WorldWideScience

Sample records for wd fleming wd-model

  1. A Application of WD Model to EB Type Contact Binary System

    Directory of Open Access Journals (Sweden)

    Su-Yeon Oh

    2000-12-01

    Full Text Available The EB type contact binaries show large temperature difference ( T 1,000K between two components. Thus we have modified the mode 3 of the WD program to adjust albedos, limb darkening coefficients and gravity darkening exponents for both components of such binaries, while the values for those parameters should be same for both components in the original WD program. Both of the modified and the original versions have been applied to the EB type contact binaries such as DO Cas, GO Cyg, and FS Lup. The computed light curves with modified version fit better to the observations.

  2. What if Fleming had not discovered penicillin?

    Science.gov (United States)

    Alharbi, Sulaiman Ali; Wainwright, Milton; Alahmadi, Tahani Awad; Salleeh, Hashim Bin; Faden, Asmaa A; Chinnathambi, Arunachalam

    2014-09-01

    What would have happened had Alexander Fleming not discovered penicillin in 1928? Perhaps the obvious answer is that, someone else would have discovered penicillin during 1930s and the Oxford group, would still have purified it sometime in the early 1940s. Here, however, in this counterfactual account of the penicillin story, it is argued that without Fleming, penicillin might still be undiscovered and the antibiotic age would never have dawned. As a result, many of the recent developments in medicine, such as organ transplantation, might have been delayed or, at best, made more hazardous. Penicillin might have come onto the scene a few years later but, had Fleming overlooked the discovery, it seems certain that penicillin would not have saved countless Allied lives, during and after D-Day. Instead of having enjoyed fifty and more years of the antibiotic age, it is argued here, that we would have had to rely upon highly developed sulphonamides, so-called "supasulfas", and other chemically-derived antibacterial drugs. Indeed, it might be the case that, even well into this new millennium, the antibiotic age has yet to dawn, and medicine is still waiting for someone to chance upon penicillin. Here we discuss what might have happened had Fleming not discovered penicillin and come to the conclusion that the medical armoury available today would have been far different and might have relied solely upon highly developed varieties of sulphonamides or similar, synthetic, non-antibiotic antibacterial agents.

  3. WD1145+017

    Science.gov (United States)

    Motta, Mario

    2017-06-01

    WD1145 is a 17th magnitude white dwarf star 570 light years away in Virgo, that was discovered to have a disintegrating planetoid in close orbit by Andrew Vanderburg a graduate student at Harvard CFA, while data mining the Kepler 2 mission. He contacted me to obtain transit data to elucidate the nature of its rather bizarre transit light curves. I obtained multiple observations of WD1145 over the course of a year, and found a series of complex transit light curves that could only be interpreted as a ring complex or torus in close orbit around WD1145. Combined with data from other amateur astronomers, professional observations, and satellite data it became clear that WD1145 has a small planetoid in close orbit at the Roche limit and is breaking apart forming a ring of debris material that is then raining down on the white dwarf. The surface of the star is "polluted" by heavy metals by spectroscopic data. Given that in the intense gravitational field of a white dwarf any heavy metals could not for long last on the surface, this confirms that we are tracking in real time the destruction of a small planet by its host star.

  4. WD1145+017 (Abstract)

    Science.gov (United States)

    Motta, M.

    2017-12-01

    (Abstract only) WD1145 is a 17th magnitude white dwarf star 570 light years away in Virgo that was discovered to have a disintegrating planetoid in close orbit by Andrew Vanderburg, a graduate student at Harvard CfA, while data mining the elucidate the nature of its rather bizarre transit light curves. I obtained multiple observations of WD1145 over the course of a year, and found a series of complex transit light curves that could only be interpreted as a ring complex or torus in close orbit around WD1145. Combined with data from other amateur astronomers, professional observations, and satellite data, it became clear that WD1145 has a small planetoid in close orbit at the Roche limit and is breaking apart, forming a ring of debris material that is then raining down on the white dwarf. The surface of the star is "polluted" by heavy metals, determined by spectroscopic data. Given that in the intense gravitational field of a white dwarf any heavy metals could not for long last on the surface, this confirms that we are tracking in real time the destruction of a small planet by its host star.

  5. John Ambrose Fleming and the Beginning of Electronics

    Energy Technology Data Exchange (ETDEWEB)

    Fred Dylla; Steve Corneliussen

    2004-11-01

    2004 was the centenary of John Ambrose Fleming's momentous patent on the thermionic diode that can be called the birth of electronics. The ''Edison effect'' was discovered in 1882; this was later shown to be the result of thermionic emission of electrons from a heated filament into a vacuum. Edison did not make any significant devices based on this discovery, and the effect was ignored for more than 8 years. In 1890 Fleming explained the effect and showed that the thermionic diode could be used as a rectifier. Fourteen years later Fleming filed his 1904 patent on the thermionic diode. It was the first public announcement of the electron tube; this revolutionized the development of radio and led to the invention of the thermionic triode by Lee de Forest in 1906. The background to these events will be described.

  6. Spiro K. Antiochos Receives 2013 John Adam Fleming Medal: Citation

    Science.gov (United States)

    Klimchuk, James A.

