decreased slightly with time. The most common errors are tabulated and include TG-40/TG-142 compliance (82% of institutions were deficient), small field size output factors (59% of institutions had errors ≥3%), and wedge factors (33% of institutions had errors ≥3%). Dosimetric errors of ≥10%, including in beam calibration, were seen at many institutions. There is substantial room for improvement of both dosimetric and programmatic issues in radiation therapy, which should be a high priority for the medical physics community. Particularly relevant was suboptimal beam modeling in the TPS and a corresponding failure to detect these errors by not including TPS data in the linac quality assurance process. Copyright © 2017 Elsevier Inc. All rights reserved.
Boguś, M I; Wieloch, W; Ligęza-Żuber, M
2017-02-01
Coronatin-2, a 14.5 kDa protein, was isolated from culture filtrates of the entomopathogenic fungus Conidiobolus coronatus (Costantin) Batko (Entomophthoramycota: Entomophthorales). After LC-MS/MS (liquid chromatography tandem mass spectrometry) analysis of the tryptic peptide digest of coronatin-2 and a mass spectra database search no orthologs of this protein could be found in fungi. The highest homology was observed to the partial translation elongation factor 1a from Sphaerosporium equinum (protein sequence coverage, 21%), with only one peptide sequence, suggesting that coronatin-2 is a novel fungal protein that has not yet been described. In contrast to coronatin-1, an insecticidal 36 kDa protein, which shows both elastolytic and chitinolytic activity, coronatin-2 showed no enzymatic activity. Addition of coronatin-2 into cultures of hemocytes taken from larvae of Galleria mellonella Linnaeus (Lepidoptera: Pyralidae), resulted in progressive disintegration of nets formed by granulocytes and plasmatocytes due to rapid degranulation of granulocytes, extensive vacuolization of plasmatocytes accompanied by cytoplasm expulsion, and cell disintegration. Spherulocytes remained intact, while oenocytes rapidly disintegrated. Coronatin-2 produced 80% mortality when injected into G. mellonella at 5 µg larva-1. Further study is warranted to determine the relevance of the acute toxicity of coronatin-2 and its effects on hemocytes in vitro to virulence of C. coronatus against its hosts.
Leong, Y J; Sanchez, N P; Wallace, H W; Karakurt Cevik, B; Hernandez, C S; Han, Y; Flynn, J H; Massoli, P; Floerchinger, C; Fortner, E C; Herndon, S; Bean, J K; Hildebrandt Ruiz, L; Jeon, W; Choi, Y; Lefer, B; Griffin, R J
2017-08-01
The sources of submicrometer particulate matter (PM 1 ) remain poorly characterized in the industrialized city of Houston, TX. A mobile sampling approach was used to characterize PM 1 composition and concentration across Houston based on high-time-resolution measurements of nonrefractory PM 1 and trace gases during the DISCOVER-AQ Texas 2013 campaign. Two pollution zones with marked differences in PM 1 levels, character, and dynamics were established based on cluster analysis of organic aerosol mass loadings sampled at 16 sites. The highest PM 1 mass concentrations (average 11.6 ± 5.7 µg/m 3 ) were observed to the northwest of Houston (zone 1), dominated by secondary organic aerosol (SOA) mass likely driven by nighttime biogenic organonitrate formation. Zone 2, an industrial/urban area south/east of Houston, exhibited lower concentrations of PM 1 (average 4.4 ± 3.3 µg/m 3 ), significant organic aerosol (OA) aging, and evidence of primary sulfate emissions. Diurnal patterns and backward-trajectory analyses enable the classification of airmass clusters characterized by distinct PM sources: biogenic SOA, photochemical aged SOA, and primary sulfate emissions from the Houston Ship Channel. Principal component analysis (PCA) indicates that secondary biogenic organonitrates primarily related with monoterpenes are predominant in zone 1 (accounting for 34% of the variability in the data set). The relevance of photochemical processes and industrial and traffic emission sources in zone 2 also is highlighted by PCA, which identifies three factors related with these processes/sources (~50% of the aerosol/trace gas concentration variability). PCA reveals a relatively minor contribution of isoprene to SOA formation in zone 1 and the absence of isoprene-derived aerosol in zone 2. The relevance of industrial amine emissions and the likely contribution of chloride-displaced sea salt aerosol to the observed variability in pollution levels in zone 2 also are captured by PCA. This
Weissman, Evan; Butcher, Kristin F.; Schneider, Emily; Teres, Jedediah; Collado, Herbert; Greenberg, David
2011-01-01
Queensborough Community College and Houston Community College are two large, urban institutions that offer learning communities for their developmental math students, with the goals of accelerating students' progress through the math sequence and of helping them to perform better in college and ultimately earn degrees or certificates. They are…
Understanding the world energy challenges. CERAWeek 2015 - Houston / April 20-24, 2015
International Nuclear Information System (INIS)
2015-04-01
The 34. CERAWeek conference of Houston is a major meeting for worldwide energy actors. The aim of this note is not to present a structured synthesis of the debates, but to point out some of the experts' or politicians' position regarding: the proven predominance of fossil fuels, the challenge of prices, the market design change in the electric power industry, the 21. conference of parties (COP 21) on climate change, and the most original regional initiatives
2013-08-08
... information technology outsourcing services. Specifically, the workers are subcontractors working in a call... workers of the subject firm. New information shows that the Houston, Texas and Tewksbury, Massachusetts locations of CompuCom Systems are engaged in activities related to the supply of information technology...
Sexton, Ken; Linder, Stephen H
2015-01-01
Although ambient concentrations have declined steadily over the past 30 years, Houston has recorded some of the highest levels of hazardous air pollutants in the United States. Nevertheless, federal and state regulatory efforts historically have emphasized compliance with the National Ambient Air Quality Standard for ozone, treating "air toxics" in Houston as a residual problem to be solved through application of technology-based standards. Between 2004 and 2009, Mayor Bill White and his administration challenged the well-established hierarchy of air quality management spelled out in the Clean Air Act, whereby federal and state authorities are assigned primacy over local municipalities for the purpose of designing and implementing air pollution control strategies. The White Administration believed that existing regulations were not sufficient to protect the health of Houstonians and took a diversity of both collaborative and combative policy actions to mitigate air toxic emissions from stationary sources. Opposition was substantial from a local coalition of entrenched interests satisfied with the status quo, which hindered the city's attempts to take unilateral policy actions. In the short term, the White Administration successfully raised the profile of the air toxics issue, pushed federal and state regulators to pay more attention, and induced a few polluting facilities to reduce emissions. But since White left office in 2010, air quality management in Houston has returned to the way it was before, and today there is scant evidence that his policies have had any lasting impact.
Is Vitamin E Life Supporter for Gamma Irradiated Galleria Mollenella?
International Nuclear Information System (INIS)
Mohamed, H.F.
2012-01-01
This study conducted to determine the effect of vitamin E separate or combined with gamma ray in semi artificial diets on some biological aspects of the Greater wax moth, Galleria mellonella L. (Pyralidae : Lepidoptera). The increase in the average number of eggs per mated female for more than 70 % of the control in both treated male and female. Also, through the F1 generation (descendant of P1 progeny fed on artificial diet plus vitamin E) in either irradiated male or female at 100 and 300 Gy dose levels. The life supporter of vitamin E clearly demonstrates throughout F1 whose offspring fed on artificial diet plus Vitamin E, also more pronounced during the first generation treated with gamma irradiation (100 and 300 Gray) which descendant from the offspring were fed on the artificial diet containing Vitamin E (0.02%) than that treatments which treated with gamma irradiation only. The average weight of larvae and pupae significantly increase by using petroleum ether only or this may be abnormal. The average weight of larvae and pupae at the concentration 0.02% was 105.07 and 121.87 % from the control treatment, respectively then decreased to 67.86 and 75.12%, respectively from the control treatment at the concentration 0.04% and then increase at the two concentrations 0.06 and 0.08 %. The increase in weight gain in the case combined ( 100 Gy or 300 Gy with Vitamin E) more than in case using a single dose of gamma irradiation , the increase in case 300 Gy only or combined with Vitamin E more than the control treatment. The best result in case of Vitamin (E) only then when treated the pest with gamma radiation after Vitamin (E) and the effect at 100 Gy better than in case 300 Gy. The combined effect of sub sterilizing dose (300 Gy) and sterilizing doses (400 and 500 Gy) of gamma radiation and vitamin E on the mating competitiveness of F1 males G. Mellenella shows that the competitiveness values more than 1.0 at the combined VE and the two dose levels 400 and 500 Gy
Oden, Jeannette H.; Szabo, Zoltan
2016-03-21
The U.S. Geological Survey (USGS), in cooperation with the City of Houston, began a study in 2007 to determine concentrations, spatial extent, and associated geochemical conditions that might be conducive for mobility and transport of selected naturally occurring trace elements and radionuclides in the Gulf Coast aquifer system in Houston, Texas. Water samples were collected from 91 municipal supply wells completed in the Evangeline and Chicot aquifers of the Gulf Coast aquifer system in northeastern, northwestern, and southwestern Houston; hereinafter referred to as northeast, northwest and southwest Houston areas. Wells were sampled in three phases: (1) 28 municipal supply wells were sampled during 2007–8, (2) 60 municipal supply wells during 2010, and (3) 3 municipal supply wells during December 2011. During each phase of sampling, samples were analyzed for major ions, selected trace elements, and radionuclides. At a subset of wells, concentrations of arsenic species and other radionuclides (carbon-14, radium-226, radium-228, radon-222, and tritium) also were analyzed. Selected physicochemical properties were measured in the field at the time each sample was collected, and oxidation-reduction potential and unfiltered sulfides also were measured at selected wells. The source-water (the raw, ambient water withdrawn from municipal supply wells prior to water treatment) samples were collected for assessment of aquifer conditions in order to provide community water-system operators information that could be important when they make decisions about which treatment processes to apply before distributing finished drinking water.
Ribeiro, F C; de Barros, P P; Rossoni, R D; Junqueira, J C; Jorge, A O C
2017-01-01
The aim of this study was to evaluate the potential anti-Candida effects of Lactobacillus rhamnosus ATCC 9595 on Candida albicans ATCC 18804 using in vitro and in vivo models. The in vitro analysis evaluated the effects of L. rhamnosus on C. albicans's biofilm formation by CFU count and metabolic activity, filamentation capacity, and adhesion (ALS3 and HWP1) and transcriptional regulatory gene (BCR1 and CPH1) expression. The in vitro results showed that both the L. rhamnosus cells and supernatant reduced C. albicans biofilm formation, filamentation and gene expression. In the in vivo study, the treatment with L. rhamnosus supernatant increased 80% the survival of Galleria mellonella larvae infected with C. albicans. Furthermore, the supernatant of L. rhamnosus recruited haemocytes into the haemolymph (2·1-fold increase). Lactobacillus rhamnosus reduced the biofilm formation and filamentation of C. albicans in vitro by negatively regulating all studied C. albicans genes. Lactobacillus rhamnosus protected G. mellonella against experimental candidiasis in vivo. This study is the first study to report the anti-Candida properties of L. rhamnosus ATCC 9595. The supernatant of this strain has immunomodulatory effects on the G. mellonella model and protects the larvae against pathogens. © 2016 The Society for Applied Microbiology.
The William Houston Medal of the Royal College of Surgeons of Edinburgh 2002.
Teague, A M
2004-06-01
The William Houston medal is a prestigious prize awarded to the individual achieving the most outstanding examination performance at the Membership in Orthodontics examination for the Royal College of Surgeons of Edinburgh. Five clinical cases treated by the candidate are presented as part of the final examination; two of these cases are described below. The first a Class III malocclusion, and the second a Class II division 1 malocclusion, were both treated by orthodontic camouflage.
The Galleria mellonella larvae as an in vivo model for evaluation of Shigella virulence.
Barnoy, Shoshana; Gancz, Hanan; Zhu, Yuewei; Honnold, Cary L; Zurawski, Daniel V; Venkatesan, Malabi M
2017-07-04
Shigella spp. causing bacterial diarrhea and dysentery are human enteroinvasive bacterial pathogens that are orally transmitted through contaminated food and water and cause bacillary dysentery. Although natural Shigella infections are restricted to humans and primates, several smaller animal models are used to analyze individual steps in pathogenesis. No animal model fully duplicates the human response and sustaining the models requires expensive animals, costly maintenance of animal facilities, veterinary services and approved animal protocols. This study proposes the development of the caterpillar larvae of Galleria mellonella as a simple, inexpensive, informative, and rapid in-vivo model for evaluating virulence and the interaction of Shigella with cells of the insect innate immunity. Virulent Shigella injected through the forelegs causes larvae death. The mortality rates were dependent on the Shigella strain, the infectious dose, and the presence of the virulence plasmid. Wild-type S. flexneri 2a, persisted and replicated within the larvae, resulting in haemocyte cell death, whereas plasmid-cured mutants were rapidly cleared. Histology of the infected larvae in conjunction with fluorescence, immunofluorescence, and transmission electron microscopy indicate that S. flexneri reside within a vacuole of the insect haemocytes that ultrastructurally resembles vacuoles described in studies with mouse and human macrophage cell lines. Some of these bacteria-laden vacuoles had double-membranes characteristic of autophagosomes. These results suggest that G. mellonella larvae can be used as an easy-to-use animal model to understand Shigella pathogenesis that requires none of the time and labor-consuming procedures typical of other systems.
A Heart as Big as Texas: Small-Town Roots Nurture a Houston Music Teacher's Success
Moore, Patience
2011-01-01
Teaching music to nearly a thousand elementary students each week would make any educator break a sweat. But one would never know that from talking to MaryElla Neeley Stevens. After 30-plus years teaching K-4 music in the Aldine Independent School District of Houston, Texas, she still radiates positivity. Whether it's mentoring and training…
Directory of Open Access Journals (Sweden)
Raquel Teles de Menezes
2017-05-01
Full Text Available Klebsiella pneumoniae é um dos patógenos que possui grande resistência a vários antimicrobianos. A Terapia Fotodinâmica Antimicrobiana (PDT vem sendo estudada como novo recurso no combate à resistência bacteriana. Objetivo: Avaliar a ação antimicrobiana da PDT em K. pneumoniae utilizando como modelo de infecção in vivo Galleria mellonella. Métodos: Foram inoculados 10µL da suspensão padronizada de K. pneumoniae ATCC 4352 na última proleg esquerda de cada larva selecionada de G. mellonella. Decorridos 30 minutos, as larvas foram submetidas a PDT, com o uso do fotossensibilizador Azul de metileno e Laser de Arseneto de Gálio Alumínio. Passadas 24h, por sete dias o número de lagartas mortas foi anotado para a realização da curva de sobrevivência. Resultados: A PDT contribuiu para melhora da sobrevida das larvas, porém sem apresentar diferença estatística significante. Conclusão: A PDT apresentou atividade antimicrobiana contra a cepa de K. pneumoniae ATCC 4352.
Wu, Gongqing; Liu, Yi; Ding, Ying; Yi, Yunhong
2016-08-01
Galleria mellonella larvae have been widely used as a model to study the virulence of various human pathogens. Hemocytes play important roles in the innate immune response of G. mellonella. In this study, the hemocytes of G. mellonella larvae were analyzed by transmission electron microscope, light microscope, and cytochemistry. The cytological and morphological analyses revealed four types of hemocytes; Plasmatocytes, granular cells, spherule cells and oenocytoids. Differential hemocyte counts showed that under our conditions plasmatocytes and granular cells were the most abundant circulating cell types in the hemolymph. We also investigated the role of different types of hemocytes in the cellular and humoral immune defenses. The in-vivo experiment showed that plasmatocytes, granular cells and oenocytoids phagocytized FITC-labelled Escherichia coli bacteria in larvae of G. mellonella, whereas the granular cells exhibited the strongest phagocytic ability against these microbial cells. After incubation with L-DOPA, plasmatocytes, granular cells and oenocytoids are stained brown, indicating the presence of phenoloxidase activity. These results shed new light on our understanding of the immune function of G. mellonella hemocytes. Copyright © 2016 Elsevier Ltd. All rights reserved.
Establishment of a National Wind Energy Center at University of Houston
Energy Technology Data Exchange (ETDEWEB)
Wang, Su Su [Univ. of Houston, TX (United States)
2016-10-31
The DOE-supported project objectives are to: establish a national wind energy center (NWEC) at University of Houston and conduct research to address critical science and engineering issues for the development of future large MW-scale wind energy production systems, especially offshore wind turbines. The goals of the project are to: (1) establish a sound scientific/technical knowledge base of solutions to critical science and engineering issues for developing future MW-scale large wind energy production systems, (2) develop a state-of-the-art wind rotor blade research facility at the University of Houston, and (3) through multi-disciplinary research, introducing technology innovations on advanced wind-turbine materials, processing/manufacturing technology, design and simulation, testing and reliability assessment methods related to future wind turbine systems for cost-effective production of offshore wind energy. To achieve the goals of the project, the following technical tasks were planned and executed during the period from April 15, 2010 to October 31, 2014 at the University of Houston: (1) Basic research on large offshore wind turbine systems (2) Applied research on innovative wind turbine rotors for large offshore wind energy systems (3) Integration of offshore wind-turbine design, advanced materials and manufacturing technologies (4) Integrity and reliability of large offshore wind turbine blades and scaled model testing (5) Education and training of graduate and undergraduate students and post- doctoral researchers (6) Development of a national offshore wind turbine blade research facility The research program addresses both basic science and engineering of current and future large wind turbine systems, especially offshore wind turbines, for MW-scale power generation. The results of the research advance current understanding of many important scientific issues and provide technical information for solving future large wind turbines with advanced design
Lee, Michael T.; Asquith, William H.; Oden, Timothy D.
2012-01-01
In December 2005, the U.S. Geological Survey (USGS), in cooperation with the City of Houston, Texas, began collecting discrete water-quality samples for nutrients, total organic carbon, bacteria (Escherichia coli and total coliform), atrazine, and suspended sediment at two USGS streamflow-gaging stations that represent watersheds contributing to Lake Houston (08068500 Spring Creek near Spring, Tex., and 08070200 East Fork San Jacinto River near New Caney, Tex.). Data from the discrete water-quality samples collected during 2005–9, in conjunction with continuously monitored real-time data that included streamflow and other physical water-quality properties (specific conductance, pH, water temperature, turbidity, and dissolved oxygen), were used to develop regression models for the estimation of concentrations of water-quality constituents of substantial source watersheds to Lake Houston. The potential explanatory variables included discharge (streamflow), specific conductance, pH, water temperature, turbidity, dissolved oxygen, and time (to account for seasonal variations inherent in some water-quality data). The response variables (the selected constituents) at each site were nitrite plus nitrate nitrogen, total phosphorus, total organic carbon, E. coli, atrazine, and suspended sediment. The explanatory variables provide easily measured quantities to serve as potential surrogate variables to estimate concentrations of the selected constituents through statistical regression. Statistical regression also facilitates accompanying estimates of uncertainty in the form of prediction intervals. Each regression model potentially can be used to estimate concentrations of a given constituent in real time. Among other regression diagnostics, the diagnostics used as indicators of general model reliability and reported herein include the adjusted R-squared, the residual standard error, residual plots, and p-values. Adjusted R-squared values for the Spring Creek models ranged
DOE Zero Energy Ready Home Case Study: Durable Energy Builders - Houston, Texas
Energy Technology Data Exchange (ETDEWEB)
none,
2014-11-01
This case study describes a DOE Zero Energy Ready Home in Houston, Texas, that scored HERS 39 without PV and HERS 29 with PV. This 5,947 ft2 custom home has 11.5-inch ICF walls. The attic is insulated along the roof line with 5 to 7 inches of open-cell spray foam. Most of the home's drinking water is supplied by a 11,500-gallon rainwater cistern. Hurricane strapping connects the roof to the walls. The triple-pane windows are impact resistant. The foundation is a raised slab.
Directory of Open Access Journals (Sweden)
Jeffrey K. Bean
2016-05-01
Full Text Available Particulate matter was measured in Conroe, Texas (~60 km north of downtown Houston, Texas during the September 2013 DISCOVER-AQ campaign to determine the sources of particulate matter in the region. The measurement site is influenced by high biogenic emission rates as well as transport of anthropogenic pollutants from the Houston metropolitan area and is therefore an ideal location to study anthropogenic-biogenic interactions. Data from an Aerosol Chemical Speciation Monitor (ACSM suggest that on average 64 percent of non-refractory PM1 was organic material, including a high fraction (27%–41% of organic nitrates. There was little diurnal variation in the concentrations of ammonium sulfate; however, concentrations of organic and organic nitrate aerosol were consistently higher at night than during the day. Potential explanations for the higher organic aerosol loadings at night include changing boundary layer height, increased partitioning to the particle phase at lower temperatures, and differences between daytime and nighttime chemical processes such as nitrate radical chemistry. Positive matrix factorization was applied to the organic aerosol mass spectra measured by the ACSM and three factors were resolved—two factors representing oxygenated organic aerosol and one factor representing hydrocarbon-like organic aerosol. The factors suggest that the measured aerosol was well mixed and highly processed, consistent with the distance from the site to major aerosol sources, as well as the high photochemical activity.
Kerns, James R; Followill, David S; Lowenstein, Jessica; Molineu, Andrea; Alvarez, Paola; Taylor, Paige A; Kry, Stephen F
2018-03-14
Reference dosimetry data can provide an independent second check of acquired values when commissioning or validating a treatment planning system (TPS). The Imaging and Radiation Oncology Core at Houston (IROC-Houston) has measured numerous linear accelerators throughout its existence. The results of those measurements are given here, comparing accelerators and the agreement of measurement versus institutional TPS calculations. Data from IROC-Houston on-site reviews from 2000 through 2014 were analyzed for all Elekta accelerators, approximately 50. For each, consistent point dose measurements were conducted for several basic parameters in a water phantom, including percentage depth dose, output factors, small-field output factors, off-axis factors, and wedge factors. The results were compared by accelerator type independently for 6, 10, 15, and 18 MV. Distributions of the measurements for each parameter are given, providing the mean and standard deviation. Each accelerator's measurements were also compared to its corresponding TPS calculation from the institution to determine the level of agreement, as well as determining which dosimetric parameters were most often in error. Accelerators were grouped by head type and reference dosimetric values were compiled. No class of linac had better overall agreement with its TPS, but percentage depth dose and output factors commonly agreed well, while small-field output factors, off-axis factors, and wedge factors often disagreed substantially from their TPS calculations. Reference data has been collected and analyzed for numerous Elekta linacs, which provide an independent way for a physicist to double-check their own measurements to prevent gross treatment errors. In addition, treatment planning parameters more often in error have been highlighted, providing practical caution for physicists commissioning treatment planning systems for Elekta linacs. © 2018 American Association of Physicists in Medicine.
Assessment of Listeria monocytogenes virulence in the Galleria mellonella insect larvae model.
Directory of Open Access Journals (Sweden)
Mira Rakic Martinez
Full Text Available Several animal models have been used to understand the molecular basis of the pathogenicity, infectious dose and strain to strain variation of Listeria monocytogenes. The greater wax worm Galleria mellonella, as an alternative model, provides some useful advantages not available with other models and has already been described as suitable for the virulence assessment of various pathogens including L. monocytogenes. The objectives of this study are: 1 confirming the usefulness of this model with a wide panel of Listeria spp. including non-pathogenic L. innocua, L. seeligeri, L. welshimeri and animal pathogen L. ivanovii; 2 assessment of virulence of several isogenic in-frame deletion mutants in virulence and stress related genes of L. monocytogenes and 3 virulence assessment of paired food and clinical isolates of L. monocytogenes from 14 major listeriosis outbreaks occurred worldwide between 1980 and 2015. Larvae injected with different concentrations of Listeria were incubated at 37°C and monitored over seven days for time needed to kill 50% of larvae (LT50 and to determine change of bacterial population in G. mellonella, 2 and 24 hours post-inoculation. Non-pathogenic members of Listeria and L. ivanovii showed significantly (P < 0.05 higher LT50 (lower virulence than the wild type L. monocytogenes strains. Isogenic mutants of L. monocytogenes with the deletions in prfA, plcA, hly, actA and virR genes, also showed significantly (P < 0.05 higher LT50 than the wild type strain at the inoculum of 106CFU/larva. Food isolates had significantly (P < 0.05 lower virulence than the paired clinical isolates, at all three inoculum concentrations. L. monocytogenes strains related to non-invasive (gastroenteritis outbreaks of listeriosis showed significantly (P < 0.05 lower virulence than isolates of the same serotype obtained from outbreaks with invasive symptoms. The difference, however, was dose and strain- dependent. No significant differences in
Mrak, N. Ariana
1998-01-01
Investigates whether, due to the language contact situation in Houston in a group of a Mexican-American speakers, the imperfect forms of subordinate language (Spanish) are going through a process of reduction in favor of the forms of the superordinate language (English) when compared to the speech of Spanish monolinguals. (Author/VWL)
de Oliveira, Felipe Eduardo; Rossoni, Rodnei Dennis; de Barros, Patricia Pimentel; Begnini, Barbara Evelyn; Junqueira, Juliana Campos; Jorge, Antonio Olavo Cardoso; Leão, Mariella Vieira Pereira; de Oliveira, Luciane Dias
2017-09-01
Due to the growing number of multi-resistant Candida spp., adjuvant treatments that may help combat these fungal pathogens are relevant and useful. This study evaluated the immunomodulation and anti-Candida activity of Lactobacillus rhamnosus (LR), Lactobacillus acidophilus and Lactobacillus paracasei suspensions, either single- or multiple-strain, in mouse macrophages (RAW 264.7) and Galleria mellonella (GM). Mouse macrophages were activated by different lactobacilli suspensions and challenged with C. albicans (CA). Tumor necrosis factor (TNF)-α, interleukin IL-1β, IL-6 and IL-17 production and cell viability were investigated. LR was the best suspension for stimulating all evaluated cytokines and thus was used in subsequent in vivo assays. Two C. albicans clinical strains, CA21 and CA60, were then added to the GM assays to further confirm the results. LR suspension was injected into the larvae 24 h before challenging with CA. Survival curve, CFU per larva and hemocytes were counted. In the GM, the LR suspension increased the survival rate and hemocyte counts and decreased the CFU per larva counts for all groups. Lactobacilli suspensions presented strain-dependent immunomodulation; however, single suspensions showed better results. Anti-Candida activity was demonstrated by decreased Candida counts in the GM with the use of LR. Copyright © 2017 Elsevier Ltd. All rights reserved.
Guajardo, Richard; Brett, Kelsey; Young, Frederick
2017-01-01
For the past several years academic libraries have been adopting discovery systems to provide a search experience that reflects user expectations and improves access to electronic resources. University of Houston Libraries has kept pace with this evolving trend by pursuing various discovery options; these include an open-source tool, a federated…
Dong, Chun-Liu; Li, Lin-Xiong; Cui, Ze-Hua; Chen, Shu-Wen; Xiong, Yan Q.; Lu, Jia-Qi; Liao, Xiao-Ping; Gao, Yuan; Sun, Jian; Liu, Ya-Hong
2017-01-01
Invasive infections due to Staphylococcus aureus, including methicillin-resistant S. aureus are prevalent and life-threatening. Combinations of antibiotic therapy have been employed in many clinical settings for improving therapeutic efficacy, reducing side effects of drugs, and development of antibiotic resistance. Pleuromutilins have a potential to be developed as a new class of antibiotics for systemic use in humans. In the current study, we investigated the relationship between pleuromutilins, including valnemulin, tiamulin, and retapamulin, and 13 other antibiotics representing different mechanisms of action, against methicillin-susceptible and -resistant S. aureus both in vitro and in an experimental Galleria mellonella model. In vitro synergistic effects were observed in combination of all three study pleuromutilins with tetracycline (TET) by standard checkerboard and/or time-kill assays. In addition, the combination of pleuromutilins with ciprofloxacin or enrofloxacin showed antagonistic effects, while the rest combinations presented indifferent effects. Importantly, all study pleuromutilins in combination with TET significantly enhanced survival rates as compared to the single drug treatment in the G. mellonella model caused by S. aureus strains. Taken together, these results demonstrated synergy effects between pleuromutilins and TET against S. aureus both in vitro and in vivo. PMID:28874907
Directory of Open Access Journals (Sweden)
Chun-Liu Dong
2017-08-01
Full Text Available Invasive infections due to Staphylococcus aureus, including methicillin-resistant S. aureus are prevalent and life-threatening. Combinations of antibiotic therapy have been employed in many clinical settings for improving therapeutic efficacy, reducing side effects of drugs, and development of antibiotic resistance. Pleuromutilins have a potential to be developed as a new class of antibiotics for systemic use in humans. In the current study, we investigated the relationship between pleuromutilins, including valnemulin, tiamulin, and retapamulin, and 13 other antibiotics representing different mechanisms of action, against methicillin-susceptible and -resistant S. aureus both in vitro and in an experimental Galleria mellonella model. In vitro synergistic effects were observed in combination of all three study pleuromutilins with tetracycline (TET by standard checkerboard and/or time-kill assays. In addition, the combination of pleuromutilins with ciprofloxacin or enrofloxacin showed antagonistic effects, while the rest combinations presented indifferent effects. Importantly, all study pleuromutilins in combination with TET significantly enhanced survival rates as compared to the single drug treatment in the G. mellonella model caused by S. aureus strains. Taken together, these results demonstrated synergy effects between pleuromutilins and TET against S. aureus both in vitro and in vivo.
Directory of Open Access Journals (Sweden)
Deodoro Magno Brighenti
2005-02-01
Full Text Available Objetivou-se avaliar a eficiência do Bacillus thuringiensis var. kurstaki (Berliner no controle de Galleria mellonella (Linnaeus. Os experimentos foram realizados no Laboratório de Biologia de Insetos do Departamento de Entomologia da Universidade Federal de Lavras - UFLA, Lavras, MG, a 28±2ºC, UR 70±10% e fotofase de 12 horas. Aplicou-se formulação comercial de B. thuringiensis var. kurstaki por meio de pulverização, imersão dos favos e também foi incorporada à dieta artificial fornecida às lagartas de terceiro ínstar da traça da cera. A aplicação do produto fitossanitário por meio da pulverização dos favos mostrou-se eficiente no controle de lagartas, atingindo níveis iguais ou superiores a 85% de mortalidade quando foram utilizados 5 g/100 mL de água. Na aplicação por imersão dos favos, todas as dosagens testadas foram eficientes atingindo até 100% de mortalidade. Adicionada à dieta artificial, a concentração com maior porcentagem de mortalidade foi de 10g/60g de dieta. Sintomas de infecção pelo B. thuringiensis foram identificados nas lagartas e o isolamento da bactéria, por meio de uma cultura de Bacillus, comprovou a causa da morte desses insetos em todas as dosagens da formulação comercial do B. thuringiensis var. kurstaki utilizadas.This research aim at evaluating the efficiency of Bacillus thruringiensis var. kurstaki (Berliner in the control of Galleria mellonella (Linnaeus.The experiments were conducted in the Insect Biology Laboratory of the Entomology Department of the Universidade Federal de Lavras - UFLA, Lavras, MG, Brazil, at 28±2ºC, RH 70±10% and 12-hour photophase. Commercial formulation of B. thuringiensis. var. kurstaki was applied through spraying, comb soaking and also incorporated into the artificial diet fed to third instar caterpillars of the greater wax moth. Application of B. thuringiensis var. kurstaki through the spraying of the combs was efficient for control, reaching levels
Ruiz de Castilla, Verónica
2018-01-01
Aware of the challenges set before the Houston Independent school District by rapid growth in the numbers of English learner students, and a critical shortage of teachers with bilingual certification for more than a decade, members of Regional Educational Laboratory Southwest's English Learners Research Alliance sought information that districts…
Goldman, G. T.; Johnson, C.; Gutierrez, A.; Declet-Barreto, J.; Berman, E.; Bergman, A.
2017-12-01
When Hurricane Harvey made landfall outside Houston, Texas, the storm's wind speeds and unprecedented precipitation caused significant damage to the region's petrochemical infrastructure. Most notably, the company Arkema's Crosby facility suffered a power failure that led to explosions and incineration of six of its peroxide tanks. Chemicals released into the air from the explosions sent 15 emergency responders to the hospital with severe respiratory conditions and led to the evacuation of hundreds of surrounding households. Other petrochemical facilities faced other damages that resulted in unsafe and acute chemical releases into the air and water. What impacts did such chemical disasters have on the surrounding communities and emergency responders during Harvey's aftermath? What steps might companies have taken to prevent such chemical releases? And what chemical safety policies might have ensured that such disaster risks were mitigated? In this talk we will report on a survey of the extent of damage to Houston's oil and gas infrastructure and related chemical releases and discuss the role of federal chemical safety policy in preventing and mitigating the potential for such risks for future storms and other extreme weather and climate events. We will also discuss how these chemical disasters created acute toxics exposures on environmental justice communities already overburdened with chronic exposures from the petrochemical industry.
Rossoni, Rodnei Dennis; Fuchs, Beth Burgwyn; de Barros, Patrícia Pimentel; Velloso, Marisol dos Santos; Jorge, Antonio Olavo Cardoso; Junqueira, Juliana Campos; Mylonakis, Eleftherios
2017-01-01
Probiotics have been described as a potential strategy to control opportunistic infections due to their ability to stimulate the immune system. Using the non-vertebrate model host Galleria mellonella, we evaluated whether clinical isolates of Lactobacillus spp. are able to provide protection against Candida albicans infection. Among different strains of Lactobacillus paracasei, Lactobacillus rhamnosus and Lactobacillus fermentum, we verified that L. paracasei 28.4 strain had the greatest ability to prolong the survival of larvae infected with a lethal dose of C. albicans. We found that the injection of 107 cells/larvae of L. paracasei into G. mellonella larvae infected by C. albicans increased the survival of these insects compared to the control group (P = 0.0001). After that, we investigated the immune mechanisms involved in the protection against C. albicans infection, evaluating the number of hemocytes and the gene expression of antifungal peptides. We found that L. paracasei increased the hemocyte quantity (2.38 x 106 cells/mL) in relation to the control group (1.29 x 106 cells/mL), indicating that this strain is capable of raising the number of circulating hemocytes into the G. mellonella hemolymph. Further, we found that L. paracasei 28.4 upregulated genes that encode the antifungal peptides galiomicin and gallerymicin. In relation to the control group, L. paracasei 28.4 increased gene expression of galiomicin by 6.67-fold and 17.29-fold for gallerymicin. Finally, we verified that the prophylactic provision of probiotic led to a significant reduction of the number of fungal cells in G. mellonella hemolymph. In conclusion, L. paracasei 28.4 can modulate the immune system of G. mellonella and protect against candidiasis. PMID:28267809
Rossoni, Rodnei Dennis; Fuchs, Beth Burgwyn; de Barros, Patrícia Pimentel; Velloso, Marisol Dos Santos; Jorge, Antonio Olavo Cardoso; Junqueira, Juliana Campos; Mylonakis, Eleftherios
2017-01-01
Probiotics have been described as a potential strategy to control opportunistic infections due to their ability to stimulate the immune system. Using the non-vertebrate model host Galleria mellonella, we evaluated whether clinical isolates of Lactobacillus spp. are able to provide protection against Candida albicans infection. Among different strains of Lactobacillus paracasei, Lactobacillus rhamnosus and Lactobacillus fermentum, we verified that L. paracasei 28.4 strain had the greatest ability to prolong the survival of larvae infected with a lethal dose of C. albicans. We found that the injection of 107 cells/larvae of L. paracasei into G. mellonella larvae infected by C. albicans increased the survival of these insects compared to the control group (P = 0.0001). After that, we investigated the immune mechanisms involved in the protection against C. albicans infection, evaluating the number of hemocytes and the gene expression of antifungal peptides. We found that L. paracasei increased the hemocyte quantity (2.38 x 106 cells/mL) in relation to the control group (1.29 x 106 cells/mL), indicating that this strain is capable of raising the number of circulating hemocytes into the G. mellonella hemolymph. Further, we found that L. paracasei 28.4 upregulated genes that encode the antifungal peptides galiomicin and gallerymicin. In relation to the control group, L. paracasei 28.4 increased gene expression of galiomicin by 6.67-fold and 17.29-fold for gallerymicin. Finally, we verified that the prophylactic provision of probiotic led to a significant reduction of the number of fungal cells in G. mellonella hemolymph. In conclusion, L. paracasei 28.4 can modulate the immune system of G. mellonella and protect against candidiasis.
Directory of Open Access Journals (Sweden)
Carolina Firacative
Full Text Available Cryptococcosis is mainly caused by Cryptococcus neoformans. However, the number of cases due to C. gattii is increasing, affecting mainly immunocompetent hosts. C. gattii is divided into four major molecular types, VGI to VGIV, which differ in their host range, epidemiology, antifungal susceptibility and geographic distribution. Besides studies on the Vancouver Island outbreak strains, which showed that the subtype VGIIa is highly virulent compared to the subtype VGIIb, little is known about the virulence of the other major molecular types. To elucidate the virulence potential of the major molecular types of C. gattii, Galleria mellonella larvae were inoculated with ten globally selected strains per molecular type. Survival rates were recorded and known virulence factors were studied. One VGII, one VGIII and one VGIV strain were more virulent (p 0.05, 21 (five VGI, five VGII, four VGIII and seven VGIV were less virulent (p <0.05 while one strain of each molecular type were avirulent. Cell and capsule size of all strains increased markedly during larvae infection (p <0.001. No differences in growth rate at 37°C were observed. Melanin synthesis was directly related with the level of virulence: more virulent strains produced more melanin than less virulent strains (p <0.05. The results indicate that all C. gattii major molecular types exhibit a range of virulence, with some strains having the potential to be more virulent. The study highlights the necessity to further investigate the genetic background of more and less virulent strains in order to recognize critical features, other than the known virulence factors (capsule, melanin and growth at mammalian body temperature, that maybe crucial for the development and progression of cryptococcosis.
Aparecida Procópio Gomes, Livia; Alves Figueiredo, Lívia Mara; Corrêa Geraldo, Barbara Maria; Isler Castro, Kelly Cristine; Ruano de Oliveira Fugisaki, Luciana; Olavo Cardoso Jorge, Antônio; Dias de Oliveira, Luciane; Campos Junqueira, Juliana
2016-01-01
Due to the increase of bacterial resistance, medicinal alternatives are being explored. Punica granatum L. is an effective herbal extract with broad spectrum of action and bactericidal, antifungal, anthelmintic potential and being able to modulate the immune response. The aim was to evaluate the antimicrobial activity of pomegranate glycolic extract (PGE) against the periodontal pathogen Porphyromonas gingivalis by using Galleria mellonella as in vivo model. Fifteen larvae were used per group. Injection of high concentration (200, 100, and 25 mg/mL) of PGE showed a toxic effect, leading them to death. A suspension of P. gingivalis (106 cells/mL) was inoculated in the left last proleg and PGE (12.5, 6.25, 3.1, and 2.5 mg/mL) were injected into the right proleg. The larvae were then kept at 37°C under the dark. Injection of PGE at any dose statistically improved larvae survival rates. The data were analysed (log-rank test, Mantel-Cox, P < 0.05) and showed that all concentrations of PGE (12.5, 6.25, 3.1, and 2.5 mg/mL) presented higher larval survival rates, with significant statistical difference in relation to control group (P. gingivalis). In conclusion, the PGE had antimicrobial action against P. gingivalis in vivo model using G. mellonella. PMID:27668280
2010-07-26
... DEPARTMENT OF LABOR Employment and Training Administration TA-W-71,483, Continental Airlines, Inc., Reservations Division, Houston, TX; TA-W-71,483A, Continental Airlines, Inc., Reservations Division, Tampa, FL; TA-W-71,483B, Continental Airlines, Inc., Reservations Division, Salt Lake City, UT; Notice of...
Groundwater quality of the Gulf Coast aquifer system, Houston, Texas, 2007-08
Oden, Jeannette H.; Oden, Timothy D.; Szabo, Zoltan
2010-01-01
In the summers of 2007 and 2008, the U.S. Geological Survey (USGS), in cooperation with the City of Houston, Texas, completed an initial reconnaissance-level survey of naturally occurring contaminants (arsenic, other selected trace elements, and radionuclides) in water from municipal supply wells in the Houston area. The purpose of this reconnaissance-level survey was to characterize source-water quality prior to drinking water treatment. Water-quality samples were collected from 28 municipal supply wells in the Houston area completed in the Evangeline aquifer, Chicot aquifer, or both. This initial survey is part of ongoing research to determine concentrations, spatial extent, and associated geochemical conditions that might be conducive for mobility and transport of these constituents in the Gulf Coast aquifer system in the Houston area. Samples were analyzed for major ions (calcium, magnesium, potassium, sodium, bromide, chloride, fluoride, silica, and sulfate), selected chemically related properties (residue on evaporation [dissolved solids] and chemical oxygen demand), dissolved organic carbon, arsenic species (arsenate [As(V)], arsenite [As(III)], dimethylarsinate [DMA], and monomethylarsonate [MMA]), other trace elements (aluminum, antimony, arsenic, barium, beryllium, boron, cadmium, chromium, cobalt, copper, iron, lead, lithium, manganese, molybdenum, nickel, selenium, silver, strontium, thallium, vanadium, and zinc), and selected radionuclides (gross alpha- and beta-particle activity [at 72 hours and 30 days], carbon-14, radium isotopes [radium-226 and radium-228], radon-222, tritium, and uranium). Field measurements were made of selected physicochemical (relating to both physical and chemical) properties (oxidation-reduction potential, turbidity, dissolved oxygen concentration, pH, specific conductance, water temperature, and alkalinity) and unfiltered sulfides. Dissolved organic carbon and chemical oxygen demand are presented but not discussed in the
The location of late night bars and alcohol-related crashes in Houston, Texas.
Levine, Ned
2017-10-01
A study in the City of Houston, Texas, related the location of establishments primarily serving alcohol ("bars") after midnight to late night alcohol-related motor vehicle crashes. There were three data sets for 2007-09: 1) 764bars that were open after midnight; 2) 1660 alcohol-related crashes that occurred within the City of Houston between midnight and 6 am; and 3) 4689 modeling network road segments to which bars and alcohol-related crashes were assigned. Forty-five percent of the late night alcohol-related crashes were within a quarter mile of a late night bar. The bars were highly concentrated in 17 small bar clusters. Using the modeling network, Poisson-Gamma-CAR and Poisson-Lognormal-CAR spatial regression models showed a positive exponential relationship between late night alcohol-related crashes and the number of late nights bars and bar clusters, and a negative exponential relationship to distance to the nearest late night bar controlling for the type of road segment (freeway, principal arterial, minor arterial). A more general model dropped the bar cluster variable. Further, the Poisson-Gamma-CAR model appeared to produce a better representation than the Poisson-Lognormal-CAR model though the errors were different. The general Poisson-Gamma-CAR model showed that each late night bar increased the frequency of alcohol-related crashes on a segment by approximately 190%. For each mile closer a segment was to a late night bar, the likelihood increased by 42%. Copyright © 2017 Elsevier Ltd. All rights reserved.