    2014-01-01

    The John Adam Fleming Medal is awarded for "original research and technical leadership in geomagnetism, atmospheric electricity, aeronomy, space physics, and related sciences." Originality and technical leadership are exactly the characteristics that distinguish the research of Spiro K. Antiochos. Spiro possesses a truly unique combination of physical insight, creativity, and mastery of the concepts and mathematical and numerical tools of space physics. These talents have allowed him to develop completely original theories for major observational problems and to test and refine those theories using sophisticated numerical simulation codes that he himself helped to develop. Spiro's physical insight is especially impressive. He has an uncanny ability to identify the fundamental aspects of complex problems and to see physical connections where others do not. This can sometimes involve ideas that may initially seem counterintuitive to those with less creativity. Many of Spiro's revolutionary advances have opened up whole new areas of study and shaped the course of space physics. Examples include the breakout model for coronal mass ejections (CMEs), the S-web model for the slow solar wind, and the thermal nonequilibrium model for solar prominences. The breakout model is of special significance to AGU as it strives to promote science for the betterment of humanity. CMEs are enormous explosions on the Sun that can have major "space weather" impacts here on Earth. They affect technologies ranging from communication and navigation systems to electrical power grids. Breakout is the leading theory for why CMEs occur and may one day be the foundation for more accurate space weather forecasting.

  7. DAMPAK KEBIJAKAN FISKAL DAN MONETER DALAM PEREKONOMIAN INDONESIA: APLIKASI MODEL MUNDELL-FLEMING

    Directory of Open Access Journals (Sweden)

    Teguh Santoso

    2013-03-01

    Full Text Available This study aims to analysis the impact of fiscal and monetary policy in Indonesian economy by using Mundell Fleming (IS-LM-BOP model. The main objective of this paper is to see the impact of fiscal and monetary policy to Indonesia Gross Domestic Product (GDP. Indonesia as a small open economy with imperfectly capital mobility, so temporary thesis of the Mundell-Fleming model is that monetary policy more effective than fiscal policy in improving of the GDP, that caused by its crowding out effect yielded from expansive\\ fiscal policy. A variant of the Mundell Fleming model for the Indonesian economy is constructed and analysed using the Two Stage Least Square Methods (2sls. The result of two stage least square estimation indicating that the impact of monetary policy with money supply(M2 instrument is more effective in improving GDP than fiscal policy with government expenditure instrument . This result is proved with influences which are positive and significant among money supply (M2 variable and GDP from demand side. However, goverment expenditure variables give positive effect but not significant to the GDP. These finding support the Hypothesis of model Mundell-Fleming

  8. Large deviations for the Fleming-Viot process with neutral mutation and selection

    OpenAIRE

    Dawson, Donald; Feng, Shui

    1998-01-01

    Large deviation principles are established for the Fleming-Viot processes with neutral mutation and selection, and the corresponding equilibrium measures as the sampling rate goes to 0. All results are first proved for the finite allele model, and then generalized, through the projective limit technique, to the infinite allele model. Explicit expressions are obtained for the rate functions.

  9. Recent dynamic changes on Fleming Glacier after the disintegration of Wordie Ice Shelf, Antarctic Peninsula

    Science.gov (United States)

    Friedl, Peter; Seehaus, Thorsten C.; Wendt, Anja; Braun, Matthias H.; Höppner, Kathrin

    2018-04-01

    The Antarctic Peninsula is one of the world's regions most affected by climate change. Several ice shelves have retreated, thinned or completely disintegrated during recent decades, leading to acceleration and increased calving of their tributary glaciers. Wordie Ice Shelf, located in Marguerite Bay at the south-western side of the Antarctic Peninsula, completely disintegrated in a series of events between the 1960s and the late 1990s. We investigate the long-term dynamics (1994-2016) of Fleming Glacier after the disintegration of Wordie Ice Shelf by analysing various multi-sensor remote sensing data sets. We present a dense time series of synthetic aperture radar (SAR) surface velocities that reveals a rapid acceleration of Fleming Glacier in 2008 and a phase of further gradual acceleration and upstream propagation of high velocities in 2010-2011.The timing in acceleration correlates with strong upwelling events of warm circumpolar deep water (CDW) into Wordie Bay, most likely leading to increased submarine melt. This, together with continuous dynamic thinning and a deep subglacial trough with a retrograde bed slope close to the terminus probably, has induced unpinning of the glacier tongue in 2008 and gradual grounding line retreat between 2010 and 2011. Our data suggest that the glacier's grounding line had retreated by ˜ 6-9 km between 1996 and 2011, which caused ˜ 56 km2 of the glacier tongue to go afloat. The resulting reduction in buttressing explains a median speedup of ˜ 1.3 m d-1 ( ˜ 27 %) between 2008 and 2011, which we observed along a centre line extending between the grounding line in 1996 and ˜ 16 km upstream. Current median ice thinning rates (2011-2014) along profiles in areas below 1000 m altitude range between ˜ 2.6 to 3.2 m a-1 and are ˜ 70 % higher than between 2004 and 2008. Our study shows that Fleming Glacier is far away from approaching a new equilibrium and that the glacier dynamics are not primarily controlled by the loss of the

  10. Is WD 1437-008 a cataclysmic variable?

    Science.gov (United States)

    Shimansky, V. V.; Nurtdinova, D. N.; Borisov, N. V.; Spiridonova, O. I.

    2011-10-01

    Comprehensive observations of a close binary candidate WD 1437-008 are performed. The shape and amplitude of the observed brightness variations are shown to be inconsistent with the hypothesis of reflection effects, and the photometric period of the system, P phot = 0. d 2775, is found to differ from the period of spectral variations, P sp = 0. d 272060. As a result, WD 1437-008 has been preliminarily classified as a low-inclination cataclysmic variable.

  11. Fleming's penicillin producing streain is not Penicillium chrysogenum but P. rubens

    DEFF Research Database (Denmark)

    Houbraken, Jos; Frisvad, Jens Christian; Samson, Robert A.

    2011-01-01

    Penicillium chrysogenum is a commonly occurring mould in indoor environments and foods, and has gained much attention for its use in the production of the antibiotic penicillin. Phylogenetic analysis of the most important penicillin producing P. chrysogenum isolates revealed the presence of two...... not produce these metabolites. Fleming’s original penicillin producing strain and the full genome sequenced strain of P. chrysogenum are re-identified as P. rubens. Furthermore, the well-known claim that Alexander Fleming misidentified the original penicillin producing strain as P. rubrum is discussed....

  12. Call-Fleming Syndrome (Reversible Cerebral Artery Vasoconstriction and Aneurysm Associated with Multiple Recreational Drug Use

    Directory of Open Access Journals (Sweden)

    Doniel Drazin

    2013-01-01

    Full Text Available Drug abuse represents a significant health issue. Evidence suggests that recreational drug use has a direct effect on the cerebral vasculature and is of greater concern in those with undiagnosed aneurysms or vascular malformations. The authors report a case of thunderclap headache with a negative head CT and equivocal lumbar puncture after a drug-fueled weekend. The patient underwent diagnostic cerebral angiogram which demonstrated multisegmental, distal areas of focal narrowing of the middle, anterior, posterior, and posterior inferior cerebral artery and an incidental aneurysm. It is often difficult to determine the exact origin of symptoms; thus we were left with a bit of a chicken or the egg debate, trying to decipher which part came first. Either the aneurysm ruptured with associated concomitant vasospasm or it is a case of Call-Fleming syndrome (reversible cerebral artery vasoconstriction with an incidental aneurysm. The authors proposed their management and rationale of this complex case.

  13. Monitoring and modelling of white dwarfs with extremely weak magnetic fields. WD 2047+372 and WD 2359-434

    Science.gov (United States)

    Landstreet, J. D.; Bagnulo, S.; Valyavin, G.; Valeev, A. F.

    2017-11-01

    Magnetic fields are detected in a few percent of white dwarfs. The number of such magnetic white dwarfs known is now some hundreds. Fields range in strength from a few kG to several hundred MG. Almost all the known magnetic white dwarfs have a mean field modulus ≥1 MG. We are trying to fill a major gap in observational knowledge at the low field limit (≤200 kG) using circular spectro-polarimetry. In this paper we report the discovery and monitoring of strong, periodic magnetic variability in two previously discovered "super-weak field" magnetic white dwarfs, WD 2047+372 and WD 2359-434. WD 2047+372 has a mean longitudinal field that reverses between about -12 and + 15 kG, with a period of 0.243 d, while its mean field modulus appears nearly constant at 60 kG. The observations can be interpreted in terms of a dipolar field tilted with respect to the stellar rotation axis. WD 2359-434 always shows a weak positive longitudinal field with values between about 0 and + 12 kG, varying only weakly with stellar rotation, while the mean field modulus varies between about 50 and 100 kG. The rotation period is found to be 0.112 d using the variable shape of the Hα line core, consistent with available photometry. The field of this star appears to be much more complex than a dipole, and is probably not axisymmetric. Available photometry shows that WD 2359-434 is a light variable with an amplitude of only 0.005 mag; our own photometry shows that if WD 2047+372 is photometrically variable, the amplitude is below about 0.01 mag. These are the first models for magnetic white dwarfs with fields below about 100 kG based on magnetic measurements through the full stellar rotation. They reveal two very different magnetic surface configurations, and that, contrary to simple ohmic decay theory, WD 2359-434 has a much more complex surface field than the much younger WD 2047+372. Based, in part, on observations collected at the European Organisation for Astronomical Research in the

  14. Capital Liberalization and Imperfect Substitutability between Bonds and Stocks: Reexamination of the Mundell-Fleming Model

    Directory of Open Access Journals (Sweden)

    Tae-Joon Kim

    2002-06-01

    Full Text Available This paper analyzes the effects of macroeconomic policies and foreign shocks on the stability of a small open economy, in which equity investment is more crucial than debt investment. The key assumption of our model is that stocks and bonds are imperfect substitutes. Accordingly, financial market equilibrium in our model is achieved only when both money and stock markets are simultaneously in equilibrium. In contrast to the Mundell-Fleming model, fiscal policy is relatively effective under the flexible exchange rate regime, while monetary policy is relatively effective under the fixed exchange rate regime. In the case of foreign shocks such as hike of world interest rates, the flexible exchange rate regime appears more effective in stabilizing the economy because the flexible exchange rate functions as a shock absorber. The empirical evidence from the Korean economy during 1998:4- 2000:11 supports these findings. After the 1997 currency crisis, the Korean monetary authorities adopted the independently floating exchange regime and fully liberalized the capital account. Using a vector autoregressive model consisting of money stock, interest rate, balance of payments and exchange rate, we analyze the effect of an expansionary monetary policy. An increase in money supply decreases the domestic interest rates but the balance of payments turns into surplus. This result confirms that the higher rates of return on equity results in net capital inflows, in spite of lower domestic interest rates, and thus appreciates the domestic currency.