2015-12-01
Over the years, the Palm Center (PC) in Houston, Texas, has been the beneficiary of several economic : development endeavors designed to ignite economic and community growth and revitalization. While : these endeavors brought forth initial success, t...
Kryukov, Vadim Yu; Kryukova, Natalia A; Tyurin, Maksim V; Yaroslavtseva, Olga N; Glupov, Viktor V
2017-03-15
Females of the ectoparasitoid Habrobracon hebetor attack and envenomate numerous host individuals during oviposition. The vectoring of the entomopathogenic fungus Beauveria bassiana during the adhesion stage by ectoparasitoid females among the wax moth larvae Galleria mellonella was explored under laboratory conditions. Vectoring occurred both from infected parasitoids to wax moth larvae and from infected to healthy wax moth larvae by parasitoids. The efficacy of vectoring in both cases was dose dependent. Parasitoid females were unable to recognize infected larvae in a labyrinth test. In addition, the presence of H. hebetor females significantly (1.5-13 fold) increased the mycoses level in clusters of G. mellonella, with 40% of the larvae infected with fungal conidia. Envenomation by H. hebetor increased conidia germination on the cuticles of the wax moth larvae by 4.4 fold. An enhanced germination rate (2 fold) was registered in the n-hexane epicuticular extract of envenomated larvae compared to that of healthy larvae. Both envenomation and mycoses enhanced the phenoloxidase (PO) activity in the integument of G. mellonella and, in contrast, decreased the encapsulation rate in hemolymphs. We hypothesize that changes in the integument property and inhibition of cellular immunity provide the highest infection efficacy of entomopathogenic fungi with H. hebetor. © 2017 Institute of Zoology, Chinese Academy of Sciences.
Dere, Beyza; Altuntaş, Hülya; Nurullahoğlu, Z Ulya
2015-07-01
The insecticidal effects, specifically, changes in hemolymph total protein and malondialdehyde (MDA) levels, and antioxidant enzyme activities of azadirachtin (AZA) given to the wax moth, Galleria mellonella L. (Lepidoptera: Pyralidae) larvae via force feeding were investigated. Bioassays showed that the LD50 and LD99 (lethal dose) values of AZA were 2.1 and 4.6 μg/larva, respectively. Experimental analyses were performed with five doses of AZA (0.5, 1, 1.5, 2, and 3 μg/larva). Total protein level in larval hemolymph increased at all AZA doses at 24 h whereas a considerable decrease was observed at 2 and 3 μg/larva doses, and only an increase displayed at 1.5 μg/larva at 72 h. The level of MDA increased at 2 and 3 μg/larva doses at 24 h compared with controls. This trend was also observed at 1.5, 2, and 3 μg/larva doses at 72 h and MDA levels were lower when compared with those of 24 h at all doses except for 1.5 μg/larva dose. Catalase activity decreased at 1, 1.5, and 2 μg/larva doses at 24 h whereas increased at all doses except for 0.5 μg/larva at 72 h compared with controls. AZA led to a decline in superoxide dismutase activity at all experimental doses at 24 and 72 h except for 3 μg/larva doses at 72 h. An increase in glutathione-S-transferase (GST) activity was evident at all AZA doses at 24 h. AZA displayed 68% decline in GST activity at 72 h post treatments when compared to 24 h. Consequently, We infer that the toxicity of AZA extends beyond its known actions in molting processes to redox homeostasis. © 2015 Wiley Periodicals, Inc.
Noh, S. J.; Lee, J. H.; Lee, S.; Zhang, Y.; Seo, D. J.
2017-12-01
Hurricane Harvey was one of the most extreme weather events in Texas history and left significant damages in the Houston and adjoining coastal areas. To understand better the relative impact to urban flooding of extreme amount and spatial extent of rainfall, unique geography, land use and storm surge, high-resolution water modeling is necessary such that natural and man-made components are fully resolved. In this presentation, we reconstruct spatiotemporal evolution of inundation during Hurricane Harvey using hyper-resolution modeling and quantitative image reanalysis. The two-dimensional urban flood model used is based on dynamic wave approximation and 10 m-resolution terrain data, and is forced by the radar-based multisensor quantitative precipitation estimates. The model domain includes Buffalo, Brays, Greens and White Oak Bayous in Houston. The model is simulated using hybrid parallel computing. To evaluate dynamic inundation mapping, we combine various qualitative crowdsourced images and video footages with LiDAR-based terrain data.
Directory of Open Access Journals (Sweden)
Majed F Alghoribi
Full Text Available Galleria mellonella larvae are an alternative in vivo model for investigating bacterial pathogenicity. Here, we examined the pathogenicity of 71 isolates from five leading uropathogenic E. coli (UPEC lineages using G. mellonella larvae. Larvae were challenged with a range of inoculum doses to determine the 50% lethal dose (LD50 and for analysis of survival outcome using Kaplan-Meier plots. Virulence was correlated with carriage of a panel of 29 virulence factors (VF. Larvae inoculated with ST69 and ST127 isolates (10(4 colony-forming units/larvae showed significantly higher mortality rates than those infected with ST73, ST95 and ST131 isolates, killing 50% of the larvae within 24 hours. Interestingly, ST131 isolates were the least virulent. We observed that ST127 isolates are significantly associated with a higher VF-score than isolates of all other STs tested (P≤0.0001, including ST69 (P<0.02, but one ST127 isolate (strain EC18 was avirulent. Comparative genomic analyses with virulent ST127 strains revealed an IS1 mediated deletion in the O-antigen cluster in strain EC18, which is likely to explain the lack of virulence in the larvae infection model. Virulence in the larvae was not correlated with serotype or phylogenetic group. This study illustrates that G. mellonella are an excellent tool for investigation of the virulence of UPEC strains. The findings also support our suggestion that the incidence of ST127 strains should be monitored, as these isolates have not yet been widely reported, but they clearly have a pathogenic potential greater than that of more widely recognised clones, including ST73, ST95 or ST131.
Tambong, J T; Xu, R; Sadiku, A; Chen, Q; Badiss, A; Yu, Q
2014-04-01
Serratia marcescens strains isolated from entomopathogenic nematodes (Rhabditis sp.) were examined for their pathogenicity and establishment in wax moth (Galleria mellonella) larvae. All the Serratia strains were potently pathogenic to G. mellonella larvae, leading to death within 48 h. The strains were shown to possess a metalloprotease gene encoding for a novel serralysin-like protein. Rapid establishment of the bacteria in infected larvae was confirmed by specific polymerase chain reaction (PCR) detection of a DNA fragment encoding for this protein. Detection of the viable Serratia strains in infected larvae was validated using the SYBR Green reverse transcriptase real-time PCR assay targeting the metalloprotease gene. Nucleotide sequences of the metalloprotease gene obtained in our study showed 72 single nucleotide polymorphisms (SNP) and 3 insertions compared with the metalloprotease gene of S. marcescens E-15. The metalloprotease gene had 60 synonymous and 8 nonsynonymous substitutions relative to the closest GenBank entry, S. marcescens E-15. A comparison of the amino acid composition of the new serralysin-like protein with that of the serralysin protein of S. marcescens E-15 revealed differences at 11 positions and a new aspartic acid residue. Analysis of the effect of protein variation suggests that a new aspartic acid residue resulting from nonsynonymous nucleotide mutations in the protein structure could have the most significant effect on its biological function. The new metalloprotease gene and (or) its product could have applications in plant agricultural biotechnology.
Houston, we have a narrative why science needs story
Olson, Randy
2015-01-01
Ask a scientist about Hollywood, and you ll probably get eye rolls. But ask someone in Hollywood about science, and they ll see dollar signs: moviemakers know that science can be the source of great stories, with all the drama and action that blockbusters require. That s a huge mistake, says Randy Olson: Hollywood has a lot to teach scientists about how to tell a story and, ultimately, how to "do" science better. With "Houston, We Have a Narrative," he lays out a stunningly simple method for turning the dull into the dramatic. Drawing on his unique background, which saw him leave his job as a working scientist to launch a career as a filmmaker, Olson first diagnoses the problem: When scientists tell us about their work, they pile one moment and one detail atop another moment and another detail a stultifying procession of and, and, and. What we need instead is an understanding of the basic elements of story, the narrative structures that our brains are all but hardwired to look for which Olson boils down, bril...
The Advanced Lab Course at the University of Houston
Forrest, Rebecca
2009-04-01
The University of Houston Advanced Lab course is designed to help students understand the physics in classic experiments, become familiar with experimental equipment and techniques, gain experience with independent experimentation, and learn to communicate results orally and in writing. It is a two semester course, with a Lab Seminar also required during the first semester. In the Seminar class we discuss keeping a notebook and writing a laboratory report, error analysis, data fitting, and scientific ethics. The students give presentations, in pairs, on the workings and use of basic laboratory equipment. In the Lab courses students do a one week introductory experiment, followed by six two-week experiments each semester. These range from traditional experiments in modern physics to contemporary experiments with superconductivity and chaos. The students are required to keep a laboratory notebook and to write a four-page paper for each experiment in the publication style of the American Institute of Physics. This course introduces students to the experimental tools and techniques used in physics, engineering, and industry laboratories, and allows them to mature as experimentalists.
Directory of Open Access Journals (Sweden)
Jan Zawitkowski
2014-04-01
Full Text Available Entomopathogenic fungi occur in habitats of their host organisms i.e. in soil. Arthropods – their potential hosts, are one of the biotic factors affecting the occurrence and survival of the fungi. Infection by entomopathogenic organisms (fungi of the test insect Galleria mellonella L. was determined from pathological changes in caterpillars. The effect of incubation temperature on the development of entomophages was accounted for during observations. The infection of caterpillars by fungi was more effective at 25°C than at 20°C. Four species of entomopathognic fungi infecting caterpillars of the greater wax moth (G. mellonella were determined. Entomopathogenic nematodes infecting the insect were classified to family. Determined relationships may vary in time. A set of similar studies in the Mokotów District is needed to confirm the obtained results.
Warner, M. E.; Bhatia, U.; Sela, L.; Wang, R.; Kodra, E.; Ganguly, A. R.
2017-12-01
A well-designed recovery strategy for lifeline infrastructure networks can lead to faster and more reliable restoration of essential services in the aftermath of natural catastrophes such as hurricanes or earthquakes. Urban and regional lifelines impact one another, while the recovery of urban lifelines in turn impacts regional infrastructural resilience, owing to the interdependence of lifelines across scales. Prior work by our team, often in collaboration, has led to the development of new recovery approaches based on network science and engineering, including centrality measures from network science, information theoretic metrics, and network optimization approaches. We have developed proof-of-concept demonstrations at both regional scales, such as for the Indian Railways Network and the US National Airspace System both subjected to multiple hazards, and to urban settings, such as the post-Hurricane recovery of combined power-subway system-of-systems in Boston and the New York City MTA after Hurricane Sandy. Here we make an attempt to understand how such methods may have been, or continue to be, applicable to the transportation network in Houston post-Harvey, and more broadly, how and to what extent lessons learned in urban and regional resilience may generalize across cases. We make an assessment of the state of the literature, process understanding, simulation models, data science methods, and best practices, necessary to address problems of this nature, with a particular focus on post-Harvey recovery of transportation services in Houston.
2010-07-12
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR10-44-000; Docket No. PR10-46-000; Docket No. PR10-48- 000; Docket No. PR10-49-000; Docket No. PR10-50-000] Houston Pipe Line Company LP, Worsham-Steed Gas Storage, L.P., Energy Transfer Fuel, LP, Mid Continent Market Center, L.L.C...
Radar-based Flood Warning System for Houston, Texas and Its Performance Evaluation
Fang, N.; Bedient, P.
2009-12-01
Houston has a long history of flooding problems as a serious nature. For instance, Houstonians suffered from severe flood inundation during Tropical Storm Allison in 2001 and Hurricane Ike in 2008. Radar-based flood warning systems as non-structural tools to provide accurate and timely warnings to the public and private entities are greatly needed for urban areas prone to flash floods. Fortunately, the advent of GIS, radar-based rainfall estimation using NEXRAD, and real-time delivery systems on the internet have allowed flood alert systems to provide important advanced warning of impending flood conditions. Thus, emergency personnel can take proper steps to mitigate against catastrophic losses. The Rice and Texas Medical Center (TMC) Flood Alert System (FAS2) has been delivering warning information with 2 to 3 hours of lead time to facility personnel in a readily understood format for more than 40 events since 1997. The system performed well during these major rainfall events with R square value of 93%. The current system has been improved by incorporating a new hydraulic prediction tool - FloodPlain Map Library (FPML). The FPML module aims to provide visualized information such as floodplain maps and water surface elevations instead of just showing hydrographs in real time based on NEXRAD radar rainfall data. During Hurricane Ike (September, 2008), FAS2 successfully provided precise and timely flood warning information to TMC with the peak flow difference of 3.6% and the volume difference of 5.6%; timing was excellent for this double-peaked event. With the funding from the Texas Department of Transportation, a similar flood warning system has been developed at a critical transportation pass along Highway 288 in Houston, Texas. In order to enable emergency personnel to begin flood preparation with as much lead time as possible, FAS2 is being used as a prototype to develop warning system for other flood-prone areas such as City of Sugar Land.
This study measured food security and hunger of households enrolled in Head Start in Houston, Texas, and Birmingham, Alabama and assessed factors that could affect food security. Interviewers collected data from primary caregivers on demographic characteristics, dietary intake, and the six-item US f...
Wei, Wenjuan; Yang, Haifei; Hu, Lifen; Ye, Ying; Li, Jiabin
2017-12-01
Treatment of Acinetobacter baumannii infections is challenging owing to widespread multidrug-resistant A. baumannii (MDR-AB) and the lack of novel agents. Although recent data suggest that levofloxacin (LVX) may have unique activity against MDR-AB in combination with colistin (CST), further preclinical work is needed. We used a A. baumannii type strain ATCC19606, a CST-resistant strain AB19606R, and two clinical isolates (GN0624 and GN1115) of MDR-AB to investigate the in vitro and in vivo efficacy of LVX-CST combination. Synergy studies were performed using the microtiter plate chequerboard assay and time-kill methodology. Inhibitory activity of antibiotics against biofilms and the mutant prevention concentrations were also studied in vitro. A simple invertebrate model (Galleria mellonella) has been used to assess the in vivo activity of antimicrobial therapies. The LVX-CST combination was bactericidal against the CST-susceptible clinical isolate (GN0624). In checkerboard assays, synergy (defined as a fractional inhibitory concentration index of baumanni. Treatment of G. mellonella larvae infected with lethal doses of A. baumannii resulted in significantly enhanced survival rates when LVX was given with CST compared with CST treatment alone (p < 0.05). In summary, a synergistic or additive effect between CST and LVX was observed in vitro and in vivo against CST-susceptible A. baumannii strains, although not against CST-resistant ones. Copyright © 2015. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Gopala K. Mannala
2017-12-01
Full Text Available microRNAs (miRNAs coordinate several physiological and pathological processes by regulating the fate of mRNAs. Studies conducted in vitro indicate a role of microRNAs in the control of host-microbe interactions. However, there is limited understanding of miRNA functions in in vivo models of bacterial infections. In this study, we systematically explored changes in miRNA expression levels of Galleria mellonella larvae (greater-wax moth, a model system that recapitulates the vertebrate innate immunity, following infection with L. monocytogenes. Using an insect-specific miRNA microarray with more than 2000 probes, we found differential expression of 90 miRNAs (39 upregulated and 51 downregulated in response to infection with L. monocytogenes. We validated the expression of a subset of miRNAs which have mammalian homologs of known or predicted function. In contrast, non-pathogenic L. innocua failed to induce these miRNAs, indicating a virulence-dependent miRNA deregulation. To predict miRNA targets using established algorithms, we generated a publically available G. mellonella transcriptome database. We identified miRNA targets involved in innate immunity, signal transduction and autophagy, including spätzle, MAP kinase, and optineurin, respectively, which exhibited a virulence-specific differential expression. Finally, in silico estimation of minimum free energy of miRNA-mRNA duplexes of validated microRNAs and target transcripts revealed a regulatory network of the host immune response to L. monocytogenes. In conclusion, this study provides evidence for a role of miRNAs in the regulation of the innate immune response following bacterial infection in a simple, rapid and scalable in vivo model that may predict host-microbe interactions in higher vertebrates.
Khan, Sehroon; Nadir, Sadia; Lihua, Guo; Xu, Jianchu; Holmes, Keith A; Dewen, Qiu
2016-01-01
An insect-toxic protein, Bb70p, was purified from Beauveria bassiana 70 using ammonium sulfate precipitation, ion exchange chromatography, and gel filtration. Bb70p has a high affinity for anion exchangers and 2D electrophoresis results revealed a single spot with a molecular weight of 35.5 kDa and an iso-electric point of ∼4.5. Bb70p remains active from 4 to 60°C, within a pH range of 4-10, but is more active in slightly acidic pH. A pure protein, Bb70p does not have any carbohydrate side chains. The protein caused high mortality by intra-haemocelic injection into Galleria mellonella with LD50 of 334.4 μg/g body weight and activates the phenol oxidase cascade. With a partial amino acid sequence comparison using the NCBI database, we showed no homology to known toxin proteins of entomopathogenic fungi. Thus, Bb70p appears to be an insect toxin protein, demonstrating novelty. Identification of this insect-toxic protein presents potential to enhance the virulence of B. bassiana through genetic manipulation. Copyright © 2015 Elsevier Inc. All rights reserved.
Botlaguduru, Venkata S V; Kommalapati, Raghava R; Huque, Ziaul
2018-04-19
The Houston-Galveston-Brazoria (HGB) area of Texas has a history of ozone exceedances and is currently classified under moderate nonattainment status for the 2008 8-hr ozone standard of 75 ppb. The HGB area is characterized by intense solar radiation, high temperature, and humidity, which influence day-to-day variations in ozone concentrations. Long-term air quality trends independent of meteorological influence need to be constructed for ascertaining the effectiveness of air quality management in this area. The Kolmogorov-Zurbenko (KZ) filter technique used to separate different scales of motion in a time series, is applied in the current study for maximum daily 8-hr (MDA8) ozone concentrations at an urban site (EPA AQS Site ID: 48-201-0024, Aldine) in the HGB area. This site located within 10 miles of downtown Houston and the George Bush Intercontinental Airport, was selected for developing long-term meteorologically independent MDA8 ozone trends for the years 1990-2016. Results from this study indicate a consistent decrease in meteorologically independent MDA8 ozone between 2000-2016. This pattern could be partially attributed to a reduction in underlying NO X emissions, particularly that of lowering nitrogen dioxide (NO 2 ) levels, and a decrease in the release of highly reactive volatile organic compounds (HRVOC). Results also suggest solar radiation to be most strongly correlated to ozone, with temperature being the secondary meteorological control variable. Relative humidity and wind speed have tertiary influence at this site. This study observed that meteorological variability accounts for a high of 61% variability in baseline ozone (low-frequency component, sum of long-term and seasonal components), while 64% of the change in long-term MDA8 ozone post-2000 could be attributed to NO X emissions reduction. Long-term MDA8 ozone trend component was estimated to be decreasing at a linear rate of 0.412 ± 0.007 ppb/yr for the years 2000-2016, and 0.155
Directory of Open Access Journals (Sweden)
Inês N Silva
Full Text Available Burkholderia cepacia complex (Bcc bacteria are opportunistic pathogens causing chronic respiratory infections particularly among cystic fibrosis patients. During these chronic infections, mucoid-to-nonmucoid morphotype variation occurs, with the two morphotypes exhibiting different phenotypic properties. Here we show that in vitro, the mucoid clinical isolate Burkholderia multivorans D2095 gives rise to stable nonmucoid variants in response to prolonged stationary phase, presence of antibiotics, and osmotic and oxidative stresses. Furthermore, in vitro colony morphotype variation within other members of the Burkholderia genus occurred in Bcc and non-Bcc strains, irrespectively of their clinical or environmental origin. Survival to starvation and iron limitation was comparable for the mucoid parental isolate and the respective nonmucoid variant, while susceptibility to antibiotics and to oxidative stress was increased in the nonmucoid variants. Acute infection of Galleria mellonella larvae showed that, in general, the nonmucoid variants were less virulent than the respective parental mucoid isolate, suggesting a role for the exopolysaccharide in virulence. In addition, most of the tested nonmucoid variants produced more biofilm biomass than their respective mucoid parental isolate. As biofilms are often associated with increased persistence of pathogens in the CF lungs and are an indicative of different cell-to-cell interactions, it is possible that the nonmucoid variants are better adapted to persist in this host environment.
Horney, Jennifer A; Casillas, Gaston A; Baker, Erin; Stone, Kahler W; Kirsch, Katie R; Camargo, Krisa; Wade, Terry L; McDonald, Thomas J
2018-01-01
Polycyclic aromatic hydrocarbons (PAHs) are complex environmental toxicants. Exposure to them has been linked to adverse health outcomes including cancer, as well as diseases of the skin, liver, and immune system. Based on an ongoing community engagement partnership with stakeholder groups and residents, we conducted a small longitudinal study to assess domestic exposure to PAHs among residents of Manchester, an environmental justice neighborhood located in the East End of Houston, TX. In December, 2016, we used fiber wipes to collect samples of household dust from 25 homes in Manchester. Following Hurricane Harvey, in September 2017, we revisited 24 of the 25 homes to collect soil samples from the front yards of the same homes. Wipes and soil were analyzed for the presence of PAHs using gas chromatography-mass spectrometry (GC-MS) methods. Principal component analysis plots, heatmaps, and PAH ratios were used to compare pre- and post-Hurricane Harvey samples. While direct comparison is not possible, we present three methods for comparing PAHs found in pre-hurricane fiber wipes and post-hurricane soil samples. The methods demonstrate that the PAHs found before and after Hurricane Harvey are likely from similar sources and that those sources are most likely to be associated with combustion. We also found evidence of redistribution of PAHs due to extreme flooding associated with Hurricane Harvey. Residents of the Manchester neighborhood of Houston, TX, are exposed to a range of PAHs in household dust and outdoor soil. While it was not possible to compare directly, we were able to use several methods to assess detected concentrations, changes in site-specific PAH allocations, and PAH origination. Additional research is needed to identify specific sources of domestic PAH exposure in these communities and continued work involving community members and policy makers should aim to develop interventions to reduce domestic exposure to and prevent negative health outcomes
Vigil, Karen J; Jiang, Zhi-Dong; Chen, Jaclyn J; Palumbo, Kathryn L; Galbadage, Thushara; Brown, Eric L; Yiang, Jing; Koo, Hoonmo; DuPont, Margaret W; Ericsson, Charles; Adachi, Javier A; DuPont, Herbert L
2009-04-01
Bacterial enteropathogens acquired from contaminated food are the principal causes of travelers' diarrhea (TD). We evaluated desserts obtained from popular restaurants in the tourist city of Guadalajara, Mexico, and Houston, Texas, to determine coliform and Escherichia coli contamination levels and presence of diarrheagenic E. coli known to be important in TD. Contamination for all organisms was seen for desserts served in Guadalajara restaurants. Desserts should be considered as potentially risky foods for development of TD among international visitors to developing regions of the world.
Heitmueller, Miriam; Billion, André; Dobrindt, Ulrich; Vilcinskas, Andreas; Mukherjee, Krishnendu
2017-10-01
Innate-immunity-related genes in humans are activated during urinary tract infections (UTIs) caused by pathogenic strains of Escherichia coli but are suppressed by commensals. Epigenetic mechanisms play a pivotal role in the regulation of gene expression in response to environmental stimuli. To determine whether epigenetic mechanisms can explain the different behaviors of pathogenic and commensal bacteria, we infected larvae of the greater wax moth, Galleria mellonella , a widely used model insect host, with a uropathogenic E. coli (UPEC) strain that causes symptomatic UTIs in humans or a commensal-like strain that causes asymptomatic bacteriuria (ABU). Infection with the UPEC strain (CFT073) was more lethal to larvae than infection with the attenuated ABU strain (83972) due to the recognition of each strain by different Toll-like receptors, ultimately leading to differential DNA/RNA methylation and histone acetylation. We used next-generation sequencing and reverse transcription (RT)-PCR to correlate epigenetic changes with the induction of innate-immunity-related genes. Transcriptomic analysis of G. mellonella larvae infected with E. coli strains CFT073 and 83972 revealed strain-specific variations in the class and expression levels of genes encoding antimicrobial peptides, cytokines, and enzymes controlling DNA methylation and histone acetylation. Our results provide evidence for the differential epigenetic regulation of transcriptional reprogramming by UPEC and ABU strains of E. coli in G. mellonella larvae, which may be relevant to understanding the different behaviors of these bacterial strains in the human urinary tract. Copyright © 2017 American Society for Microbiology.
Schrama, D; Helliwell, N; Neto, L; Faleiro, M L
2013-06-01
The aim of this study was to evaluate the effect of the acid and salt adaptation in a cheese-based medium on the virulence potential of Listeria monocytogenes strains isolated from cheese and dairy processing environment using the Galleria mellonella model. Four L. monocytogenes strains were exposed to a cheese-based medium in conditions of induction of an acid tolerance response and osmotolerance response (pH 5·5 and 3·5% w/v NaCl) and injected in G. mellonella insects. The survival of insects and the L. monocytogenes growth kinetics in insects were evaluated. The gene expression of hly, actA and inlA genes was determined by real-time PCR. The adapted cells of two dairy strains showed reduced insect mortality (P 0·05) was found between adapted and nonadapted cells. The gene expression results evidenced an overexpression of virulence genes in cheese-based medium, but not in simulated insect-induced conditions. Our results suggest that adaptation to low pH and salt in a cheese-based medium can affect the virulence of L. monocytogenes, but this effect is strain dependent. In this study, the impact of adaptation to low pH and salt in a cheese-based medium on L. monocytogenes virulence was tested using the Wax Moth G. mellonella model. This model allowed the differentiation of the virulence potential between the L. monocytogenes strains. The effect of adaptation on virulence is strain dependent. The G. mellonella model revealed to be a prompt method to test food-related factors on L. monocytogenes virulence. © 2013 The Society for Applied Microbiology.
The long-term effects of the Houston Child Advocates, Inc., program on children and family outcomes.
Waxman, Hersh C; Houston, W Robert; Profilet, Susan M; Sanchez, Betsi
2009-01-01
The objective of the study is to investigate the longitudinal effects of the Houston Child Advocates, Inc., program on children's outcomes. The treatment group consisted of children in the court system that were assigned Child Advocates volunteers, and the comparison children were chosen randomly from a similar population of children. The treatment group had significantly higher scores on the protective factor and family functioning measures and received more social services than those in the comparison group. Children in the treatment group also had significantly fewer placement changes and did better academically and behaviorally in school than children in the comparison group.
International Nuclear Information System (INIS)
Mikhaiel, A.A.; Mohamed, H.F.; Mohamed, N.E.
2011-01-01
This study is conducted to determine the impact of unilateral and joint with vitamin C concentrations (0.25 Molar) and gamma rays in artificial diets on some biological aspects of the greater wax moth, Galleria mellonella L. Vitamin C showed the positive impact of combined treatment with the dose rate 100 Gy on the average number of eggs per mated female and on percentage of the eggs hatched through the crosses T male X N female and N male X T female. Larval and Pupal period for both sexes did much affect by either radiation or vitamin C or both together. The average weights of larvae and pupae were significantly increased in the most concentrations when compared with the untreated control group. The highest percentage of survived larvae was 96.30 % from the control at the concentration 0.25 Molar of vitamin C and the lowest percentage was 61.11% from the control at dose rate 300 Gy only. While highest rate of the emergence was found by the treatments of vitamin C only or combined with the dose rate 100 Gy. The percentage of sex ratio was in favor of males at the dose rate 300 Gy only. Vitamin C significantly increased the activity of GOT and GPT enzymes by increasing the dose of gamma radiation in larvae of G. mellonella as compared to the control group
76 FR 16631 - National Heart, Lung, and Blood Institute; Notice of Closed Meetings
2011-03-24
..., and Blood Institute Special Emphasis Panel; Biology of the Artery Wall and Atherosclerosis. Date... Westin BWI, 1110 Old Elkridge Landing Road, Linthicum, MD 21090. Contact Person: Charles Joyce, PhD...
Time of travel of solutes in Buffalo Bayou and selected tributaries, Houston, Texas, August 1999
East, Jeffery W.; Schaer, Jasper D.
2000-01-01
The U.S. Geological Survey (USGS), in cooperation with the U.S. Environmental Protection Agency, conducted a time-of-travel study in the Buffalo Bayou watershed during low flow in August 1999. The study was done as part of the U.S. Environmental Protection Agency Environmental Monitoring for Public Access and Community Tracking (EMPACT) program. The EMPACT program was designed for the U.S. Environmental Protection Agency to work with communities to “make timely, accurate, and understandable environmental information available to millions of people in the largest metropolitan areas across the country.” (U.S. Environmental Protection Agency, 2000). Buffalo Bayou, located in Houston, Texas, was chosen as a pilot project because it is a frequently used recreational water source, it has many water-treatment facilities located along its stream segments, and it has a history of water-quality problems (Houston-Galveston Area Council, 2000). One component of the pilot project is to develop a water-quality simulation model that can be used to assess the effects of noncompliance events on Buffalo Bayou. Because accurate estimates of time of travel during low flow are required to develop the model, the time of travel of solutes in Buffalo Bayou and selected tributaries was determined using dye tracing methods. The study was conducted during low flow in a 38.7-mile reach of Buffalo Bayou, a 9.6-mile reach of Whiteoak Bayou, a 5.9-mile reach of Mason Creek, and a 6.6-mile reach of Bear Creek. Efforts to determine the time of travel in a 7.5-mile reach of Horsepen Creek were unsuccessful. This report explains the approach used to conduct the study and presents the results of the study
Vertyporokh, Lidiia; Taszłow, Paulina; Samorek-Pieróg, Małgorzata; Wojda, Iwona
2015-09-01
We aimed to investigate how exposition of infected insects to short-term heat shock affects the biochemical and molecular aspects of their immune response. Galleria mellonella larvae were exposed to 43°C for 15min, at the seventy second hour after natural infection with entomopathogenic fungus Beauveria bassiana. As a result, both qualitative and quantitative changes in hemolymph protein profiles, and among them infection-induced changes in the amount of apolipophorin III (apoLp-III), were observed. Heat shock differently affects the expression of the tested immune-related genes. It transiently inhibits expression of antifungal peptides gallerimycin and galiomicin in both the fat body and hemocytes of infected larvae. The same, although to a lesser extent, concerned apoLp-III gene expression and was observed directly after heat shock. Nevertheless, in larvae that had recovered from heat shock, apoLp-III expression was higher in comparison to unshocked larvae in the fat body but not in hemocytes, which was consistent with the higher amount of this protein detected in the hemolymph of the infected, shocked larvae. Furthermore, lysozyme-type activity was higher directly after heat shock, while antifungal activity was significantly higher also in larvae that had recovered from heat shock, in comparison to the respective values in their non-shocked, infected counterparts. These results show how changes in the external temperature modulate the immune response of G. mellonella suffering from infection with its natural pathogen B. bassiana. Copyright © 2015 Elsevier Inc. All rights reserved.
76 FR 34719 - Center for Scientific Review; Notice of Closed Meetings
2011-06-14
...: Westin Seattle Hotel, 1900 5th Avenue, Seattle, WA 98101. Contact Person: Jose H Guerrier, PhD...: Center for Scientific Review Special Emphasis Panel, Small Business: Respiratory Sciences. Date: July 14...
Wu, Gongqing; Xu, Li; Yi, Yunhong
2016-06-01
Larvae of Galleria mellonella are useful models for studying the innate immunity of invertebrates or for evaluating the virulence of microbial pathogens. In this work, we demonstrated that prior exposure of G. mellonella larvae to high doses (1×10(4), 1×10(5) or 1×10(6) cells/larva) of heat-killed Photorhabdus luminescens TT01 increases the resistance of larvae to a lethal dose (50 cells/larva) of viable P. luminescens TT01 infection administered 48h later. We also found that the changes in immune protection level were highly correlated to the changes in levels of cellular and humoral immune parameters when priming the larvae with different doses of heat-killed P. luminescens TT01. Priming the larvae with high doses of heat-killed P. luminescens TT01 resulted in significant increases in the hemocytes activities of phagocytosis and encapsulation. High doses of heat-killed P. luminescens TT01 also induced an increase in total hemocyte count and a reduction in bacterial density within the larval hemocoel. Quantitative real-time PCR analysis showed that genes coding for cecropin and gallerimycin and galiomycin increased in expression after priming G. mellonella with heat-killed P. luminescens TT01. All the immune parameters changed in a dose-dependent manner. These results indicate that the insect immune system is capable of sensing the extent of priming agent and mounting a proportionate immune response. Copyright © 2016 European Federation of Immunological Societies. Published by Elsevier B.V. All rights reserved.
Collins, Timothy W; Grineski, Sara E; Chakraborty, Jayajit
2018-02-01
This article outlines a conceptual model and comparatively applies it to results from environmental justice (EJ) studies of flood risk in the Miami, Florida, and Houston, Texas, metropolitan areas. In contrast to most EJ studies of air pollution, which have found that socially-vulnerable groups experience disproportionate risk, distributive EJ studies of flooding reveal inconsistent findings regarding the relationship between social vulnerability and flood exposure. Counterintuitively (from a conventional EJ perspective), some pre-flood EJ studies have found that socially-advantaged people experience the highest residential exposure to flood risks. To integrate those anomalous findings within an EJ perspective, our conceptual model focuses on (1) the differential capacities of social groups to deploy/access protective resources for reducing the threat of loss, even while they reside amid flood-prone environments, and (2) both flood hazards and water-based benefits. Application of this model in Miami reveals that environmental injustices materialize as socially-privileged groups expose themselves to residential flood risks by seeking coastal amenities, as the costs of mitigating risks are conveyed to the broader public; in the process, socially-vulnerable residents are relegated to areas with air pollution and/or inland flood risks, where they experience constrained access to protective resources and coastal amenities. Findings from Houston better align with conventional EJ expectations-with flood zones disproportionately inhabited by socially-vulnerable people-because many coastal lands there are used by petrochemical industries, which produce major residential-environmental disamenities . Results underscore the need to consider protective resources and locational benefits in future empirical research on the EJ implications of flood hazards.
Directory of Open Access Journals (Sweden)
Jennifer K Bender
Full Text Available The larvae of the wax moth, Galleria mellonella, have been used experimentally to host a range of bacterial and fungal pathogens. In this study we evaluated the suitability of G. mellonella as an alternative animal model of Salmonella infection. Using a range of inoculum doses we established that the LD₅₀ of SalmonellaTyphimurium strain NCTC 12023 was 3.6 × 10³ bacteria per larva. Further, a set of isogenic mutant strains depleted of known virulence factors was tested to identify determinants essential for S. Typhimurium pathogenesis. Mutants depleted of one or both of the type III secretion systems encoded by Salmonella Pathogenicity Islands 1 and 2 showed no virulence defect. In contrast, we observed reduced pathogenic potential of a phoQ mutant indicating an important role for the PhoPQ two-component signal transduction system. Lipopolysaccharide (LPS structure was also shown to influence Salmonella virulence in G. mellonella. A waaL(rfaL mutant, which lacks the entire O-antigen (OAg, was virtually avirulent, while a wzz(ST/wzz(fepE double mutant expressing only a very short OAg was highly attenuated for virulence. Furthermore, shortly after infection both LPS mutant strains showed decreased replication when compared to the wild type in a flow cytometry-based competitive index assay. In this study we successfully established a G. mellonella model of S. Typhimurium infection. By identifying PhoQ and LPS OAg length as key determinants of virulence in the wax moth larvae we proved that there is an overlap between this and other animal model systems, thus confirming that the G. mellonella infection model is suitable for assessing aspects of Salmonella virulence function.
Directory of Open Access Journals (Sweden)
Jennifer A Horney
Full Text Available Polycyclic aromatic hydrocarbons (PAHs are complex environmental toxicants. Exposure to them has been linked to adverse health outcomes including cancer, as well as diseases of the skin, liver, and immune system. Based on an ongoing community engagement partnership with stakeholder groups and residents, we conducted a small longitudinal study to assess domestic exposure to PAHs among residents of Manchester, an environmental justice neighborhood located in the East End of Houston, TX.In December, 2016, we used fiber wipes to collect samples of household dust from 25 homes in Manchester. Following Hurricane Harvey, in September 2017, we revisited 24 of the 25 homes to collect soil samples from the front yards of the same homes. Wipes and soil were analyzed for the presence of PAHs using gas chromatography-mass spectrometry (GC-MS methods. Principal component analysis plots, heatmaps, and PAH ratios were used to compare pre- and post-Hurricane Harvey samples.While direct comparison is not possible, we present three methods for comparing PAHs found in pre-hurricane fiber wipes and post-hurricane soil samples. The methods demonstrate that the PAHs found before and after Hurricane Harvey are likely from similar sources and that those sources are most likely to be associated with combustion. We also found evidence of redistribution of PAHs due to extreme flooding associated with Hurricane Harvey.Residents of the Manchester neighborhood of Houston, TX, are exposed to a range of PAHs in household dust and outdoor soil. While it was not possible to compare directly, we were able to use several methods to assess detected concentrations, changes in site-specific PAH allocations, and PAH origination. Additional research is needed to identify specific sources of domestic PAH exposure in these communities and continued work involving community members and policy makers should aim to develop interventions to reduce domestic exposure to and prevent negative
Astvad, Karen Marie Thyssen; Meletiadis, Joseph; Whalley, Sarah
2017-01-01
ABSTRACT The invertebrate model organism Galleria mellonella can be used to assess the efficacy of treatment of fungal infection. The fluconazole dose best mimicking human exposure during licensed dosing is unknown. We validated a bioassay for fluconazole detection in hemolymph and determined the fluconazole pharmacokinetics and pharmacodynamics in larval hemolymph in order to estimate a humanized dose for future experiments. A bioassay using 4-mm agar wells, 20 μl hemolymph, and the hypersusceptible Candida albicans DSY2621 was established and compared to a validated liquid chromatography-tandem mass spectrometry (LC–MS-MS) method. G. mellonella larvae were injected with fluconazole (5, 10, and 20 mg/kg of larval weight), and hemolymph was harvested for 24 h for pharmacokinetics calculations. The exposure was compared to the human exposure during standard licensed dosing. The bioassay had a linear standard curve between 1 and 20 mg/liter. Accuracy and coefficients of variation (percent) values were below 10%. The Spearman coefficient between assays was 0.94. Fluconazole larval pharmacokinetics followed one-compartment linear kinetics, with the 24-h area under the hemolymph concentration-time curve (AUC24 h) being 93, 173, and 406 mg · h/liter for the three doses compared to 400 mg · h/liter in humans under licensed treatment. In conclusion, a bioassay was validated for fluconazole determination in hemolymph. The pharmacokinetics was linear. An exposure comparable to the human exposure during standard licensed dosing was obtained with 20 mg/kg. PMID:28760893
Bawden, Gerald W.; Johnson, Michaela R.; Kasmarek, Mark C.; Brandt, Justin; Middleton, Clifton S.
2012-01-01
Since the early 1900s, groundwater has been the primary source of municipal, industrial, and agricultural water supplies for the Houston-Galveston region, Texas. The region's combination of hydrogeology and nearly century-long use of groundwater has resulted in one of the largest areas of subsidence in the United States; by 1979, as much as 3 meters (m) of subsidence had occurred, and approximately 8,300 square kilometers of land had subsided more than 0.3 m. The U.S. Geological Survey, in cooperation with the Harris-Galveston Subsidence District, used interferometric synthetic aperture radar (InSAR) data obtained for four overlapping scenes from European remote sensing satellites ERS-1 and ERS-2 to analyze land subsidence in the Houston-Galveston region of Texas. The InSAR data were processed into 27 interferograms that delineate and quantify land-subsidence patterns and magnitudes. Contemporaneous data from the Global Positioning System (GPS) were reprocessed by the National Geodetic Survey and analyzed to support, verify, and provide temporal resolution to the InSAR investigation.
Directory of Open Access Journals (Sweden)
Gregory Knell
2018-03-01
Full Text Available Transportation-related physical activity can significantly increase daily total physical activity through active transportation or walking/biking to transit stops. The purpose of this study was to assess the relations between transit-use and self-reported and monitor-based physical activity levels in a predominantly minority population from the Houston Travel-Related Activity in Neighborhoods (TRAIN Study. This was a cross-sectional analysis of 865 adults living in Houston, Texas between 2013 and 2015. The exposure variable was transit-use (non-users, occasional users, and primary users. Self-reported and accelerometer-determined physical activity were the outcomes of interest. Regression models adjusting for age, sex, race/ethnicity, and other covariates of interest were built to test the hypothesis that transit user status was directly associated with 1 minutes of moderate-intensity physical activity and 2 the prevalence of achieving the physical activity guidelines. The majority of participants were female, non-Hispanic black, and almost one-third had a high school education or less. After adjustment, primary transit-use was associated with 134.2 (p<0.01 additional mean minutes per week of self-reported moderate-intensity transportation-related physical activity compared to non-users. Further, primary users had 7.3 (95% CI: 2.6–20.1 times the relative adjusted odds of meeting physical activity recommendations than non-users based on self-reported transportation-related physical activity. There were no statistically significant associations of transit-use with self-reported leisure-time or accelerometer-derived physical activity. Transit-use has the potential for a large public health impact due to its sustainability and scalability. Therefore, encouraging the use of transit as a means to promote physical activity should be examined in future studies. Keywords: Physical activity, Transportation, Commuting, Motor activity, Urban health
Knell, Gregory; Durand, Casey P; Shuval, Kerem; Kohl Iii, Harold W; Salvo, Deborah; Sener, Ipek; Gabriel, Kelley Pettee
2018-03-01
Transportation-related physical activity can significantly increase daily total physical activity through active transportation or walking/biking to transit stops. The purpose of this study was to assess the relations between transit-use and self-reported and monitor-based physical activity levels in a predominantly minority population from the Houston Travel-Related Activity in Neighborhoods (TRAIN) Study. This was a cross-sectional analysis of 865 adults living in Houston, Texas between 2013 and 2015. The exposure variable was transit-use (non-users, occasional users, and primary users). Self-reported and accelerometer-determined physical activity were the outcomes of interest. Regression models adjusting for age, sex, race/ethnicity, and other covariates of interest were built to test the hypothesis that transit user status was directly associated with 1) minutes of moderate-intensity physical activity and 2) the prevalence of achieving the physical activity guidelines. The majority of participants were female, non-Hispanic black, and almost one-third had a high school education or less. After adjustment, primary transit-use was associated with 134.2 ( p < 0.01) additional mean minutes per week of self-reported moderate-intensity transportation-related physical activity compared to non-users. Further, primary users had 7.3 (95% CI: 2.6-20.1) times the relative adjusted odds of meeting physical activity recommendations than non-users based on self-reported transportation-related physical activity. There were no statistically significant associations of transit-use with self-reported leisure-time or accelerometer-derived physical activity. Transit-use has the potential for a large public health impact due to its sustainability and scalability. Therefore, encouraging the use of transit as a means to promote physical activity should be examined in future studies.