  15. Genome sequence of the Fleming strain of Micrococcus luteus, a simple free- living actinobacterium

    Energy Technology Data Exchange (ETDEWEB)

    Young, Michael; Artsatbanov, Vladislav; Beller, Harry R.; Chandra, Govind; Chater, Keith F.; Dover, Lynn G.; Goh, Ee-Been; Kahan, Tamar; Kaprelyants, Arseny S.; Kyrpides, Nikos; Lapidus, Alla; Lowry, Stephen R.; Lykidis, Athanasios; Mahillon, Jacques; Markowitz, Viktor; Mavrommatis, Konstantinos; Mukamolova, Galina V.; Oren, Aharon; Rokem, J. Stefan; Smith, Margaret C. M.; Young, Danielle I.; Greenblatt, Charles L.

    2009-11-01

    Micrococcus luteus (NCTC2665, Fleming strain) has one of the smallest genomes of free living actinobacteria sequenced to date, comprising a single circular chromosome of 2,501,097 bp (G+C content 73%) predicted to encode 2403 proteins. The genome shows extensive synteny with that of the closely related organism, Kocuria rhizophila, from which it was taxonomically separated relatively recently. Despite its small size, the genome harbors 73 IS elements, almost all of which are closely related to elements found in other actinobacteria. An IS element is inserted into the rrs gene of one of only two rrn operons found in M. luteus. The genome encodes only four sigma factors and fourteen response regulators, indicative of adaptation to a rather strict ecological niche (mammalian skin). The high sensitivity of M. luteus to {Beta}-lactam antibiotics may result from the presence of a reduced set of penicillin binding proteins and the absence of a wblC gene, which plays an important role in antibiotic resistance in other actinobacteria. Consistent with the restricted range of compounds it can use as a sole source of carbon for energy and growth, M. luteus has a minimal complement of genes concerned with carbohydrate transport and metabolism and its inability to utilize glucose as a sole carbon source may be due to the apparent absence of a gene encoding glucokinase. Uniquely among characterized bacteria, M. luteus appears to be able to metabolize glycogen only via trehalose, and to make trehalose only via glycogen. It has very few genes associated with secondary metabolism. In contrast to other actinobacteria, M. luteus encodes only one resuscitation-promoting factor (Rpf) required for emergence from dormancy and its complement of other dormancy-related proteins is also much reduced. M. luteus is capable of long-chain alkene biosynthesis, which is of interest for advanced biofuel production; a three gene cluster essential for this metabolism has been identified in the genome.

  16. Preliminary hydrogeologic investigation of the Maxey Flats radioactive waste burial site, Fleming County, Kentucky

    Science.gov (United States)

    Zehner, Harold H.

    1979-01-01

    Burial trenches at the Maxey Flats radioactive waste burial site , Fleming County, Ky., cover an area of about 0.03 square mile, and are located on a plateau, about 300 to 400 feet above surrounding valleys. Although surface-water characteristics are known, little information is available regarding the ground-water hydrology of the Maxey Flats area. If transport of radionuclides from the burial site were to occur, water would probably be the principal mechanism of transport by natural means. Most base flow in streams around the burial site is from valley alluvium, and from the mantle of regolith, colluvium, and soil partially covering adjacent hills. Very little base flow is due to ground-water flow from bedrock. Most water in springs is from the mantle, rather than from bedrock. Rock units underlying the Maxey Flats area are, in descending order, the Nancy and Farmers Members of the Borden Formation, Sunbury, Bedford, and Ohio Shales, and upper part of the Crab Orchard Formation. These units are mostly shales, except for the Farmers Member, which is mostly sandstone. Total thickness of the rocks is about 320 feet. All radioactive wastes are buried in the Nancy Member. Most ground-water movement in bedrock probably occurs in fractures. The ground-water system at Maxey Flats is probably unconfined, and recharge occurs by (a) infiltration of rainfall into the mantle, and (b) vertical, unsaturated flow from the saturated regolith on hilltops to saturated zones in the Farmers Member and Ohio Shale. Data are insufficient to determine if saturated zones exist in other rock units. The upper part of the Crab Orchard Formation is probably a hydrologic boundary, with little ground-water flow through the formation. (USGS)

  17. Fault detection of feed water treatment process using PCA-WD with parameter optimization.

    Science.gov (United States)

    Zhang, Shirong; Tang, Qian; Lin, Yu; Tang, Yuling

    2017-05-01

    Feed water treatment process (FWTP) is an essential part of utility boilers; and fault detection is expected for its reliability improvement. Classical principal component analysis (PCA) has been applied to FWTPs in our previous work; however, the noises of T 2 and SPE statistics result in false detections and missed detections. In this paper, Wavelet denoise (WD) is combined with PCA to form a new algorithm, (PCA-WD), where WD is intentionally employed to deal with the noises. The parameter selection of PCA-WD is further formulated as an optimization problem; and PSO is employed for optimization solution. A FWTP, sustaining two 1000MW generation units in a coal-fired power plant, is taken as a study case. Its operation data is collected for following verification study. The results show that the optimized WD is effective to restrain the noises of T 2 and SPE statistics, so as to improve the performance of PCA-WD algorithm. And, the parameter optimization enables PCA-WD to get its optimal parameters in an automatic way rather than on individual experience. The optimized PCA-WD is further compared with classical PCA and sliding window PCA (SWPCA), in terms of four cases as bias fault, drift fault, broken line fault and normal condition, respectively. The advantages of the optimized PCA-WD, against classical PCA and SWPCA, is finally convinced with the results. Copyright © 2017 ISA. Published by Elsevier Ltd. All rights reserved.

  18. Rapid ice unloading in the Fleming Glacier region, southern Antarctic Peninsula, and its effect on bedrock uplift rates

    DEFF Research Database (Denmark)

    Zhao, Chen; King, Matt A.; Watson, Christopher S.

    2017-01-01

    deformation. We subtract modeled elastic deformation rates, and a suite of modeled viscous rates, from GPS-derived three-dimensional bedrock velocities at sites to the south of Fleming Glacier to infer properties of Earth rheology. Assuming the pre-breakup bedrock uplift was positive due to post-Last Glacial...... Maximum (LGM) ice retreat, our viscoelastic-corrected GPS uplift rates suggest upper mantle viscosities are >2×1019 Pas and likely >1×1020 Pas in this region, 1–2 orders of magnitude greater than previously found for the northern Antarctic Peninsula. Horizontal velocities at the GPS site nearest...

  19. Evolving ONe WD+He star systems to intermediate-mass binary pulsars

    Science.gov (United States)

    Liu, D.; Wang, B.; Chen, W.; Zuo, Z.; Han, Z.

    2018-06-01

    It has been suggested that accretion-induced collapse (AIC) is a non-negligible path for the formation of the observed neutron stars (NSs). An ONe white dwarf (WD) that accretes material from a He star may experience AIC process and eventually produce intermediate-mass binary pulsars (IMBPs), named as the ONe WD+He star scenario. Note that previous studies can only account for part of the observed IMBPs with short orbital periods. In this work, we investigate the evolution of about 900 ONe WD+He star binaries to explore the distribution of IMBPs. We found that the ONe WD+He star scenario could form IMBPs including pulsars with 5-340 ms spin periods and 0.75-1.38 M_{⊙} WD companions, in which the orbital periods range from 0.04 to 900 d. Compared with the 20 observed IMBPs, this scenario can cover the parameters of 13 sources in the final orbital period-WD mass plane and the Corbet diagram, most of which have short orbital periods. We found that the ONe WD+He star scenario can explain almost all the observed IMBPs with short orbital periods. This work can well match the observed parameters of PSR J1802-2124 (one of the two precisely observed IMBPs), providing a possible evolutional path for its formation. We also speculate that the compact companion of HD 49798 (a hydrogen depleted sdO6 star) may be not a NS based on this work.

  20. Effects of 4WD and ABS of safe driving on slippery roads; Tei {mu} ji ni okeru 4WD to ABS no koka to unten sosa hoho

    Energy Technology Data Exchange (ETDEWEB)

    Kojima, Y [National Research Inst. of Police Science, Tokyo (Japan); Takigami, K; Asano, K [Japan Safe Driving Center, Tokyo (Japan); Nagai, M [Tokyo University of Agriculture and Technology, Tokyo (Japan)

    1997-10-01

    Effects of 4WD and ABS on safe driving were examined by brake, obstacle avoidance, acceleration, cornering and lane-changing tests on slippery road. The braking operations, used in these tests, are full, intermitted and modulated brakings. As the results of discussion, the major findings are (1) ABS is effective to shorten the stopping distance and to increase the ability of obstacle avoidance in many cases, (2) `Modulated Braking (without wheel locks)` has the same function as ABS, and (3) 4WD is effective to increase the stability while accelerating, cornering and lane-changing. 5 refs., 6 figs.

  1. The LuWD40-1 gene encoding WD repeat protein regulates growth and pollen viability in flax (Linum Usitatissimum L..

    Directory of Open Access Journals (Sweden)

    Santosh Kumar

    Full Text Available As a crop, flax holds significant commercial value for its omega-3 rich oilseeds and stem fibres. Canada is the largest producer of linseed but there exists scope for significant yield improvements. Implementation of mechanisms such as male sterility can permit the development of hybrids to assist in achieving this goal. Temperature sensitive male sterility has been reported in flax but the leakiness of this system in field conditions limits the production of quality hybrid seeds. Here, we characterized a 2,588 bp transcript differentially expressed in male sterile lines of flax. The twelve intron gene predicted to encode a 368 amino acid protein has five WD40 repeats which, in silico, form a propeller structure with putative nucleic acid and histone binding capabilities. The LuWD40-1 protein localized to the nucleus and its expression increased during the transition and continued through the vegetative stages (seed, etiolated seedling, stem while the transcript levels declined during reproductive development (ovary, anthers and embryonic morphogenesis of male fertile plants. Knockout lines for LuWD40-1 in flax failed to develop shoots while overexpression lines showed delayed growth phenotype and were male sterile. The non-viable flowers failed to open and the pollen grains from these flowers were empty. Three independent transgenic lines overexpressing the LuWD40-1 gene had ∼80% non-viable pollen, reduced branching, delayed flowering and maturity compared to male fertile genotypes. The present study provides new insights into a male sterility mechanism present in flax.