76 FR 55722 - U.S. Advisory Commission on Public Diplomacy; Notice of Meeting
2011-09-08
.... on September 15, 2011, in the Loy Henderson conference room of the State Department's Harry S Truman... Texas; Ms. Lezlee Westine of Virginia; and, Mr. Sim Farar of California. Two seats on the Commission are...
Huang, C. J.; Motard, R. L.
1978-01-01
The computing equipment in the engineering systems simulation laboratory of the Houston University Cullen College of Engineering is described and its advantages are summarized. The application of computer techniques in aerospace-related research psychology and in chemical, civil, electrical, industrial, and mechanical engineering is described in abstracts of 84 individual projects and in reprints of published reports. Research supports programs in acoustics, energy technology, systems engineering, and environment management as well as aerospace engineering.
77 FR 32169 - SJI Board of Directors Meeting, Notice
2012-05-31
... meeting is to consider grant applications for the 3rd quarter of FY 2012, and other business. All portions of this meeting are open to the public. ADDRESSES: Westin Hotel, 1900 5th Ave., Seattle, WA 98101...
King, K.A.; Stafford, C.J.; Cain, B.W.; Mueller, A.J.; Hall, H.D.
1987-01-01
Double-crested cormorants (Phalacrocorax auritus ) collected in the Houston Ship Channel, Texas, USA, in November shortly after their fall migration contained residues of several industrial, agricultural, and petroleum contaminants including polychlorinated styrenes (PCS's), polychlorinated biphenyls (PCB's), DDE, and petroleum hydrocarbons. PCS concentrations in over-wintering birds collected in late February were three times higher than those in birds collected in November. PCB and petroleum concentrations remained at about the same level throughout the 3-month winter period. Petroleum hydrocarbons were present in all cormorants and residues in some individuals exceeded 25 ppm (wet weight). Mean DDE residues in samples collected in November and February were less than 1 ppm. Low concentrations of five other organochlorine compounds, not detected in cormorants collected in November, were recovered in birds collected in February.
Atmospheric Methane Enhancements Related with Natural Gas Usage in the Greater Houston Area
Sanchez, N. P.; Zheng, C.; Ye, W.; Czader, B.; Cohan, D. S.; Tittel, F. K.; Griffin, R. J.
2017-12-01
Natural gas (NG) usage as a replacement of oil and coal has increased significantly in the U.S in recent years. Despite the benefits associated with this fuel, leakage from NG distribution systems and in-use uncombusted NG (e.g., compressed natural gas vehicles) can be relevant sources of methane (CH4) emissions in urban centers. Methane, the main constituent of NG, is a potent greenhouse gas impacting the chemistry of the atmosphere, whose emission might outweigh the potential environmental advantages of NG use. Although the Greater Houston area (GHA) is the fifth-largest metropolitan area in the U.S, no studies on the potential impact of NG usage on atmospheric CH4 levels have been published in the scientific literature to date. In this work, a mobile-based study of CH4 and ethane (C2H6) concentration levels in eight residential zones with different expected probability of NG leakage in the GHA was conducted in the summer of 2016. A novel laser-based sensor system for simultaneous detection of CH4 and C2H6 was developed and deployed in a mid-sized vehicle, and monitoring of these gas species was conducted for over 14 days covering 250 road miles. Both linear discriminant and cluster analyses were performed to assess the spatial variability of atmospheric CH4 concentrations in the GHA. These analyses showed clear differences in the CH4 mixing ratios in an inter- and intra-neighborhood level and indicated the presence of high CH4 concentration clusters mainly located in the central and west central parts of the GHA. Source discrimination analyses based on orthogonal regression analysis and a Keeling-like plot method were conducted to establish the predominant origin of CH4 in the identified high concentration clusters and in over 30 CH4 concentration peaks observed during the field campaign. Results of these analyses indicate that thermogenic sources of CH4 (e.g., NG) were predominant in short-duration concentration spikes (lasting less than 10 minutes), while CH4
An application of LOTEM around salt dome near Houston, Texas
Paembonan, Andri Yadi; Arjwech, Rungroj; Davydycheva, Sofia; Smirnov, Maxim; Strack, Kurt M.
2017-07-01
A salt dome is an important large geologic structure for hydrocarbon exploration. It may seal a porous reservoir of rocks that form petroleum reservoirs. Several techniques such as seismic, gravity, and electromagnetic including magnetotelluric have successfully yielded salt dome interpretation. Seismic has difficulties seeing through the salt because the seismic energy gets trapped by the salt due to its high velocity. Gravity and electromagnetics are more ideal methods. Long Offset Transient Electromagnetic (LOTEM) and Focused Source Electromagnetic (FSEM) were tested over a salt dome near Houston, Texas. LOTEM data were recorded at several stations with varying offset, and the FSEM tests were also made at some receiver locations near a suspected salt overhang. The data were processed using KMS's processing software: First, for assurance, including calibration and header checking; then transmitter and receiver data are merged and microseismic data is separated; Finally, data analysis and processing follows. LOTEM processing leads to inversion or in the FSEM case 3D modeling. Various 3D models verify the sensitivity under the salt dome. In addition, the processing was conducted pre-stack, stack, and post-stack. After pre-stacking, the noise was reduced, but showed the ringing effect due to a low-pass filter. Stacking and post-stacking with applying recursive average could reduce the Gibbs effect and produce smooth data.
Directory of Open Access Journals (Sweden)
Schachtner Joachim
2008-12-01
Full Text Available Abstract Background Toxin complex (Tc proteins termed TcaABC, TcdAB, and TccABC with insecticidal activity are present in a variety of bacteria including the yersiniae. Results The tc gene sequences of thirteen Yersinia strains were compared, revealing a high degree of gene order conservation, but also remarkable differences with respect to pseudogenes, sequence variability and gene duplications. Outside the tc pathogenicity island (tc-PAIYe of Y. enterocolitica strain W22703, a pseudogene (tccC2'/3' encoding proteins with homology to TccC and similarity to tyrosine phosphatases at its C-terminus was identified. PCR analysis revealed the presence of the tc-PAIYe and of tccC2'/3'-homologues in all biotype 2–5 strains tested, and their absence in most representatives of biotypes 1A and 1B. Phylogenetic analysis of 39 TccC sequences indicates the presence of the tc-PAIYe in an ancestor of Yersinia. Oral uptake experiments with Manduca sexta revealed a higher larvae lethality of Yersinia strains harbouring the tc-PAIYe in comparison to strains lacking this island. Following subcutaneous infection of Galleria mellonella larvae with five non-human pathogenic Yersinia spp. and four Y. enterocolitica strains, we observed a remarkable variability of their insecticidal activity ranging from 20% (Y. kristensenii to 90% (Y. enterocolitica strain 2594 dead larvae after five days. Strain W22703 and its tcaA deletion mutant did not exhibit a significantly different toxicity towards G. mellonella. These data confirm a role of TcaA upon oral uptake only, and suggest the presence of further insecticidal determinants in Yersinia strains formerly unknown to kill insects. Conclusion This study investigated the tc gene distribution among yersiniae and the phylogenetic relationship between TccC proteins, thus contributing novel aspects to the current discussion about the evolution of insecticidal toxins in the genus Yersinia. The toxic potential of several Yersinia
Mc Namara, Louise; Carolan, James C; Griffin, Christine T; Fitzpatrick, David; Kavanagh, Kevin
2017-07-01
Galleria mellonella is a well-established model species regularly employed in the study of the insect immune response at cellular and humoral levels to investigate fungal pathogenesis and biocontrol agents. A cellular and proteomic analysis of the effect of culture filtrate of three entomopathogenic fungi (EPF) species on the immune system of G. mellonella was performed. Treatment with Beauveria caledonica and Metarhizium anisopliae 96h culture filtrate facilitated a significantly increased yeast cell density in larvae (3-fold and 3.8-fold, respectively). Larvae co-injected with either M. anisopliae or B. caledonica culture filtrate and Candida albicans showed significantly increased mortality. The same was not seen for larvae injected with Beauveria bassiana filtrate. Together these results suggest that B. caledonica and M. anisopliae filtrate are modulating the insect immune system allowing a subsequent pathogen to proliferate. B. caledonica and M. anisopliae culture filtrates impact upon the larval prophenoloxidase (ProPO) cascade (e.g. ProPO activating factor 3 and proPO activating enzyme 3 were increased in abundance relative to controls), while B. bassiana treated larvae displayed higher abundances of alpha-esterase when compared to control larvae (2.4-fold greater) and larvae treated with M. anisopliae and B. caledonica. Treatment with EPF culture filtrate had a significant effect on antimicrobial peptide abundances particularly in M. anisopliae treated larvae where cecropin-D precursor, hemolin and gloverin were differentially abundant in comparison to controls. Differences in proteomic profiles for different treatments may reflect or even partially explain the differences in their immunomodulatory potential. Screening EPF for their ability to modulate the insect immune response represents a means of assessing EPF for use as biocontrol agents, particularly if the goal is to use them in combination with other control agents. Additionally EPF represent a
Directory of Open Access Journals (Sweden)
Wenjuan Wei
2017-12-01
Full Text Available Background/Purpose: Treatment of Acinetobacter baumannii infections is challenging owing to widespread multidrug-resistant A. baumannii (MDR-AB and the lack of novel agents. Although recent data suggest that levofloxacin (LVX may have unique activity against MDR-AB in combination with colistin (CST, further preclinical work is needed. Methods: We used a A. baumannii type strain ATCC19606, a CST-resistant strain AB19606R, and two clinical isolates (GN0624 and GN1115 of MDR-AB to investigate the in vitro and in vivo efficacy of LVXâCST combination. Synergy studies were performed using the microtiter plate chequerboard assay and timeâkill methodology. Inhibitory activity of antibiotics against biofilms and the mutant prevention concentrations were also studied in vitro. A simple invertebrate model (Galleria mellonella has been used to assess the in vivo activity of antimicrobial therapies. Results: The LVXâCST combination was bactericidal against the CST-susceptible clinical isolate (GN0624. In checkerboard assays, synergy (defined as a fractional inhibitory concentration index of < 0.5 was observed between CST and LVX in GN0624. The combination had antibiofilm properties on the preformed biofilms of four tested strains and could prevent the emergence of CST-resistant A. baumanni. Treatment of G. mellonella larvae infected with lethal doses of A. baumannii resulted in significantly enhanced survival rates when LVX was given with CST compared with CST treatment alone (p < 0.05. Conclusion: In summary, a synergistic or additive effect between CST and LVX was observed in vitro and in vivo against CST-susceptible A. baumannii strains, although not against CST-resistant ones. Keywords: Acinetobacter baumannii, antimicrobial synergy, invertebrate model, levofloxacin, polymyxins
International Nuclear Information System (INIS)
Mohamed, H.F.; Mikhaiel, A.A.; Abul-Fadl, H.A.
2006-01-01
Full grown male pupae of the greater wax moth, Galleria mellonella L., were gamma irradiated with 50, 100, 200, 300 and 400 Gy. The resulting F1 larvae were treated at the fourth instar with different concentrations (0, 5, 10, 20, and 40 %) of Bacillus thuringiensis (Bt.) var. kurstaki. Combined effects of the two doses of gamma radiation (50 and 100 Gy) and / or Bt. (LC 50 ) on certain biological aspects in addition to histological effects on larval mid gut were studied. The obtained results indicated that Bt. or irradiation treatments either alone or in combination decreased the number of F1 larvae that reached the adult stage as compared to the control. Also, the reduction in survived individuals was obvious at dose level 400 Gy than 50, 100 and 200 Gy (the lower doses). The larval mortality, percent pupation, percent emergence and adult survival were decreased gradually by increasing the concentration of Bt. especially at the combined treatments. The sex ratio was altered in favour of males at either Bt. and / or irradiation treatments. Certain histological changes through longitudinal sections of the mid gut of F1 larvae due to irradiation and / or Bt. treatments were detected. The damage of tissues was increased by increasing the dose of irradiation and / or concentration of Bt. The cytoplasmic extrusion was appeared as the apical margin of cells as a confluent mass and the muscular layers were broken in some parts, large amount of secretions was released in the lumen of the mid gut while a few amounts were attached to the apical margin of the cells. Much destruction of the mid gut took place when the Bt. treatments were combined with gamma irradiation where large number of epithelial cells became vacuolated and the cytoplasm was appeared as confluent masses because of the hydropic analysis of the epithelium
Yang, Qing; Zhang, Jie; Li, Tianhui; Liu, Shen; Song, Ping; Nangong, Ziyan; Wang, Qinying
2017-09-01
PirAB (Photorhabdus insect-related proteins, PirAB) toxin was initially found in the Photorhabdus luminescens TT01 strain and has been shown to be a binary toxin with high insecticidal activity. Based on GenBank data, this gene was also found in the Xenorhabdus nematophila genome sequence. The predicted amino acid sequence of pirA and pirB in the genome of X. nematophila showed 51% and 50% identity with those gene sequences from P. luminescens. The purpose of this experiment is to identify the relevant information for this toxin gene in X. nematophila. The pirA, pirB and pirAB genes of X. nematophila HB310 were cloned and expressed in Escherichia coli BL21 (DE3) using the pET-28a vector. A PirAB-fusion protein (PirAB-F) was constructed by linking the pirA and pirB genes with the flexible linker (Gly) 4 DNA encoding sequence and then efficiently expressed in E. coli. The hemocoel and oral insecticidal activities of the recombinant proteins were analyzed against the larvae of Galleria mellonella. The results show that PirA/B alone, PirA/B mixture, co-expressed PirAB protein, and PirAB-F all had no oral insecticidal activity against the second-instar larvae of G. mellonella. Only PirA/B mixture and co-expressed PirAB protein had hemocoel insecticidal activity against G. mellonella fifth-instar larvae, with an LD 50 of 2.718μg/larva or 1.566μg/larva, respectively. Therefore, we confirmed that PirAB protein of X. nematophila HB310 is a binary insecticidal toxin. The successful expression and purification of PirAB laid a foundation for further studies on the function, insecticidal mechanism and expression regulation of the binary toxin. Copyright © 2017 Elsevier Inc. All rights reserved.
Kasmarek, Mark C.; Johnson, Michaela R.; Ramage, Jason K.
2013-01-01
Most of the subsidence in the Houston-Galveston region, Texas, has occurred as a direct result of groundwater withdrawals for municipal supply, commercial and industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers, thereby causing compaction mostly in the clay and silt layers of the aquifer sediments. This report, prepared by the U.S. Geological Survey in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District, is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and measured compaction of subsurface sediments in the Chicot and Evangeline aquifers in the Houston-Galveston region. The report contains maps depicting approximate water-level altitudes for 2013 (represented by measurements made during December 2012-February 2013) for the Chicot, Evangeline, and Jasper aquifers; maps depicting 1-year (2012-13) water-level changes for each aquifer; maps depicting 5-year (2008--13) water-level changes for each aquifer; maps depicting long-term (1990-2013 and 1977-2013) water-level changes for the Chicot and Evangeline aquifers; a map depicting long-term (2000-13) water-level changes for the Jasper aquifer; a map depicting locations of borehole-extensometer sites; and graphs depicting measured compaction of subsurface sediments at the extensometers during 1973-2012. Tables listing the data used to construct each water-level map for each aquifer and the compaction graphs are included.
76 FR 20050 - Sunshine Act Meetings
2011-04-11
... LEGAL SERVICES CORPORATION Sunshine Act Meetings Notice DATE AND TIME: The Legal Services... run concurrently after the meeting of the Finance Committee. LOCATION: The Westin Hotel, 6631 Broad.... Promotion & Provision for the Delivery 9 a.m. of Legal Services Committee. 2. Operations & Regulations...
76 FR 46312 - Advisory Committee on Commercial Operations of Customs and Border Protection (COAC)
2011-08-02
... DEPARTMENT OF HOMELAND SECURITY [Docket No. USCBP-2011-0024] Advisory Committee on Commercial... Homeland Security (DHS). ACTION: Committee management; notice of Federal Advisory Committee meeting...-of-business on August 12, 2011. ADDRESSES: The meeting will be held at the Westin Long Beach Hotel...
U.S.-Africa Business Conference Summary
The State Department, in collaboration with several co-sponsors and other US government agencies, hosted the U.S.-Africa Business Conference in Cincinnati, Ohio, June 21-22, at the Westin Cincinnati Hotel. The conference followed the annual African Growth and Opportunity Act (AGO...
Randle, Yvonne H; Freeman, Cheryl Battle; Jackson, Monique; Reyna, Martin; Debboun, Mustapha
2016-01-01
In the 14 years since the emergence of West Nile virus (WNV) in Harris County and the city of Houston, Texas, the number of mosquitoes infected with the virus has fluctuated with several high and low count years. During this 14-year period, mosquito surveillance operational areas in Harris County were expanded from 248 to 268 and the distribution of the virus activity in mosquitoes varied from year to year. Operational areas with WNV infected mosquitoes increased from 137 in 2002 to 197 in 2006, decreased to 71 areas in 2007, and to an all-time low of 18 in 2008. The number increased to 78 areas in 2009, 96 in 2010, 133 in 2011, and 177 in 2012, but fell to 73 in 2013. However, 234 areas were confirmed in 2014, and only 138 in 2015. The WNV transmission was high in 2002 with 227 WNV positive mosquito pools. The number of positive mosquitoes remained elevated for a number of years and then declined from 2007 to 2010. Three record high years for WNV activity were: 2005, 2006, and 2011 with 698, 838, and 605 confirmed positive mosquito pools, respectively. Viral activity declined in 2012, followed by a marked decline in 2013 with only 147 WNV positive mosquito pools. In 2014, a record-breaking number of 1,286 WNV positive mosquito pools were confirmed in Harris County and the city of Houston, the most ever in a single season, while 406 were confirmed in 2015.
Directory of Open Access Journals (Sweden)
Patrícia S. Sousa
2018-04-01
Full Text Available Legionella pneumophila is a ubiquitous bacterium in freshwater environments and in many man-made water systems capable of inducing pneumonia in humans. Despite its ubiquitous character most studies on L. pneumophila virulence focused on clinical strains and isolates from man-made environments, so little is known about the nature and extent of virulence variation in strains isolated from natural environments. It has been established that clinical isolates are less diverse than man-made and natural environmental strains, suggesting that only a subset of environmental isolates is specially adapted to infect humans. In this work we intended to determine if unrelated L. pneumophila strains, isolated from different environments and with distinct virulence-related genetic backgrounds, displayed differences in virulence, using the Wax Moth Galleria mellonella infection model. We found that all tested strains were pathogenic in G. mellonella, regardless of their origin. Indeed, a panoply of virulence-related phenotypes was observed sustaining the existence of significant differences on the ability of L. pneumophila strains to induce disease. Taken together our results suggest that the occurrence of human infection is not related with the increased capability of some strains to induce disease since we also found a concentration threshold above which L. pneumophila strains are equally able to cause disease. In addition, no link could be established between the sequence-type (ST and L. pneumophila pathogenicity. We envision that in man-made water distribution systems environmental filtering selection and biotic competition acts structuring L. pneumophila populations by selecting more resilient and adapted strains that can rise to high concentration if no control measures are implemented. Therefore, public health strategies based on the sequence based typing (STB scheme analysis should take into account that the major disease-associated clones of L
Kasmarek, Mark C.; Johnson, Michaela R.; Ramage, Jason K.
2014-01-01
Most of the land-surface subsidence in the Houston-Galveston region, Texas, has occurred as a direct result of groundwater withdrawals for municipal supply, commercial and industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers, thereby causing compaction of the aquifer sediments, mostly in the fine-grained clay and silt layers. This report, prepared by the U.S. Geological Survey in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District, is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and measured compaction of subsurface sediments in the Chicot and Evangeline aquifers in the Houston-Galveston region. The report contains maps depicting approximate 2014 water-level altitudes (represented by measurements made during December 2013–March 2014) for the Chicot, Evangeline, and Jasper aquifers; maps depicting 1-year (2013–14) water-level changes for each aquifer; maps depicting contoured 5-year (2009–14) water-level changes for each aquifer; maps depicting contoured long-term (1990–2014 and 1977–2014) water-level changes for the Chicot and Evangeline aquifers; a map depicting contoured long-term (2000–14) water-level changes for the Jasper aquifer; a map depicting locations of borehole-extensometer sites; and graphs depicting measured cumulative compaction of subsurface sediments at the borehole extensometers during 1973–2013. Tables listing the data used to construct each water-level map for each aquifer and the compaction graphs are included.
Directory of Open Access Journals (Sweden)
Elbehery Huda
2016-12-01
Full Text Available Different concentrations of Neem Azal-T/S were used in an artificial diet, to study the mortality of the greater wax moth Galleria mellonella. A Neem formulation and different ages of natural beeswax combs were used for the effective management of the wax moth. While the diet was being prepared, Neem Azal-T/S was directly added ensure that the Neem formulation was distributed evenly in the diet at concentrations of 0.25, 0.5, 1, 2, and 4%. The obtained results showed that the different concentrations of Neem Azal-T/S mixed in the prepared artificial diet had a significant efficacy against the tested 2nd instar larvae. An outstanding elongation of the 2nd larval instar was clear in comparison with the control, even at the least tested concentration (0.25%. Neem Azal-T/S at 4, 2,1, and 0.5% caused 100% mortality for all tested larvae. When using a 4% concentration, all the tested larvae died in the 2nd instar. However, when using a 2% concentration, the larvae died in the fifth instar. When using a decreased concentration of 1.0 and 0.5%, some of the larvae were tolerant and lived till the 6th instar. Feeding the larvae on beeswax combs treated with 2% Neem Azal-T/S, caused 100% mortality when fed on very old wax. When the diet was old wax treated with 2% Neem Azal-T/S, a 91% mortality was recorded. When the diet was new wax treated with 2% Neem Azal-T/S, a 90% mortality was recorded. A 4% Neem formulation caused mortality for all larvae during the first week of treatment on the different tested ages of beeswax combs.
Reports on the 2013 AAAI fall symposium series
Burns, Gully A P C; Gil, Yolanda; Villanueva-Rosales, Natalia; Liu, Yan; Risi, Sebastian; Lehman, Joel; Clune, Jeff; Lebiere, Christian; Rosenbloom, Paul S.; Van Harmelen, Frank; Hendler, James A.; Hitzler, Pascal; Janowicz, Krzysztof; Swarup, Samarth
2014-01-01
The Association for the Advancement of Artificial Intelligence was pleased to present the 2013 Fall Symposium Series, held Friday through Sunday, November 15-17, at the Westin Arlington Gateway in Arlington, Virginia, near Washington, D.C., USA. The titles of the five symposia were Discovery
76 FR 30723 - Breast and Cervical Cancer Early Detection and Control Advisory Committee (BCCEDCAC)
2011-05-26
... 16, 2011. 9 a.m.-12:30 p.m., June 17, 2011. Place: Westin Atlanta Perimeter North, 7 Concourse... program goals and objectives; implementation strategies; and program, priorities including surveillance... Cervical Cancer Early Detection Program Marketing Tool kit for increased awareness for the state programs...
International Nuclear Information System (INIS)
Konopacki, S.; Akbari, H.
2002-01-01
In 1997, the U.S. Environmental Protection Agency (EPA) established the ''Heat Island Reduction Initiative'' to quantify the potential benefits of Heat-Island Reduction (HIR) strategies (i.e., shade trees, reflective roofs, reflective pavements and urban vegetation) to reduce cooling-energy use in buildings, lower the ambient air temperature and improve urban air quality in cities, and reduce CO2 emissions from power plants. Under this initiative, the Urban Heat Island Pilot Project (UHIPP) was created with the objective of investigating the potential of HIR strategies in residential and commercial buildings in three initial UHIPP cities: Baton Rouge, LA; Sacramento, CA; and Salt Lake City, UT. Later two other cities, Chicago, IL and Houston, TX were added to the UHIPP. In an earlier report we summarized our efforts to calculate the annual energy savings, peak power avoidance, and annual CO2 reduction obtainable from the introduction of HIR strategies in the initial three cities. This report summarizes the results of our study for Chicago and Houston. In this analysis, we focused on three building types that offer the highest potential savings: single-family residence, office and retail store. Each building type was characterized in detail by vintage and system type (i.e., old and new building constructions, and gas and electric heat). We used the prototypical building characteristics developed earlier for each building type and simulated the impact of HIR strategies on building cooling- and heating-energy use and peak power demand using the DOE-2.1E model. Our simulations included the impact of (1) strategically-placed shade trees near buildings[direct effect], (2) use of high-albedo roofing material on the building[direct effect], (3) urban reforestation with high-albedo pavements and building surfaces[indirect effect] and (4) combined strategies 1, 2, and 3[direct and indirect effects]. We then estimated the total roof area of air-conditioned buildings in each
A contribution to the development of an economic atlas of the Houston Area Test Site
1972-01-01
An outine description of the Houston Area Test Site was prepared, in the form of an atlas-catalog of Universal Transverse Mercator grid coordinate locations, building on the manufacturing sector and expanding along agreed lines as far as possible. It was concluded that (1) the effort expended in securing and verifying the locations of larger manufacturing plants yielded 5,000-plus usable entries, in addition to certain valuable conclusions about the general feasibility of obtaining ground information by economic sector; (2) on the basis of the number and the quality of the usable entries obtained, the resources expended on nonmanufacturing sectors and on historical data cannot be wholly justified; and (3) even without the 5,000-odd locations of completely satisfactory quality, the relatively modest cost of this pilot study secured enough data to provide a sound basis for obtaining feasibly and systematically some appropriate ground information on almost any economic or social activity, together with some indication of their relative areal and economic significance.
International Nuclear Information System (INIS)
EL-KHOLY, E.M.S.; EL-NAGGAR, S.E.M.; ABD EL-AZIZ, N.M.
2008-01-01
The present study was carried out on the full grown male pupae of the greater wax moth, Galleria mellonella L., when irradiated with 100, 150, 300 and 400 Gray of gamma radiation. Two groups of newly moulted 4 th instar larvae were set up, each group consisted of 50 larvae. The first group was exposed in the pupal stage to 100 Gy and the second with 150 Gy then the larval haemolymph was collected. Also, a control group of 50 larvae (non-irradiated) was investigated. The morphological changes in the irradiated blood cells, as compared to the control, were examined using the transmission electron microscopy (TEM). Vacuolization of cytoplasm, disorganization and swelling of mitochondria were appeared. The biological effects of gamma irradiation of the parental male pupae on the reproduction of adult moths when treated males were mated with normal females (male line) and when normal males were mated with treated females (female line) were studied. The latent biological effects of four gamma doses (100, 150, 300 and 400 Gy) on the F1 generation showed that the average number of eggs per mated female, the percentage of egg hatch and the percent of mating were gradually reduced when the given gamma dose to male parents was increased at all treatments (male and female lines). The reduction in the fecundity and the percentage of egg hatch among female line pairings (females descendant of irradiated parental male pupae) was reduced than that among male line pairings (males descendant of irradiated parental male pupae) with increasing the gamma dose
2009 Integrated Biorefinery Platform Review Report
Energy Technology Data Exchange (ETDEWEB)
Ferrell, John [Office of Energy Efficiency and Renewable Energy (EERE), Washington, DC (United States)
2009-12-01
This document summarizes the recommendations and evaluations provided by an independent external panel of experts at the U.S. Department of Energy Biomass Program‘s Integrated Biorefinery (IBR) platform review meeting, held on February 18–19, 2009, at the Westin National Harbor, National Harbor, Maryland.
Magnetic Nanoparticles as Mechanical Actuators of Inner Ear Hair Cells
2016-01-13
Nanoparticles: A Precision Tool for Cell Imaging and Activations”, Seminar, 5th Frontier Scientist Workshop, KAST , Hotel Novotel London West, London, UK, Oct...of Science and Technology ( KAST ), Westin Chosun Hotel, Seoul, Korea, Nov. 2nd, 2012. “Rational Design of Nanoparticles for Biomedical and Energy
Energy Technology Data Exchange (ETDEWEB)
Taylor, Paige A., E-mail: pataylor@mdanderson.org; Kry, Stephen F.; Alvarez, Paola; Keith, Tyler; Lujano, Carrie; Hernandez, Nadia; Followill, David S.
2016-05-01
Purpose: The purpose of this study was to summarize the findings of anthropomorphic proton phantom irradiations analyzed by the Imaging and Radiation Oncology Core Houston QA Center (IROC Houston). Methods and Materials: A total of 103 phantoms were irradiated by proton therapy centers participating in clinical trials. The anthropomorphic phantoms simulated heterogeneous anatomy of a head, liver, lung, prostate, and spine. Treatment plans included those for scattered, uniform scanning, and pencil beam scanning beam delivery modalities using 5 different treatment planning systems. For every phantom irradiation, point doses and planar doses were measured using thermoluminescent dosimeters (TLD) and film, respectively. Differences between measured and planned doses were studied as a function of phantom, beam delivery modality, motion, repeat attempt, treatment planning system, and date of irradiation. Results: The phantom pass rate (overall, 79%) was high for simple phantoms and lower for phantoms that introduced higher levels of difficulty, such as motion, multiple targets, or increased heterogeneity. All treatment planning systems overestimated dose to the target, compared to TLD measurements. Errors in range calculation resulted in several failed phantoms. There was no correlation between treatment planning system and pass rate. The pass rates for each individual phantom are not improving over time, but when individual institutions received feedback about failed phantom irradiations, pass rates did improve. Conclusions: The proton phantom pass rates are not as high as desired and emphasize potential deficiencies in proton therapy planning and/or delivery. There are many areas for improvement with the proton phantom irradiations, such as treatment planning system dose agreement, range calculations, accounting for motion, and irradiation of multiple targets.
The melding of drug markets in Houston after Katrina: dealer and user perspectives.
Kotarba, Joseph A; Fackler, Jennifer; Johnson, Bruce D; Dunlap, Eloise
2010-07-01
In the aftermath of Hurricane Katrina, the majority of routine activities in New Orleans were disrupted, including the illegal drug market. The large-scale relocation of New Orleans evacuees (NOEs), including many illegal drug users and sellers, to host cities led to a need for new sources of illegal drugs. This need was quickly satisfied by two initially distinct drug markets (1) drug dealers from New Orleans who were themselves evacuees and (2) established drug dealers in the host cities. To be expected, the two markets did not operate indefinitely in parallel fashion. This paper describes the evolving, operational relationship between these two drug markets over time, with a focus on Houston. We analyze the reciprocal evolution of these two markets at two significant points in time: at the beginning of the relocation (2005) and two years later (2007). The overall trend is towards a melding of the two drug markets, as evidenced primarily by decreases in drug-related violence and the cross-fertilization of drug tastes. We describe the process by which the two drug markets are melded over time, in order to seek a better understanding of the social processes by which drug markets in general evolve.
Learning from Katrina: environmental health observations from the SWCPHP response team in Houston.
Elledge, Brenda L; Boatright, Daniel T; Woodson, Paul; Clinkenbeard, Rodney E; Brand, Michael W
2007-09-01
Hurricane Katrina provided an opportunity to observe the public health and medical care response system in practice and provided vital lessons about identifying and learning critical response measures as well as about ineffective investments of time and effort. The Southwest Center for Public Health Preparedness (SWCPHP) response team, while working among evacuees housed at Reliant Park in Houston, Texas, made a number of observations related to environmental public health. This summary reports firsthand observations which are, to a great extent, supported by the Federal Response to Hurricane Katrina: Lessons Learned report, and it provides a contextual backdrop for improvement in the areas of volunteer and citizen preparedness training and education. Katrina provided an opportunity to see public health in a highly stressed practice setting and to identify and reinforce the fundamental tenets of public health with which all individuals responding to an event should be familiar. Knowledge gained from Katrina should be integrated into future efforts related to disaster response planning; specifically, it is imperative that volunteers receive standardized training in the areas of incident command systems (ICS), basic hygiene, transmission of disease, and food and water safety principles.
Rapid assessment of household needs in the Houston area after Tropical Storm Allison.
Waring, Stephen C; Reynolds, Kaye M; D'Souza, Gypsyamber; Arafat, Raouf R
2002-09-01
Tropical Storm Allison, which hit landfall near Galveston, Texas, on June 5, 2001, caused the most severe flood-related damage ever recorded in the Houston metropolitan area. The main goal of the public health response to tropical storm Allison was to evaluate the immediate health needs of the community. To estimate damage and household needs, we conducted a rapid needs assessment in the areas most affected by flooding with use of a modified cluster sampling method facilitated by Geographical Information Systems methodology. A total of 420 households participated in the survey, 210 each from the 2 sampling areas. We found a 4-fold increase in illness among persons living in flooded homes compared with those living in nonflooded homes. These findings suggest a need for rapid resolution of flood-related damage and the possibility that residents should seek temporary housing during clean-up and repair. In addition, we obtained reliable estimates of damage and household needs to help guide relief efforts. The findings underscore the usefulness of a rapid-needs assessment as a tool to identify actual health threats and to facilitate delivery of resources to those with the greatest and most immediate need.
Clinic access and teenage birth rates: Racial/ethnic and spatial disparities in Houston, TX.
Wisniewski, Megan M; O'Connell, Heather A
2018-03-01
Teenage motherhood is a pressing issue in the United States, and one that is disproportionately affecting racial/ethnic minorities. In this research, we examine the relationship between the distance to the nearest reproductive health clinic and teenage birth rates across all zip codes in Houston, Texas. Our primary data come from the Texas Department of State Health Services. We use spatial regression analysis techniques to examine the link between clinic proximity and local teenage birth rates for all females aged 15 to 19, and separately by maternal race/ethnicity. We find, overall, limited support for a connection between clinic distance and local teenage birth rates. However, clinics seem to matter most for explaining non-Hispanic white teenage birth rates, particularly in high-poverty zip codes. The racial/ethnic and economic variation in the importance of clinic distance suggests tailoring clinic outreach to more effectively serve a wider range of teenage populations. We argue social accessibility should be considered in addition to geographic accessibility in order for clinics to help prevent teenage pregnancy. Copyright © 2018. Published by Elsevier Ltd.
Sanchez, Nancy P.; Zheng, Chuantao; Ye, Weilin; Czader, Beata; Cohan, Daniel S.; Tittel, Frank K.; Griffin, Robert J.
2018-03-01
The extensive use of natural gas (NG) in urban areas for heating and cooking and as a vehicular fuel is associated with potentially significant emissions of methane (CH4) to the atmosphere. Methane, a potent greenhouse gas that influences the chemistry of the atmosphere, can be emitted from different sources including leakage from NG infrastructure, transportation activities, end-use uncombusted NG, landfills and livestock. Although significant CH4 leakage associated with aging local NG distribution systems in the U.S. has been reported, further investigation is required to study the role of this infrastructure component and other NG-related sources in atmospheric CH4 enhancements in urban centers. In this study, neighborhood-scale mobile-based monitoring of potential CH4 emissions associated with NG in the Greater Houston area (GHA) is reported. A novel dual-gas 3.337 μm interband cascade laser-based sensor system was developed and mobile-mode deployed for simultaneous CH4 and ethane (C2H6) monitoring during a period of over 14 days, corresponding to ∼ 90 h of effective data collection during summer 2016. The sampling campaign covered ∼250 exclusive road miles and was primarily concentrated on eight residential zones with distinct infrastructure age and NG usage levels. A moderate number of elevated CH4 concentration events (37 episodes) with mixing ratios not exceeding 3.60 ppmv and associated with atmospheric background enhancements below 1.21 ppmv were observed during the field campaign. Source discrimination analyses based on the covariance between CH4 and C2H6 levels indicated the predominance of thermogenic sources (e.g., NG) in the elevated CH4 concentration episodes. The volumetric fraction of C2H6 in the sources associated with the thermogenic CH4 spikes varied between 2.7 and 5.9%, concurring with the C2H6 content in NG distributed in the GHA. Isolated CH4 peak events with significantly higher C2H6 enhancements (∼11%) were observed at industrial
Directory of Open Access Journals (Sweden)
E. C. Wood
2010-09-01
Full Text Available Many recent models underpredict secondary organic aerosol (SOA particulate matter (PM concentrations in polluted regions, indicating serious deficiencies in the models' chemical mechanisms and/or missing SOA precursors. Since tropospheric photochemical ozone production is much better understood, we investigate the correlation of odd-oxygen ([Ox]≡[O3]+[NO2] and the oxygenated component of organic aerosol (OOA, which is interpreted as a surrogate for SOA. OOA and Ox measured in Mexico City in 2006 and Houston in 2000 were well correlated in air masses where both species were formed on similar timescales (less than 8 h and not well correlated when their formation timescales or location differed greatly. When correlated, the ratio of these two species ranged from 30 μg m−3/ppm (STP in Houston during time periods affected by large petrochemical plant emissions to as high as 160 μg m−3/ppm in Mexico City, where typical values were near 120 μg m−3/ppm. On several days in Mexico City, the [OOA]/[Ox] ratio decreased by a factor of ~2 between 08:00 and 13:00 local time. This decrease is only partially attributable to evaporation of the least oxidized and most volatile components of OOA; differences in the diurnal emission trends and timescales for photochemical processing of SOA precursors compared to ozone precursors also likely contribute to the observed decrease. The extent of OOA oxidation increased with photochemical aging. Calculations of the ratio of the SOA formation rate to the Ox production rate using ambient VOC measurements and traditional laboratory SOA yields are lower than the observed [OOA]/[Ox] ratios by factors of 5 to 15, consistent with several other models' underestimates of SOA. Calculations of this ratio using emission factors for organic compounds from gasoline and diesel exhaust do not reproduce the observed
Kasmarek, Mark C.; Ramage, Jason K.; Houston, Natalie A.; Johnson, Michaela R.; Schmidt, Tiffany S.
2015-01-01
Most of the land-surface subsidence in the Houston-Galveston region, Texas, has occurred as a direct result of groundwater withdrawals for municipal supply, commercial and industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers, thereby causing compaction of the aquifer sediments, mostly in the fine-grained silt and clay layers. This report, prepared by the U.S. Geological Survey in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District, is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and measured cumulative compaction of subsurface sediments in the Chicot and Evangeline aquifers in the Houston-Galveston region. The report contains regional-scale maps depicting approximate 2015 water-level altitudes (represented by measurements made during December 2014–March 2015) for the Chicot, Evangeline, and Jasper aquifers; maps depicting 1-year (2014–15) water-level changes for each aquifer; maps depicting approximate contoured 5-year (2010–15) water-level changes for each aquifer; maps depicting approximate contoured long-term (1990–2015 and 1977–2015) water-level changes for the Chicot and Evangeline aquifers; a map depicting approximate contoured long-term (2000–15) water-level changes for the Jasper aquifer; a map depicting locations of borehole-extensometer sites; and graphs depicting measured cumulative compaction of subsurface sediments at the borehole extensometers during 1973–2014. Three tables listing the water-level data used to construct each water-level map for each aquifer and a table listing the measured cumulative compaction data for each extensometer site and graphs are included.
Energy Technology Data Exchange (ETDEWEB)
Konopacki, S.; Akbari, H.
2002-02-28
In 1997, the U.S. Environmental Protection Agency (EPA) established the ''Heat Island Reduction Initiative'' to quantify the potential benefits of Heat-Island Reduction (HIR) strategies (i.e., shade trees, reflective roofs, reflective pavements and urban vegetation) to reduce cooling-energy use in buildings, lower the ambient air temperature and improve urban air quality in cities, and reduce CO2 emissions from power plants. Under this initiative, the Urban Heat Island Pilot Project (UHIPP) was created with the objective of investigating the potential of HIR strategies in residential and commercial buildings in three initial UHIPP cities: Baton Rouge, LA; Sacramento, CA; and Salt Lake City, UT. Later two other cities, Chicago, IL and Houston, TX were added to the UHIPP. In an earlier report we summarized our efforts to calculate the annual energy savings, peak power avoidance, and annual CO2 reduction obtainable from the introduction of HIR strategies in the initial three cities. This report summarizes the results of our study for Chicago and Houston. In this analysis, we focused on three building types that offer the highest potential savings: single-family residence, office and retail store. Each building type was characterized in detail by vintage and system type (i.e., old and new building constructions, and gas and electric heat). We used the prototypical building characteristics developed earlier for each building type and simulated the impact of HIR strategies on building cooling- and heating-energy use and peak power demand using the DOE-2.1E model. Our simulations included the impact of (1) strategically-placed shade trees near buildings [direct effect], (2) use of high-albedo roofing material on the building [direct effect], (3) urban reforestation with high-albedo pavements and building surfaces [indirect effect] and (4) combined strategies 1, 2, and 3 [direct and indirect effects]. We then estimated the total roof area of air
76 FR 17712 - Sunshine Act; Notice Of Agency Meeting
2011-03-30
... NATIONAL CREDIT UNION ADMINISTRATION Sunshine Act; Notice Of Agency Meeting TIME AND DATE: 9:30 a.m., Monday, April 4, 2011. PLACE: Westin San Diego Hotel, Board Room, 3rd Floor, 400 West Broadway, San Diego, CA 92101. STATUS: Closed. MATTERS TO BE CONSIDERED: 1. Consideration of Supervisory...
78 FR 78819 - National Conference on Weights and Measures 99th Interim Meeting
2013-12-27
... specifications would require that measuring devices used in retail applications to fill motor vehicles have a... to 17, 2014, at the Westin Book Cadillac Detroit, 1114 Washington Boulevard, Detroit, MI 48226. Some... specifications, tolerances, and other requirements for devices used in the retail sales of engine fuels and the...
Rashid, Jamila R; Leath, Brenda A; Truman, Benedict I; Atkinson, Donna Durant; Gary, Lisa C; Manian, Nanmathi
In the United States, racial/ethnic minorities account for disproportionate disease and death from type 2 diabetes, hypertension, and obesity; however, interventions with measured efficacy in comparative effectiveness research are often not adopted or used widely in those communities. To assess implementation and effects of comparative effectiveness research-proven interventions translated for minority communities. Mixed-method assessment with pretest-posttest single-group evaluation design. US Department of Health and Human Services, Office of Minority Health, research contractor, and advisory board; health centers, including a federally qualified community health center in Chicago, Illinois; and public housing facilities for seniors in Houston, Texas. A total of 97 black, Hispanic, and Asian participants with any combination of health care provider-diagnosed type 2 diabetes, hypertension, or obesity. Virtual training institutes where intervention staff learned cultural competency methods of adapting effective interventions. Health educators delivered the Health Empowerment Lifestyle Program (HELP) in Chicago; community pharmacists delivered the MyRx Medication Adherence Program in Houston. Participation rates, satisfaction with interventions during January to April 2013, and pre- to postintervention changes in knowledge, diet, and clinical outcomes were analyzed through July 2013. In Chicago, 38 patients experienced statistically significant reductions in hemoglobin A1c and systolic blood pressure, increased knowledge of hypertension management, and improved dietary behaviors. In Houston, 38 subsidized housing residents had statistically nonsignificant improvements in knowledge of self-management and adherence to medication for diabetes and hypertension but high levels of participation in pharmacist home visits and group education classes. Adaptation, adoption, and implementation of HELP and MyRx demonstrated important postintervention changes among racial
Johnson, Michaela R.; Ellis, Robert H.H.
2013-01-01
The U.S. Geological Survey (USGS) in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District has produced a series of annual reports depicting groundwater-level altitudes in the Chicot, Evangeline, and Jasper aquifers of the Gulf Coast aquifer system in the Houston-Galveston region, Texas. To produce these annual reports, contours of equal water-level altitudes are created from water levels measured between December and March of each year from groundwater wells screened completely within one of these three aquifers. Information obtained from maps published in the annual series of USGS reports and geospatial datasets of water-level altitude contours used to create the annual series of USGS reports were compiled into a comprehensive geodatabase. The geospatial compilation contains 88 datasets from previously published contour maps showing water-level altitudes for each primary aquifer of the Gulf Coast aquifer system, 37 for the Chicot (1977–2013), 37 for the Evangeline aquifer (1977–2013), and 14 for the Jasper aquifer (2000–13).
Environmental literacy of Hispanic, urban, middle school students in Houston, Texas
Meuth, Amber M.
With the global crises facing the planet that bring major implications, (Hart & Nolan, 1999; Hungerford & Simmons, 2003) it is imperative that there be an environmentally literate citizenry who can identify, solve, and prevent environmental issues. Since middle school students are evolving into participating citizens and are developing the ability to think in abstract terms, they are a critical group to study regarding levels of environmental literacy. Additionally, with the increased resource needs and decreased air and water quality in highly populated urban areas, focusing on the environmental literacy of students living and attending school in urban areas is essential. The purpose of this study was to describe the levels of environmental literacy of a group of Hispanic, urban, middle school students in Houston, Texas. Sixth, seventh, and eighth grade students who attend a charter school in Houston, Texas were given, the Middle School Environmental Literacy Survey (MSELS). This survey has been developed to measure components of environmental literacy as related to domains identified critical to environmental literacy (McBeth et al., 2008). The four domains include ecological knowledge, environmental affect, cognitive skills, and behavior. Data collected from the survey was used to determine levels of environmental literacy in the following variables: ecological knowledge, verbal commitment, actual commitment, environmental sensitivity, general environmental feelings, and environmental issue and action skills. Descriptive statistics were calculated and analyzed for each grade level and as an entire sample for each variable in order to generate a profile of the group. Composite scores were calculated in the four domains (ecological knowledge, environmental affect, cognitive skills, and behavior) and were compared to high, moderate, and low levels of environmental literacy set forth by top environmental education researchers (McBeth et al., 2008). Additionally, two
Effects of cold fronts on ozone in the Houston-Galveston-Brazoria Area
Lei, R.; Talbot, R. W.; Wang, Y.; Wang, S. C.; Estes, M. J.
2017-12-01
A cold front may have confounding effects on ozone by bringing in contaminated air masses to an area and causing lower temperatures which likely lead to low ozone production rates. Literature reports on individual cold front events showing increasing and decreasing effects on ozone. The Houston-Galveston-Brazoria (HGB) area as the energy capital of USA suffers relatively high ozone levels. The effect of cold fronts on HGB ozone in the long-term range remains unknown. Weather Prediction Center (WPC) Surface Analysis Archive from National Oceanic and Atmospheric Administration (NOAA) which records cold fronts' positions since 2003 has been employed in this study. The results show the count of cold fronts passing the HGB area shows no clear trend but great interannual variation. Cold front appearance in summer is much less than in other seasons. In general, both mean MDA8 and background ozone during cold front days increased compared non-cold front days. This increasing effect has been enhanced during post-front days and summer season. Cluster analysis on meteorological parameters shows cold front days with high precipitation or wind speed could lower the MDA8 and background ozone but the proportion of those days are low in all cold front days. It may explain why cold fronts show increasing effects on ozone in the HGB area.
International Nuclear Information System (INIS)
Liu, Suyang; Zhang, Kai
2015-01-01
Fine particulate matter (less than 2.5 μm in aerodynamic diameter; PM_2_._5) pollution poses a major environmental threat in Greater Houston due to rapid economic growth and the numerous PM_2_._5 sources including ports, vehicles, and the largest petrochemical industry in the United States (U.S.). Our objectives were to estimate the short-term associations between the PM_2_._5 components and mortality during 2000–2011, and evaluate whether these associations have changed over time. A total of 333,317 deaths were included in our assessment, with an average of 76 deaths per day. We selected 17 PM_2_._5 components from the U.S. Environmental Protection Agency's Chemical Speciation Network, and then applied Poisson regression models to assess the associations between the PM_2_._5 components and mortality. Additionally, we repeated our analysis for two consecutive periods: 2000–2005 and 2006–2011. Interquartile range increases in ammonium (0.881 μg/m"3), nitrate (0.487 μg/m"3), sulfate (2.245 μg/m"3), and vanadium (0.004 μg/m"3) were associated with an increased risk in mortality of 0.69% (95% confidence interval (CI): 0.26, 1.12%), 0.38% (95% CI: 0.11, 0.66%), 0.61% (95% CI: 0.15, 1.06%), and 0.58% (95% CI: 0.12, 1.04%), respectively. Seasonal analysis suggested that the associations were strongest during the winter months. The association between PM_2_._5 mass and mortality decreased during 2000–2011, however, the PM_2_._5 components showed no notable changes in mortality risk over time. Our study indicates that the short-term associations between PM_2_._5 and mortality differ across the PM_2_._5 components and suggests that future air pollution control measures should not only focus on mass but also pollutant sources. - Highlights: • PM_2_._5 concentrations were associated with increased mortality risk. • A few major PM_2_._5 components were associated with increased mortality risk. • Associations were generally strongest in winter in Greater
Directory of Open Access Journals (Sweden)
Amalia Muñoz-Gómez
Full Text Available Galleria mellonella has emerged as a potential invertebrate model for scrutinizing innate immunity. Larvae are easy to handle in host-pathogen assays. We undertook proteomics research in order to understand immune response in a heterologous host when challenged with microconidia of Fusarium oxysporum. The aim of this study was to investigate hemolymph proteins that were differentially expressed between control and immunized larvae sets, tested with F. oxysporum at two temperatures. The iTRAQ approach allowed us to observe the effects of immune challenges in a lucid and robust manner, identifying more than 50 proteins, 17 of them probably involved in the immune response. Changes in protein expression were statistically significant, especially when temperature was increased because this was notoriously affected by F. oxysporum 104 or 106 microconidia/mL. Some proteins were up-regulated upon immune fungal microconidia challenge when temperature changed from 25 to 37°C. After analysis of identified proteins by bioinformatics and meta-analysis, results revealed that they were involved in transport, immune response, storage, oxide-reduction and catabolism: 20 from G. mellonella, 20 from the Lepidoptera species and 19 spread across bacteria, protista, fungi and animal species. Among these, 13 proteins and 2 peptides were examined for their immune expression, and the hypothetical 3D structures of 2 well-known proteins, unannotated for G. mellonella, i.e., actin and CREBP, were resolved using peptides matched with Bombyx mori and Danaus plexippus, respectively. The main conclusion in this study was that iTRAQ tool constitutes a consistent method to detect proteins associated with the innate immune system of G. mellonella in response to infection caused by F. oxysporum. In addition, iTRAQ was a reliable quantitative proteomic approach to detect and quantify the expression levels of immune system proteins and peptides, in particular, it was found that 104
Johnson, Michaela R.; Linard, Joshua I.
2014-01-01
The U.S. Geological Survey (USGS) in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District has produced an annual series of reports that depict water-level changes in the Chicot, Evangeline, and Jasper aquifers of the Gulf Coast aquifer system in the Houston-Galveston region, Texas, from 1977 to 2013. Changes are determined from water-level measurements between December and March of each year from groundwater wells screened in one of the three aquifers. Existing published maps and unpublished geographic information system (GIS) datasets were compiled into a comprehensive geodatabase of all water-level-change maps produced as part of this multiagency effort. Annual water-level-change maps were georeferenced and digitized where existing GIS data were unavailable (1979–99). Existing GIS data available for 2000–13 were included in the geodatabase. The compilation contains 121 datasets showing water-level changes for each primary aquifer of the Gulf Coast aquifer system: 56 for the Chicot aquifer (1977; 1979–2013 and 1990; 1993–2013), 56 for the Evangeline aquifer (1977; 1979–2013 and 1990; 1993–2013), and 9 for the Jasper aquifer (2000; 2005–13).
2011-03-10
... from 8:30 a.m. to 4 p.m. (Eastern Time). ADDRESSES: The face-to-face meeting will be held at the Westin...: In general, individuals or groups requesting an oral presentation at a public face-to-face meeting... contact information noted above by March 23, 2011 for the face- to-face meeting, to be placed on the list...
Diao, Lijun; Choi, Yunsoo; Czader, Beata; Li, Xiangshang; Pan, Shuai; Roy, Anirban; Souri, Amir Hossein; Estes, Mark; Jeon, Wonbae
2016-11-01
Air quality simulations were conducted using the Community Multiscale Air Quality (CMAQ) model for nocturnal isoprene in September 2013 using the United States Environmental Protection Agency's (EPA's) National Emissions Inventory of 2011 (NEI, 2011). The results were evaluated against measurements collected at eight Texas Commission on Environmental Quality (TCEQ) Automated Gas Chromatographs (AutoGCs) monitoring stations. The comparisons demonstrated two distinctive behaviors: overestimation before midnight (20:00-23:00 p.m. local time) versus underestimation after midnight (00:00-06:00 a.m.). Analyses identify the uncertainties in nitrate radical (NO3) concentration and vertical mixing as the possible minor factors contributing to the underestimation, and the underestimated wind speed as the major factor contributing to the overestimation. Further analysis links isoprene underestimation to the uncertainties in the nocturnal isoprene anthropogenic emissions in the NEI (2011) over industrial areas in Houston. This can be substantiated by the fact that the observed nighttime isoprene concentrations increased when the wind direction veered back from southeast to northeast, placing the stations downwind of industrial facilities. A sensitivity run with adjusted anthropogenic isoprene emissions in the later part of the night (i.e., the emissions were multiplied by the hourly underestimation factors ranging from 3.81 to 14.82) yielded closer isoprene predictions after midnight with slightly improved model mean (0.15 to 0.20 ppb), mean error (- 0.10 to - 0.04 ppb), mean absolute error (0.18 to 0.15 ppb), root mean squared error (RMSE, 0.27 to 0.25 ppb), and index of agreement (IOA, 0.66 to 0.68). The insignificant improvement was likely due to the uncertainties in the location of the high-peaked anthropogenic emissions. The impacts of the nighttime-adjusted isoprene emissions on the isoprene oxidation products, organic nitrate and ozone, were found to be minimal. This
Kasmarek, Mark C.; Houston, Natalie A.; Ramage, Jason K.
2009-01-01
This report, done in cooperation with the Harris-Galveston Subsidence District, the City of Houston, the Fort Bend Subsidence District, and the Lone Star Groundwater Conservation District, is one in an annual series of reports that depicts water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers, and compaction in the Chicot and Evangeline aquifers in the Houston-Galveston region, Texas. The report (excluding appendixes) contains 16 sheets and 15 tables: 3 sheets are maps showing current-year (2009) water-level altitudes for each aquifer, respectively; 3 sheets are maps showing 1-year (2008-09) water-level changes for each aquifer, respectively; 3 sheets are maps showing 5-year (2004-09) water-level changes for each aquifer, respectively; 4 sheets are maps showing long-term (1990-2009 and 1977-2009) water-level changes for the Chicot and Evangeline aquifers, respectively; 1 sheet is a map showing long-term (2000-2009) water-level change for the Jasper aquifer; 1 sheet is a map showing site locations of borehole extensometers; and 1 sheet comprises graphs showing measured compaction of subsurface material at the sites from 1973 or later through 2008, respectively. Tables listing the data used to construct the aquifer-data maps and the compaction graphs are included.
Energy Technology Data Exchange (ETDEWEB)
Liu, Suyang; Zhang, Kai, E-mail: Kai.Zhang@uth.tmc.edu
2015-12-15
Fine particulate matter (less than 2.5 μm in aerodynamic diameter; PM{sub 2.5}) pollution poses a major environmental threat in Greater Houston due to rapid economic growth and the numerous PM{sub 2.5} sources including ports, vehicles, and the largest petrochemical industry in the United States (U.S.). Our objectives were to estimate the short-term associations between the PM{sub 2.5} components and mortality during 2000–2011, and evaluate whether these associations have changed over time. A total of 333,317 deaths were included in our assessment, with an average of 76 deaths per day. We selected 17 PM{sub 2.5} components from the U.S. Environmental Protection Agency's Chemical Speciation Network, and then applied Poisson regression models to assess the associations between the PM{sub 2.5} components and mortality. Additionally, we repeated our analysis for two consecutive periods: 2000–2005 and 2006–2011. Interquartile range increases in ammonium (0.881 μg/m{sup 3}), nitrate (0.487 μg/m{sup 3}), sulfate (2.245 μg/m{sup 3}), and vanadium (0.004 μg/m{sup 3}) were associated with an increased risk in mortality of 0.69% (95% confidence interval (CI): 0.26, 1.12%), 0.38% (95% CI: 0.11, 0.66%), 0.61% (95% CI: 0.15, 1.06%), and 0.58% (95% CI: 0.12, 1.04%), respectively. Seasonal analysis suggested that the associations were strongest during the winter months. The association between PM{sub 2.5} mass and mortality decreased during 2000–2011, however, the PM{sub 2.5} components showed no notable changes in mortality risk over time. Our study indicates that the short-term associations between PM{sub 2.5} and mortality differ across the PM{sub 2.5} components and suggests that future air pollution control measures should not only focus on mass but also pollutant sources. - Highlights: • PM{sub 2.5} concentrations were associated with increased mortality risk. • A few major PM{sub 2.5} components were associated with increased mortality risk.
Directory of Open Access Journals (Sweden)
Ali Heidari
2017-03-01
Full Text Available Introduction: Stored product pests are a major problem in the storage of agricultural products that cause damage from harvest until consumption. Greater Wax Moth (Galleria mellonella L. is one of the most important pests of stored products and beehives. The most common method to control this pest in many countries is use of chemical compounds. However, these compounds have disadvantages such as pesticide residues in wax, the development of resistance in pest and irreversible effects on the environment and humans. The use of insect pathogenic fungi due to its low risk on mammals and natural enemies can be a good alternative to conventional chemical pesticides. Response surface methodology (RSM is a statistical technique that is employed to optimize processes that are affected by several variables. This technique uses regression analysis to obtain optimal equations to estimate the values. Using this method, while maintaining the quality in the experiments, the number of those could be reduced. Therefore, this study was aimed to evaluate response surface methodology to determine the effect of optimum lethal level of concentration of B. bassiana conidia, temperature as well as humidity variables on the mortality of fifth instar larvae of greater wax moth. Materials and Methods: Wax moth-eating insects were raised in plastic containers containing artificial food and old black wax at 30 ± 1 ° C and a relative humidity of 85 ± 1 % and photoperiod of 14:10 h (L: D. Isolation of insect pathogenic fungus B. bassiana was done by using Galleria Bait Method (GBM. For this purpose, after preparation of the fungus suspension from the infected larvae, 1 ml volume of the suspension was transferred to the water-agar 1.2% and then sealed petri dishes incubated at 30 ° C for three days. After identifying the single colony and formation of pure isolates, microscopic slides were prepared and eventually recovered isolates were recognized as B. bassiana. The
Mouthguard usage by middle and high school student-athletes in Houston, Texas.
Miller, Michael B; Johnson, Cleverick D; Cooley, Ralph A; Sharp, Holly; Servos, Thomas A
2016-01-01
This survey recorded utilization levels of stock and custom mouthguards among middle and high school athletes in a US metropolitan area and gathered data on the prevalence of traumatic injuries that have occurred as a consequence of school-based athletic competition. The data also included reasons for the athletes' noncompliance. A 23-question, online survey form was developed. A geographically diverse list of public and private schools in the Houston metropolitan area was identified and included 30 public middle schools, 32 public high schools, 8 private middle schools, and 10 private high schools. The sports surveyed were baseball, basketball, field hockey, football, lacrosse, soccer, softball, volleyball, and wrestling. Only 1 private middle school participated. Only 5 of 32 public high schools and 1 private high school participated, representing response rates of 16% and 10%, respectively. Overall, there were 503 responses, and 56% of the respondents did not have a mouthguard. Among athletes who owned a mouthguard, most (70%) had stock versions purchased in a retail store, while 11% had a custom mouthguard fabricated by a dentist, and 19% had both types. The most frequent reasons cited for not wearing a mouthguard were forgetting to use it and a lack of comfort. The injury rates reported by respondents in the stock and custom mouthguard groups were 26% and 9%, respectively. A consistent, concerted effort by local dental societies should be aimed at school administrators and coaches to encourage enforcement or reinforcement of mouthguard usage policies among high school athletes, but, ultimately, parents need to step up to protect their children.
Vitamin D: Findings from Antarctic, Bed Rest, Houston, and ISS
Zwart, Sara R.; Locke, J.; Pierson, D.; Mehta, S.; Bourbeau, Y.; Parsons, H.; Smith, S. M.
2009-01-01
Obtaining vitamin D is critical for space travelers because they lack ultraviolet light exposure and have an insufficient dietary supply of vitamin D. Despite the provision of 400 IU vitamin D supplements to International Space Station (ISS) early crewmembers, vitamin D status was consistently lower after flight than before flight, and in several crewmembers has decreased to levels considered clinically significant. Vitamin D has long been known to play a role in calcium metabolism, and more recently its non-calcitropic functions have been recognized. According to the results of several recent studies, functionally relevant measures indicate that the lower limit of serum 25-hydroxyvitamin D (a marker of vitamin D status) should be raised from the current 23 nmol/L to 80 nmol/L. The mean preflight serum 25-hydroxyvitamin D (25-OH vit D) for U.S. ISS crewmembers to date is 63 +/- 16 nmol/L, and after a 4- to 6-mo space flight it typically decreases 25-30% despite supplementation (400 IU/d). The sub-optimal pre- and postflight vitamin D status is an issue that needs to be addressed, to allow NASA to better define the appropriate amount of supplemental vitamin D to serve as a countermeasure against vitamin D deficiency in astronaut crews. A series of ground-based and flight studies in multiple models have been conducted, including Antarctica in winter months when UV-B radiation levels are essentially zero, bed rest where subjects are not exposed to UV-B radiation for 60-90 days, in free-living individuals in Houston, and in International Space Station crewmembers. In these studies, we looked at dose regimen and efficacy, compliance issues, as well as toxicity. Preliminary results from these studies will be presented. Together, the data from these studies will enable us to provide space crews with evidence-based recommendations for vitamin D supplementation. The findings also have implications for other persons with limited UV light exposure, including polar workers and
Metabolic Engineering X Conference
Energy Technology Data Exchange (ETDEWEB)
Flach, Evan [American Institute of Chemical Engineers
2015-05-07
The International Metabolic Engineering Society (IMES) and the Society for Biological Engineering (SBE), both technological communities of the American Institute of Chemical Engineers (AIChE), hosted the Metabolic Engineering X Conference (ME-X) on June 15-19, 2014 at the Westin Bayshore in Vancouver, British Columbia. It attracted 395 metabolic engineers from academia, industry and government from around the globe.
76 FR 26309 - Center for Scientific Review; Notice of Closed Meetings
2011-05-06
... U.S.C. App.), notice is hereby given of the following meetings. The meetings will be closed to the public in accordance with the provisions set forth in sections 552b(c)(4) and 552b(c)(6), Title 5 U.S.C... Westin Long Beach, 333 East Ocean Boulevard, Long Beach, CA 90802. Contact Person: Yi-Hsin Liu, PhD...
Gori, A.; Juan, A.; Blessing, R.; Brody, S.; Bedient, P. B.
2017-12-01
The FEMA 100 year floodplain serves as the benchmark for characterizing and managing flood risk in the United States. However, it is usually generated by using methodologies that are too simplistic to accurately depict the spatial reality of flood risk, and often fail to consider non-stationary variables such as changing land use conditions or precipitation patterns. The impacts of these limitations are evidenced in Houston, TX, where rainfall-induced flooding has resulted in billions of dollars in commercial and residential damage over the past two decades, much of which has occurred outside of the 100 year floodplain. Specifically, rapid urbanization has drastically increased overland runoff and resulting peak flows, thereby exposing new areas to flood risks. It is therefore crucial to examine the impacts of future land development on floodplain depth and extent in order to develop effective long-term stormwater management and mitigation strategies. This study presents a methodology for characterizing the impacts of future development on flood risk in an urbanizing watershed by integrating land use projection and high-resolution hydrologic / hydraulic modeling. Development projections are generated by identifying historical land use/ land cover change (LULCC) drivers, which are incorporated into an artificial neural network (ANN) to predict development conditions out to 2040. Hydrologic modeling of current and projected land cover conditions is achieved through a physics-based distributed hydrologic model. Finally, a coupled 1D/2D unsteady hydraulic model is used to simulate floodplain depths and extents, and to generate floodplain maps for all considered scenarios. This methodology is applied to the Cypress Creek watershed in northwest Houston, TX, a partially-developed watershed which is expected to rapidly urbanize for the next few decades. The study quantifies floodplain changes (i.e., extent and depth) and the number of impacted residences, and also
Predictors of Intention to Quit Waterpipe Smoking: A Survey of Arab Americans in Houston, Texas
Directory of Open Access Journals (Sweden)
Liqa Athamneh
2015-01-01
Full Text Available Waterpipe smoking has been described as “the second global tobacco epidemic since the cigarette.” Both Middle Eastern ethnicity and having a friend of Middle Eastern ethnicity have been reported as significant predictors of waterpipe smoking. Addressing waterpipe smoking in this ethnic minority is essential to controlling this growing epidemic in the US. We investigated the predictors of an intention to quit waterpipe smoking by surveying 340 Arab American adults in the Houston area. Primary analyses were conducted using stepwise logistic regression. Only 27% of participants reported having an intention to quit waterpipe smoking. Intention to quit waterpipe smoking was significantly higher with history of cigar use, a prior attempt to quit, and not smoking when seriously ill and significantly lower with increasing age, medium cultural acceptability of using waterpipe among family, high cultural acceptability of using waterpipe among friends, longer duration of smoking sessions, and perceiving waterpipe smoking as less harmful than cigarettes. Educational programs that target Arab Americans in general, and specifically older adults, those who smoke waterpipe for more than 60 minutes, those whose family and friends approve waterpipe smoking, and those with no former attempts to quit, may be necessary to increase the intention to quit waterpipe smoking.
Miller, M. M.; Shirzaei, M.
2017-12-01
Category-4 Hurricane Harvey had devastating socioeconomic impacts to Houston, with flooding far past the 100-year flood zones published by FEMA. In recent decades, frequency and intensity of coastal flooding are escalating, correlated with sea level rise (SLR). Moreover, Local land subsidence (LLS) due to groundwater and hydrocarbon extraction and natural compaction changes surface elevation and slope, potentially altering drainage patterns. GPS data show a mm broad co-cyclonic subsidence due to elastic loading from the water mass measured by GPS, which is inverted to solve for the total fluid volume of 2.73x1010 m3. We additionally investigate the joint impact of an SLR and pre-cyclonic LLS on the flooding of Houston-Galveston during Hurricane Harvey. We examine vertical land motion within North American Vertical Datum 2012 for the period 2007 until the cyclone by investigating SAR imaged acquired by ALOS and Sentinel-1A/B radar satellites combined with GPS data. We find patchy, LLS bowls resulting in sinks where floodwater can collect. We map the flooding extent by comparing amplitudes of Sentinal1-A/B pixels' backscattered radar signal from pre- and post-Harvey acquisitions and estimate 782 km2 are submerged within the area of 3478 km2 of pixels covered by Sentinel frame. Comparing with the LLS map, 89% of the flooded pixels exhibit -3 mm/yr or greater vertical motion. Flooding attributed to the storm surge is determined with high-resolution LiDAR digital elevation models (DEM) and a 0.75 m storm tide inundation model, which engulfs only 195 km2 and nearby the shorelines. We estimate future inundation hazard by combining LiDAR DEMs with our InSAR derived subsidence map, projecting LLS rates forward 100 years, and modeling projected SLR from 0.4 to 1.2 meters. Were subsidence to continue unabated, the total flooded area is 281 km2 with a 0.4 m and 394 km2 with a 1.2 m SLR. Next, we add a modest storm tide (0.752 m), which increases the flooded area to 389 - 480
Louchouarn, Patrick; Seward, Shaya M; Cornelissen, Gerard; Arp, Hans Peter H; Yeager, Kevin M; Brinkmeyer, Robin; Santschi, Peter H
2018-02-20
Sediments from a waste pit in Houston Ship Channel (HSC) were characterized using a number of molecular markers of natural organic matter fractions (e.g., pyrogenic carbon residues, PAHs, lignins), in addition to dioxins, in order to test the hypothesis that the dispersal and mobility of dioxins from the waste pit in the San Jacinto River is minimal. Station SG-6, sampled at the site of the submerged waste pit, had the highest dioxin/furan concentrations reported for the Houston Ship Channel/Galveston Bay (HSC/GB) system (10,000-46,000 pg/g), which translated into some of the highest reported World Health Organization Toxic Equivalents (TEQs: 2000-11,000 pg/g) in HSC sediments. Using a multi-tracer approach, this study confirmed our hypothesis that sludges from chlorinated pulps are a very likely source of dioxins/furans to this pit. However, this material also contained large quantities of additional hydrophobic organic contaminants (PAHs) and pyrogenic markers (soot-BC, levoglucosan), pointing to the co-occurrence of petroleum hydrocarbons and combustion byproducts. Comparison of dioxin/furan signatures in the waste pit with those from sediments of the HSC and a control site suggests that the remobilization of contaminated particles did not occur beyond the close vicinity of the pit itself. The dioxins/furans in sediments outside the waste pit within the HSC are rather from other diffuse inputs, entering the sedimentary environment through the air and water, and which are comprised of a mixture of industrial and municipal sources. Fingerprinting of waste pit dioxins indicates that their composition is typical of pulp and paper sources. Measured pore water concentrations were 1 order of magnitude lower than estimated values, calculated from a multiphase sorption model, indicating low mobility of dioxins within the waste pit. This is likely accomplished by co-occurring and strong sorbing pyrogenic and petrogenic residues in the waste pit, which tend to keep
International Nuclear Information System (INIS)
1993-01-01
The Geneva Industries Site is an abandoned refinery in Houston, Texas, that manufactured polychlorinated biphenyls (PCBs). Although there is evidence of past exposure to site contaminants, the site currently poses no apparent public health hazard. The contaminants to which persons may have been exposed in the past include polychlorinated biphenyls (PCBs), polycyclic aromatic hydrocarbons (PAHs), and 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD). The lack of historical ambient air data from the time when the site was active prevents us from evaluating the potential for adverse health effects from inhalation exposure. Although fish and crawfish taken from the local drainageways were contaminated with PCBs, it is unlikely that humans would have been exposed to these species through the food chain. The groundwater under the site is contaminated. Although the contaminated water is not currently being used for human consumption, there is a potential for exposure to contaminated groundwater in the future. Planned groundwater remedial actions should eliminate this threat
Directory of Open Access Journals (Sweden)
Melissa S. Nolan
2012-01-01
Full Text Available West Nile virus (WNV, a mosquito-borne virus, has clinically affected hundreds of residents in the Houston metropolitan area since its introduction in 2002. This study aimed to determine if living within close proximity to a water source increases one’s odds of infection with WNV. We identified 356 eligible WNV-positive cases and 356 controls using a population proportionate to size model with US Census Bureau data. We found that living near slow moving water sources was statistically associated with increased odds for human infection, while living near moderate moving water systems was associated with decreased odds for human infection. Living near bayous lined with vegetation as opposed to concrete also showed increased risk of infection. The habitats of slow moving and vegetation lined water sources appear to favor the mosquito-human transmission cycle. These methods can be used by resource-limited health entities to identify high-risk areas for arboviral disease surveillance and efficient mosquito management initiatives.
Wallace, Henry W.; Sanchez, Nancy P.; Flynn, James H.; Erickson, Mathew H.; Lefer, Barry L.; Griffin, Robert J.
2018-01-01
From February 7 to 27, 2015, a mobile air quality laboratory was deployed to a location proximate to a major refinery, the Port of Houston, and several neighborhoods to conduct measurements of atmospheric trace gases and particulate matter. Two statistical models were utilized to apportion the sources of pollution impacting this site and the denizens of the nearby neighborhoods. Positive matrix factorization (PMF) was performed on the organic signal of the aerosol mass spectra, resulting in five factors totaling an average of 4.1 μg/m3 of the organic aerosol: hydrocarbon-like (0.67 μg/m3), cooking (0.35 μg/m3) biomass burning (1.14 μg/m3), low-volatility oxidized (1.15 μg/m3), and semi-volatile oxidized (0.78 μg/m3). Principal component analysis was performed on daytime and nighttime data, including concentrations from PMF output, of other PM1 components, and of trace gases. This generated five daytime and five nighttime factors that explained 74.5% and 73.0% of the variance, respectively. The most important factors impacting this site were from mobile source exhaust and petrochemical aromatic compound emissions. Together these two factors also constitute most of the observed carcinogens.
Directory of Open Access Journals (Sweden)
Kristina W. Whitworth
2017-04-01
Full Text Available Abstract: Communities of color or low socioeconomic status are disproportionately affected by metal exposure given spatial variability of the ambient levels of these contaminants. Despite this, there is little research characterizing metal concentrations in blood among disadvantaged populations in the U.S., especially among pregnant women who are particularly vulnerable and difficult to access. Thus, we conducted a pilot study among disadvantaged pregnant women in Houston, Texas to assess willingness to participate in key activities of an epidemiologic study and characterize exposures to 16 metals. Thirty-one women attending a Medicaid-serving prenatal clinic were included in this pilot study and completed an interviewer-administered questionnaire. We obtained and measured metal compounds in whole blood samples for 22 of these women during third-trimester prenatal visits. Median whole blood concentrations of Ni, As, Cd, and Pb were 27, 1.4, 0.6, and 6.3 µg/L, respectively. Most women were willing to participate in critical aspects of a research study, including wearing a personal air-sampling badge for 2–3 days (87.1%, receiving ultrasounds (83.9%, and providing blood draws (64.5%. Despite the small sample, our results provide evidence of women’s metal exposure and their willingness to participate in future research studies to elucidate exposure pathways and explore related health effects experienced among this population of disadvantaged pregnant women.
Energy Technology Data Exchange (ETDEWEB)
Kokajko, L.; Skay, D.; Wang, H.; Murphy, D. [Nuclear Regulatory Commission, Washington, DC (United States)
1995-03-01
This report provides the results of the South Texas Project Allegations Review Team of the US Nuclear Regulatory Commission. This team was formed to obtain and review allegations from individuals represented by three attorneys who had contacted Congressional staff members. The allegers were employed in various capacities at South Texas Project Electric Generating Station, licensed by Houston Lighting and Power Company, et al.; therefore, the allegations are confined to this site. The South Texas Project Allegations Review Team reviewed, referred, and dispositioned concerns related to discriminatory issues (harassment and intimidation), falsification of records and omission of information, and various technical issues. The team was able to substantiate certain technical issues of minor safety significance or regulatory concern at the South Texas Project facility, but it did not find widespread discriminatory practices such as harassment and intimidation.
International Nuclear Information System (INIS)
Kokajko, L.; Skay, D.; Wang, H.; Murphy, D.
1995-03-01
This report provides the results of the South Texas Project Allegations Review Team of the US Nuclear Regulatory Commission. This team was formed to obtain and review allegations from individuals represented by three attorneys who had contacted Congressional staff members. The allegers were employed in various capacities at South Texas Project Electric Generating Station, licensed by Houston Lighting and Power Company, et al.; therefore, the allegations are confined to this site. The South Texas Project Allegations Review Team reviewed, referred, and dispositioned concerns related to discriminatory issues (harassment and intimidation), falsification of records and omission of information, and various technical issues. The team was able to substantiate certain technical issues of minor safety significance or regulatory concern at the South Texas Project facility, but it did not find widespread discriminatory practices such as harassment and intimidation
Grounta, Athena; Harizanis, Paschalis; Mylonakis, Eleftherios; Nychas, George-John E; Panagou, Efstathios Z
2016-01-01
The use of Galleria mellonella as a model host to elucidate microbial pathogenesis and search for novel drugs and therapies has been well appreciated over the past years. However, the effect of microorganisms with functional appeal in the specific host remains scarce. The present study investigates the effect of treatment with selected lactic acid bacteria (LAB) with probiotic potential, as potential protective agents by using live or heat-killed cells at 6 and 24 h prior to infection with Listeria monocytogenes and Staphylococcus aureus or as potential therapeutic agents by using cell-free supernatants (CFS) after infection with the same pathogens. The employed LAB strains were Lactobacillus pentosus B281 and Lactobacillus plantarum B282 (isolated from table olive fermentations) along with Lactobacillus rhamnosus GG (inhabitant of human intestinal tract). Kaplan-Meier survival curves were plotted while the pathogen's persistence in the larval hemolymph was determined by microbiological analysis. It was observed that the time (6 or 24 h) and type (live or heat-killed cells) of challenge period with LAB prior to infection greatly affected the survival of infected larvae. The highest decrease of L. monocytogenes population in the hemolymph was observed in groups challenged for 6 h with heat-killed cells by an average of 1.8 log units compared to non challenged larvae for strains B281 (p 0.0322), B282 (p 0.0325), and LGG (p 0.0356). In the case of S. aureus infection, the population of the pathogen decreased in the hemolymph by 1 log units at 8 h post infection in the groups challenged for 6 h with heat-killed cells of strains B281 (p 0.0161) and B282 (p 0.0096) and by 1.8 log units in groups challenged with heat-killed cells of LGG strain (p 0.0175). Further use of CFS of each LAB strain did not result in any significant prolonged survival but interestingly it resulted in pronounced decrease of L. monocytogenes in the hemolymph at 24 h and 48 h after infection by
The Genomic Evolution of Prostate Cancer
2017-06-01
the proposed project : 1. To continue to acquire a comprehensive understanding of prostate cancer genomics . 2. To develop an understanding of... Genetics I • ECEV 35901 Evolutionary Genomics • Fundamentals of Clinical Research • HGEN 47400 Introduction to Probability and Statistics for Geneticists...Marc Gillard,2 David M. Hatcher,5 Westin R. Tom,5 Walter M. Stadler2 and Kevin P. White1,2,3 1Institute for Genomics and Systems Biology , Departments of
Directory of Open Access Journals (Sweden)
Duccio Dogheria
2008-06-01
Full Text Available Il muro, nel suo grigio rigore formale, nella sua fredda geometria, nel suo intento divisorio, nasconde spesso il cielo. Sovente il linguaggio dell’arte, ma non di meno quello della comunicazione, hanno interferito con le sue algide barriere. In molti casi, beninteso, non è che il potere in altre forme, che interferisce con se stesso: pensiamo ai bandi affissi agli angoli delle città, o le lettere d’indulgenza papali -spesso impreziosite da miniature al punto da poterle considerare antenate dal manifesto- che nel corso del medioevo venivano affisse sulle porte delle chiese.
Geldiyev, P.
2017-12-01
Rapid urban development and changing climate influences the frequency and magnitude of flooding in Houston area. This proposed project aims to evaluate the flooding risks with the current and future land use changes by 2040 for one subbasin of the San Jacinto Brazos/Neches-Trinity Coastal basin. Surface environments and streamflow data of the Clear Creek are analyzed and stimulated to discuss the possible impact of urbanization on the occurrence of floods. The streamflow data is analyzed and simulated with the application of the Geographic Information Systems and its extensions. Both hydrologic and hydraulic models of the Clear Creek are created with the use of HEC-HMS and HEC-RAS software. Both models are duplicated for the year 2040, based on projected 2040 Landcover Maps developed by Houston and Galveston Area Council. This project examines a type of contemporary hydrologic disturbance and the interaction between land cover and changes in hydrological processes. Expected results will be very significant for urban development and flooding management.
Long, S Wesley; Olsen, Randall J; Eagar, Todd N; Beres, Stephen B; Zhao, Picheng; Davis, James J; Brettin, Thomas; Xia, Fangfang; Musser, James M
2017-05-16
Klebsiella pneumoniae is a major human pathogen responsible for high morbidity and mortality rates. The emergence and spread of strains resistant to multiple antimicrobial agents and documented large nosocomial outbreaks are especially concerning. To develop new therapeutic strategies for K. pneumoniae , it is imperative to understand the population genomic structure of strains causing human infections. To address this knowledge gap, we sequenced the genomes of 1,777 extended-spectrum beta-lactamase-producing K. pneumoniae strains cultured from patients in the 2,000-bed Houston Methodist Hospital system between September 2011 and May 2015, representing a comprehensive, population-based strain sample. Strains of largely uncharacterized clonal group 307 (CG307) caused more infections than those of well-studied epidemic CG258. Strains varied markedly in gene content and had an extensive array of small and very large plasmids, often containing antimicrobial resistance genes. Some patients with multiple strains cultured over time were infected with genetically distinct clones. We identified 15 strains expressing the New Delhi metallo-beta-lactamase 1 (NDM-1) enzyme that confers broad resistance to nearly all beta-lactam antibiotics. Transcriptome sequencing analysis of 10 phylogenetically diverse strains showed that the global transcriptome of each strain was unique and highly variable. Experimental mouse infection provided new information about immunological parameters of host-pathogen interaction. We exploited the large data set to develop whole-genome sequence-based classifiers that accurately predict clinical antimicrobial resistance for 12 of the 16 antibiotics tested. We conclude that analysis of large, comprehensive, population-based strain samples can assist understanding of the molecular diversity of these organisms and contribute to enhanced translational research. IMPORTANCE Klebsiella pneumoniae causes human infections that are increasingly difficult to
Schulze, B.; Wallace, H. W., IV; Bui, A.; Flynn, J. H., III; Erickson, M. H.; Griffin, R. J.
2017-12-01
The Texas Gulf Coast region historically has been influenced heavily by regional shipping emissions. However, the effects of the recent establishment of the North American Emissions Control Area (ECA) on aerosol properties in this region are presently unknown. In order to understand better the current sources and processing mechanisms influencing coastal aerosol near Houston, a high-resolution time-of-flight aerosol mass spectrometer (HR-ToF-AMS) was deployed for three weeks at a coastal location during May-June 2016. Total mass loadings of organic and inorganic non-refractory aerosol components during onshore flow periods were similar to those published before establishment of the regulations. Using estimated methanesulfonic acid (MSA) mass loadings and published biogenic MSA:non-sea-salt-sulfate (nss-SO4) ratios, we determined that over 70% of nss-SO4 over the Gulf was from anthropogenic sources, predominantly shipping emissions. Mass spectral analysis indicated that for periods with similar backward-trajectory-averaged meteorological conditions, air masses influenced by shipping emissions have an increased mass fraction of ions related to carboxylic acids and a significantly larger oxygen-to-carbon (O:C) ratio than air masses that stay within the ECA boundary, suggesting that shipping emissions impact marine organic aerosol (OA) oxidation state. Amine fragment mass loadings were positively correlated with anthropogenic nss-SO4 during onshore flow, implying anthropogenic-biogenic interaction in marine OA production. Five OA factors were resolved by positive matrix factorization, corresponding to a hydrocarbon-like OA, a semi-volatile OA, and three different oxygenated organic aerosols ranked by their O:C ratio (OOA-1, OOA-2, and OOA-3). OOA-1 constituted the majority of OA mass during a period likely influenced by aqueous-phase processing and may be linked to local glyoxal/methylglyoxal-related sources. OOA-2 was produced within the Houston urban region and was
Directory of Open Access Journals (Sweden)
Athena Grounta
Full Text Available The use of Galleria mellonella as a model host to elucidate microbial pathogenesis and search for novel drugs and therapies has been well appreciated over the past years. However, the effect of microorganisms with functional appeal in the specific host remains scarce. The present study investigates the effect of treatment with selected lactic acid bacteria (LAB with probiotic potential, as potential protective agents by using live or heat-killed cells at 6 and 24 h prior to infection with Listeria monocytogenes and Staphylococcus aureus or as potential therapeutic agents by using cell-free supernatants (CFS after infection with the same pathogens. The employed LAB strains were Lactobacillus pentosus B281 and Lactobacillus plantarum B282 (isolated from table olive fermentations along with Lactobacillus rhamnosus GG (inhabitant of human intestinal tract. Kaplan-Meier survival curves were plotted while the pathogen's persistence in the larval hemolymph was determined by microbiological analysis. It was observed that the time (6 or 24 h and type (live or heat-killed cells of challenge period with LAB prior to infection greatly affected the survival of infected larvae. The highest decrease of L. monocytogenes population in the hemolymph was observed in groups challenged for 6 h with heat-killed cells by an average of 1.8 log units compared to non challenged larvae for strains B281 (p 0.0322, B282 (p 0.0325, and LGG (p 0.0356. In the case of S. aureus infection, the population of the pathogen decreased in the hemolymph by 1 log units at 8 h post infection in the groups challenged for 6 h with heat-killed cells of strains B281 (p 0.0161 and B282 (p 0.0096 and by 1.8 log units in groups challenged with heat-killed cells of LGG strain (p 0.0175. Further use of CFS of each LAB strain did not result in any significant prolonged survival but interestingly it resulted in pronounced decrease of L. monocytogenes in the hemolymph at 24 h and 48 h after
Marella, Richard L.; Dixon, Joann F.