  2. The LuWD40-1 gene encoding WD repeat protein regulates growth and pollen viability in flax (Linum Usitatissimum L.).

    Science.gov (United States)

    Kumar, Santosh; Jordan, Mark C; Datla, Raju; Cloutier, Sylvie

    2013-01-01

    As a crop, flax holds significant commercial value for its omega-3 rich oilseeds and stem fibres. Canada is the largest producer of linseed but there exists scope for significant yield improvements. Implementation of mechanisms such as male sterility can permit the development of hybrids to assist in achieving this goal. Temperature sensitive male sterility has been reported in flax but the leakiness of this system in field conditions limits the production of quality hybrid seeds. Here, we characterized a 2,588 bp transcript differentially expressed in male sterile lines of flax. The twelve intron gene predicted to encode a 368 amino acid protein has five WD40 repeats which, in silico, form a propeller structure with putative nucleic acid and histone binding capabilities. The LuWD40-1 protein localized to the nucleus and its expression increased during the transition and continued through the vegetative stages (seed, etiolated seedling, stem) while the transcript levels declined during reproductive development (ovary, anthers) and embryonic morphogenesis of male fertile plants. Knockout lines for LuWD40-1 in flax failed to develop shoots while overexpression lines showed delayed growth phenotype and were male sterile. The non-viable flowers failed to open and the pollen grains from these flowers were empty. Three independent transgenic lines overexpressing the LuWD40-1 gene had ∼80% non-viable pollen, reduced branching, delayed flowering and maturity compared to male fertile genotypes. The present study provides new insights into a male sterility mechanism present in flax.

  3. WD+RG systems as the progenitors of type Ia supernovae

    International Nuclear Information System (INIS)

    Wang Bo; Han Zhanwen

    2010-01-01

    Type Ia supernovae (SNe Ia) play an important role in the study of cosmic evolution, especially in cosmology. There are several progenitor models for SNe Ia proposed in the past years. By considering the effect of accretion disk instability on the evolution of white dwarf (WD) binaries, we performed detailed binary evolution calculations for the WD + red-giant (RG) channel of SNe Ia, in which a carbon-oxygen WD accretes material from a RG star to increase its mass to the Chandrasekhar mass limit. According to these calculations, we mapped out the initial and final parameters for SNe Ia in the orbital period-secondary mass (log P i - M i 2 ) plane for various WD masses for this channel. We discussed the influence of the variation of the duty cycle value on the regions for producing SNe Ia. Similar to previous studies, this work also indicates that the long-period dwarf novae offer possible ways for producing SNe Ia. Meanwhile, we find that the surviving companion stars from this channel have a low mass after the SN explosion, which may provide a means for the formation of the population of single low-mass WDs ( o-dot ).

  4. THE FIRST DISTANCE CONSTRAINT ON THE RENEGADE HIGH-VELOCITY CLOUD COMPLEX WD

    Energy Technology Data Exchange (ETDEWEB)

    Peek, J. E. G.; Roman-Duval, Julia; Tumlinson, Jason [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Bordoloi, Rongmon [MIT-Kavli Center for Astrophysics and Space Research, 77 Massachusetts Avenue, Cambridge, MA 02139 (United States); Sana, Hugues [Institute of Astronomy, KU Leuven, Celestijnenlaan 200 D, B-3001 Leuven (Belgium); Zheng, Yong [Department of Astronomy, Columbia University, New York, NY 10027 (United States)

    2016-09-10

    We present medium-resolution, near-ultraviolet Very Large Telescope/FLAMES observations of the star USNO-A0600-15865535. We adapt a standard method of stellar typing to our measurement of the shape of the Balmer ϵ absorption line to demonstrate that USNO-A0600-15865535 is a blue horizontal branch star, residing in the lower stellar halo at a distance of 4.4 kpc from the Sun. We measure the H and K lines of singly ionized calcium and find two isolated velocity components, one originating in the disk, and one associated with the high-velocity cloud complex WD. This detection demonstrated that complex WD is closer than ∼4.4 kpc and is the first distance constraint on the +100 km s{sup −1} Galactic complex of clouds. We find that complex WD is not in corotation with the Galactic disk, which has been assumed for decades. We examine a number of scenarios and find that the most likely scenario is that complex WD was ejected from the solar neighborhood and is only a few kiloparsecs from the Sun.

  5. Magnetism, X-rays and accretion rates in WD 1145+017 and other polluted white dwarf systems

    Science.gov (United States)

    Farihi, J.; Fossati, L.; Wheatley, P. J.; Metzger, B. D.; Mauerhan, J.; Bachman, S.; Gänsicke, B. T.; Redfield, S.; Cauley, P. W.; Kochukhov, O.; Achilleos, N.; Stone, N.