2015-09-18
A detailed inventory of irrigated crop acreage is not available at the level of resolution needed to accurately estimate water use or to project future water demands in many Florida counties. This report provides a detailed digital map and summary of irrigated areas for 2014 within Jackson, Calhoun, and Gadsden Counties in Florida, and Houston County in Alabama. The irrigated areas were delineated using land-use data and orthoimagery that were then field verified between June and November 2014. Selected attribute data were collected for the irrigated areas, including crop type, primary water source, and type of irrigation system. Results of the 2014 study indicate that an estimated 31,608 acres were irrigated in Jackson County during 2014. This estimate includes 25,733 acres of field crops, 1,534 acres of ornamentals and grasses (including pasture), and 420 acres of orchards. Specific irrigated crops include cotton (11,759 acres), peanuts (9,909 acres), field corn (2,444 acres), and 3,235 acres of various vegetable (row) crops. The vegetable acreage includes 1,714 acres of which 857 acres were planted with both a spring and fall crop on the same field (double cropped). Overall, groundwater was used to irrigate 98.6 percent of the total irrigated acreage in Jackson County during 2014, whereas surface water and wastewater were used to irrigate the remaining 1.4 percent.
Directory of Open Access Journals (Sweden)
Kristy O Murray
Full Text Available In 2012, we witnessed a resurgence of West Nile virus (WNV in the United States, with the largest outbreak of human cases reported since 2003. WNV is now endemic and will continue to produce epidemics over time, therefore defining the long-term consequences of WNV infection is critical. Over a period of eight years, we prospectively followed a cohort of 157 WNV-infected subjects in the Houston metropolitan area to observe recovery over time and define the long-term clinical outcomes. We used survival analysis techniques to determine percentage of recovery over time and the effects of demographic and co-morbid conditions on recovery. We found that 40% of study participants continued to experience symptoms related to their WNV infection up to 8 years later. Having a clinical presentation of encephalitis and being over age 50 were significantly associated with prolonged or poor recovery over time. Since the health and economic impact as a result of prolonged recovery, continued morbidity, and related disability is likely substantial in those infected with WNV, future research should be aimed at developing effective vaccines to prevent illness and novel therapeutics to minimize morbidity, mortality, and long-term complications from infection.
PERANAN PERSON IN CHARGE DALAM PENYELENGGARAAN MICE DI BICC THE WESTIN RESORT
Directory of Open Access Journals (Sweden)
AA. Sagung Amega Indra Theresa
2015-12-01
Full Text Available Nowadays Bali has developed into a MICE tourist destination. Several events hav been a successfuly held in Bali. The event such of the ASEAN Summit and Climate Change Summit 2012, ASEAN Summit and the ASEAN Foreign Ministers Meeting. Behind the success of the international MICE events in Bali, there are the role of person who are competent to make it happen. Human resources in the area of MICE services have a very important role for MICE events took place. They are the one who hold the key to the success of the event. One of them is a representative of the hotel (venue where the convention was held as a person in charge who will be contacted by the organizers to communicate all necessary purposes. The person in charge holds the key to the success of the hotel (venue in providing the best service to convention delegates, and play crucial part of convincing the organizers to use hotel as a venue. This study was conducted to determine how the specification of the role of the person in charge in the organization of international MICE event.
Sansom, Garett; Berke, Philip; McDonald, Thomas; Shipp, Eva; Horney, Jennifer
2016-08-23
In the last few decades, there has been an increase in community-based participatory research being conducted within the United States. Recent research has demonstrated that working with local community organizations, interest groups, and individuals can assist in the creation of, and sustainability in, health initiatives, adoption of emergency protocols, and potentially improve health outcomes for at-risk populations. However little research has assessed if communal concerns over environmental contaminants would be confirmed through environmental research. This cross-sectional study collected survey data and performed surface water analysis for heavy metals in a small neighborhood in Houston, TX, which is characterized by industrial sites, unimproved infrastructure, nuisance flooding, and poor air quality. Surveys were completed with 109 residents of the Manchester neighborhood. Water samples were taken from thirty zones within the neighborhood and assessed for arsenic (As), barium (Ba), cadmium (Cd), chromium (Cr), lead (Pb), selenium (Se), silver (Ag), and mercury (Hg). Survey results showed that the vast majority of all respondents were concerned over proximity to industry and waste facilities, as well as exposure to standing surface water. Barium was discovered in every sample and many of the zones showed alarming levels of certain metals. For example, one zone, two blocks from a public park, showed levels of arsenic at 180 (μg/L), barium at 3296 (μg/L), chromium at 363 (μg/L), lead at 1448 (μg/L), and mercury at 10 (μg/L). These findings support the hypothesis that neighborhood members are aware of the issues affecting their community and can offer researchers valuable assistance in every stage of study design and execution.
Directory of Open Access Journals (Sweden)
Garett Sansom
2016-08-01
Full Text Available In the last few decades, there has been an increase in community-based participatory research being conducted within the United States. Recent research has demonstrated that working with local community organizations, interest groups, and individuals can assist in the creation of, and sustainability in, health initiatives, adoption of emergency protocols, and potentially improve health outcomes for at-risk populations. However little research has assessed if communal concerns over environmental contaminants would be confirmed through environmental research. This cross-sectional study collected survey data and performed surface water analysis for heavy metals in a small neighborhood in Houston, TX, which is characterized by industrial sites, unimproved infrastructure, nuisance flooding, and poor air quality. Surveys were completed with 109 residents of the Manchester neighborhood. Water samples were taken from thirty zones within the neighborhood and assessed for arsenic (As, barium (Ba, cadmium (Cd, chromium (Cr, lead (Pb, selenium (Se, silver (Ag, and mercury (Hg. Survey results showed that the vast majority of all respondents were concerned over proximity to industry and waste facilities, as well as exposure to standing surface water. Barium was discovered in every sample and many of the zones showed alarming levels of certain metals. For example, one zone, two blocks from a public park, showed levels of arsenic at 180 (μg/L, barium at 3296 (μg/L, chromium at 363 (μg/L, lead at 1448 (μg/L, and mercury at 10 (μg/L. These findings support the hypothesis that neighborhood members are aware of the issues affecting their community and can offer researchers valuable assistance in every stage of study design and execution.
International Nuclear Information System (INIS)
Mehrens, H; Lewis, B; Lujano, C; Nguyen, T; Hernandez, N; Alvarez, P; Molineu, A; Followill, D
2016-01-01
Purpose: To describe the results of IROC Houston’s international and domestic end-to-end QA phantom irradiations. Methods: IROC Houston has anthropomorphic lung, liver, head and neck, prostate, SRS and spine phantoms that are used for credentialing and quality assurance purposes. The phantoms include structures that closely mimic targets and organs at risk and are made from tissue equivalent materials: high impact polystyrene, solid water, cork and acrylic. Motion tables are used to mimic breathing motion for some lung and liver phantoms. Dose is measured with TLD and radiochromic film in various planes within the target of the phantoms. Results: The most common phantom requested is the head and neck followed by the lung phantom. The head and neck phantom was sent to 800 domestic and 148 international sites between 2011 and 2015, with average pass rates of 89% and 92%, respectively. During the past five years, a general upward trend exists regarding demand for the lung phantom for both international and domestic sites with international sites more than tripling from 5 (2011) to 16 (2015) and domestic sites doubling from 66 (2011) to 152 (2015). The pass rate for lung phantoms has been consistent from year to year despite this large increase in the number of phantoms irradiated with an average pass rate of 85% (domestic) and 95% (international) sites. The percentage of lung phantoms used in combination with motions tables increased from 38% to 79% over the 5 year time span. Conclusion: The number of domestic and international sites irradiating the head and neck and lung phantoms continues to increase and the pass rates remained constant. These end-to-end QA tests continue to be a crucial part of clinical trial credentialing and institution quality assurance. This investigation was supported by IROC grant CA180803 awarded by the NCI.
Directory of Open Access Journals (Sweden)
Prokhorov Alexander V
2008-09-01
Full Text Available Abstract Background Survey data suggest that in Texas Latino youth exhibit higher rates of susceptibility to smoking than youth from other ethnic groups. In this analysis we examined the relationship between susceptibility to smoking and well-known risk factors associated with smoking initiation among a cohort of 11 to 13 year old Mexican origin youth residing in Houston, Texas. Methods We analyzed cross-sectional survey data from 1,187 participants who reported they had never smoked, even a puff of a cigarette. The survey assessed peer and family social influence, school and neighborhood characteristics, level of family acculturation and socioeconomic status, and attitudes toward smoking. Bivariate associations, Student's t-tests, and logistic regression analysis were used to examine predictors of susceptibility. Results Overall, 22.1% of the never-smokers were susceptible to smoking. Boys were more likely to be susceptible than girls (25.6% vs. 18.9%, and susceptible children were slightly older than non-susceptible children (12.1 vs. 11.8 years. In addition, multivariate analyses revealed that positive expectations about smoking exerted the strongest influence on susceptibility status (odds ratio = 4.85. Multivariate analyses further revealed that compared to non-susceptible participants, susceptibles were more likely to report peer influences supportive of smoking, lower subjective social status and more detentions at school, more temptations to try smoking and to have a mother and a brother who smokes. Conclusion Our findings suggest that interventions that target positive expectations about smoking may be useful in this population. Furthermore, because youth encounter smoking-initiation risk factors in different social environments, our results underscore the continued need for both family- and school-based primary prevention programs to adequately combat their influence. The results also can be used to inform the development of culturally
Energy Technology Data Exchange (ETDEWEB)
Mehrens, H; Lewis, B; Lujano, C; Nguyen, T; Hernandez, N; Alvarez, P; Molineu, A; Followill, D [UT MD Anderson Cancer Center, Houston, TX (United States)
2016-06-15
Purpose: To describe the results of IROC Houston’s international and domestic end-to-end QA phantom irradiations. Methods: IROC Houston has anthropomorphic lung, liver, head and neck, prostate, SRS and spine phantoms that are used for credentialing and quality assurance purposes. The phantoms include structures that closely mimic targets and organs at risk and are made from tissue equivalent materials: high impact polystyrene, solid water, cork and acrylic. Motion tables are used to mimic breathing motion for some lung and liver phantoms. Dose is measured with TLD and radiochromic film in various planes within the target of the phantoms. Results: The most common phantom requested is the head and neck followed by the lung phantom. The head and neck phantom was sent to 800 domestic and 148 international sites between 2011 and 2015, with average pass rates of 89% and 92%, respectively. During the past five years, a general upward trend exists regarding demand for the lung phantom for both international and domestic sites with international sites more than tripling from 5 (2011) to 16 (2015) and domestic sites doubling from 66 (2011) to 152 (2015). The pass rate for lung phantoms has been consistent from year to year despite this large increase in the number of phantoms irradiated with an average pass rate of 85% (domestic) and 95% (international) sites. The percentage of lung phantoms used in combination with motions tables increased from 38% to 79% over the 5 year time span. Conclusion: The number of domestic and international sites irradiating the head and neck and lung phantoms continues to increase and the pass rates remained constant. These end-to-end QA tests continue to be a crucial part of clinical trial credentialing and institution quality assurance. This investigation was supported by IROC grant CA180803 awarded by the NCI.
Entomogenous nematode Neoaplectana carpocapsae: radiation and mammalian safety
International Nuclear Information System (INIS)
Gaugler, R.R.
1978-01-01
Infective-stage juveniles of Neoaplacetana carpocapsae were acutely sensitive to short uv radiation (254 nm) and natural sunlight. High nematode mortality, although delayed, accompanied uv exposure. Irradiation rapidly reduced nematode pathogenicity, so that nematodes exposed for 7 min were unable to cause lethal infections in Galleria mallonella larvae. Moreover, the median survival time of Galleria larvae increased progressively as nematode exposure to uv was lengthened. Inhibition of nematode reproduction and development was noted at exposure periods more than 2.45 and 5 min, respectively. However, irradiation did not appear to affect juvenile motility. Exposure to direct sunlight also reduced pathogenicity, in a range from 6.9 to 94.9% at 30 and 60 min of exposure, respectively. Long uv (366 nm) did not affect juveniles at the exposures tested
Directory of Open Access Journals (Sweden)
Paul A Christensen
2017-01-01
Full Text Available Introduction: Next-generation-sequencing (NGS is increasingly used in clinical and research protocols for patients with cancer. NGS assays are routinely used in clinical laboratories to detect mutations bearing on cancer diagnosis, prognosis and personalized therapy. A typical assay may interrogate 50 or more gene targets that encompass many thousands of possible gene variants. Analysis of NGS data in cancer is a labor-intensive process that can become overwhelming to the molecular pathologist or research scientist. Although commercial tools for NGS data analysis and interpretation are available, they are often costly, lack key functionality or cannot be customized by the end user. Methods: To facilitate NGS data analysis in our clinical molecular diagnostics laboratory, we created a custom bioinformatics tool termed Houston Methodist Variant Viewer (HMVV. HMVV is a Java-based solution that integrates sequencing instrument output, bioinformatics analysis, storage resources and end user interface. Results: Compared to the predicate method used in our clinical laboratory, HMVV markedly simplifies the bioinformatics workflow for the molecular technologist and facilitates the variant review by the molecular pathologist. Importantly, HMVV reduces time spent researching the biological significance of the variants detected, standardizes the online resources used to perform the variant investigation and assists generation of the annotated report for the electronic medical record. HMVV also maintains a searchable variant database, including the variant annotations generated by the pathologist, which is useful for downstream quality improvement and research projects. Conclusions: HMVV is a clinical grade, low-cost, feature-rich, highly customizable platform that we have made available for continued development by the pathology informatics community.
American Association for Aerosol Research (AAAR) `95
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-12-31
The Fourteenth annual meeting of the American Association for Aerosol Research was held October 9-13, 1995 at Westin William Penn Hotel in Pittsburgh, PA. This volume contains the abstracts of the papers and poster sessions presented at this meeting, grouped by the session in which they were presented as follows: Radiation Effects; Aerosol Deposition; Collision Simulations and Microphysical Behavior; Filtration Theory and Measurements; Materials Synthesis; Radioactive and Nuclear Aerosols; Aerosol Formation, Thermodynamic Properties, and Behavior; Particle Contamination Issues in the Computer Industry; Pharmaceutical Aerosol Technology; Modeling Global/Regional Aerosols; Visibility; Respiratory Deposition; Biomass and Biogenic Aerosols; Aerosol Dynamics; Atmospheric Aerosols.
Energy Technology Data Exchange (ETDEWEB)
Kerns, James R.; Followill, David S.; Kry, Stephen F., E-mail: sfkry@mdanderson.org [Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Imaging and Radiation Oncology Core-Houston, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Graduate School of Biomedical Sciences, The University of Texas Health Science Center-Houston, Houston, Texas 77030 (United States); Lowenstein, Jessica; Molineu, Andrea; Alvarez, Paola; Taylor, Paige A. [Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Imaging and Radiation Oncology Core-Houston, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States); Stingo, Francesco C. [Department of Biostatistics, The University of Texas MD Anderson Cancer Center, Houston, Texas 77030 (United States)
2016-05-15
Purpose: Accurate data regarding linear accelerator (Linac) radiation characteristics are important for treatment planning system modeling as well as regular quality assurance of the machine. The Imaging and Radiation Oncology Core-Houston (IROC-H) has measured the dosimetric characteristics of numerous machines through their on-site dosimetry review protocols. Photon data are presented and can be used as a secondary check of acquired values, as a means to verify commissioning a new machine, or in preparation for an IROC-H site visit. Methods: Photon data from IROC-H on-site reviews from 2000 to 2014 were compiled and analyzed. Specifically, data from approximately 500 Varian machines were analyzed. Each dataset consisted of point measurements of several dosimetric parameters at various locations in a water phantom to assess the percentage depth dose, jaw output factors, multileaf collimator small field output factors, off-axis factors, and wedge factors. The data were analyzed by energy and parameter, with similarly performing machine models being assimilated into classes. Common statistical metrics are presented for each machine class. Measurement data were compared against other reference data where applicable. Results: Distributions of the parameter data were shown to be robust and derive from a student’s t distribution. Based on statistical and clinical criteria, all machine models were able to be classified into two or three classes for each energy, except for 6 MV for which there were eight classes. Quantitative analysis of the measurements for 6, 10, 15, and 18 MV photon beams is presented for each parameter; supplementary material has also been made available which contains further statistical information. Conclusions: IROC-H has collected numerous data on Varian Linacs and the results of photon measurements from the past 15 years are presented. The data can be used as a comparison check of a physicist’s acquired values. Acquired values that are well
International Nuclear Information System (INIS)
Kerns, James R.; Followill, David S.; Kry, Stephen F.; Lowenstein, Jessica; Molineu, Andrea; Alvarez, Paola; Taylor, Paige A.; Stingo, Francesco C.
2016-01-01
Purpose: Accurate data regarding linear accelerator (Linac) radiation characteristics are important for treatment planning system modeling as well as regular quality assurance of the machine. The Imaging and Radiation Oncology Core-Houston (IROC-H) has measured the dosimetric characteristics of numerous machines through their on-site dosimetry review protocols. Photon data are presented and can be used as a secondary check of acquired values, as a means to verify commissioning a new machine, or in preparation for an IROC-H site visit. Methods: Photon data from IROC-H on-site reviews from 2000 to 2014 were compiled and analyzed. Specifically, data from approximately 500 Varian machines were analyzed. Each dataset consisted of point measurements of several dosimetric parameters at various locations in a water phantom to assess the percentage depth dose, jaw output factors, multileaf collimator small field output factors, off-axis factors, and wedge factors. The data were analyzed by energy and parameter, with similarly performing machine models being assimilated into classes. Common statistical metrics are presented for each machine class. Measurement data were compared against other reference data where applicable. Results: Distributions of the parameter data were shown to be robust and derive from a student’s t distribution. Based on statistical and clinical criteria, all machine models were able to be classified into two or three classes for each energy, except for 6 MV for which there were eight classes. Quantitative analysis of the measurements for 6, 10, 15, and 18 MV photon beams is presented for each parameter; supplementary material has also been made available which contains further statistical information. Conclusions: IROC-H has collected numerous data on Varian Linacs and the results of photon measurements from the past 15 years are presented. The data can be used as a comparison check of a physicist’s acquired values. Acquired values that are well
Eslami, E.; Choi, Y.; Roy, A.
2017-12-01
Air quality forecasting carried out by chemical transport models often show significant error. This study uses a deep-learning approach over the Houston-Galveston-Brazoria (HGB) area to overcome this forecasting challenge, for the DISCOVER-AQ period (September 2013). Two approaches, deep neural network (DNN) using a Multi-Layer Perceptron (MLP) and Restricted Boltzmann Machine (RBM) were utilized. The proposed approaches analyzed input data by identifying features abstracted from its previous layer using a stepwise method. The approaches predicted hourly ozone and PM in September 2013 using several predictors of prior three days, including wind fields, temperature, relative humidity, cloud fraction, precipitation along with PM, ozone, and NOx concentrations. Model-measurement comparisons for available monitoring sites reported Indexes of Agreement (IOA) of around 0.95 for both DNN and RBM. A standard artificial neural network (ANN) (IOA=0.90) with similar architecture showed poorer performance than the deep networks, clearly demonstrating the superiority of the deep approaches. Additionally, each network (both deep and standard) performed significantly better than a previous CMAQ study, which showed an IOA of less than 0.80. The most influential input variables were identified using their associated weights, which represented the sensitivity of ozone to input parameters. The results indicate deep learning approaches can achieve more accurate ozone forecasting and identify the important input variables for ozone predictions in metropolitan areas.
Sansom, Garett; Parras, Juan; Parras, Ana; Nieto, Yudith; Arellano, Yvette; Berke, Philip; McDonald, Thomas; Shipp, Eva; Horney, Jennifer A
2017-08-01
Previous research has shown that communities with low average socioeconomic status (SES) and majority minority populations are more likely to be exposed to industrial buildings, waste facilities, and poor infrastructure compared to white communities with higher average SES. While some studies have demonstrated linkages between exposures to specific environmental contaminates within these communities and negative health outcomes, little research has analyzed the effects of environmental contaminants on the mental and physical health of these populations. A cross-sectional survey collected data from residents of Manchester, a small neighborhood in Houston, TX, that is characterized by industrial sites, unimproved infrastructure, nuisance flooding, and poor air quality. Our study (N = 109) utilized the 12 item Short Form Health Survey version 2 (SF12v2) to assess the general mental and physical health of the community. The community as a whole had reduced physical health scores compared to U.S. national averages. The time residents had lived in the neighborhood was also correlated with a reported reduction in physical health scores (r2 = 0.136; p-value health scores remained after adjusting for age, race, and gender (coef = -0.27, p-value Mental health scores were within national averages and time spent living in the neighborhood did not appear to negatively impact respondent's mental health scores. These findings point to the need for more research to determine the potential for additive physical and mental health impacts in long-term residents in neighborhoods characterized by environmental justice issues.
Czech Academy of Sciences Publication Activity Database
Fedič, Robert; Žurovec, Michal; Sehnal, František
2002-01-01
Roč. 7, - (2002), s. 1-15 ISSN 0037-2455 R&D Projects: GA ČR GA204/00/0019; GA MŠk ME 204 Institutional research plan: CEZ:AV0Z5007907 Keywords : Bombyx * Antheraea * Galleria Subject RIV: CE - Biochemistry
Luther, Megan K.; Arvanitis, Marios; Mylonakis, Eleftherios
2014-01-01
Enterococci are the third most frequent cause of infective endocarditis. A high-inoculum stationary-phase in vitro pharmacodynamic model with simulated endocardial vegetations was used to simulate the human pharmacokinetics of daptomycin at 6 or 10 mg/kg of body weight/day or linezolid at 600 mg every 12 h (q12h), alone or in combination with gentamicin at 1.3 mg/kg q12h or rifampin at 300 mg q8h or 900 mg q24h. Biofilm-forming, vancomycin-susceptible Enterococcus faecalis and vancomycin-resistant Enterococcus faecium (vancomycin-resistant enterococcus [VRE]) strains were tested. At 24, 48, and 72 h, all daptomycin-containing regimens demonstrated significantly more activity (decline in CFU/g) than any linezolid-containing regimen against biofilm-forming E. faecalis. The addition of gentamicin to daptomycin (at 6 or 10 mg/kg) in the first 24 h significantly improved bactericidal activity. In contrast, the addition of rifampin delayed the bactericidal activity of daptomycin against E. faecalis, and the addition of rifampin antagonized the activities of all regimens against VRE at 24 h. Also, against VRE, the addition of gentamicin to linezolid at 72 h improved activity and was bactericidal. Rifampin significantly antagonized the activity of linezolid against VRE at 72 h. In in vivo Galleria mellonella survival assays, linezolid and daptomycin improved survival. Daptomycin at 10 mg/kg improved survival significantly over that with linezolid against E. faecalis. The addition of gentamicin improved the efficacy of daptomycin against E. faecalis and those of linezolid and daptomycin against VRE. We conclude that in enterococcal infection models, daptomycin has more activity than linezolid alone. Against biofilm-forming E. faecalis, the addition of gentamicin in the first 24 h causes the most rapid decline in CFU/g. Of interest, the addition of rifampin decreased the activity of daptomycin against both E. faecalis and VRE. PMID:24867993
Kasmarek, Mark C.; Johnson, Michaela R.; Ramage, Jason K.
2010-01-01
Most of the subsidence in the Houston-Galveston region has occurred as a direct result of groundwater withdrawals for municipal supply, industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers causing compaction of the clay layers of the aquifer sediments. This report, prepared by the U.S. Geological Survey, in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, and Lone Star Groundwater Conservation District, is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and compaction in the Chicot and Evangeline aquifers in the Houston-Galveston region. The report contains maps showing 2010 water-level altitudes for the Chicot, Evangeline, and Jasper aquifers, respectively; maps showing 1-year (2009-10) water-level-altitude changes for each aquifer; maps showing 5-year (2005-10) water-level-altitude changes for each aquifer; maps showing long-term (1990-2010 and 1977-2010) water-level-altitude changes for the Chicot and Evangeline aquifers; a map showing long-term (2000-10) water-level-altitude change for the Jasper aquifer; a map showing locations of borehole extensometer sites; and graphs showing measured compaction of subsurface material at the extensometers from 1973, or later, through 2009. Tables listing the data used to construct each aquifer-data map and the compaction graphs are included. Water levels in the Chicot, Evangeline, and Jasper aquifers were measured during December 2009-March 2010. In 2010, water-level-altitude contours for the Chicot aquifer ranged from 200 feet below National Geodetic Vertical Datum of 1929 or North American Vertical Datum of 1988 (hereinafter, datum) in a small area in southwestern Harris County to 200 feet above datum in central to southwestern Montgomery County. Water-level-altitude changes in the Chicot aquifer ranged from a 49-foot decline to a 67
Vertical profiles of nitrous acid in the nocturnal urban atmosphere of Houston, TX
Directory of Open Access Journals (Sweden)
K. W. Wong
2011-04-01
Full Text Available Nitrous acid (HONO often plays an important role in tropospheric photochemistry as a major precursor of the hydroxyl radical (OH in early morning hours and potentially during the day. However, the processes leading to formation of HONO and its vertical distribution at night, which can have a considerable impact on daytime ozone formation, are currently poorly characterized by observations and models. Long-path differential optical absorption spectroscopy (LP-DOAS measurements of HONO during the 2006 TexAQS II Radical and Aerosol Measurement Project (TRAMP, near downtown Houston, TX, show nocturnal vertical profiles of HONO, with mixing ratios of up to 2.2 ppb near the surface and below 100 ppt aloft. Three nighttime periods of HONO, NO2 and O3 observations during TRAMP were used to perform model simulations of vertical mixing ratio profiles. By adjusting vertical mixing and NOx emissions the modeled NO2 and O3 mixing ratios showed very good agreement with the observations.
Using a simple conversion of NO2 to HONO on the ground, direct HONO emissions, as well as HONO loss at the ground and on aerosol, the observed HONO profiles were reproduced by the model for 1–2 and 7–8 September in the nocturnal boundary layer (NBL. The unobserved increase of HONO to NO2 ratio (HONO/NO2 with altitude that was simulated by the initial model runs was found to be due to HONO uptake being too small on aerosol and too large on the ground. Refined model runs, with adjusted HONO uptake coefficients, showed much better agreement of HONO and HONO/NO2 for two typical nights, except during morning rush hour, when other HONO formation pathways are most likely active. One of the nights analyzed showed an increase of HONO mixing ratios together with decreasing NO2 mixing ratios that the model was unable to reproduce, most likely due to the impact of
Identification of W chromosomes in Lepidoptera by comparative genome hybridization
Czech Academy of Sciences Publication Activity Database
Sahara, K.; Marec, František; Traut, W.
1998-01-01
Roč. 98, č. 6 (1998), s. 20 [International Symposium on Genomics and Proteomics - Functional and Computational Aspects and Annual Meeting of the GfG. 04.10.1998-07.10.1998, Heidelberg] Keywords : Galleria mellonella * DNA Subject RIV: EB - Genetics ; Molecular Biology
SINET: Ethiopian Journal of Science - Vol 33, No 2 (2010)
African Journals Online (AJOL)
... Native Fungal Isolates of Metrahizium anisopliae Var. Acridum and Beauveria bassiana against the Greater Wax Moth, Galleria mellonella (L) (Pyralidae: Lepidoptera) in Ethiopia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. H. Namusana, E Seyoum, 117-124 ...
2013-08-08
..., Printing & Personal System Americas Division, Marketing Services, Houston, Texas; Notice of Investigation... Division, Marketing Services, Houston, Texas. On January 25, 2013, the Department issued a Notice of... & Personal System Americas Division, Marketing Services, Houston, Texas) to be filed. Because the later-filed...
Directory of Open Access Journals (Sweden)
Zahra Jandaghian
2018-03-01
Full Text Available Increasing surface reflectivity in urban areas can decrease ambient temperature, resulting in reducing photochemical reaction rates, reducing cooling energy demands and thus improving air quality and human health. The weather research and forecasting model with chemistry (WRF-Chem is coupled with the multi-layer of the urban canopy model (ML-UCM to investigate the effects of surface modification on urban climate in a two-way nested approach over North America focusing on Sacramento, Houston, and Chicago during the 2011 heat wave period. This approach decreases the uncertainties associated with scale separation and grid resolution and equip us with an integrated simulation setup to capture the full impacts of meteorological and photochemical reactions. WRF-ChemV3.6.1 simulated the diurnal variation of air temperature reasonably well, overpredicted wind speed and dew point temperature, underpredicted relative humidity, overpredicted ozone and nitrogen dioxide concentrations, and underpredicted fine particular matters (PM2.5. The performance of PM2.5 is a combination of overprediction of particulate sulfate and underprediction of particulate nitrate and organic carbon. Increasing the surface albedo of roofs, walls, and pavements from 0.2 to 0.65, 0.60, and 0.45, respectively, resulted in a decrease in air temperature by 2.3 °C in urban areas and 0.7 °C in suburban areas; a slight increase in wind speed; an increase in relative humidity (3% and dew point temperature (0.3 °C; a decrease of PM2.5 and O3 concentrations by 2.7 µg/m3 and 6.3 ppb in urban areas and 1.4 µg/m3 and 2.5 ppb in suburban areas, respectively; minimal changes in PM2.5 subspecies; and a decrease of nitrogen dioxide (1 ppb in urban areas.
Couasnon, Anaïs; Sebastian, Antonia; Morales-Nápoles, Oswaldo
2017-04-01
Recent research has highlighted the increased risk of compound flooding in the U.S. In coastal catchments, an elevated downstream water level, resulting from high tide and/or storm surge, impedes drainage creating a backwater effect that may exacerbate flooding in the riverine environment. Catchments exposed to tropical cyclone activity along the Gulf of Mexico and Atlantic coasts are particularly vulnerable. However, conventional flood hazard models focus mainly on precipitation-induced flooding and few studies accurately represent the hazard associated with the interaction between discharge and elevated downstream water levels. This study presents a method to derive stochastic boundary conditions for a coastal watershed. Mean daily discharge and maximum daily residual water levels are used to build a non-parametric Bayesian network (BN) based on copulas. Stochastic boundary conditions for the watershed are extracted from the BN and input into a 1-D process-based hydraulic model to obtain water surface elevations in the main channel of the catchment. The method is applied to a section of the Houston Ship Channel (Buffalo Bayou) in Southeast Texas. Data at six stream gages and two tidal stations are used to build the BN and 100-year joint return period events are modeled. We find that the dependence relationship between the daily residual water level and the mean daily discharge in the catchment can be represented by a Gumbel copula (Spearman's rank correlation coefficient of 0.31) and that they result in higher water levels in the mid- to upstream reaches of the watershed than when modeled independently. This indicates that conventional (deterministic) methods may underestimate the flood hazard associated with compound flooding in the riverine environment and that such interactions should not be neglected in future coastal flood hazard studies.
Kursi koolkond näitab oma töid biennaaliaegses Veneetsias / Priit Pangsepp ; interv. Tiina Sarv
Pangsepp, Priit
2007-01-01
Viljandi kunstniku Priit Pangsepaga Kursi koolkonna 20. aastapäeva tähistavast kunstinäitusest Galleria d'Arte III Millennios Veneetsias. Maale näitavad Priit Pangsepp, Ilmar Kruusamäe, Peeter Allik, Albert Gulk ja Priit Pajos. Näitus ei esinda biennaaliaegses Veneetsias Eestit vaid Kursi koolkonda
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
... College Station, TX 77843. Present address: Barrens Consulting Co., 273 Pepe's Farm Road, Milford, CT 06470. Department of Physics, Sam Houston State University, Huntsville, TX 77341. Present address: SN4, NASA-JSC, Houston, TX 77858. Shell Development Corporation, P.O. Box 481, Houston, Texas 77001.
Directory of Open Access Journals (Sweden)
Silvia Cecchini
2013-05-01
Full Text Available Nel ruolo di direttore di musei Corrado Ricci sperimenta, tra il 1893 e il 1904, la possibilità di far comunicare il museo con un pubblico più ampio degli addetti ai lavori attraverso sale allestite secondo un impianto tipologico-iconografico. Crea così le sale storico-topografiche e le sale dei ritratti. Il modello viene realizzato per la prima volta nella Galleria Reale di Parma, poi replicato nella Galleria Estense di Modena, nell’Accademia Carrara di Bergamo, ed anche nella mostra temporanea dedicata all’antica arte senese. Introduce uno spazio di mediazione tra gli spazi della città e le sale del museo, tra il tempo presente della vita e il passato ritratto nei quadri. Proposte che oggi ci possono sollecitare a riflettere sul ruolo della ricerca e su quello della traduzione, momenti essenziali del messaggio che il museo vorrebbe trasmettere. As Museum Director Corrado Ricci experiences, between 1893 and 1904, the ability to communicate the Museum to a wider audience then the scholars through halls outfitted with a typological-iconographic system. He creates topographic-historic rooms and rooms of portraits. The model is realized for the first time in the Royal Gallery of Parma, then replicated in Galleria Estense in Modena, in the Accademia Carrara of Bergamo, and also in the temporary exhibition dedicated to ancient art of Siena. He introduces a mediation between the spaces of the city and the rooms of the Museum, between the present life and the past of the paintings. Proposals that today we shall seek to reflect on the role of research and translation, essential moments of the message that the Museum would like to transmit.
DCS Survey Submission for Unincorporated Houston County, Houston County, AL
Federal Emergency Management Agency, Department of Homeland Security — Survey data includes spatial datasets and data tables necessary to digitally represent data collected in the survey phase of the study. (Source: FEMA Guidelines and...
Directory of Open Access Journals (Sweden)
Ljerka Dulibic
2016-12-01
Full Text Available The basis of today’s Strossmayer Gallery’s collection is the bequest of European Old Masters’ paintings collected by Bishop J. J. Strossmayer (1815-1905, with the fundamental desire to enlarge the scope of the Croatian cultural tradition through the appropriation of European elite culture. The meaning and function of the Gallery changed considerably over time. Before WWI, the Strossmayer Gallery was a utopian project in the sense that its mission was not only to fabricate what was seen to be a missing artistic past, but also to create the foundations for a future, native art. After WWI, with the formation of the Kingdom of Serbs, Croats and Slovenes, the national state was, at least in some form, realized, and the Gallery now turned its attention to concrete matters. In this paper, we follow the paths of intensive professionalization of the wide range of activities in the interwar period, retracing not only the history of museum presentation, or the history of Art History and of Art Conservation in Croatia, but also some traces of the general development of the dynamic, intertwined and significant relationship between Art History, Art Conservation and the museum. Il nucleo dell’odierna collezione della Galleria Strossmayer è costituito dal lascito delle opere dei maestri antichi europei raccolti dal vescovo J.J. Strossmayer (1815-1905, il cui scopo fondamentale fu di allargare la tradizione culturale croata con l’appropriazione della cultura elitaria europea. Con il passare del tempo, il signifi cato e la funzione della Galleria cambiò considerevolmente. Prima della Prima guerra mondiale la Galleria Strossmayer fu un progetto utopistico nel senso che la sua missione non era solo di riempire il vuoto visto come il passato artistico mancante, ma anche di creare le fondamenta per una futura arte locale. Dopo la guerra, con la formazione del Regno dei Serbi, Croati e Sloveni, lo stato nazionale fu, almeno in un certo senso, realizzato, e
Modulation of Replicative Lifespan in Cryptococcus neoformans: Implications for Virulence
Bouklas, Tejas; Jain, Neena; Fries, Bettina C.
2017-01-01
The fungal pathogen, Cryptococcus neoformans, has been shown to undergo replicative aging. Old cells are characterized by advanced generational age and phenotypic changes that appear to mediate enhanced resistance to host and antifungal-based killing. As a consequence of this age-associated resilience, old cells accumulate during chronic infection. Based on these findings, we hypothesized that shifting the generational age of a pathogenic yeast population would alter its vulnerability to the host and affect its virulence. SIR2 is a well-conserved histone deacetylase, and a pivotal target for the development of anti-aging drugs. We tested its effect on C. neoformans’ replicative lifespan (RLS). First, a mutant C. neoformans strain (sir2Δ) was generated, and confirmed a predicted shortened RLS in sir2Δ cells consistent with its known role in aging. Next, RLS analysis showed that treatment of C. neoformans with Sir2p-agonists resulted in a significantly prolonged RLS, whereas treatment with a Sir2p-antagonist shortened RLS. RLS modulating effects were dependent on SIR2 and not observed in sir2Δ cells. Because SIR2 loss resulted in a slightly impaired fitness, effects of genetic RLS modulation on virulence could not be compared with wild type cells. Instead we chose to chemically modulate RLS, and investigated the effect of Sir2p modulating drugs on C. neoformans cells in a Galleria mellonella infection model. Consistent with our hypothesis that shifts in the generational age of the infecting yeast population alters its vulnerability to host cells, we observed decreased virulence of C. neoformans in the Galleria host when RLS was prolonged by treatment with Sir2p agonists. In contrast, treatment with a Sir2p antagonist, which shortens RLS enhanced virulence in Galleria. In addition, combination of Sir2p agonists with antifungal therapy enhanced the antifungal’s effect. Importantly, no difference in virulence was observed with drug treatment when sir2Δ cells
Czech Academy of Sciences Publication Activity Database
Sláma, Karel; Lukáš, J.
2013-01-01
Roč. 110, č. 2 (2013), s. 221-230 ISSN 1210-5759 Grant - others:Ministerstvo zemědělství(CZ) MZe0002700604 Institutional support: RVO:60077344 Keywords : Lepidoptera * Galleria mellonella * Coleoptera Subject RIV: ED - Physiology Impact factor: 1.076, year: 2013 http://www.eje.cz/pdfs/110/2/221
77 FR 20647 - Ocean Energy Safety Advisory Committee (OESC); Notice of Meeting
2012-04-05
... Intercontinental Airport Hotel in Houston, Texas. DATES: Thursday, April 26, 2012, from 8 a.m. to 5:30 p.m. ADDRESSES: Doubletree by Hilton Houston Intercontinental Airport Hotel, 15747 JFK Boulevard, Houston, Texas... and Budget's Circular No. A-63, Revised. Dated: March 30, 2012. James A. Watson, Director, Bureau of...
Directory of Open Access Journals (Sweden)
S. Wesley Long
2017-05-01
Full Text Available Klebsiella pneumoniae is a major human pathogen responsible for high morbidity and mortality rates. The emergence and spread of strains resistant to multiple antimicrobial agents and documented large nosocomial outbreaks are especially concerning. To develop new therapeutic strategies for K. pneumoniae, it is imperative to understand the population genomic structure of strains causing human infections. To address this knowledge gap, we sequenced the genomes of 1,777 extended-spectrum beta-lactamase-producing K. pneumoniae strains cultured from patients in the 2,000-bed Houston Methodist Hospital system between September 2011 and May 2015, representing a comprehensive, population-based strain sample. Strains of largely uncharacterized clonal group 307 (CG307 caused more infections than those of well-studied epidemic CG258. Strains varied markedly in gene content and had an extensive array of small and very large plasmids, often containing antimicrobial resistance genes. Some patients with multiple strains cultured over time were infected with genetically distinct clones. We identified 15 strains expressing the New Delhi metallo-beta-lactamase 1 (NDM-1 enzyme that confers broad resistance to nearly all beta-lactam antibiotics. Transcriptome sequencing analysis of 10 phylogenetically diverse strains showed that the global transcriptome of each strain was unique and highly variable. Experimental mouse infection provided new information about immunological parameters of host-pathogen interaction. We exploited the large data set to develop whole-genome sequence-based classifiers that accurately predict clinical antimicrobial resistance for 12 of the 16 antibiotics tested. We conclude that analysis of large, comprehensive, population-based strain samples can assist understanding of the molecular diversity of these organisms and contribute to enhanced translational research.
Differential endophytic colonization of sorghum plant by eight ...
African Journals Online (AJOL)
Virulence of the conidia before and after endophytic growth phases were assessed using Galleria mellonella larvae mortality bioassay in-vitro. All the strains of the fungi colonised the sorghum plant. The strains of I. farinosa and B. bassiana were detected in the roots, the stem and the leaves while M. anisopliae was ...
Challenges for developing biopesticides against varroa
Biological control of bee pests is a small but growing field as beekeepers and bee researchers seek ways to reduce pesticide use. Of the arthropod pests of honey bees, the pests that have been targets of biological control on at least the laboratory level are the Wax Moths Galleria mellonella and Ac...
International Nuclear Information System (INIS)
Spada, Nicholas; Bozlaker, Ayse; Chellam, Shankararaman
2012-01-01
Highlights: ► Analytical method for PGEs, main group, transition and rare earth metals developed. ► Comprehensive characterization of road and tunnel dust samples was accomplished. ► PGEs in dusts arise from autocatalyst attrition. ► Mobile sources also contributed to Cu, Zn, Ga, As, Mo, Cd, Sn, Sb, Ba, W and Pb. ► All other elements, including rare earths arose from crustal sources. - Abstract: Platinum group elements (PGEs) including Rh, Pd, and Pt are important tracers for vehicular emissions, though their measurement is often challenging and difficult to replicate in environmental campaigns. These challenges arise from sample preparation steps required for PGE quantitation, which often cause severe isobaric interferences and spectral overlaps from polyatomic species of other anthropogenically emitted metals. Consequently, most previous road dust studies have either only quantified PGEs or included a small number of anthropogenic elements. Therefore a novel analytical method was developed to simultaneously measure PGEs, lanthanoids, transition and main group elements to comprehensively characterize the elemental composition of urban road and tunnel dusts. Dust samples collected from the vicinity of high-traffic roadways and a busy underwater tunnel restricted to single-axle (predominantly gasoline-driven) vehicles in Houston, TX were analyzed for 45 metals with the newly developed method using dynamic reaction cell-quadrupole-inductively coupled plasma–mass spectrometry (DRC-q-ICP–MS). Average Rh, Pd and Pt concentrations were 152 ± 52, 770 ± 208 and 529 ± 130 ng g −1 respectively in tunnel dusts while they varied between 6 and 8 ng g −1 , 10 and 88 ng g −1 and 35 and 131 ng g −1 in surface road dusts. Elemental ratios and enrichment factors demonstrated that PGEs in dusts originated from autocatalyst attrition/abrasion. Strong evidence is also presented for mobile source emissions of Cu, Zn, Ga, As, Mo, Cd, Sn, Sb, Ba, W and Pb. However
Kasmarek, Mark C.; Ramage, Jason K.
2017-08-16
Most of the land-surface subsidence in the Houston-Galveston region, Texas, has occurred as a direct result of groundwater withdrawals for municipal supply, commercial and industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers, thereby causing compaction of the aquifer sediments, mostly in the fine-grained silt and clay layers. This report, prepared by the U.S. Geological Survey in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District, is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and measured cumulative compaction of subsurface sediments in the Chicot and Evangeline aquifers in the Houston-Galveston region. This report contains regional-scale maps depicting approximate 2017 water-level altitudes (represented by measurements made during December 2016 through March 2017) and long-term water-level changes for the Chicot, Evangeline, and Jasper aquifers; a map depicting locations of borehole-extensometer (hereinafter referred to as “extensometer”) sites; and graphs depicting measured long-term cumulative compaction of subsurface sediments at the extensometers during 1973–2016.In 2017, water-level-altitude contours for the Chicot aquifer ranged from 200 feet (ft) below the North American Vertical Datum of 1988 (hereinafter referred to as “datum”) in two localized areas in southwestern and northwestern Harris County to 200 ft above datum in west-central Montgomery County. The largest water-level-altitude decline (120 ft) depicted by the 1977–2017 water-level-change contours for the Chicot aquifer was in northwestern Harris County. A broad area where water-level altitudes declined in the Chicot aquifer extends from northwestern, north-central, and southwestern Harris County
Directory of Open Access Journals (Sweden)
Roderick eCard
2016-05-01
Full Text Available Salmonella enterica is a foodborne zoonotic pathogen of significant public health concern. We have characterised the virulence and antimicrobial resistance gene content of 95 Salmonella isolates from 11 serovars by DNA microarray recovered from UK livestock or imported meat. Genes encoding resistance to sulphonamides (sul1, sul2, tetracycline (tet(A, tet(B, streptomycin (strA, strB, aminoglycoside (aadA1, aadA2, beta-lactam (blaTEM, and trimethoprim (dfrA17 were common. Virulence gene content differed between serovars; S. Typhimurium formed two subclades based on virulence plasmid presence. Thirteen isolates were selected by their virulence profile for pathotyping using the Galleria mellonella pathogenesis model. Infection with a chicken invasive S. Enteritidis or S. Gallinarum isolate, a multidrug resistant S. Kentucky, or a S. Typhimurium DT104 isolate resulted in high mortality of the larvae; notably presence of the virulence plasmid in S. Typhimurium was not associated with increased larvae mortality. Histopathological examination showed that infection caused severe damage to the Galleria gut structure. Enumeration of intracellular bacteria in the larvae 24 hours post-infection showed increases of up to 7 log above the initial inoculum and transmission electron microscopy (TEM showed bacterial replication in the haemolymph. TEM also revealed the presence of vacuoles containing bacteria in the haemocytes, similar to Salmonella containing vacuoles observed in mammalian macrophages; although there was no evidence from our work of bacterial replication within vacuoles. This work shows that microarrays can be used for rapid virulence genotyping of S. enterica and that the Galleria animal model replicates some aspects of Salmonella infection in mammals. These procedures can be used to help inform on the pathogenicity of isolates that may be antibiotic resistant and have scope to aid the assessment of their potential public and animal health risk.
Czech Academy of Sciences Publication Activity Database
Takiya, S.; Gaži, Michal; Mach, Václav
2003-01-01
Roč. 33, - (2003), s. 1145-1154 ISSN 0965-1748 R&D Projects: GA AV ČR KSK5052113; GA ČR GA301/96/0153; GA MŠk ME 176 Institutional research plan: CEZ:AV0Z5007907 Keywords : Drosophila * bombys * Galleria Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.358, year: 2003
Singhal, Surendra N.
2003-01-01
The SAE G-11 RMSL Division and Probabilistic Methods Committee meeting sponsored by the Picatinny Arsenal during March 1-3, 2004 at Westin Morristown, will report progress on projects for probabilistic assessment of Army system and launch an initiative for probabilistic education. The meeting features several Army and industry Senior executives and Ivy League Professor to provide an industry/government/academia forum to review RMSL technology; reliability and probabilistic technology; reliability-based design methods; software reliability; and maintainability standards. With over 100 members including members with national/international standing, the mission of the G-11s Probabilistic Methods Committee is to enable/facilitate rapid deployment of probabilistic technology to enhance the competitiveness of our industries by better, faster, greener, smarter, affordable and reliable product development.
International Nuclear Information System (INIS)
Mickunas, D.B.
2009-01-01
An Urban Air Toxic Monitoring Program was developed by the United States Environmental Protection Agency (US EPA) to help evaluate the potential toxic air pollution in urban areas. The Trace Atmospheric Gas Analyzer (TAGA) was used to monitor the ambient air for target compounds associated with industrial, motor vehicle, and natural emissions sources in areas adjacent to the Houston Ship Channel in Texas. In this study, the TAGA used triple quadrupole technology to perform qualitative and quantitative analyses for benzene, toluene, xylenes, styrene, 1,3-butadiene, methyl tert-butyl ether, and 1,2,3-trichloropropane. The concentrations for the various ion pairs of the target compounds were updated approximately every 2 seconds. The information was incorporated into the geographic information system (GIS) along with the global positioning system (GPS) information for the TAGA location, aerial views of the monitoring area, and meteorological data for the associated region. The information is used to isolate the emission sources and help reduce air pollution. The GPS output helps determine a path-averaged concentration along various routes. Combined with meteorological data, this information can be used in risk assessment to calculate downwind impacts associated with the target compounds under other meteorological conditions and to determine health impacts. It was concluded that the TAGA can provide rapid, accurate and reliable analytical information for monitoring ambient air. 2 refs., 1 tab., 9 figs
Energy Technology Data Exchange (ETDEWEB)
Mickunas, D.B. [United States Environmental Protection Agency, Research Triangle Park, NC (United States). Environmental Response Team; Wood, J.; Weeks, W. [Lockheed Martin Response Engineering and Analytical Contract, Edison, NJ (Canada)
2009-07-01
An Urban Air Toxic Monitoring Program was developed by the United States Environmental Protection Agency (US EPA) to help evaluate the potential toxic air pollution in urban areas. The Trace Atmospheric Gas Analyzer (TAGA) was used to monitor the ambient air for target compounds associated with industrial, motor vehicle, and natural emissions sources in areas adjacent to the Houston Ship Channel in Texas. In this study, the TAGA used triple quadrupole technology to perform qualitative and quantitative analyses for benzene, toluene, xylenes, styrene, 1,3-butadiene, methyl tert-butyl ether, and 1,2,3-trichloropropane. The concentrations for the various ion pairs of the target compounds were updated approximately every 2 seconds. The information was incorporated into the geographic information system (GIS) along with the global positioning system (GPS) information for the TAGA location, aerial views of the monitoring area, and meteorological data for the associated region. The information is used to isolate the emission sources and help reduce air pollution. The GPS output helps determine a path-averaged concentration along various routes. Combined with meteorological data, this information can be used in risk assessment to calculate downwind impacts associated with the target compounds under other meteorological conditions and to determine health impacts. It was concluded that the TAGA can provide rapid, accurate and reliable analytical information for monitoring ambient air. 2 refs., 1 tab., 9 figs.
Asquith, William H.; Cleveland, Theodore G.; Roussel, Meghan C.
2011-01-01
Estimates of peak and time of peak streamflow for small watersheds (less than about 640 acres) in a suburban to urban, low-slope setting are needed for drainage design that is cost-effective and risk-mitigated. During 2007-10, the U.S. Geological Survey (USGS), in cooperation with the Harris County Flood Control District and the Texas Department of Transportation, developed a method to estimate peak and time of peak streamflow from excess rainfall for 10- to 640-acre watersheds in the Houston, Texas, metropolitan area. To develop the method, 24 watersheds in the study area with drainage areas less than about 3.5 square miles (2,240 acres) and with concomitant rainfall and runoff data were selected. The method is based on conjunctive analysis of rainfall and runoff data in the context of the unit hydrograph method and the rational method. For the unit hydrograph analysis, a gamma distribution model of unit hydrograph shape (a gamma unit hydrograph) was chosen and parameters estimated through matching of modeled peak and time of peak streamflow to observed values on a storm-by-storm basis. Watershed mean or watershed-specific values of peak and time to peak ("time to peak" is a parameter of the gamma unit hydrograph and is distinct from "time of peak") of the gamma unit hydrograph were computed. Two regression equations to estimate peak and time to peak of the gamma unit hydrograph that are based on watershed characteristics of drainage area and basin-development factor (BDF) were developed. For the rational method analysis, a lag time (time-R), volumetric runoff coefficient, and runoff coefficient were computed on a storm-by-storm basis. Watershed-specific values of these three metrics were computed. A regression equation to estimate time-R based on drainage area and BDF was developed. Overall arithmetic means of volumetric runoff coefficient (0.41 dimensionless) and runoff coefficient (0.25 dimensionless) for the 24 watersheds were used to express the rational
Falomo, L.; Bevilacqua, F.; Montalbetti, Claudia
2000-01-01
E' già stato aggiunto da tempo un altro tassello alla "Galleria dei Personaggi" su Web, quello su Charles Augustin Coulomb. Tale sito, come quello precedente Alessandro Volta, è stato progettato nel Laboratorio di Tecnologie educative del Dipartimento di Fisica "A.Volta" dell'Università di Pavia, e ha visto collaborare ancora una volta tale laboratorio e il CILEA.
Occurrence of entomopathogenic fungi in arable soil
Directory of Open Access Journals (Sweden)
Ryszard Miętkiewski
2014-08-01
Full Text Available Samples of soil were taken from arable field and from balk. Larvae of Galleria mellonella and Ephestia kühniella were used as an "insect bait" for isolation of entomopathogenic fungi from soil. Metarhizium anisopliae and Paecilomyces fumosoroseus were isolated from both kind of soil. but Beauveria bassiana was present only in soil taken from balk.
HIV testing implementation in two urban cities: practice, policy, and perceived barriers.
Directory of Open Access Journals (Sweden)
Camden J Hallmark
Full Text Available Although funding has supported the scale up of routine, opt-out HIV testing in the US, variance in implementation mechanisms and barriers in high-burden jurisdictions remains unknown.We conducted a survey of health care organizations in Washington, DC and Houston/Harris County to determine number of HIV tests completed in 2011, policy and practices associated with HIV testing, funding mechanisms, and reported barriers to testing in each jurisdiction and to compare results between jurisdictions.In 2012, 43 Houston and 35 DC HIV-testing organizations participated in the survey. Participants represented 85% of Department of Health-supported testers in DC and 90% of Department of Health-supported testers in Houston. The median number of tests per organization was 568 in DC and 1045 in Houston. Approximately 50% of organizations in both DC and Houston exclusively used opt-in consent and most conducted both pre- and post-test counseling with HIV testing (80% of organizations in DC, 70% in Houston. While the most frequent source of funding in DC was the Department of Health, Houston organizations primarily billed the patient or third-party payers. Barriers to testing most often reported were lack of funding, followed by patient discomfort/refusal with more barriers reported in DC.Given unique policies, resources and programmatic contexts, DC and Houston have taken different approaches to support routine testing. Many organizations in both cities reported opt-in consent approaches and pre-test counseling, suggesting 2006 national HIV testing recommendations are not being followed consistently. Addressing the barriers to testing identified in each jurisdiction may improve expansion of testing.
Byun, Daewon W; Kim, Soontae; Czader, Beata; Nowak, David; Stetson, Stephen; Estes, Mark
2005-06-01
The Houston-Galveston Area (HGA) is one of the most severe ozone non-attainment regions in the US. To study the effectiveness of controlling anthropogenic emissions to mitigate regional ozone nonattainment problems, it is necessary to utilize adequate datasets describing the environmental conditions that influence the photochemical reactivity of the ambient atmosphere. Compared to the anthropogenic emissions from point and mobile sources, there are large uncertainties in the locations and amounts of biogenic emissions. For regional air quality modeling applications, biogenic emissions are not directly measured but are usually estimated with meteorological data such as photo-synthetically active solar radiation, surface temperature, land type, and vegetation database. In this paper, we characterize these meteorological input parameters and two different land use land cover datasets available for HGA: the conventional biogenic vegetation/land use data and satellite-derived high-resolution land cover data. We describe the procedures used for the estimation of biogenic emissions with the satellite derived land cover data and leaf mass density information. Air quality model simulations were performed using both the original and the new biogenic emissions estimates. The results showed that there were considerable uncertainties in biogenic emissions inputs. Subsequently, ozone predictions were affected up to 10 ppb, but the magnitudes and locations of peak ozone varied each day depending on the upwind or downwind positions of the biogenic emission sources relative to the anthropogenic NOx and VOC sources. Although the assessment had limitations such as heterogeneity in the spatial resolutions, the study highlighted the significance of biogenic emissions uncertainty on air quality predictions. However, the study did not allow extrapolation of the directional changes in air quality corresponding to the changes in LULC because the two datasets were based on vastly different
Sericin composition in the silk of Antheraea yamamai
Czech Academy of Sciences Publication Activity Database
Žurovec, Michal; Yonemura, N.; Kludkiewicz, Barbara; Sehnal, František; Kodrík, Dalibor; Cota Vieira, Ligia; Kučerová, Lucie; Strnad, H.; Koník, P.; Sehadová, Hana
2016-01-01
Roč. 17, č. 5 (2016), s. 1776-1787 ISSN 1525-7797 EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Galleria mellonella L. * Bombyx mori * mechanical properties Subject RIV: CE - Biochemistry OBOR OECD: Biochemistry and molecular biology Impact factor: 5.246, year: 2016 http://pubs.acs.org/doi/abs/10.1021/acs.biomac.6b00189
Nonarteritic anterior ischemic optic neuropathy: cause, effect, and management
Directory of Open Access Journals (Sweden)
Berry S
2017-09-01
Full Text Available Shauna Berry,1 Weijie V Lin,2 Ama Sadaka,1 Andrew G Lee1–7 1Department of Ophthalmology, Blanton Eye Institute, Houston Methodist Hospital, Houston, TX, USA; 2Department of Ophthalmology, Baylor College of Medicine, Houston, TX, USA; 3Department of Ophthalmology and Visual Sciences, University of Texas Medical Branch (UTMB, Galveston, TX, USA; 4Department of Ophthalmology, 5Department of Neurology, 6Department of Neurosurgery, Weill Cornell Medicine, Houston, TX, USA; 7Department of Ophthalmology, The University of Texas MD Anderson Cancer Center, Houston, TX, USA Abstract: Nonarteritic anterior ischemic optic neuropathy (NAION is the most common form of ischemic optic neuropathy and the second most common optic neuropathy. Patients are generally over the age of 50 years with vasculopathic risk factors (eg, diabetes mellitus, hypertension, and obstructive sleep apnea. The exact mechanism of NAION is not fully understood. In addition, several treatment options have been proposed. This article summarizes the current literature on the diagnosis, treatment, and management of NAION. Keywords: anterior ischemic optic neuropathy, nonarteritic anterior ischemic optic neuropathy, ischemic optic neuropathy
DEFF Research Database (Denmark)
Jensen, Rasmus Hare; Thyssen Astvad, Karen Marie; Vale Silva, Luis
2015-01-01
-MS were used for sterol analyses. In vivo virulence was determined in the insect model Galleria mellonella and evaluated by log-rank Mantel–Cox tests. Results: P-1 + P-2 were susceptible, P-3 + P-4 fluconazole resistant, P-5 pan-azole resistant, P-6 + P-7 pan-azole and echinocandin resistant and P-8 + P-9...
zation of knowledge of condom use and modeling among military ...
African Journals Online (AJOL)
Administrator
1Institute of Community Health, College of Pharmacy, University of Houston, Houston, Texas 77030; 2 University of Texas, School of Public. Health .... marijuana use, and attitude towards condom ... adjust for the possible confounding effects.
Kasmarek, Mark C.; Ramage, Jason K.; Johnson, Michaela R.
2016-10-07
Most of the land-surface subsidence in the Houston-Galveston region, Texas, has occurred as a direct result of groundwater withdrawals for municipal supply, commercial and industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers, thereby causing compaction of the aquifer sediments, mostly in the fine-grained silt and clay layers. This report, prepared by the U.S. Geological Survey in cooperation with the Harris-Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District, is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and measured cumulative compaction of subsurface sediments in the Chicot and Evangeline aquifers in the Houston-Galveston region. The report contains regional-scale maps depicting approximate 2016 water-level altitudes (represented by measurements made during December 2015–March 2016) for the Chicot, Evangeline, and Jasper aquifers; maps depicting 1-year (2015–16) water-level changes for each aquifer; maps depicting approximate contoured 5-year (2011–16) water-level changes for each aquifer; maps depicting approximate contoured long-term (1990–2016 and 1977–2016) water-level changes for the Chicot and Evangeline aquifers; a map depicting approximate contoured long-term (2000–16) water-level changes for the Jasper aquifer; a map depicting locations of borehole-extensometer sites; and graphs depicting measured long-term cumulative compaction of subsurface sediments at the extensometers during 1973–2015. Tables listing the water-level data used to construct each water-level map for each aquifer and the measured long-term cumulative compaction data for each extensometer site are included. Graphs depicting water-level measurement data also are included; these graphs can be used to approximate
2013-01-03
... conjunction with a state stakeholder meeting being held by the Maryland Department of Natural Resources on......... Houston, TX Clear Lake City-County 5 p.m.-8 p.m Freeman Branch Library, 16616 Diana Lane, Houston, Texas...
Indian Academy of Sciences (India)
source”– is now located at the University of Houston ... University of Houston Libraries), illustrates Feynman's brilliance as he delved into fundamental questions in biology ..... information content in a code of dots and dashes to represent the.
Hydraulics, HOUSTON COUNTY, AL
Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...
HYDROLOGY, HOUSTON COUNTY, ALABAMA
Federal Emergency Management Agency, Department of Homeland Security — Hydrology data include spatial datasets and data tables necessary for documenting the hydrologic procedures for estimating ALood discharges for a ALood Insurance...
HOUSTON COUNTY, ALABAMA ORTHOIMAGERY
Federal Emergency Management Agency, Department of Homeland Security — Digital orthographic imagery datasets contain georeferenced images of the Earth's surface, collected by a sensor in which object displacement has been removed for...
Fog chemistry in the Texas-Louisiana Gulf Coast corridor
Raja, Suresh; Raghunathan, Ravikrishna; Yu, Xiao-Ying; Lee, Taehyoung; Chen, Jing; Kommalapati, Raghava R.; Murugesan, Karthik; Shen, Xinhua; Qingzhong, Yuan; Valsaraj, Kalliat T.; Collett, Jeffrey L.
Fog samples were collected in two population centers of the US Gulf Coast (Houston, Texas and Baton Rouge, Louisiana) using Caltech active strand cloud collectors. A total of 32 fogwater samples were collected in Baton Rouge (November 2004-February 2005) and Houston (February 2006). These samples were analyzed for pH, total and dissolved organic carbon, major inorganic ions, and a variety of organic compounds including organic acids, aromatics, carbonyls, and linear alkanes. Fogs in both environments were of moderate density, with typical fog liquid water contents <100 mg m -3. Fog samples collected in Houston reflect a clear influence of marine and anthropogenic inputs, while Baton Rouge samples also reflect agricultural inputs. The volume-weighted mean fog pH was somewhat more acidic (˜4.3) in Houston than in Baton Rouge (˜5.0). A wide pH range was observed in fog at both locations. Houston fog had higher concentrations of Cl -, NO 3-, Na +, Mg 2+, and Ca 2+. Sulfate to nitrate ratios were high in fogs at both locations, typical of many clouds in the eastern US. Total organic carbon concentrations were much higher in Houston fogs than in Baton Rouge fogs. Efforts to speciate dissolved organic carbon (DOC) reveal large contributions from organic acids and carbonyls, with smaller contributions from other organic compound families including aromatics, alkanes, amides, and alcohols. Approximately 40% of the fog DOC was unspeciated in samples from both study locations.
Transportation Security Institute: recruiting next generation professionals.
2012-08-01
"The Center for Transportation Training and Research (CTTR), as part of Texas Southern University (TSU), served as host for the 2012 Transportation Security Institute (TSI) in Houston and surrounding area. The 2012 Houston TSI focuses on the mission ...
47 CFR 90.614 - Segments of the 806-824/851-869 MHz band for non-border areas.
2010-10-01
..., Henry, Houston, Jackson, Jefferson, Lamar, Lauderdale, Lawrence, Lee, Limestone, Lowndes, Macon, Madison..., Greene, Gwinnett, Habersham, Hall, Hancock, Haralson, Harris, Hart, Heard, Henry, Houston, Irwin, Jackson, Jasper, Jeff Davis, Jefferson, Jenkins, Johnson, Jones, Lamar, Lanier, Laurens, Lee, Liberty, Lincoln...
Pan, Shuai; Choi, Yunsoo; Roy, Anirban; Jeon, Wonbae
2017-09-01
A WRF-SMOKE-CMAQ air quality modeling system was used to investigate the impact of horizontal spatial resolution on simulated nitrogen oxides (NOx) and ozone (O3) in the Greater Houston area (a non-attainment area for O3). We employed an approach recommended by the United States Environmental Protection Agency to allocate county-based emissions to model grid cells in 1 km and 4 km horizontal grid resolutions. The CMAQ Integrated Process Rate analyses showed a substantial difference in emissions contributions between 1 and 4 km grids but similar NOx and O3 concentrations over urban and industrial locations. For example, the peak NOx emissions at an industrial and urban site differed by a factor of 20 for the 1 km and 8 for the 4 km grid, but simulated NOx concentrations changed only by a factor of 1.2 in both cases. Hence, due to the interplay of the atmospheric processes, we cannot expect a similar level of reduction of the gas-phase air pollutants as the reduction of emissions. Both simulations reproduced the variability of NASA P-3B aircraft measurements of NOy and O3 in the lower atmosphere (from 90 m to 4.5 km). Both simulations provided similar reasonable predictions at surface, while 1 km case depicted more detailed features of emissions and concentrations in heavily polluted areas, such as highways, airports, and industrial regions, which are useful in understanding the major causes of O3 pollution in such regions, and to quantify transport of O3 to populated communities in urban areas. The Integrated Reaction Rate analyses indicated a distinctive difference of chemistry processes between the model surface layer and upper layers, implying that correcting the meteorological conditions at the surface may not help to enhance the O3 predictions. The model-observation O3 bias in our studies (e.g., large over-prediction during the nighttime or along Gulf of Mexico coastline), were due to uncertainties in meteorology, chemistry or other processes. Horizontal grid
ARI Environmental, Inc. (ARI) was retained by Houston Refining LP (HRO) to conduct an emission test program at their refinery located in Houston, Texas. The testing was conducted on on the 736 Delayed Coking Unit (DCU) in response to EPA's ICR.
2012-12-06
..., Cumberland, Davidson, DeKalb, Dickson, Fentress, Franklin, Giles, Grundy, Henry, Hickman, Houston, Humphreys..., Hall, Hancock, Haralson, Harris, Hart, Heard, Henry, Houston, Irwin, Jackson, Jasper, Jefferson, Jenkins, Johnson, Jones, Lamar, Laurens, Lee, Liberty, Lincoln, Long, Lumpkin, McDuffie, McIntosh, Macon...
Asphahani, Aziz; Siegel, Sidney; Siegel, Edward
2010-03-01
Siegel [[J.Mag.Mag.Mtls.7,312(78); PSS(a)11,45(72); Semis.& Insuls.5(79)] (at: ORNL, ANS, Westin``KL"ouse, PSEG, IAEA, ABB) warning of old/new nuclear-reactors/spent-fuel-casks/refineries/ jet/missile/rocket-engines austenitic/FCC Ni/Fe-based (so MIS- called)``super"alloys(182/82;Hastelloy-X; 600;304/304L-SSs; 690 !!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's- diseas(WD)[J.Appl.Phys.17,857(46)]; Ostwald-ripening; spinodal- decomposition; overageing-embrittlement; thermomechanical- INstability: Mayo[Google: ``If Leaks Could Kill"; at flickr.com search on ``Giant-Magnotoresistance"; find: [SiegelPolitics(79)]; Hoffman[animatedsoftware.com],...what DOE/NRC MISlabels as ``butt-welds" ``stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embrit- tlement caused brittle-fracture cracking from early/ongoing AEC/DOE-n``u''tional-la``v''atories sabotage!!!
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Amir Hossein Souri1 Sanaz Vajedian2. Department of Earth and Atmospheric Sciences, University of Houston, Houston, TX 77204, USA. Department of Surveying and Geomatics Engineering, University College of Engineering, University of Tehran, North Kargar Ave., P.O. Box 11365-4563, Tehran, Iran.
Lilly, M. R.; Feditova, A.; Levine, K.; Giardino, J. R.
2017-12-01
The Harris County Flood Control District has an impressive amount of information available for the public related to flood management and response. During Hurricane Harvey, this information was used by the authors to help address daily questions from family and friends living in the Houston area. Common near-real-time reporting data included precipitation and water levels. Maps included locations of data stations, stream or bayou conditions (in bank, out of bank) and watershed or drainage boundaries. In general, the data station reporting and online information was updating well throughout the hurricane and post-flooding period. Only a few of the data reporting stations had problems with water level sensor measurements. The overall information was helpful to hydrologists and floodplain managers. The online information could not easily answer all common questions residents may have during a flood event. Some of the more common questions were how to use the water-level information to know the potential extent of flooding and relative location of flooding to the location of residents. To help address the questions raised during the flooding on how to use the available water level data, we used Google Earth to get lot and intersection locations to help show the relative differences between nearby water-level stations and residences of interest. The reported resolution of the Google Earth elevation data is 1-foot. To help confirm the use of this data, we compared Google Earth approximate elevations with reported Harris County Floodplain Reference Mark individual reports. This method helped verify we could use the Google Earth information for approximate comparisons. We also faced questions on what routes to take if evacuation was needed, and where to go to get to higher ground elevations. Google Earth again provided a helpful and easy to use interface to look at road and intersection elevations and develop suggested routes for family and friends to take to avoid low
Qu, F.; Lu, Z.; Kim, J. W.
2017-12-01
Growth faults are common and continue to evolve throughout the unconsolidated sediments of Greater Houston (GH) region in Texas. Presence of faults can induce localized surface displacements, aggravate localized subsidence, and discontinue the integrity of ground water flow. Property damages due to fault creep have become more evident during the past few years over the GH area, portraying the necessity of further study of these faults. Interferometric synthetic aperture radar (InSAR) has been proven to be effective in mapping creep along and/or across faults. However, extracting a short wavelength, as well as small amplitude of the creep signal (about 10-20 mm/year) from long time span interferograms is extremely difficult, especially in agricultural or vegetated areas. This paper aims to map and monitor the latest rate, extent, and temporal evolution of faulting at a highest spatial density over GH region using an improved Multi-temporal InSAR (MTI) technique. The method, with maximized usable signal and correlation, has the ability to identify and monitor the active faults to provide an accurate and elaborate image of the faults. In this study, two neighboring ALOS tracks and Sentinel-1A datasets are used. Many zones of steep phase gradients and/or discontinuities have been recognized from the long term velocity maps by both ALOS (2007-2011) and Sentinei-1A (2015-2017) imagery. Not only those previously known faults position but also the new fault traces that have not been mapped by other techniques are imaged by our MTI technique. Fault damage and visible cracking of ground were evident at most locations through our field survey. The discovery of new fault activation, or faults moved from earlier locations is a part of the Big Barn Fault and Conroe fault system, trending from southwest to northeast between Hockley and Conroe. The location of area of subsidence over GH is also shrinking and migrating toward the northeast (Montgomery County) after 2000. The
C:\\Users\\AISA\\Desktop\\KALLEL SADREDDINE.xps
African Journals Online (AJOL)
AISA
dans des récipients en plastique avec un couvercle de 12 cm de hauteur et présentant une base circulaire de 11cm de diamètre. Les sols sont par la suite humidifiés et déposés sur un papier filtre de 13 cm de diamètre préalablement humidifié et recevant soit des œufs de criquets soit des chenilles de Galleria mellonella.
Gram-Negative Bacterial Wound Infections
2014-05-01
Bovine Tuberculosis in Cattle Farms in Zaria and Kaduna and Possible Transmission Through Milk P. N. Mbianga, V. J. Umoh, A. I. 0, K. C. A; Ahmadu...Pathogenic Escherichia coli R. M. Ramirez, M-X. Haro, P. Miranda, S-H. Sanchez, L-E. Vidales; Univ. Aut6noma de Zacatecas, Zacatecas, Mexico 517...isolates. Subsequently, five representative isolates were tested in murine pulmonary and Galleria mellonella models of infection. Infections with one strain
Students Need Libraries--In HISD and Every School District
Hand, Dorcas
2018-01-01
Catalyst: Another newspaper article ("Ranks of School Librarians Dwindle in HISD, Statewide" in the October 7, 2013, "Houston Chronicle") detailing another decision by a Houston Independent School District (HISD) campus principal to eliminate the librarian (Mellon 2013). In response to this article, Dorcas Hand, an experienced…
Genes involved in Beauveria bassiana infection to Galleria mellonella.
Chen, Anhui; Wang, Yulong; Shao, Ying; Zhou, Qiumei; Chen, Shanglong; Wu, Yonghua; Chen, Hongwei; Liu, Enqi
2018-05-01
The ascomycete fungus Beauveria bassiana is a natural pathogen of hundreds of insect species and is commercially produced as an environmentally friendly mycoinsecticide. Many genes involved in fungal insecticide infection have been identified but few have been further explored. In this study, we constructed three transcriptomes of B. bassiana at 24, 48 and 72 h post infection of insect pests (BbI) or control (BbC). There were 3148, 3613 and 4922 genes differentially expressed at 24, 48 and 72 h post BbI/BbC infection, respectively. A large number of genes and pathways involved in infection were identified. To further analyze those genes, expression patterns across different infection stages (0, 12, 24, 36, 48, 60, 72 and 84 h) were studied using quantitative RT-PCR. This analysis showed that the infection-related genes could be divided into four patterns: highly expressed throughout the whole infection process (thioredoxin 1); highly expressed during early stages of infection but lowly expressed after the insect death (adhesin protein Mad1); lowly expressed during early infection but highly expressed after insect death (cation transporter, OpS13); or lowly expressed across the entire infection process (catalase protein). The data provide novel insights into the insect-pathogen interaction and help to uncover the molecular mechanisms involved in fungal infection of insect pests.
A madurella mycetomatis grain model in galleria mellonella larvae
W. Kloezen (Wendy); M. van Helvert-van Poppel (Marilyn); A.H. Fahal (Ahmed); W.W.J. van de Sande (Wendy)
2015-01-01
textabstractEumycetoma is a chronic granulomatous subcutaneous infectious disease, endemic in tropical and subtropical regions and most commonly caused by the fungus Madurella mycetomatis. Interestingly, although grain formation is key in mycetoma, its formation process and its susceptibility
77 FR 23472 - Tennessee Gas Pipeline Company, L.L.C.; Notice of Application
2012-04-19
... Pipeline Company, L.L.C.; Notice of Application Take notice that on April 4, 2012, Tennessee Gas Pipeline Company, L.L.C. (Tennessee), 1001 Louisiana Street, Houston, Texas 77002, filed an application in the..., Manager, Certificates, Tennessee Gas Pipeline Company, L.L.C., 1001 Louisiana Street, Houston, Texas 77002...
2011-05-11
... objectives, the previously-disclosed parties to MWCV have formed Marine Well Containment Company LLC (``MWCC LLC''), a Delaware limited liability company located in Houston, TX; and (2) in furtherance of the..., BP Offshore Response Company LLC, Houston, TX, has been added as a party to this venture. The changes...
2012-01-09
... DEPARTMENT OF TRANSPORTATION Federal Aviation Administration 14 CFR Part 97 [Docket No. 30819... to their depiction on charts printed by publishers of aeronautical materials. The advantages of..., VOR RWY 26L, Amdt 32 Houston, TX, Sugar Land Rgnl, ILS OR LOC RWY 35, Amdt 4 Houston, TX, Sugar Land...
2011-09-13
... exhibition ``Tombs, Temples and Warriors: China's Imperial Legacy,'' imported from abroad for temporary... the exhibit objects at the Bowers Museum, Santa Ana, California, from on or about October 1, 2011, until on or about March 4, 2012, at the Houston Museum of Natural Sciences, Houston, Texas, from on or...
The Evolution of a Multi-Instructional Teaching Center (MITC) in a Metropolitan University System.
Bell, David P.; Hayes, Edward J.; Hugetz, Edward T.; Ivancevich, John M.; Smith, Don N.; Woods, Molly R.
1998-01-01
The University of Houston (Texas) and its four campuses have adopted a "co-opetition" approach to create a multi-instructional teaching center to deliver educational programs and courses in the Houston metropolitan area. It has been found that citizens, legislators, administrators, faculty, and students all benefit, without sacrificing…
Eficiência de isolamento e de plaqueamento de protoplastos de laranja-doce
Directory of Open Access Journals (Sweden)
Lívia Mendes de Castro
2011-06-01
Full Text Available O isolamento e plaqueamento de protoplastos são fatores fundamentais para o sucesso no cultivo in vitro deste tipo de explante visando a manipulações genéticas. A composição da solução enzimática no isolamento, a densidade de cultivo, bem como o próprio genótipo utilizado são variáveis importantes nestas etapas. Desta forma, o objetivo do trabalho foi avaliar a eficiência de isolamento de protoplastos em função de três soluções enzimáticas e a eficiência de plaqueamento em função de cinco densidades de protoplastos e diferentes composições de meio de cultura em cultivares de laranja-doce. As soluções enzimáticas avaliadas para o isolamento de protoplastos foram: 1. celulase Onozuka RS 1%, macerase R-10 1% e pectoliase 0,2%; 2. celulase Onozuka RS 1%, macerase R-10 1% ; 3. celulase Onozuka R-10 4%, macerase R-10 1%. O plaqueamento dos protoplastos foi realizado nas densidades de 2 x 10(4; 5 x 10(4; 10(5; 2x 10(5 e 3 x 10(5 protoplastos.mL-1, nos meios de cultura EME 0,7M, BH3 0,7M e BH3 + EME 0,7M em ausência de luz, a 25 ± 1 ºC. A solução enzimática 2 proporcionou maior rendimento no isolamento de protoplastos das cultivares 'Hamlin', 'Natal' e 'Pera', e a solução enzimática 1 foi a mais adequada para a laranja 'Westin'. Para a cultivar 'Lima-Verde', a solução enzimática 3 foi a mais eficiente. A eficiência final de plaqueamento, avaliada aos 90 dias de cultivo, foi superior nas densidades de 3 x 10(5 e 2 x 10(5 protoplastos.mL-1 para as cultivares 'Hamlin', 'Natal' e 'Lima-Verde', e nas densidades de 2 x 10(5 e 10(5 protoplastos.mL-1 para a laranja 'Westin'.
77 FR 8247 - Tennessee Gas Pipeline Company, L.L.C. Notice of Application
2012-02-14
... Pipeline Company, L.L.C. Notice of Application Take notice that on February 2, 2012, Tennessee Gas Pipeline Company, L.L.C. (Tennessee), 1001 Louisiana Street, Houston, Texas 77002, filed an application in Docket... Gas Pipeline Company, L.L.C., 1001 Louisiana Street, Houston, Texas 77002, by telephone at (713) 420...
77 FR 43277 - Tennessee Gas Pipeline Company, L.L.C.; Notice of Application
2012-07-24
... Pipeline Company, L.L.C.; Notice of Application Take notice that on July 6, Tennessee Gas Pipeline Company, L.L.C. (Tennessee), 1001 Louisiana Street, Houston, Texas 77002, filed in the above referenced... Company, L.L.C. 1001 Louisiana Street, Houston, Texas 77002, or telephone (713) 420- 3299, or facsimile...
Nosé, Yukihiko
2003-09-01
The artificial organ museum established in Cleveland, Ohio, in 1979 organized by the International Center for Artificial Organs and Transplantation (ICAOT), was moved to Houston, Texas, in 1999. The museum with expanded and renewed artificial organ exhibits was officially opened on the 8th and 9th of November, 2002, at the Cullen Pavilion of the original Memorial Hermann Hospital. This building is the oldest in the Texas Medical Center, which was built in 1922. The ICMT (International Center for Medical Technologies) Museum for Artificial Organs (Museum) was completed after phase I, II, and III expansions of the exhibit booths, which were made over the last two years. Approximately 250 historically important and currently widely used artificial organs are exhibited in the Museum. The official opening of the Museum was coordinated with the "Symposium on Artificial Organs: Past, Present, and Future" during two days in November. There were approximately 225 participants at these events, and approximately 40 pioneers and clinical experts in the development and practice of various types of artificial organs contributed. During these programs, a proposal to maintain human resources in addition to artificial organ hardware and software was made in addition to the Museum. This new organization would be called the International Academy of Artificial Organ Pioneers (Academy). All contributors to the symposium were invited to be members of the Academy. The attendants of the symposium accepted this proposal unanimously. An additional 40 individuals, who were recognized as contributors to artificial organ technologies, were later added to the original Academy members. Later, the effective utilization of the Museum and Academy was encompassed in the International Faculty for Health and Medical Technologies (Faculty), a new addition to the activities of the ICMT. Dr. Michael DeBakey was elected as Dean of the Faculty. This is considered a "university without walls," a "university
75 FR 4547 - High Island Offshore System, L.L.C.; Notice of Application
2010-01-28
... Offshore System, L.L.C.; Notice of Application January 21, 2010. Take notice that on January 12, 2010, High Island Offshore System, L.L.C. (HIOS), 1100 Louisiana St., Houston, Texas 77002, filed in Docket No. CP10... directed to Jeff Molinaro, High Island Offshore System, L.L.C., 1100 Louisiana St., Houston, Texas 77002...
Kasmarek, Mark C.; Johnson, Michaela R.; Ramage, Jason K.
2012-01-01
Most of the subsidence in the Houston–Galveston region, Texas, has occurred as a direct result of groundwater withdrawals for municipal supply, commercial and industrial use, and irrigation that depressured and dewatered the Chicot and Evangeline aquifers and caused compaction of the clay layers of the aquifer sediments. This report—prepared by the U.S. Geological Survey in cooperation with the Harris– Galveston Subsidence District, City of Houston, Fort Bend Subsidence District, Lone Star Groundwater Conservation District, and Brazoria County Groundwater Conservation District—is one in an annual series of reports depicting water-level altitudes and water-level changes in the Chicot, Evangeline, and Jasper aquifers and compaction in the Chicot and Evangeline aquifers in the Houston–Galveston region. The report contains maps showing approximate water-level altitudes for 2012 (calculated from measurements of water levels in wells made during December 2011–February 2012) for the Chicot, Evangeline, and Jasper aquifers; maps showing 1-year (2011–12) water-level-altitude changes for each aquifer; maps showing 5-year (2007–12) water-levelaltitude changes for each aquifer; maps showing long-term (1990–2012 and 1977–2012) water-level-altitude changes for the Chicot and Evangeline aquifers; a map showing long-term (2000–12) water-level-altitude change for the Jasper aquifer; a map showing locations of borehole extensometer sites; and graphs showing measured compaction of subsurface sediments at the extensometers from 1973 (or later) through 2011. Tables listing the data that were used to construct each water-level map for each aquifer and the cumulative compaction graphs are included.
The cost-effectiveness of methanol for reducing motor vehicle emissions and urban ozone
International Nuclear Information System (INIS)
Krupnick, A.J.; Walls, M.A.
1992-01-01
This article analyzes the costs and emissions characteristics of methanol vehicles. The cost-effectiveness of methanol - the cost per ton of reactive hydrocarbon emissions reduced - is calculated and compared to the cost-effectiveness of other hydrocarbon reduction strategies. Methanol is found to cost from $33,000 to nearly $60,000 per ton, while several other options are available for under $10,000 per ton. The cost per part-per-million reduction in peak ambient ozone levels is also computed for two cities, Houston and Philadelphia. Despite the greater improvement in ozone in Philadelphia than Houston, methanol is found to be more cost-effective in Houston. This result occurs because Houston's distribution and marketing costs are lower than Philadelphia's. The costs in both cities, however, are far higher than estimates of the benefits from acute health improvements. Finally, the reduction in ozone exposure in Los Angeles is estimated and the costs of the reduction compared with an estimate of acute health benefits. Again, the benefits fall far short of the costs. 51 refs., 5 tabs
76 FR 35200 - High Island Offshore System, L.L.C.; Notice of Amendment
2011-06-16
... Offshore System, L.L.C.; Notice of Amendment Take notice that on June 6, 2011, High Island Offshore System, L.L.C. (HIOS), 1100 Louisiana St., Houston, Texas 77002, filed in Docket No. CP10-43-001, to amend... System, L.L.C., 1100 Louisiana St., Houston, Texas 77002, or (telephone) 713-381-2526, or [email protected
The Effects of Higher Education/Military Service on Achievement Levels of Police Academy Cadets.
Johnson, Thomas Allen
This study compared levels of achievement of three groups of Houston (Texas) police academy cadets: those with no military service but with 60 or more college credit hours, those with military service and 0 hours of college credit, and those with military service and 1 to 59 hours of college credit. Prior to 1991, police cadets in Houston were…
2010-07-01
... County X Hart County X Heard County X Henry County X Houston County X Irwin County X Jackson County X Jasper County X Jeff Davis County X Jefferson County X Jenkins County X Johnson County X Jones County X... County X Hart County X Heard County X Henry County X Houston County X Irwin County X Jackson County X...