    2018-02-01

    This paper reports circular spectropolarimetry and X-ray observations of several polluted white dwarfs including WD 1145+017, with the aim to constrain the behaviour of disc material and instantaneous accretion rates in these evolved planetary systems. Two stars with previously observed Zeeman splitting, WD 0322-019 and WD 2105-820, are detected above 5σ and 〈Bz〉 > 1 kG, while WD 1145+017, WD 1929+011, and WD 2326+049 yield (null) detections below this minimum level of confidence. For these latter three stars, high-resolution spectra and atmospheric modelling are used to obtain limits on magnetic field strengths via the absence of Zeeman splitting, finding B* Earth composition material falling on to the magnetic polar regions of white dwarfs, where X-rays and cyclotron radiation may contribute to accretion luminosity. This analysis is applied to X-ray data for WD 1145+017, WD 1729+371, and WD 2326+049, and the upper bound count rates are modelled with spectra for a range of plasma kT = 1-10 keV in both the magnetic and non-magnetic accretion regimes. The results for all three stars are consistent with a typical dusty white dwarf in a steady state at 108-109 g s-1. In particular, the non-magnetic limits for WD 1145+017 are found to be well below previous estimates of up to 1012 g s-1, and likely below 1010 g s-1, thus suggesting the star-disc system may be average in its evolutionary state, and only special in viewing geometry.

  6. The WD+He star binaries as the progenitors of type Ia supernovae

    Directory of Open Access Journals (Sweden)

    Wang Bo

    2017-12-01

    Full Text Available Employing the MESA stellar evolution code, we computed He accretion onto carbon-oxygen white dwarfs (CO WDs.We found two possible outcomes for models in which the WD steadily grows in mass towards the Chandrasekhar limit. For relatively low He-accretion rates carbon ignition occurs in the center, leading to a type Ia supernova (SN Ia explosion, whereas for relatively high accretion rates carbon is ignited off-center, probably leading to collapse. Thus the parameter space producing SNe Ia is reduced compared to what was assumed in earlier papers, in which the possibility of off-center ignition was ignored. We then applied these results in binary population synthesis modelling, finding a modest reduction in the expected birthrate of SNe Ia resulting from the WD+He star channel.

  7. Rancang Bangun Sistem Smart Charging menggunakan Panel Surya pada Robot 6WD berbasis Mikrokontroler Arduino

    Directory of Open Access Journals (Sweden)

    made yogi hendrayanto

    2018-03-01

    Full Text Available Ilmu pengetahuan dan teknologi dalam bidang robotika pada saat ini berkembang dengan sangat cepat. Teknologi robotika pada dasarnya dikembangkan dengan tujuan untuk membantu manusia dalam melakukan pekerjaan tertentu, seperti pekerjaan yang berisiko tinggi, pekerjaan yang tidak bisa dikerjakan oleh tangan manusia secara langsung dan pekerjaan yang membutuhkan ketelitian tinggi. Pada saat ini, robot masih dikendalikan secara manual oleh manusia menggunakan Baterai sebagai sumber energi robot dan melakukan pengisian secara manual. Berdasarkan hal tersebut maka ada suatu keinginan untuk berkontribusi dalam pengembangan teknologi robot 6WD yaitu dengan merancang sebuah sistem Smart charging menggunakan Panel surya sebagai sumber energi untuk melakukan pengisian baterai robot secara langsung. Sistem yang dibuat, nantinya dapat membuat robot 6WD, bergerak dengan cara manual menggunakan inputan dari komputer yang dikontrol manual dari manusia. Manusia hanya perlu menggerakkan dan dapat melihat kondisi dari 2 buah baterai robot 6WD dari Komputer, kemudian komunikasi yang terjadi antara komputer dengan robot dapat dilakukan secara dua arah, agar robot dapat memberikan informasi balik kepada komputer, baik itu daya baterai, loss area dan lain sebagainya.Arduino Mega 2560 digunakan sebagai sistem utama yang mengolah semua data input dan output pada sistem. Modul HM-TRP befungsi untuk mengirimkan data dari robot ke komputer untuk ditampilkan.Pengiriman informasi robot 6WD meliputi informasi kondisi status 2 buah baterai, arus baterai, tegangan baterai, dan arah dari gerakan robot yang akan dikendalikan melalui GCS(Ground Control Station.   [TURNITIN CHECK 8%, 18042017

  8. WD60/FAP163 is a dynein intermediate chain required for retrograde intraflagellar transport in cilia

    Science.gov (United States)

    Patel-King, Ramila S.; Gilberti, Renée M.; Hom, Erik F. Y.; King, Stephen M.

    2013-01-01

    Retrograde intraflagellar transport (IFT) is required for assembly of cilia. We identify a Chlamydomonas flagellar protein (flagellar-associated protein 163 [FAP163]) as being closely related to the D1bIC(FAP133) intermediate chain (IC) of the dynein that powers this movement. Biochemical analysis revealed that FAP163 is present in the flagellar matrix and is actively trafficked by IFT. Furthermore, FAP163 copurified with D1bIC(FAP133) and the LC8 dynein light chain, indicating that it is an integral component of the retrograde IFT dynein. To assess the functional role of FAP163, we generated an RNA interference knockdown of the orthologous protein (WD60) in planaria. The Smed-wd60(RNAi) animals had a severe ciliary assembly defect that dramatically compromised whole-organism motility. Most cilia were present as short stubs that had accumulated large quantities of IFT particle–like material between the doublet microtubules and the membrane. The few remaining approximately full-length cilia had a chaotic beat with a frequency reduced from 24 to ∼10 Hz. Thus WD60/FAP163 is a dynein IC that is absolutely required for retrograde IFT and ciliary assembly. PMID:23864713

  9. Improving Assessment of Work Related Mental Health Function Using the Work Disability Functional Assessment Battery (WD-FAB).