2010-07-28
... Alabama Geneva 47.08 Alabama Greene 31.39 Alabama Hale 31.39 Alabama Henry 31.39 Alabama Houston 47.08... 62.78 Georgia Henry 156.94 Georgia Houston 62.78 Georgia Irwin 47.08 Georgia Jackson 156.94 Georgia Jasper 62.78 Georgia Jeff Davis......... 47.08 Georgia Jefferson 47.08 Georgia Jenkins 47.08 Georgia...
Institutional Patient-specific IMRT QA Does Not Predict Unacceptable Plan Delivery
Energy Technology Data Exchange (ETDEWEB)
Kry, Stephen F., E-mail: sfkry@mdanderson.org [Imaging and Radiation Oncology Core at Houston, Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Molineu, Andrea [Imaging and Radiation Oncology Core at Houston, Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Kerns, James R.; Faught, Austin M.; Huang, Jessie Y.; Pulliam, Kiley B.; Tonigan, Jackie [Imaging and Radiation Oncology Core at Houston, Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas (United States); The University of Texas Health Science Center Houston, Graduate School of Biomedical Sciences, Houston, Texas (United States); Alvarez, Paola [Imaging and Radiation Oncology Core at Houston, Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Stingo, Francesco [The University of Texas Health Science Center Houston, Graduate School of Biomedical Sciences, Houston, Texas (United States); Department of Biostatistics, The University of Texas MD Anderson Cancer Center, Houston, Texas (United States); Followill, David S. [Imaging and Radiation Oncology Core at Houston, Department of Radiation Physics, The University of Texas MD Anderson Cancer Center, Houston, Texas (United States); The University of Texas Health Science Center Houston, Graduate School of Biomedical Sciences, Houston, Texas (United States)
2014-12-01
Purpose: To determine whether in-house patient-specific intensity modulated radiation therapy quality assurance (IMRT QA) results predict Imaging and Radiation Oncology Core (IROC)-Houston phantom results. Methods and Materials: IROC Houston's IMRT head and neck phantoms have been irradiated by numerous institutions as part of clinical trial credentialing. We retrospectively compared these phantom results with those of in-house IMRT QA (following the institution's clinical process) for 855 irradiations performed between 2003 and 2013. The sensitivity and specificity of IMRT QA to detect unacceptable or acceptable plans were determined relative to the IROC Houston phantom results. Additional analyses evaluated specific IMRT QA dosimeters and analysis methods. Results: IMRT QA universally showed poor sensitivity relative to the head and neck phantom, that is, poor ability to predict a failing IROC Houston phantom result. Depending on how the IMRT QA results were interpreted, overall sensitivity ranged from 2% to 18%. For different IMRT QA methods, sensitivity ranged from 3% to 54%. Although the observed sensitivity was particularly poor at clinical thresholds (eg 3% dose difference or 90% of pixels passing gamma), receiver operator characteristic analysis indicated that no threshold showed good sensitivity and specificity for the devices evaluated. Conclusions: IMRT QA is not a reasonable replacement for a credentialing phantom. Moreover, the particularly poor agreement between IMRT QA and the IROC Houston phantoms highlights surprising inconsistency in the QA process.
Institutional Patient-specific IMRT QA Does Not Predict Unacceptable Plan Delivery
International Nuclear Information System (INIS)
Kry, Stephen F.; Molineu, Andrea; Kerns, James R.; Faught, Austin M.; Huang, Jessie Y.; Pulliam, Kiley B.; Tonigan, Jackie; Alvarez, Paola; Stingo, Francesco; Followill, David S.
2014-01-01
Purpose: To determine whether in-house patient-specific intensity modulated radiation therapy quality assurance (IMRT QA) results predict Imaging and Radiation Oncology Core (IROC)-Houston phantom results. Methods and Materials: IROC Houston's IMRT head and neck phantoms have been irradiated by numerous institutions as part of clinical trial credentialing. We retrospectively compared these phantom results with those of in-house IMRT QA (following the institution's clinical process) for 855 irradiations performed between 2003 and 2013. The sensitivity and specificity of IMRT QA to detect unacceptable or acceptable plans were determined relative to the IROC Houston phantom results. Additional analyses evaluated specific IMRT QA dosimeters and analysis methods. Results: IMRT QA universally showed poor sensitivity relative to the head and neck phantom, that is, poor ability to predict a failing IROC Houston phantom result. Depending on how the IMRT QA results were interpreted, overall sensitivity ranged from 2% to 18%. For different IMRT QA methods, sensitivity ranged from 3% to 54%. Although the observed sensitivity was particularly poor at clinical thresholds (eg 3% dose difference or 90% of pixels passing gamma), receiver operator characteristic analysis indicated that no threshold showed good sensitivity and specificity for the devices evaluated. Conclusions: IMRT QA is not a reasonable replacement for a credentialing phantom. Moreover, the particularly poor agreement between IMRT QA and the IROC Houston phantoms highlights surprising inconsistency in the QA process
TERRAIN, HOUSTON COUNTY, TN, USA
Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix N: Data Capture Standards, describes the digital topographic data that was used to create...
Houston Ship Channel 1993-1994
National Oceanic and Atmospheric Administration, Department of Commerce — Between May 5, 1993 and September 19, 1994, we collected quantitative 1-m2 area drop samples and measured a variety of habitat attributes using field surveys and...
Space Biology and Aerospace Medicine, Volume 11, Number 6, 1977
1978-02-14
Report," (NASA), Houston, Sect 3, 1973, pp 177-190. 3. Lutwak , L.; Whedon, G. D.; et al. J. CLIN. ENDOCR., Vol 28, 1969, p 1140. 4. Whedon, G. D... Lutwak , L.; Ranbauf, P. C; et al. in: "Skylab Preli- minary Biomedical Report," (NASA), Houston, Sect 3, 1973, pp 169-176. 5. Ilyushko, N. A.; Il’in
2011-09-01
ISO / IEC 17025 :2005, NADCAP Acuren...River Road Brackenridge, PA 250 (724) 224-1000 $4.8B 11,000 ISO -9001, AS- 9100, NADCAP, ISO / IEC 17025 ATI – Allegheny Ludlum (Houston, PA) 501...Western Ave Houston, PA 233 (724) 745-2000 $4.8B 11,000 ISO -9001, AS- 9100, NADCAP, ISO / IEC 17025 ATI – Allegheny Ludlum (Louisville, OH)
HOUSTON, we’ve got a problem : Introduction program case Houston Galveston Bay Region, Texas (USA)
Brand, A.D.; Kothuis, B.L.M.; Kothuis, Baukje; Kok, Matthijs
2017-01-01
Various interesting tools were used and/or developed to stimulate knowledge integration in the Multifunctional Flood Defenses program. This chapter will present a diverse collection of these tools, hopefully stimulating others to consider using some of them in future.
David J. Nowak; Allison R. Bodine; Robert E. Hoehn; Christopher B. Edgar; Gretchen Riley; Dudley R. Hartel; Kerry J. Dooley; Sharon M. Stanton; Mark A. Hatfield; Thomas J. Brandeis; Tonya W. Lister
2017-01-01
An analysis of the urban forest in Houston, Texas, reveals that this area has an estimated 33.3 million live trees with tree canopy that covers 18.4 percent of the city. Roughly 19.2 million of the cityâs trees are located on private lands. The most common tree species are yaupon, Chinese tallowtree, Chinese privet, Japanese privet, and sugarberry. Trees in Houston...
Optical Elastography of Systemic Sclerosis Skin
2017-09-01
ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER University of Houston, 4800 Calhoun Road, Houston, TX The University of Texas Health Science ...o What was the impact on society beyond science and technology? Nothing to Report. 5.CHANGES/PROBLEMS: o Changes in approach and reasons for...Sclerosis Patient-Derived Data Role: PI Time Commitment: 0.24 calendar mos Supporting Agency: Momenta Pharmaceuticals , Inc Name and Address of the
A Galleria Boundary Element Method for two-dimensional nonlinear magnetostatics
Brovont, Aaron D.
The Boundary Element Method (BEM) is a numerical technique for solving partial differential equations that is used broadly among the engineering disciplines. The main advantage of this method is that one needs only to mesh the boundary of a solution domain. A key drawback is the myriad of integrals that must be evaluated to populate the full system matrix. To this day these integrals have been evaluated using numerical quadrature. In this research, a Galerkin formulation of the BEM is derived and implemented to solve two-dimensional magnetostatic problems with a focus on accurate, rapid computation. To this end, exact, closed-form solutions have been derived for all the integrals comprising the system matrix as well as those required to compute fields in post-processing; the need for numerical integration has been eliminated. It is shown that calculation of the system matrix elements using analytical solutions is 15-20 times faster than with numerical integration of similar accuracy. Furthermore, through the example analysis of a c-core inductor, it is demonstrated that the present BEM formulation is a competitive alternative to the Finite Element Method (FEM) for linear magnetostatic analysis. Finally, the BEM formulation is extended to analyze nonlinear magnetostatic problems via the Dual Reciprocity Method (DRBEM). It is shown that a coarse, meshless analysis using the DRBEM is able to achieve RMS error of 3-6% compared to a commercial FEM package in lightly saturated conditions.
2017-10-01
Negative Breast Cancer PRINCIPAL INVESTIGATOR: Dr. Liuqing Yang CONTRACTING ORGANIZATION: University of Texas MD Anderson Cancer Center Houston, TX...Signaling Axis: A Novel Paradigm for Treating Triple-Negative Breast Cancer 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Liuqing Yang 5d...ORGANIZATION REPORT NUMBER UNIVERSITY OF TEXAS M D ANDERSON CANCER HOUSTON TX 77030-0417 9. SPONSORING / MONITORING AGENCY NAME(S) AND ADDRESS(ES
2017-11-01
Prostate Cancer (PCa) PRINCIPAL INVESTIGATOR: George Wilding, M.D. CONTRACTING ORGANIZATION: University of Texas MD Anderson Cancer Center Houston, TX...Indicator of Antiandrogen Therapy Resistance of Prostate Cancer (PCa) 5b. GRANT NUMBER W81XWH-15-1-0509 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S...AND ADDRESS(ES) 8. PERFORMING ORGANIZATION REPORT NUMBER The University of Texas MD Anderson Cancer Center 1515 Holcombe Blvd. Houston, TX 77030-4009
Rotorwash Operational Footprint Modeling
2014-07-01
I-13. Francis, J. K., and Gillespie, A., “Relating Gust Speed to Tree Damage in Hurricane Hugo , 1989,” Journal of Arboriculture, November 1993...statement has been Rotorwash Operational Footprint Modeling 72 found to be correct. In many parts of the United States, the requirements for hurricane ...On August 18, 1983, Hurricane Alicia struck downtown Houston, Texas. Researchers were allowed into downtown Houston the following day to help survey
78 FR 15602 - Annual Update to Fee Schedule for the Use of Government Lands by Hydropower Licensees
2013-03-12
....31 Greene 42.14 Hale 49.85 Henry 49.49 Houston 57.92 Jackson 57.45 Jefferson 93.62 Lamar 38.84....08 Heard 109.41 Henry 158.11 Houston 97.45 Irwin 59.36 Jackson 163.15 Jasper 101.22 Jeff Davis 58.81 Jefferson 56.70 Jenkins 50.55 Johnson 51.92 Jones 93.94 Lamar 109.93 Lanier 62.61 Laurens 55.93 Lee 66.04...
Creighton, C. S.; Fassuliotis, G.
1985-01-01
A nematode identified as Heterorhabditis sp. was discovered in June 1982 in larval cadavers of the banded cucumber beetle, Diabrotica balteata, in soil on wooded land. Effective beetle control (over 95%) was obtained when larvae were exposed to potted soil containing infective stage nematode juveniles or infected larval cadavers. The nematode was propagated in vivo on larvae of D. balteata, Diaphania nitidalis (the pickleworm), and Galleria mellonella (the greater wax moth). This Heterorhabditis sp. has promising potential as a biocontrol agent for the banded cucumber beetle. PMID:19294074
The Mock-up of the "Ratto Delle Sabine" by Giambologna: Making and Utilization of a 3D Model
Directory of Open Access Journals (Sweden)
Grazia Tucci
2015-02-01
Full Text Available Within a project for the knowledge and preservation of the mock-up of Giambologna's Ratto delle Sabine housed in the Galleria dell'Accademia in Florence, the GeCO laboratory has made laser scanner acquisitions to create surface models at different resolutions for structural analysis, on which to check the coverage of the photographic campaign and to create a three-dimensional thematic mapping of data relating to investigations and restoration works. The PDF3D file format has been used to easily manage data on a platform immediately available to all operators.
An insect pathogenic symbiosis between a Caenorhabditis and Serratia
Morrison, Julie; Cooper, Vaughn; Thomas, W. Kelley
2011-01-01
We described an association between a strain of the nematode Caenorhabditis briggsae, i.e. KT0001, and the bacteria Serratia sp. SCBI (South African Caenorhabditis briggsae isolate), which was able to kill the insect Galleria (G. mellonella). Here we show that the Serratia sp. SCBI lines the gut of the nematode, similar to the Heterorhabditis-Photorhabdus complex, indicating that the association is possibly internal. We also expand on the relevance of this tripartite, i.e. insect-nematode-bacteria, interaction in the broader evolutionary context and Caenorhabditis natural history. PMID:21389770
DEFF Research Database (Denmark)
Friman, Ville-Petri; Ghoul, Melanie; Molin, Søren
2013-01-01
) patients affects its survival in the presence of natural phage (14/1, ΦKZ, PNM and PT7) and protist (Tetrahymena thermophila and Acanthamoebae polyphaga) enemies. We found that most of the bacteria isolated from relatively recently intermittently colonised patients (1-25 months), were innately phage......-resistant and highly toxic for protists. In contrast, bacteria isolated from long time chronically infected patients (2-23 years), were less efficient in both resisting phages and killing protists. Moreover, chronic isolates showed reduced killing of wax moth larvae (Galleria mellonella) probably due to weaker...
More U.S. production changes hands
International Nuclear Information System (INIS)
Land, R.
1992-01-01
This paper reports that more U.S. oil and gas production is acquiring new owners as some operators scale back operations and others see opportunities for growth. It's part of a continuing program of adjustment to a depressed economy in the petroleum industry. In the latest announcements: Forest Oil Corp., Denver, agree to acquire Transco Energy Co. subsidiary Transco Exploration ampersand Production Co. (Tepco), Houston, for $45 million; Louis Dreyfus Natural Gas Corp., Oklahoma City, agreed to buy essentially all the U.S. oil and gas operations of Dekalb Energy Co., Denver; Black Stone Minerals, a Texas partnership managed by Black Stone Holdings Partnership, Houston, agreed to pay $15 million to Santa Fee Energy Resources Inc. and Santa Fe Energy Partners LP, both of Houston, for royalty and undeveloped mineral interests in 493,000 acres in east Texas and Louisiana
Creating the Public Connection: Interactive Experiences with Real-Time Earth and Space Science Data
Reiff, Patricia H.; Ledley, Tamara S.; Sumners, Carolyn; Wyatt, Ryan
1995-01-01
The Houston Museum of Natural Sciences is less than two miles from Rice University, a major hub on the Internet. This project links these two institutions so that NASA real-time data and imagery can flow via Rice to the Museum where it reaches the public in the form of planetarium programs, computer based interactive kiosks, and space and Earth science problem solving simulation. Through this program at least 200,000 visitors annually (including every 4th and 7th grader in the Houston Independent School District) will have direct exposure to the Earth and space research being conducted by NASA and available over the Internet. Each information conduit established between Rice University and the Houston Museum of Natural Science will become a model for public information dissemination that can be replicated nationally in museums, planetariums, Challenger Centers, and schools.
2014-10-01
azatetrabenzoporphyrins-new red laser diode -compatible indicators for optical oxygen sensing,” ACS Appl. Mater. Interfaces 2(2), 366–374 (2010). 17. C. S...Detachment, U.S. Army Institute of Surgical Research, 3698 Chambers Pass, Suite B, JBSA –Fort Sam Houston, Texas 78234-7767, USA 4Harvard University...NUMBER 7. PERFORMING ORGANIZATION NAME(S) AND ADDRESS(ES) United States Army Institute of Surgical Research, JBSA Fort Sam Houston, TX 8
7 CFR 1007.51 - Class I differential, adjustments to Class I prices, and Class I price.
2010-01-01
... AL GREENE 01063 0.30 AL HALE 01065 0.30 AL HENRY 01067 0.85 AL HOUSTON 01069 0.85 AL JACKSON 01071 0....70 GA HEARD 13149 0.70 GA HENRY 13151 0.70 GA HOUSTON 13153 0.70 GA IRWIN 13155 1.15 GA JACKSON 13157 0.70 GA JASPER 13159 0.70 GA JEFF DAVIS 13161 1.15 GA JEFFERSON 13163 0.70 GA JENKINS 13165 1.00 GA...
Probing the mechanical properties of TNF-α stimulated endothelial cell with atomic force microscopy
Directory of Open Access Journals (Sweden)
Sei-Young Lee
2011-01-01
Full Text Available Sei-Young Lee1,2, Ana-Maria Zaske3, Tommaso Novellino1,4*, Delia Danila3, Mauro Ferrari1,5*, Jodie Conyers3, Paolo Decuzzi1,6*1Department of Nanomedicine and Biomedical Engineering, The University of Texas Medical School at Houston, Houston, TX, USA; 2Department of Mechanical Engineering, The University of Texas at Austin, Austin, TX, USA; 3CeTIR – Center for Translational Injury Research, The University of Texas Health Science Center at Houston, Houston, TX, USA; 4Department of Biomedical Engineering, Biomedical Campus University of Rome, Italy; 5MD Anderson Cancer Center, Houston, TX, USA; 6BioNEM – Center of Bio-Nanotechnology and Engineering for Medicine, University of Magna Graecia, Catanzaro, Italy; *Currently at Department of Nanomedicine and Biomedical Engineering, The Methodist Hospital Research Institute, Houston, TX, USAAbstract: TNF-α (tumor necrosis factor-α is a potent pro-inflammatory cytokine that regulates the permeability of blood and lymphatic vessels. The plasma concentration of TNF-α is elevated (> 1 pg/mL in several pathologies, including rheumatoid arthritis, atherosclerosis, cancer, pre-eclampsia; in obese individuals; and in trauma patients. To test whether circulating TNF-α could induce similar alterations in different districts along the vascular system, three endothelial cell lines, namely HUVEC, HPMEC, and HCAEC, were characterized in terms of 1 mechanical properties, employing atomic force microscopy; 2 cytoskeletal organization, through fluorescence microscopy; and 3 membrane overexpression of adhesion molecules, employing ELISA and immunostaining. Upon stimulation with TNF-α (10 ng/mL for 20 h, for all three endothelial cells, the mechanical stiffness increased by about 50% with a mean apparent elastic modulus of E ~5 ± 0.5 kPa (~3.3 ± 0.35 kPa for the control cells; the density of F-actin filaments increased in the apical and median planes; and the ICAM-1 receptors were overexpressed compared with
Family Roles in Transition. In a Changing Military.
1981-06-18
and Management and Department of Psychology Dr. Larry Cummings College Park MD 20742 University of Wisconsin-Madison Graduate School of Business Dr. D...Graduate School of Management and Business University of Oregon Eugene OR 97403 Dr. James R. Terborg University of Houston Department of Psychology Houston...AD-A107 348 UNdITED STATES INTERNATIONAL UNIV SAN DIEGO CA FAMILY --ETC PIG 5/1l FAMILY ROLES IN TRANSITION IN A CHANGING MILITARY (U) JUN 81 E J
Energy Technology Data Exchange (ETDEWEB)
McLarty, J.M.; DeBonis, V.
1995-12-31
One of the main functions of the SPE is to provide a means for collection, dissemination, and exchange of technical information and to provide technical forums that afford opportunities for members to maintain and upgrade their technical competence. The large chapters (such as Houston SPE) located near many oil company headquarters have the advantage of being able to bring together a cross section of service company and operator personnel representing operations and research from major and independent operators. This paper describes a series of 1-day symposiums on frac pack technology that were organized by the Houston-based Gulf Coast Section SPE Production Operations Study Group. These study sessions provided a means for the local members of the industry to further develop a new technology as a team. Publishing the major focus and contributions of the seminars will allow sharing of the technology with chapters outside of Houston.
Tsibanos, V.; Wang, G.
2017-12-01
The Long Point Fault located in Houston Texas is a complex system of normal faults which causes significant damage to urban infrastructure on both private and public property. This case study focuses on the 20-km long fault using high accuracy continuously operating global positioning satellite (GPS) stations to delineate fault movement over five years (2012 - 2017). The Long Point Fault is the longest active fault in the greater Houston area that damages roads, buried pipes, concrete structures and buildings and creates a financial burden for the city of Houston and the residents who live in close vicinity to the fault trace. In order to monitor fault displacement along the surface 11 permanent and continuously operating GPS stations were installed 6 on the hanging wall and 5 on the footwall. This study is an overview of the GPS observations from 2013 to 2017. GPS positions were processed with both relative (double differencing) and absolute Precise Point Positioning (PPP) techniques. The PPP solutions that are referred to IGS08 reference frame were transformed to the Stable Houston Reference Frame (SHRF16). Our results show no considerable horizontal displacements across the fault, but do show uneven vertical displacement attributed to regional subsidence in the range of (5 - 10 mm/yr). This subsidence can be associated to compaction of silty clays in the Chicot and Evangeline aquifers whose water depths are approximately 50m and 80m below the land surface (bls). These levels are below the regional pre-consolidation head that is about 30 to 40m bls. Recent research indicates subsidence will continue to occur until the aquifer levels reach the pre-consolidation head. With further GPS observations both the Long Point Fault and regional land subsidence can be monitored providing important geological data to the Houston community.
DCS Terrain for HOUSTON COUNTY, ALABAMA
Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix M: Data Capture Standards, describes the digital topographic data that was used to create...
Safety First: Houston, We Have Liftoff!
Roy, Ken
2014-01-01
A thrown basketball, a kicked football, an elastically launched catapult payload, and a free-falling solid fuel or pressurized gas-propelled rocket all have one thing in common. They are all projectiles familiar to elementary students. A projectile is an object thrown with an initial velocity and then allowed to move without thrust along its…
Food and Fitness Fun in Houston
Carson, Diane E.
2005-01-01
Childhood obesity is on the rise and there is no indication that the trend is reversing. To reverse this trend, it is critical that children develop and foster healthy eating behaviors and physical activity patterns to help reduce the risk of developing long-term chronic diseases such as obesity, type 2 diabetes, heart disease, and others. One…
Redelineation Submission for Houston County TX
Federal Emergency Management Agency, Department of Homeland Security — The Floodplain Mapping/Redelineation study deliverables depict and quantify the flood risks for the study area. The primary risk classifications used are the...
DCS Terrain Submission for Houston TX
Federal Emergency Management Agency, Department of Homeland Security — Terrain data, as defined in FEMA Guidelines and Specifications, Appendix N: Data Capture Standards, describes the digital topographic data that was used to create...
Redefining brand identity - Case BobbyHouston
Sotaniemi, Elina
2016-01-01
The purpose of this product thesis is to build a theoretically based framework and analysis that enables a better understanding of corporate rebranding processes among small compa- nies. Corporate rebranding is created as tangible manual concentrating on changes to corpo- rate identity, visual elements, position, name and logo as well as perception, competitive ad- vantage and value proposition. The theoretical background and competition analysis is based on literary of brand identity, rebran...
Houston, We Still Have a Problem.
Buchheit, Martin
2017-09-01
Apollo 13 was initially looking like it would be the smoothest flight ever. After the explosion of an oxygen tank, however, the astronauts were close to spending the rest of their lives in rotation around the planet. This well-known incident is used to further discuss the link, or lack thereof, between sport-science research and current field practices. There is a feeling that the academic culture and its publishing requirements have created a bit of an Apollo 13-like orbiting world (eg, journals and conferences) that is mostly disconnected from the reality of elite performance. The author discusses how poor research discredits our profession and provides some examples from the field where the research does not apply. In fact, the reality is that sport scientists often do not have the right answers. Some perspectives to improve translation are finally discussed, including a rethink of the overall publishing process: promotion of relevant submission types (eg, short-paper format, short reports, as provided by IJSPP), improvement of the review process (faster turnaround, reviewers identified to increase accountability, and, in turn, review quality), and media types (eg, free downloads, simplified versions published in coaching journals, book chapters, infographics, dissemination via social media). When it comes to guiding practitioners and athletes, instead of using an evidence-based approach, we should rather promote an "evidence-led" or "informed-practice" approach-one that appreciates context over simple scientific conclusions.
1990-12-01
was determined from the difference between the 24-state matrix product, HtP (t’)HT, and the six-state matrix product, HfPf (tT)HT’. For this...Houston: IMSL Inc., Houston, Texas (1989). 5. GNUPLOT USER’S MANUAL . "An Interactive Plotting Program." Williams, Thomas, and Colin Kelley. 6. Hawkes...Conference on Decision and Control: 712-717. Austin, Texas (December 1988). 13. LQGLIB USER’S MANUAL . "A Description of Computer Routines for Use in Linear
Polyethylene bio-degradation by caterpillars of the wax moth Galleria mellonella
Bombelli, P; Howe, CJ; Bertocchini, F
2017-01-01
Plastics are synthetic polymers derived from fossil oil and largely resistant to biodegradation. Polyethylene (PE) and polypropylene (PP) represent ∼92% of total plastic production. PE is largely utilized in packaging, representing ∼40% of total demand for plastic products (www.plasticseurope.org) with over a trillion plastic bags used every year [1]. Plastic production has increased exponentially in the past 50 years (Figure S1A in Supplemental Information, published with this article online...
An Annotated Bibliography of Patents Related to Coastal Engineering. Volume I. 1967-1970. Appendix.
1979-11-01
end when the iain, t’oc’i is p’o. .,neu :or use in .- :er 3.344.867BOTTOM BRACE FOR PILE HAMER LEADS John I. Kupka, Gladstone, N.J. assisor, by tsme as... Florian , Houston, Keyworda: Seismic hydrophone; Seismic Tex., sagnos to Mandrel Induties, Inc., Houston, hydrophone array Tez, a corporadon of Michigan...the cylinder memoer. The top of the cylinder member bears against a cushion block which is struck by the rim point of the heavy hamer . A bot- tom
Compliance to two city convenience store ordinance requirements
Menéndez, Cammie K Chaumont; Amandus, Harlan E; Wu, Nan; Hendricks, Scott A
2015-01-01
Background Robbery-related homicides and assaults are the leading cause of death in retail businesses. Robbery reduction approaches focus on compliance to Crime Prevention Through Environmental Design (CPTED) guidelines. Purpose We evaluated the level of compliance to CPTED guidelines specified by convenience store safety ordinances effective in 2010 in Dallas and Houston, Texas, USA. Methods Convenience stores were defined as businesses less than 10 000 square feet that sell grocery items. Store managers were interviewed for store ordinance requirements from August to November 2011, in a random sample of 594 (289 in Dallas, 305 in Houston) convenience stores that were open before and after the effective dates of their city’s ordinance. Data were collected in 2011 and analysed in 2012–2014. Results Overall, 9% of stores were in full compliance, although 79% reported being registered with the police departments as compliant. Compliance was consistently significantly higher in Dallas than in Houston for many requirements and by store type. Compliance was lower among single owner-operator stores compared with corporate/franchise stores. Compliance to individual requirements was lowest for signage and visibility. Conclusions Full compliance to the required safety measures is consistent with industry ‘best practices’ and evidence-based workplace violence prevention research findings. In Houston and Dallas compliance was higher for some CPTED requirements but not the less costly approaches that are also the more straightforward to adopt. PMID:26337569
US gas pipelines respond to FERC Order 636
International Nuclear Information System (INIS)
Anon.
1992-01-01
This paper reports that U.S. pipelines are continuing to examine the react to the Federal Energy Regulatory Commission's Order 636. Among the latest responses: Bill Vititoe, president and chief executive officer of ANR Pipeline Co., a subsidiary of Coastal Corp., Houston, the his company's recently proposed comprehensive service restructuring and rate settlement basically is consistent with Order 636. Paul M. Anderson, executive vice-president of Panhandle Eastern Corp., Houston, the Order 63 likely will increase reliance on long term gas sales contracts and shrink or eliminate spot market sales
Directory of Open Access Journals (Sweden)
Rui Figueiredo
Full Text Available Salmonella enterica is a zoonotic foodborne pathogen that causes acute gastroenteritis in humans. We assessed the virulence potential of one-hundred and six Salmonella strains isolated from food animals and products. A high through-put virulence genes microarray demonstrated Salmonella Pathogenicity Islands (SPI and adherence genes were highly conserved, while prophages and virulence plasmid genes were variably present. Isolates were grouped by serotype, and virulence plasmids separated S. Typhimurium in two clusters. Atypical microarray results lead to whole genome sequencing (WGS of S. Infantis Sal147, which identified deletion of thirty-eight SPI-1 genes. Sal147 was unable to invade HeLa cells and showed reduced mortality in Galleria mellonella infection model, in comparison to a SPI-1 harbouring S. Infantis. Microarray and WGS of S. Typhimurium Sal199, established for the first time in S. Typhimurium presence of cdtB and other Typhi-related genes. Characterization of Sal199 showed cdtB genes were upstream of transposase IS911, and co-expressed with other Typhi-related genes. Cell cycle arrest, cytoplasmic distension, and nuclear enlargement were detected in HeLa cells infected by Sal199, but not with S. Typhimurium LT2. Increased mortality of Galleria was detected on infection with Sal199 compared to LT2. Thus, Salmonella isolates were rapidly characterized using a high through-put microarray; helping to identify unusual virulence features which were corroborated by further characterisation. This work demonstrates that the use of suitable screening methods for Salmonella virulence can help assess the potential risk associated with certain Salmonella to humans. Incorporation of such methodology into surveillance could help reduce the risk of emergence of epidemic Salmonella strains.
Fogwater Chemistry and Air Quality in the Texas-Louisiana Gulf Coast Corridor
Kommalapati, R. R.; Raja, S.; Ravikrishna, R.; Murugesan, K.; Collett, J. L.; Valsaraj, K.
2007-05-01
The presence of fog water in polluted atmosphere can influence atmospheric chemistry and air quality. The study of interactions between fog water and atmospheric gases and aerosols are very important in understanding the atmospheric fate of the pollutants. In this Study several air samples and fogwater samples were collected in the heavily industrialized area of Gulf Coast corridor( Houston, TX and Baton Rouge, LA). A total of 32 fogwater samples were collected, comprising of nine fog events in Baton Rouge (Nov 2004 to Feb 2005) and two fog events in Houston (Feb, 2006), during the fog sampling campaigns. These samples were analyzed for pH, total and dissolved carbon, major inorganic ions, organic acids, and aromatics, aldehydes, VOCs, and linear alkanes organic compounds. Fogwater samples collected in Houston show clear influence of marine and anthropogenic environment, while Baton Rouge samples reveal a relatively less polluted environment. Also, a time series observation of air samples indicated that fog event at the monitoring site impacted the air concentrations of the pollutants. This is attributed to presence of surface active organic matter in fog water.
Compliance to two city convenience store ordinance requirements.
Chaumont Menéndez, Cammie K; Amandus, Harlan E; Wu, Nan; Hendricks, Scott A
2016-04-01
Robbery-related homicides and assaults are the leading cause of death in retail businesses. Robbery reduction approaches focus on compliance to Crime Prevention Through Environmental Design (CPTED) guidelines. We evaluated the level of compliance to CPTED guidelines specified by convenience store safety ordinances effective in 2010 in Dallas and Houston, Texas, USA. Convenience stores were defined as businesses less than 10 000 square feet that sell grocery items. Store managers were interviewed for store ordinance requirements from August to November 2011, in a random sample of 594 (289 in Dallas, 305 in Houston) convenience stores that were open before and after the effective dates of their city's ordinance. Data were collected in 2011 and analysed in 2012-2014. Overall, 9% of stores were in full compliance, although 79% reported being registered with the police departments as compliant. Compliance was consistently significantly higher in Dallas than in Houston for many requirements and by store type. Compliance was lower among single owner-operator stores compared with corporate/franchise stores. Compliance to individual requirements was lowest for signage and visibility. Full compliance to the required safety measures is consistent with industry 'best practices' and evidence-based workplace violence prevention research findings. In Houston and Dallas compliance was higher for some CPTED requirements but not the less costly approaches that are also the more straightforward to adopt. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Highway tunnel safety; Le gallerie infrastrutturali e la loro sicurezza
Energy Technology Data Exchange (ETDEWEB)
Sacripanti, A [ENEA, Divisione Robotica Informatica Avanzata, Rome (Italy)
2001-04-01
Guaranteeing an acceptable level of fire safety in tunnels requires the targeted and integrated use of innovative technologies and systems. However, their deployment to improve safety against a variable risk like fire must be based on a risk analysis capable of developing a dynamic vision of the tunnel. [Italian] Per assicurare un livello di sicurezza accettabile nei tunnel, in caso di incendio e' necessario l'uso mirato ed integrato di tecnologie e sistemi innovativi. Alla base, pero', ci deve essere una analisi di rischio in grado di sviluppare una visione dinamica della galleria, per migliorarne la sicurezza a fronte di un rischio variabile nel tempo.
Highway tunnel safety; Le gallerie infrastrutturali e la loro sicurezza
Energy Technology Data Exchange (ETDEWEB)
Sacripanti, A. [ENEA, Divisione Robotica Informatica Avanzata, Rome (Italy)
2001-04-01
Guaranteeing an acceptable level of fire safety in tunnels requires the targeted and integrated use of innovative technologies and systems. However, their deployment to improve safety against a variable risk like fire must be based on a risk analysis capable of developing a dynamic vision of the tunnel. [Italian] Per assicurare un livello di sicurezza accettabile nei tunnel, in caso di incendio e' necessario l'uso mirato ed integrato di tecnologie e sistemi innovativi. Alla base, pero', ci deve essere una analisi di rischio in grado di sviluppare una visione dinamica della galleria, per migliorarne la sicurezza a fronte di un rischio variabile nel tempo.
Silk recycling in larvae of the wax moth, Galleria mellonella (Lepidoptera: Pyralidae)
Czech Academy of Sciences Publication Activity Database
Shaik, Haq Abdul; Mishra, Archana; Sehnal, František
2017-01-01
Roč. 114, JAN 27 (2017), s. 61-65 E-ISSN 1802-8829 R&D Projects: GA MŠk ME 907 Institutional support: RVO:60077344 Keywords : Lepidoptera * Pyralidae * silk recycling Subject RIV: ED - Physiology OBOR OECD: Biochemistry and molecular biology Impact factor: 1.167, year: 2016 http://www.eje.cz/pdfs/eje/2017/01/09.pdf
Evaluation of Galleria mellonella larvae for studying the virulence of Streptococcus suis
Velikova, Nadya; Kavanagh, Kevin; Wells, Jerry M.
2016-01-01
Background: Streptococcus suis is an encapsulated Gram-positive bacterium and the leading cause of sepsis and meningitis in young pigs, resulting in considerable economic losses in the porcine industry. S. suis is considered an emerging zoonotic agent with increasing numbers of human cases over the
ORF Alignment: NC_005956 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... henselae str. Houston-1] ... Length = 98 ... Query: 5 ... RDFIDSEIKENDVILFMKGTPDAPQCGFSGQVAHIL...NYLGVPYKGINILTSDELRQGIKD 64 ... RDFIDSEIKENDVILFMKGTPDAPQCGFSGQVAHILNYLGVP...YKGINILTSDELRQGIKD Sbjct: 1 ... RDFIDSEIKENDVILFMKGTPDAPQCGFSGQVAHILNYLGVPYKGINILTSDELRQGIKD 60 ...
ORF Alignment: NC_005956 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available a henselae str. ... Houston-1] ... Length = 44 ... Query: 133 SYIVQTGDTLLSIARQRGVSVEALKLVNGIRSN...SIYIGQVLMIP 176 ... SYIVQTGDTLLSIARQRGVSVEALKLVNGIRSNSIYIGQVLMIP Sbjct: 1 ... SYIVQTGDTLLSIARQRGVSVEALKLVNGIRSNSIYIGQVLMIP 44
O'Grady, Joseph; Bument, Arlden; Siegel, Edward
2011-03-01
Carbides solid-state chemistry domination of old/new nuclear-reactors/spent-fuel-casks/refineries/jet/missile/rocket-engines is austenitic/FCC Ni/Fe-based (so miscalled)"super"alloys(182/82;Hastelloy-X,600,304/304L-SSs,...690!!!) GENERIC ENDEMIC EXTANT detrimental(synonyms): Wigner's-disease(WD) [J.Appl.Phys.17,857 (46)]/Ostwald-ripening/spinodal-decomposition/overageing-embrittlement/thermal-leading-to-mechanical(TLTM)-INstability: Mayo[Google: fLeaksCouldKill > ; - Siegel [ J . Mag . Mag . Mtls . 7 , 312 (78) = atflickr . comsearchonGiant - Magnotoresistance [Fert" [PRL(1988)]-"Gruenberg"[PRL(1989)] 2007-Nobel]necessitating NRC inspections on 40+25=65 Westin"KL"ouse PWRs(12/2006)]-Lai [Met.Trans.AIME, 9A,827(78)]-Sabol-Stickler[Phys.Stat.Sol.(70)]-Ashpahani[ Intl.Conf. Hydrogen in Metals, Paris(1977]-Russell [Prog.Mtls.Sci.(1983)]-Pollard [last UCS rept.(9/1995)]-Lofaro [BNL/DOE/NRC Repts.]-Pringle [ Nuclear-Power:From Physics to Politics(1979)]-Hoffman [animatedsoftware.com], what DOE/NRC MISlabels as "butt-welds" "stress-corrosion cracking" endpoint's ROOT-CAUSE ULTIMATE-ORIGIN is WD overageing-embrittlement caused brittle-fracture cracking from early/ongoing AEC/DOE-n"u"tional-la"v"atories sabotage!!!
Spiritual care may impact mental health and medication adherence in HIV+ populations
Directory of Open Access Journals (Sweden)
Oji VU
2017-04-01
Full Text Available Valerie U Oji,1–3 Leslie C Hung,3 Reza Abbasgholizadeh,1,4 Flora Terrell Hamilton,5 E James Essien,6 Evaristus Nwulia7 1Lifefountain Center Ministries Inc, Houston, TX, USA; 2Feik School of Pharmacy, University of the Incarnate Word, San Antonio, TX, USA; 3University of Texas, College of Pharmacy, Austin, TX, USA; 4University of Houston, Houston, TX, USA; 5Administration, Family & Medical Counseling Service, Inc. (FMCS, Washington, DC, USA; 6University of Houston Institute for Community Health, Houston, TX, USA; 7Psychiatry, Howard University Translational Neuroscience Laboratory, Washington, DC, USA Objective: To explore a potential role for spirituality in medication-related needs assessment for integrated care in chronically ill populations. Method: A systematic literature review was conducted to explore the impact of faith beliefs on health and/or medication adherence in individuals with depression and/or HIV+/AIDS. Retrospective electronic medical record review of adult HIV+ patients of an urban primary care clinic with integrated mental health services was conducted, with Substance Abuse and Mental Illness Symptoms Screener (SAMISS, major depressive disorder (MDD incidence over the preceding year, and history of contact with a spiritual advisor. A convenience sample was interviewed to qualitatively assess potential medication therapy management needs and medication-related problems. Another sample was examined utilizing the Daily Spiritual Experience Scale. Results: The literature reports positive influence on health behaviors, coping and outcomes; and poor medication adherence and treatment decisions due to patient passivity or resistance. Spiritual advisor contact (not limited to a specific religion was significantly associated with MDD absence (1.7% vs. 15.3%, P<0.005 and inversely related to SAMISS, depression, and poor health behaviors. Patient interviews reflected significance of faith in terms of insight and acceptance of
Making connections: New Orleans Evacuees' experiences in obtaining drugs.
Dunlap, Eloise; Johnson, Bruce D; Kotarba, Joseph A; Fackler, Jennifer
2009-09-01
Between August 29 and September 7, 2005, almost all New Orleans residents were evacuated from the area in the aftermath of Hurricane Katrina. News reports indicate that almost 130,000 New Orleans Evacuees (NOEs) were evacuated to Houston, Texas, the largest recipient of the civilian population from New Orleans. Some of these NOEs were active participants in the illicit drug market in New Orleans prior to the hurricane. The period between the flooding and the nearly complete evacuation of New Orleans as well as their subsequent displacement to Houston and other locations provided unique opportunities to study what occurs when illicit drug markets are disrupted, since populations of illicit drug users and purchasers could no longer routinely obtain their drugs in predictable ways. Utilizing qualitative data from in-depth interviews and focus groups, this article describes the ways NOEs (1) managed their drug acquisition and use following evacuation; (2) located new sources of drugs in Houston and elsewhere by tapping into shared drug culture; and (3) gained access to and learned the argot for drugs in the local drug market in new settings. This report contributes to the nascent literature on disrupted drug markets.
US-China Collaboration on Landslide Research and Student Training
Wang, G.
2016-12-01
Funded by a NSF International Research Experience for Students (IRES) project (OIA: 1460034) at the University of Houston (http://ires.nsm.uh.edu), the author brought eight U.S. students to China in the summer of 2016. The host university at the China side is the China University of Geoscience at Wuhan. The international collaborative project is designed to expose U.S. students to the international landslide research community at an early stage of their careers. The NSF IRES program will support minimum 18 U.S. students (two graduates and four undergraduates per year) to conduct advanced landslide research in the Three Gorges area in China during the summers (eight weeks) of 2016, 2017, and 2018. The 2016 summer program includes a one-week-long pre-training at the University of Houston, a two-week-long intensive Chinese language and cultural course at the main campus of the China University of Geosciences (Wuhan), a four-week-long landslide field investigation in the Three Gorges Reservoir area, and a one-week-long wrap-up at the University of Houston. This presentation will introduce the experiences and lessons that we learned from the first-year activities of the international collaborative project.
International Nuclear Information System (INIS)
1986-09-01
In April 1986 the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-0781) regarding the application of Houston Lighting and Power Company (applicant and agent for the owners) for a license to operate South Texas Project, Units 1 and 2 (Docket Nos. 50-498 and 50-499). The facility is located in Matagorda County, Texas, west of the Colorado River, 8 miles north-northwest of the town of Matagorda and about 89 miles southwest of Houston. This first supplement to NUREG-0781 reports the status of certain items that remained unresolved at the time the Safety Evaluation Report was published
Directory of Open Access Journals (Sweden)
Ozan eGundogdu
2015-07-01
Full Text Available The ability of the human intestinal pathogen Campylobacter jejuni to respond to oxidative stress is central to bacterial survival both in vivo during infection and in the environment. Re-annotation of the C. jejuni NCTC11168 genome revealed the presence of two MarR-type transcriptional regulators Cj1546 and Cj1556, originally annotated as hypothetical proteins, which we have designated RrpA and RrpB (regulator of response to peroxide respectively. Previously we demonstrated a role for RrpB in both oxidative and aerobic (O2 stress and that RrpB was a DNA binding protein with auto-regulatory activity, typical of MarR-type transcriptional regulators. In this study, we show that RrpA is also a DNA binding protein and that a rrpA mutant in strain 11168H exhibits increased sensitivity to hydrogen peroxide oxidative stress. Mutation of either rrpA or rrpB reduces catalase (KatA expression. However a rrpAB double mutant exhibits higher levels of resistance to hydrogen peroxide oxidative stress, with levels of KatA expression similar to the wild-type strain. Neither the rrpA nor rrpB mutant exhibits any significant difference in sensitivity to either cumene hydroperoxide or menadione oxidative stresses, but both mutants exhibit a reduced ability to survive aerobic (O2 stress, enhanced biofilm formation and reduced virulence in the Galleria mellonella infection model. The rrpAB double mutant exhibits wild-type levels of biofilm formation and wild-type levels of virulence in the Galleria mellonella infection model. Together these data indicate a role for both RrpA and RrpB in the C. jejuni peroxide oxidative and aerobic (O2 stress responses, enhancing bacterial survival in vivo and in the environment.
ORF Alignment: NC_005956 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... henselae str. Houston-1] ... Length = 201 ... Query: 8 ... IVSALRAFERGEIVVVTDDDDRENEGDLIVAAVHCTEEKMAFIIRHTTGIVCAPM...PKEEA 67 ... IVSALRAFERGEIVVVTDDDDRENEGDLIVAAVHCTEEKMAFIIRHTTGIVCAPM...PKEEA Sbjct: 1 ... IVSALRAFERGEIVVVTDDDDRENEGDLIVAAVHCTEEKMAFIIRHTTGIVCAPMPKEEA 60 ... Query: 128 HIFPLIA
ORF Alignment: NC_005956 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... henselae str. Houston-1] ... Length = 150 ... Query: 1 ... MPTFTTHRQIAHSAREMFDLVADIECYPEFLPMCE...ALIVRSRKKCEEKTLLLADMTVGYK 60 ... MPTFTTHRQIAHSAREMFDLVADIECYPEFLPMCEALIVRS...RKKCEEKTLLLADMTVGYK Sbjct: 1 ... MPTFTTHRQIAHSAREMFDLVADIECYPEFLPMCEALIVRSRKKCEEKTLLLADMTVGYK 60 ... Query: 121 L
Directory of Open Access Journals (Sweden)
Yakovlev Ye. B.
2015-08-01
Full Text Available Steinernema arenarium isolate CH was prepared at 22 °C and used as a control in laboratory experiments on rearing in Galleria mellonella larvae at different temperatures (18 and 28 °C. Host dead bodies were examined every two days. All reared adult nematodes were fixed in alcohol and mounted on permanent slides with glycerin solution in distilled water. The basic morphometric parameters (L, W, ES, ABD (CBD, T, V were measured, and statistical analysis was performed. Morphometric data in males and females of both generations were shown to significantly change depending on speed of growth and nutrients concentration. In both experimental groups, pygmy forms of adults were found.
Enterococcus infection biology: lessons from invertebrate host models.
Yuen, Grace J; Ausubel, Frederick M
2014-03-01
The enterococci are commensals of the gastrointestinal tract of many metazoans, from insects to humans. While they normally do not cause disease in the intestine, they can become pathogenic when they infect sites outside of the gut. Recently, the enterococci have become important nosocomial pathogens, with the majority of human enterococcal infections caused by two species, Enterococcus faecalis and Enterococcus faecium. Studies using invertebrate infection models have revealed insights into the biology of enterococcal infections, as well as general principles underlying host innate immune defense. This review highlights recent findings on Enterococcus infection biology from two invertebrate infection models, the greater wax moth Galleria mellonella and the free-living bacteriovorous nematode Caenorhabditis elegans.
Surface faults in the gulf coastal plain between Victoria and Beaumont, Texas
Verbeek, Earl R.
1979-01-01
Displacement of the land surface by faulting is widespread in the Houston-Galveston region, an area which has undergone moderate to severe land subsidence associated with fluid withdrawal (principally water, and to a lesser extent, oil and gas). A causative link between subsidence and fluid extraction has been convincingly reported in the published literature. However, the degree to which fluid withdrawal affects fault movement in the Texas Gulf Coast, and the mechanism(s) by which this occurs are as yet unclear. Faults that offset the ground surface are not confined to the large (>6000-km2) subsidence “bowl” centered on Houston, but rather are common and characteristic features of Gulf Coast geology. Current observations and conclusions concerning surface faults mapped in a 35,000-km2 area between Victoria and Beaumont, Texas (which area includes the Houston subsidence bowl) may be summarized as follows: (1) Hundreds of faults cutting the Pleistocene and Holocene sediments exposed in the coastal plain have been mapped. Many faults lie well outside the Houston-Galveston region; of these, more than 10% are active, as shown by such features as displaced, fractured, and patched road surfaces, structural failure of buildings astride faults, and deformed railroad tracks. (2) Complex patterns of surface faults are common above salt domes. Both radial patterns (for example, in High Island, Blue Ridge, Clam Lake, and Clinton domes) and crestal grabens (for example, in the South Houston and Friendswood-Webster domes) have been recognized. Elongate grabens connecting several known and suspected salt domes, such as the fault zone connecting Mykawa, Friendswood-Webster, and Clear Lake domes, suggest fault development above rising salt ridges. (3) Surface faults associated with salt domes tend to be short (10 km), occur singly or in simple grabens, have gently sinuous traces, and tend to lie roughly parallel to the ENE-NE “coastwise” trend common to regional growth
76 FR 29284 - Tennessee Disaster #TN-00055
2011-05-20
... Counties: Benton, Carroll, Crockett, Dyer, Gibson, Henderson, Henry, Houston, Lake, Lauderdale, Madison.... (Catalog of Federal Domestic Assistance Numbers 59002 and 59008) James E. Rivera, Associate Administrator...
75 FR 27009 - Tennessee Disaster Number TN-00039
2010-05-13
..., Houston, Madison, Obion. Contiguous Counties: (Economic Injury Loans Only): Tennessee: Henry, Weakley... remains unchanged. (Catalog of Federal Domestic Assistance Numbers 59002 and 59008) James E. Rivera...
International Nuclear Information System (INIS)
1987-01-01
In April 1986 staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-0781) regarding the application of Houston Lighting and Power Company (applicant and agent for the owners) for a license to operate South Texas Project, Units 1 and 2 (Docket Nos. 50-498 and 50-499). The facility is located in Matagorda County, Texas, west of the Colorado River, 8 miles north-northwest of the town of Matagorda and about 89 miles southwest of Houston. The first supplement to NUREG-0781 was issued in September 1986. This second supplement reports on the status of unresolved items in the Safety Evaluation Report and identifies certain additional items that have since been reviewed by the staff
Industrial customer response to wholesale prices in the restructured Texas electricity market
International Nuclear Information System (INIS)
Zarnikau, J.
2007-01-01
This paper estimates the demand responsiveness of the 20 largest industrial energy consumers in the Houston area to wholesale price signals in the restructured Electric Reliability Council of Texas (ERCOT) market. Statistical analysis of their load patterns employing a Symmetric Generalized McFadden cost function model suggests that ERCOT achieved limited success in establishing a market that facilitates demand response from the largest industrial energy consumers in the Houston area to wholesale price signals in its second year of retail competition. The muted price response is at least partially because energy consumers who opt to offer their ''interruptibility'' to the market as an ancillary service are constrained in their ability to respond to wholesale energy prices. (author)
50 CFR 14.12 - Designated ports.
2010-10-01
..., POSSESSION, TRANSPORTATION, SALE, PURCHASE, BARTER, EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS.... (f) Dallas/Fort Worth, Texas. (g) Honolulu, Hawaii. (h) Houston, Texas. (i) Los Angeles, California...
Bauer, S
1993-10-01
The Southwest Community Health Clinic (SCHC) has been providing free preventive healthcare to the poor residents of its Houston neighborhood since June 1991. Sponsored by the Sisters of Charity of the Incarnate Word Health Care System and the city of Houston, the clinic invites healing through hospitality, unlike many free clinics. The family-focused clinic takes a multidisciplinary team approach to preventive healthcare. The staff of approximately 30 healthcare professionals provides prenatal and pediatric care; immunizations; tuberculosis screenings; and a variety of social services for patients' physical, emotional, and spiritual needs. SCHC's well-child program screens children from birth through age five for physical and developmental problems. Clinic staff teach and guide parents on their children's health. The program stresses early identification of developmental delays and disabilities, with referral to appropriate services. SCHC has also implemented a tuberculosis testing program to prevent spread of the disease. Persons who test positive are referred to the City of Houston Department of Health and Human Service's chest clinics for follow-up and treatment. Community outreach is a major ingredient of SCHC's preventive healthcare program. A community health advocate, who is familiar with the cultures, traditions, and languages of the population being served, identifies families needing care and supports their access and use of healthcare services.
Directory of Open Access Journals (Sweden)
Ana Lucia Roscani Calusni
2003-07-01
Full Text Available Tuberculosis (TB is a major concern in developing countries. In Brazil, few genotyping studies have been conducted to verify the number of IS6110 copies present in local prevalent strains of Mycobacterium tuberculosis, the distribution and clustering of strains. IS6110 DNA fingerprinting was performed on a sample of M. tuberculosis isolates from patients with AFB smear-positive pulmonary TB, at a hospital in Brazil. The IS6110 profiles were analyzed and compared to a M. tuberculosis database of the Houston Tuberculosis Initiative, Houston, US. Seventy-six fingerprints were obtained from 98 patients. All M. tuberculosis strains had an IS6110 copy number between 5-21 allowing for differentiation of the isolates. Human immunodeficiency virus infection was confirmed in nearly half the patients of whom data was available. Fifty-eight strains had unique patterns, while 17 strains were grouped in 7 clusters (2 to 6 strains. When compared to the HTI database, 6 strains matched isolates from El Paso, Ciudad de Juarez, Houston, and New York. Recently acquired infections were documented in 19% of cases. The community transmission of infection is intense, since some clustered strains were recovered during the four-year study period. The intercontinental dissemination of M. tuberculosis strains is suspected by demonstration of identical fingerprints in a distant country.
Garson, Arthur; Green, Donna M; Rodriguez, Lia; Beech, Richard; Nye, Christopher
2012-05-01
Because the Affordable Care Act will expand health insurance to cover an estimated thirty-two million additional people, new approaches are needed to expand the primary care workforce. One possible solution is Grand-Aides®, who are health care professionals operating under the direct supervision of nurses, and who are trained and equipped to conduct telephone consultations or make primary care home visits to patients who might otherwise be seen in emergency departments and clinics. We conducted pilot tests with Grand-Aides in two pediatric Medicaid settings: an urban federally qualified health center in Houston, Texas, and a semi-rural emergency department in Harrisonburg, Virginia. We estimated that Grand-Aides and their supervisors averted 62 percent of drop-in visits at the Houston clinic and would have eliminated 74 percent of emergency department visits at the Virginia test site. We calculated the cost of the Grand-Aides program to be $16.88 per encounter. That compares with current Medicaid payments of $200 per clinic visit in Houston and $175 per emergency department visit in Harrisonburg. In addition to reducing health care costs, Grand-Aides have the potential to make a substantial impact in reducing congestion in primary care practices and emergency departments.
Mirhaji, Parsa; Casscells, S Ward; Srinivasan, Arunkumar; Kunapareddy, Narendra; Byrne, Sean; Richards, David Mark; Arafat, Raouf
2006-01-01
During the Hurricane Katrina relief efforts, a new city was born overnight within the City of Houston to provide accommodation and health services for thousands of evacuees deprived of food, rest, medical attention, and sanitation. The hurricane victims had been exposed to flood water, toxic materials, physical injury, and mental stress. This scenario was an invitation for a variety of public health hazards, primarily infectious disease outbreaks. Early detection and monitoring of morbidity and mortality among evacuees due to unattended health conditions was an urgent priority and called for deployment of real-time surveillance to collect and analyze data at the scene, and to enable and guide appropriate response and planning activities. The University of Texas Health Science Center at Houston (UTHSC) and the Houston Department of Health and Human Services (HDHHS) deployed an ad hoc surveillance system overnight by leveraging Internet-based technologies and Services Oriented Architecture (SOA). The system was post-coordinated through the orchestration of Web Services such as information integration, natural language processing, syndromic case finding, and online analytical processing (OLAP). Here we will report the use of Internet-based and distributed architectures in providing timely, novel, and customizable solutions on demand for unprecedented events such as natural disasters.
Directory of Open Access Journals (Sweden)
Li Y
2017-05-01
Full Text Available Ya-Huei Li,1 Osaro Mgbere,1,2 Susan Abughosh,1 Hua Chen,1 Paula Cuccaro,3 Ekere James Essien1,3 1Department of Pharmaceutical Health Outcomes and Policy, College of Pharmacy, University of Houston, Texas Medical Center, Houston, TX, USA; 2Houston Health Department, Houston, TX, USA; 3Department of Health Promotion and Behavioral Sciences, School of Public Health, University of Texas Health Science Center, Houston, TX, USA Abstract: Risk and protective processes are integrated developmental processes that directly or indirectly affect behavioral outcomes. A better understanding of these processes is needed, in order to gauge their contribution to sexual risk behaviors. This retrospective cross-sectional study modeled the ecodevelopmental chain of relationships to examine the social contexts of African-American (AA adolescents associated with sexually transmitted disease (STD- and HIV-risk behaviors. We used data from 1,619 AA adolescents with an average age of 16±1.8 years obtained from the first wave of the National Longitudinal Study of Adolescent Health for this study. Confirmatory factor analysis followed by structural equation modeling was conducted to identify the latent constructs that reflect the social–interactional components of the ecodevelopmental theory. Among contextual factors, findings indicated that a feeling of love from father, school, religion, and parent attitudes toward adolescent sexual behavior were all factors that played significant roles in the sexual behavior of AA adolescents. AA adolescents who reported feeling love from their father, feeling a strong negative attitude from their parents toward having sex at a very young age, and having a strong bond with school personnel were associated with better health statuses. The level of parents’ involvement in their children’s lives was reflected in the adolescents’ feeling of love from parents and moderated by their socioeconomic status. Being male, attaining
Energy Efficient LED Spectrally Matched Smart Lighting, Phase II
National Aeronautics and Space Administration — Innovative Imaging and Research and the University of Houston Clear Lake have teamed to develop a widely extensible, affordable, energy efficient, smart lighting...
Urban Influences on Convection and Lightning Over Houston
National Research Council Canada - National Science Library
Gauthier, Michael L
2006-01-01
The research presented in this dissertation addresses a fundamental question regarding urban, ultimately anthropogenic, influences on convection as it relates to lightning production and precipitation structure...
Physics Education at University of Houston Clear Lake
Masood, Samina
2011-03-01
We are developing a physics education program to prepare teachers to teach Physics in High Schools. The science teachers training needs to be brought to the level where they can motivate children and young adults in their classrooms to take interest in science learning to adopt science and engineering career. The early selection of career path helps the better preparation for the career.
Basemap Framework Submission for Houston County, TN, USA
Federal Emergency Management Agency, Department of Homeland Security — FEMA Framework Basemap datasets comprise six of the seven FGDC themes of geospatial data that are used by most GIS applications (Note: the seventh framework theme,...
Houston...We have a problem! Measurement of parenting
While there has been long-term recognition of parents' important influences on children's diet, physical activity, and screen media behaviors, these relationships have only recently received careful research attention. A problem in this research has been the quality of measurement. To address this...
Américo Castro en Houston: 1955-59
Directory of Open Access Journals (Sweden)
Nancy F. MARINO
2009-11-01
Full Text Available A partir del año 1936 la vida del filólogo y profesor Américo Castro le lleva a tierras americanas, donde permanece como catedrático en varias universidades mientras escribe la mayoría de sus obras maestras. En 1936 es profesor en Buenos Aires, pero un año más tarde reanuda la carrera docente en Estados Unidos, primero en la Universidad de Wisconsin (1937-39, después en la de Tejas (1939-40, y por fin en Princeton donde se pasa más de veinte años. Su jubilación a los 68 años de edad se debe a la inflexibilidad del sistema que le obliga a retirarse, y no a su deseo de dejar de dar clases. Después de abandonar su cátedra en Princeton —aunque siempre mantendrá su hogar en esa ciudad a pesar de sus varias andanzas— D. Américo se va a Venezuela para dar una serie de conferencias y para seguir trabajando en sus obras.
Freitas, Dayvison F S; Santos, Suelen S; Almeida-Paes, Rodrigo; de Oliveira, Manoel M E; do Valle, Antonio C F; Gutierrez-Galhardo, Maria Clara; Zancopé-Oliveira, Rosely M; Nosanchuk, Joshua D
2015-01-01
The metropolitan region of Rio de Janeiro is hyperendemic for cat-associated sporotrichosis. This study aimed to assess the virulence of serial Sporothrix isolates from a 61-year-old male patient with chronic, destructive disseminated sporotrichosis. Five Sporothrix isolates were cultured from skin exudates and bone samples over a 5-year period, and all were molecularly identified as Sporothrix brasiliensis. The final isolate was significantly more virulent in Galleria mellonella larvae compared to earlier isolates. We conclude that S. brasiliensis has the capacity to increase in virulence in vivo. This finding is significant to clinicians caring for individuals with S. brasiliensis disease and it suggests that further studies are needed to identify the mechanisms underlying pathogenicity enhancement during chronic disease.
Giovanni Degli Alessandri: i primi anni del direttorato agli Uffizi fra nuovi e vecchi ruoli
Directory of Open Access Journals (Sweden)
Chiara Pasquinelli
2011-11-01
Full Text Available La figura di Giovanni Degli Alessandri (1765-1830, presidente dell’Accademia di Belle Arti di Firenze e direttore degli Uffizi tra gli anni napoleonici e la Restaurazione di Ferdinando III d’Asburgo-Lorena, è quella di un personaggio chiave nella politica artistica fiorentina, e toscana più in generale. Nel saggio si esaminano i primi anni del suo direttorato alla Galleria, i rapporti con Antonio Canova, il suo ruolo all’interno dell’entourage di Elisa Baciocchi Bonaparte, oltre a considerare alcuni spunti legati al rinnovamento degli Uffizi, nonché la delicata vicenda del passaggio in città di Dominique-Vivant Denon, direttore del Louvre. L’obbiettivo è quello di introdurre elementi di approfondimento relativamente a una figura molto nota ma poco studiata.
75 FR 9018 - Petition for Waiver of Compliance
2010-02-26
... warehousing and packaging distribution business located in Houston, Texas. The efficiency and safety of their..., data, or comments. FRA does not anticipate scheduling a public hearing in connection with these...
78 FR 30921 - Ocean Transportation Intermediary License Applicants
2013-05-23
.... (NVO & OFF), 2500 Wilcrest Drive, Suite 300, Houston, TX 77042, Officers: Myrian T. Morales, Vice..., FL 33178, Officer: Jose R. Gantus, President (QI), Application Type: QI Change XL Worldwide Corp...
2011-06-29
.... Fork of Root R. (Sheldon Township), Houston, 11000468 Swift County Gethsemane Episcopal Church, 40 N. Hering St., Appleton, 11000469 Traverse County District No. 44 School, U.S. 75 (Taylor Township...
Isolation of Bartonella henselae from a serologically negative cat in Bloemfontein, South Africa
Directory of Open Access Journals (Sweden)
A-M Pretorius
1999-07-01
Full Text Available Sera collected from apparently healthy 6-12-month-old cats (n = 31 presented to the Society for the Prevention of Cruelty to Animals Veterinary Clinic in Bloemfontein for neutering were tested for antibodies reactive to Bartonella henselae (Houston-1 strain by indirect fluorescent antibody testing. Whole blood collected from the cats was used in isolation experiments and subsequent identification of Bartonella species was based on comparison of the nucleotide base sequence of polymerase chain reaction-amplified citrate synthase gene fragments. While none of the cats had antibodies reactive with B. henselae at titres > 1/64, an organism with a partial citrate synthase gene sequence identical to that of B. henselae (Houston-1 was isolated from 1 cat.
Blowout brought under control in Gulf of Mexico
International Nuclear Information System (INIS)
Anon.
1992-01-01
This paper reports that Greenhill Petroleum Corp., Houston, killed a well blowout Oct. 9 and began cleaning up oil spilled into Timbalier Bay off La Fourche Parish, La. Development well No. 250 in Timbalier Bay field blew out Sept. 29 while Blake Drilling and Workover Co., Belle Chasse, La., was trying to recomplete it in a deeper zone. Fire broke out as Boots and Coots Inc., Houston, was positioning control equipment at the wellhead. State and federal oil spill response officials estimated the uncontrolled flow of well No. 250 at 1,400 b/d of oil. Coast Guard officials on Oct. 8 upgraded the blowout to a major spill, after deciding that at least 2,500 bbl of oil had gone into the water
Field Testing Unvented Roofs with Asphalt Shingles in Cold and Hot-Humid Climates
Energy Technology Data Exchange (ETDEWEB)
Ueno, Kohta [Building Science Corporation, Westford, MA (United States); Lstiburek, Joseph W. [Building Science Corporation, Westford, MA (United States)
2015-09-01
Test houses with unvented roof assemblies were built to measure long-term moisture performance, in the Chicago area (5A) and the Houston area (2A). The Chicago-area test bed had seven experimental rafter bays, including a control vented compact roof, and six unvented roof variants with cellulose or fiberglass insulation. The interior was run at 50% RH. The Houston-area roof was an unvented attic insulated with spray-applied fiberglass. Most ridges and hips were built with a diffusion vent detail, capped with vapor permeable roof membrane. In contrast, the diffusion vent roofs had drier conditions at the roof peak in wintertime, but during the summer, RHs and MCs were higher than the unvented roof (albeit in the safe range).
75 FR 51852 - Notice of Intent To Grant Partially Exclusive License
2010-08-23
... Shear Stress and Gravity'' to Regenetech, Inc., having its principal place of business in Houston, Texas... notice, NASA receives written objections including evidence and argument that establish that the grant of...
78 FR 51750 - NASA Asteroid Initiative Idea Synthesis Workshop
2013-08-21
... streaming forums dedicated to the workshop plenary sessions and focused track sessions. Check In Workshop... main doors (3600 Bay Area Blvd., Houston, Texas 77058). Media News media interested in attending are...
Journal of Earth System Science | Indian Academy of Sciences
Indian Academy of Sciences (India)
Author Affiliations. Sankar Kumar Nath1 Khemraj Shukla1 Madhav Vyas2. Department of Geology and Geophysics, Indian Institute of Technology, Kharagpur 721 302, India. Schlumberger Limited, Houston, Texas 77077, USA.
2010-11-05
.... ADDRESSES: Written comments may be sent to: Public Affairs Office, U.S. Army Environmental Command, Attention: IMPA-AE, 1835 Army Boulevard, Basement (Building 2000), Fort Sam Houston, TX 78234-2686. FOR...
76 FR 76411 - Ocean Transportation Intermediary License; Reissuance
2011-12-07
... Customs October 28, 2011. Brokers, 1386 Salford, Houston, TX 77032. 017582F Trans Global Logistics, Inc., 1 Conan Drive, Midland City, AL 36350. Sandra L. Kusumoto, Director, Bureau of Certification and...
7 CFR 351.2 - Location of inspectors.
2010-01-01
..., Del., Duluth, Minn., Eagle Pass, Tex., El Paso, Tex., Galveston, Tex., Hidalgo, Tex., Hilo, Hawaii, Hoboken, N.J., Honolulu, Hawaii, Houston, Tex., Jacksonville, Fla., Jamaica, L.I., N.Y., Key West, Fla...
Air Pollutant Source Attribution for Southeast Texas Using 14C/12C Ratios
National Research Council Canada - National Science Library
Lemire, Kenneth
2001-01-01
Both ambient air samples for VOC analysis and particulate matter samples were collected in the greater Houston area in an attempt to assess the biogenic contribution to the formation of ground-level...
2012-12-05
... principle place of business at 333 Clay Street, Suite 1600, Houston Texas, 77002. Plains LPG is a subsidiary... with regard to whether issuing a new Presidential Permit reflecting the corporate succession and...
2012-12-05
... business at 333 Clay Street, Suite 1600, Houston Texas, 77002. Plains LPG is a subsidiary of Plains All... whether issuing a new Presidential Permit reflecting the corporate succession and authorizing Plains LPG...
2010-07-07
.... 73,869 iLevel by Weyerhaeuser, Greenwood Village, CO April 6, 2009. iLevel Marketing and Sales...., Mobile, AL. Mobile Division. 74,084 Tenaris Global Services Houston, TX. (USA) Corporation. 74,220...
Reval, Kreete
2003-01-01
Heliplaatidest: "Erkki Otsman", Kärt Tomingas "Sinine kivi", Whitney Houston "Just Whitney", Amon Tobin "Out From Out Where", Gregorian "Masters Of Chant Chapter III", "Eesti heliloojad IV: Eesti Muusika Päevad 2002"
Winters, W L
2015-01-01
Automatic typewriters, transistor radios, microfiche, black and white television…while considered high-tech in the 1950s, these technologies seem limited when viewed from the 21st century. The same is true for cardiovascular medicine, which back then relied on electrocardiograms and X-rays for most diagnoses. In the 60 years since, advances in medical capabilities have progressed at a staggering pace. Patient research that once required months poring over paper charts is now reduced to hours using electronic medical record databases. Diagnostic images that once took days to process can now be accessed instantly through ultrasound and magnetic resonance imaging. While a half-century ago no one would have imagined accessing any and all information with a 5-second Google search, so too would noninvasive heart surgery been considered unimaginable. Since the 1950s when he graduated from medical school, William L. Winters, Jr., has been a first-hand witness to breathtaking innovations in cardiovascular medicine-both globally and in Houston. Author of Houston Hearts: A History of Cardiovascular Surgery and Medicine at Houston Methodist DeBakey Heart & Vascular Center and long-time medical editor of the Methodist DeBakey Cardiovascular Journal, Dr. Winters sat down with the journal editors this past April to share his insights from the last half-century of medical practice.
Management of patients with non-Hodgkin’s lymphoma: focus on adoptive T-cell therapy
Directory of Open Access Journals (Sweden)
Perna SK
2015-03-01
Full Text Available Serena Kimi Perna,1 Leslie E Huye,1,† Barbara Savoldo1,2 1Center for Cell and Gene Therapy, Baylor College of Medicine, Houston Methodist Hospital, Houston, TX, 2Department of Pediatrics, Texas Children's Hospital, Houston, TX, USA †Leslie E Huye passed away on January 1st, 2015 Abstract: Non-Hodgkin's lymphoma (NHL represents a heterogeneous group of malignancies with high diversity in terms of biology, clinical responses, and prognosis. Standard therapy regimens produce a 5-year relative survival rate of only 69%, with the critical need to increase the treatment-success rate of this patient population presenting at diagnosis with a median age of 66 years and many comorbidities. The evidence that an impaired immune system favors the development of NHL has opened the stage for new therapeutics, and specifically for the adoptive transfer of ex vivo-expanded antigen-specific T-cells. In this review, we discuss how T-cells specific for viral-associated antigens, nonviral-associated antigens expressed by the tumor, T-cells redirected through the expression of chimeric antigen receptors, and transgenic T-cell receptors against tumor cells have been developed and used in clinical trials for the treatment of patients with NHLs. Keywords: adoptive immunotherapy, cytotoxic T lymphocytes (CTLs, chimeric antigen receptor (CAR, transgenic T-cell receptors
Usenko, S.; Sheesley, R. J.; Winfield, Z.; Yoon, S.; Erickson, M.; Flynn, J. H., III; Alvarez, S. L.; Wallace, H. W., IV; Griffin, R. J.
2017-12-01
The University of Houston Mobile Air Quality Laboratory (MAQL) was deployed to the University of Michigan Biological Station (UMBS) in July 2016 as part of the PROPHET-AMOS study and then was deployed to Jones Forest located north of Houston, TX from August 12 through September 23, 2016. Both sites are heavily forested, but UMBS is remote with no anthropogenic influence while Jones Forest sees frequent pollution transport from Houston. UMBS experienced periods of high isoprene:monoterpenes and periods of equivalent isoprene:monoterpenes, while Jones Forest had a consistently high isoprene:monoterpenes. This provided for a test bed to look at the interactions within two forested environments as well as the influence of anthropogenic sources. The MAQL was outfitted to measure O3 (2B Technology), NOy and SO2 (Thermo Scientific), NO/NOx (Air Quality Design), CO (Los Gatos), and select biogenic volatile organic carbon (BVOC) with their oxidation products (Ionicon PTR-MS). The instruments sampled from MAQL's 6 m tower at both sites. The UMBS site was below canopy and the Jones Forest site was in an open field surrounded by forest. The trends in isoprene and monoterpenes were explored in relation to time-of-day, temperature, and precipitation for both locations. In addition, the production of methyl vinyl ketone and methacrolein under these different conditions of meteorology, trace gas composition and BVOC composition was explored.
Organic composition of fogwater in the Texas-Louisiana gulf coast corridor
Raja, Suresh; Raghunathan, Ravikrishna; Kommalapati, Raghava R.; Shen, Xinhua; Collett, Jeffrey L.; Valsaraj, Kalliat T.
Fogwater and air samples were collected in Baton Rouge between November 2004-February 2005 and during February 2006 at Houston. Organic compounds present in the fog samples were detected, quantified and then grouped into different compound classes based on molecular size, solubility and polarity using gas chromatography/mass spectrometry, high performance liquid chromatography with diode array detection and ion chromatography. Organic compounds were grouped as n-alkanes, aromatics and polycyclic aromatics, carbonyls, alcohols, amides and esters. Organic compounds in fog and air samples in Houston indicated clear urban/industrial anthropogenic origin, while compounds detected in Baton Rouge fog and air samples showed a mix of both agricultural and urban/industrial anthropogenic inputs. Among the various polycyclic aromatic compounds detected, the total concentration of naphthalene and its derivatives was 2.8 μg m -3 in Houston and 0.08 μg m -3 in Baton Rouge air. Analysis of concentrations of organic compounds pre- and post- fog revealed that compounds with low vapor pressure had higher scavenging efficiency in fog sampled at the two locations. Concentrations of organic compounds in fog samples were higher than those predicted by conventional air-water Henry's law equilibrium. Observed higher concentrations in the aqueous phase were modeled accounting for surface adsorption and accumulation of gas phase species and the presence of humic-like substances in fogwater.
2011-12-23
... Office located at 245 West Houston Street, New York, NY 10014. Public Comment: Contingent upon available capacity and time, individuals wishing to make oral statements or ask questions will be accommodated on a...
Observations of Radical Precursors during TexAQS II: Findings and Implications
Olaguer, E. P.; Lefer, B. L.; Rappenglueck, B.; Pinto, J. P.
2009-12-01
The Texas Environmental Research Consortium (TERC) sponsored and helped organize significant components of the Second Texas Air Quality Study (TexAQS II). Some of the TERC-sponsored experiments, most notably those associated with the TexAQS II Radical and Aerosol Measurement Project (TRAMP) sited on top of the Moody Tower at the University of Houston, found evidence for the importance of short-lived radical sources such as formaldehyde (HCHO) and nitrous acid (HONO) in increasing ozone productivity. During TRAMP, daytime HCHO pulses as large as 32 ppb were observed and attributed to industrial activities upwind in the Houston Ship Channel (HSC), and HCHO peaks as large as 52 ppb were detected by in-situ surface monitors in the HSC. In addition, an instrumented Piper Aztec aircraft observed plumes of apparent primary formaldehyde in flares from petrochemical facilities in the HSC. In one such combustion plume, depleted of ozone by large NOx emissions, the Piper Aztec measured an HCHO-to-CO ratio three times that of mobile sources. HCHO from uncounted primary sources or ozonolysis of underestimated olefin emissions could significantly increase ozone productivity in Houston beyond previous expectations. Simulations with the CAMx model show that additional emissions of HCHO from industrial flares can increase peak ozone in Houston by up to 30 ppb, depending on conditions in the planetary boundary layer. Other findings from TexAQS II include significant concentrations of HONO throughout the day, well in excess of current air quality model predictions, with large nocturnal vertical gradients indicating a surface or near-surface source of HONO, and large concentrations of night-time radicals (~30 ppt HO2). Additional HONO sources could increase daytime ozone by more than 10 ppb. Improving the representation of primary and secondary HCHO and HONO in air quality models could enhance the effectiveness of simulated control strategies, and thus make ozone attainment
Army Healthcare Enterprise Management System
National Research Council Canada - National Science Library
2001-01-01
... to buy the Enterprise Management System. The Information Technology Business Center provides information technology services to Fort Sam Houston tenants which include the Army Medical Command and the Army Medical Department Center and School...
How Memorial Hermann’s Online Payments Are Boosting Patient Loyalty and Revenue.
Ramos Hegwer, Laura
2016-01-01
The Houston-based health system has implemented new workflows and technology in 14 of its hospitals and across its care delivery network to make the payment process more patient-friendly and build consumer loyalty.
Uudiseid maailmast / Ivo Heinloo
Heinloo, Ivo
2012-01-01
Lühisõnumid: Taas jagati Grammysid. Lahkus Whitney Houston. Suri Etta James. Esperanza Spalding jätkab tähelendu. Album Esbjörn Svenssoni mälestuseks. Madonna maailmatuur hõlmab nelja kontinenti
Directory of Open Access Journals (Sweden)
Li YH
2018-03-01
Full Text Available Ya-Huei Li,1 Paula Cuccaro,2 Hua Chen,1 Susan Abughosh,1 Paras D Mehta,3 Ekere J Essien1,2 1Department of Pharmaceutical Health Outcomes and Policy, College of Pharmacy, University of Houston, Texas Medical Center, Houston, TX, USA; 2Department of Health Promotion and Behavioral Sciences, University of Texas School of Public Health, Houston, TX, USA; 3Department of Industrial Organizational Psychology, University of Houston, Houston, TX, USA Purpose: The purpose of this study was to explore the association between the dynamics of family structure and sexual behaviors of African-American adolescents using the ecodevelopmental theory. Methods: This study stratified data from 1,617 African-American adolescents of the Add Health Wave I respondents with an identified family composition. It examined the associations between family structure, parenting function, and adolescents’ sexual decision-making: age of first sexual intercourse, sexual initiation before age 16, and using a condom during the first and last sexual intercourse.Results: Emotional connection between parents and children (feeling more love from the father: β=0.17, P=0.0312; feeling more love from the mother: β=0.3314, P=0.0420 and mothers’ less permissive attitude toward adolescents’ sexual experience in their teens (β=0.33, P=0.0466 are positively associated with late age of sexual initiation of adolescents living in two-parent households. School-level factors (β=0.07, P=0.0008 and the adolescents’ characteristics (being older: 0.42, P=0.0002; heterosexuality: β=2.28, P=0.0091 are the factors most positively related to the age of sexual initiation for those living with a single parent. Immediate social determinants, other than family factors (such as land use of immediate area [rural]: β=9.84, P<0.0001; the condition of living unit: β=1.55, P=0.0011; and safety of neighborhood: β=4.46, P=0.004, are related to late age of sexual initiation among those living with other
Practicing for space underwater: inventing neutral buoyancy training, 1963-1968.
Neufeld, Michael J; Charles, John B
2015-01-01
Neutral buoyancy's value was far from obvious when human spaceflight began in 1961. Starting in 1964, Environmental Research Associates, a tiny company in the suburbs of Baltimore, developed the key innovations in an obscure research project funded by NASA's Langley Research Center. The new Houston center dismissed it until a mid-1966 EVA crisis, after which it rapidly took over. In parallel, NASA Marshall Space Flight Center developed many of the same techniques, as did many large aerospace corporations, yet the long-run technological impact of corporate activity was near zero. Because ERA and Marshall's pioneering activities led to the two long-running NASA training centers at Houston and Huntsville, those two organizations deserve primary credit for the construction of the neutral buoyancy technological system. Published by Elsevier Ltd.
International Nuclear Information System (INIS)
1987-07-01
In April 1986 the staff of the Nuclear Regulatory Commission issued its Safety Evaluation Report (NUREG-0781) regarding the application of Houston Lighting and Power Company (applicant and agent for the owners) for a license to operate South Texas Project, Units 1 and 2 (Docket Nos. 50-498 and 50-499). The facility is located in Matagorda County, Texas, west of the Colorado River, 8 miles north-northwest of the town of Matagorda and about 89 miles southwest of Houston. The first supplement to NUREG-0781 was issued in September 1986, the second supplement in January 1987, and the third supplement in May 1987. This fourth supplement reports on the status of unresolved items in the Safety Evaluation Report and resolves all the issues necessary to support the issuance of a low-power license
International Nuclear Information System (INIS)
1986-04-01
The Safety Evaluation Report for the application filed by Houston Lighting and Power Company, City Public Service Board of San Antonio, Central Power and Light Company, and the City of Austin, as applicants and owners, for licenses to operate the South Texas Project Units 1 and 2 (Docket Nos. 50-498 and 50-499) has been prepared by the Office of Nuclear Reactor Regulation of the US Nuclear Regulatory Commission. The facility is located in Matagorda County, Texas, west of the Colorado River, 8 miles north-northwest of the town of Matagorda and about 89 miles southwest of Houston. Subject to resolution of the items discussed in this report, the staff concludes that the applicant can operate the facility without endangering the health and safety of the public
Teaching case studies on emergency evacuation : final report
2011-02-15
Through the development of four Harvard Kennedy School case studies, this project explored the policy and institutional dimensions of emergency evacuation planning and implementation in two major metropolitan areas Houston and New Orleans. By pro...
78 FR 25780 - Culturally Significant Objects Imported for Exhibition Determinations: “Koloman Moser”
2013-05-02
...,'' imported from abroad for temporary exhibition within the United States, are of cultural significance. The... about May 23, 2013, until on or about September 2, 2013; the Museum of Fine Arts, Houston, TX, from on...
2012-11-19
...., Houston, 12001000 Hill County Nolan River Bridge 303-4 of the Gulf, Colorado and Santa Fe Railway, Cty. Rd. 1127 at Nolan R., Blum, 12001001 Jack County Jack County Courthouse, 100 N. Main St., Jacksboro...
Valme, Valner, 1970-
2002-01-01
Uutest plaatidest Craig David "Slicker Than Your Avarage", Whitney Houston "Just Whitney", Christina Aguilera "Stripped", Shaggy "Lucky Day", Tolga Kashif "The Queen Symphony", Mark Knopfler "Ragpicker's Dream", Soul Milita "On The Rise", Vello Orumets "Sõbrale"
Effects of Irradiation on Insect Host-Parasite Relationship
Energy Technology Data Exchange (ETDEWEB)
Rahalkar, G. W.; Ramakrishnan, V. [Biology Division, Bhabha Atomic Research Centre, Trombay, Bombay (India)
1968-06-15
Effects of host irradiation on the development of its parasite were investigated. Females of Bracon brevicomis readily accepted irradiated larvae of tile wax moth (Galleria mellonella) and rice moth (Corcyra cephalonica) for oviposition. However, irradiated wax moth larvae adversely influenced the viability of eggs laid on them and also the survival of the parasite grubs feeding on their bodies. The female grubs were affected more than the males. Rice moth larvae, on the other hand, exerted no significant influence on the viability of parasite eggs, but adversely affected the survival of the grubs. The progeny of parents that had been reared on irradiated larvae also exhibited some developmental changes although grown on non-irradiated host larvae, and these changes were more pronounced when G. mellonella was used as the host insect. (author)
Bluetooth-based travel time/speed measuring systems development.
2010-06-01
Agencies in the Houston region have traditionally used toll tag readers to provide travel times on : freeways and High Occupancy Vehicle (HOV) lanes, but these systems require large amounts of costly and : physically invasive infrastructure. Bluetoot...
2011-12-02
...; Pelican Importing & Exporting, Houston, TX: June 6, 2010. TA-W-80,297; Steiff North America, Lincoln, RI..., Athens, GA: March 17, 2010. TA-W-80,071; PCS Administration (USA), Inc., North Brook, IL: March 25, 2010...
Mukherjee, Krishnendu; Vilcinskas, Andreas
2018-01-01
Parasitic fungi are the only pathogens that can infect insect hosts directly through their proteinaceous exoskeleton. Penetration of the cuticle requires the release of fungal enzymes, including proteinases, which act as virulence factors. Insects can sense fungal infections and activate innate immune responses, including the synthesis of antifungal peptides and proteinase inhibitors that neutralize the incoming proteinases. This well-studied host response is epigenetically regulated by histone acetylation/deacetylation. Here we show that entomopathogenic fungi can in turn sense the presence of insect-derived antifungal peptides and proteinase inhibitors, and respond by inducing the synthesis of chymotrypsin-like proteinases and metalloproteinases that degrade the host-derived defense molecules. The rapidity of this response is dependent on the virulence of the fungal strain. We confirmed the specificity of the pathogen response to host-derived defense molecules by LC/MS and RT-PCR analysis, and correlated this process with the epigenetic regulation of histone acetylation/deacetylation. This cascade of responses reveals that the coevolution of pathogens and hosts can involve a complex series of attacks and counterattacks based on communication between the invading fungal pathogen and its insect host. The resolution of this process determines whether or not pathogenesis is successful.
ETV REPORT AND VERIFICATION STATEMENT - KASELCO POSI-FLO ELECTROCOAGULATION TREATMENT SYSTEM
The Kaselco Electrocoagulation Treatment System (Kaselco system) in combination with an ion exchange polishing system was tested, under actual production conditions, processing metal finishing wastewater at Gull Industries in Houston, Texas. The verification test evaluated the a...
2012-02-06
... Takeoff Minimums and ODPs are available online free of charge. Visit http://www.nfdc.faa.gov to register... Houston, TX, Ellington Field, TACAN RWY 35L, Orig Effective 8 MAR 2012 Wilmington, DE, New Castle, ILS OR...