    Science.gov (United States)

    Marfeo, Elizabeth E; Ni, Pengsheng; McDonough, Christine; Peterik, Kara; Marino, Molly; Meterko, Mark; Rasch, Elizabeth K; Chan, Leighton; Brandt, Diane; Jette, Alan M

    2018-03-01

    Purpose To improve the mental health component of the Work Disability Functional Assessment Battery (WD-FAB), developed for the US Social Security Administration's (SSA) disability determination process. Specifically our goal was to expand the WD-FAB scales of mood & emotions, resilience, social interactions, and behavioral control to improve the depth and breadth of the current scales and expand the content coverage to include aspects of cognition & communication function. Methods Data were collected from a random, stratified sample of 1695 claimants applying for the SSA work disability benefits, and a general population sample of 2025 working age adults. 169 new items were developed to replenish the WD-FAB scales and analyzed using factor analysis and item response theory (IRT) analysis to construct unidimensional scales. We conducted computer adaptive test (CAT) simulations to examine the psychometric properties of the WD-FAB. Results Analyses supported the inclusion of four mental health subdomains: Cognition & Communication (68 items), Self-Regulation (34 items), Resilience & Sociability (29 items) and Mood & Emotions (34 items). All scales yielded acceptable psychometric properties. Conclusions IRT methods were effective in expanding the WD-FAB to assess mental health function. The WD-FAB has the potential to enhance work disability assessment both within the context of the SSA disability programs as well as other clinical and vocational rehabilitation settings.

  10. Superfund Record of Decision (EPA Region 4): Maxey Flats Nuclear Disposal site, Fleming County, KY. (First remedial action), September 1991. Final report

    International Nuclear Information System (INIS)

    1991-01-01

    The 280-acre Maxey Flats Nuclear Disposal site is an inactive low-level radioactive waste disposal facility in Fleming County, Kentucky. The estimated 663 people who reside within 2.5 miles of the site use the public water supply for drinking purposes. From 1962 to 1977, Nuclear Engineering Company, Inc. (NECO), operated a solid by-product, source, and special nuclear material disposal facility under a license with the State. Several State investigations in the 1970's revealed that leachate contaminated with tritium and other radioactive substances was migrating from the disposal trenches to unrestricted areas. The Record of Decision (ROD) addresses final remediation of soil, debris, and associated leachate. The primary contaminants of concern affecting the soil and debris are VOCs including benzene, TCE, and toluene; metals including arsenic and lead; and radioactive materials. The selected remedial action for the site is included

  11. A comparison of a new multinomial stopping rule with stopping rules of fleming and gehan in single arm phase II cancer clinical trials

    Directory of Open Access Journals (Sweden)

    Tu Dongsheng

    2011-06-01

    Full Text Available Abstract Background Response rate (RR alone may be insensitive to drug activity in phase II trials. Early progressive disease (EPD could improve sensitivity as well as increase stage I stopping rates. This study compares the previously developed dual endpoint stopping rule (DESR, which incorporates both RR and EPD into a two-stage, phase II trial, with rules using only RR. Methods Stopping rules according to the DESR were compared with studies conducted under the Fleming (16 trials or Gehan (23 trials designs. The RR hypothesis for the DESR was consistent with the comparison studies (ralt = 0.2, rnul = 0.05. Two parameter sets were used for EPD rates of interest and disinterest respectively (epdalt, epdnul: (0.4, 0.6 and (0.3, 0.5. Results Compared with Fleming, the DESR was more likely to allow stage two of accrual and to reject the null hypothesis (Hnul after stage two, with rejection being more common with EPD parameters (0.4, 0.6 than (0.3, 0.5. Compared with Gehan, both DESR parameter sets accepted Hnul in 15 trials after stage I compared with 8 trials by Gehan, with consistent conclusions in all 23 trials after stage II. Conclusions The DESR may reject Hnul when EPD rates alone are low, and thereby may improve phase II trial sensitivity to active, cytostatic drugs having limited response rates. Conversely, the DESR may invoke early stopping when response rates are low and EPD rates are high, thus shortening trials when drug activity is unlikely. EPD parameters should be chosen specific to each trial.

  12. Genome-wide investigation and expression analyses of WD40 protein family in the model plant foxtail millet (Setaria italica L..

    Directory of Open Access Journals (Sweden)

    Awdhesh Kumar Mishra

    Full Text Available WD40 proteins play a crucial role in diverse protein-protein interactions by acting as scaffolding molecules and thus assisting in the proper activity of proteins. Hence, systematic characterization and expression profiling of these WD40 genes in foxtail millet would enable us to understand the networks of WD40 proteins and their biological processes and gene functions. In the present study, a genome-wide survey was conducted and 225 potential WD40 genes were identified. Phylogenetic analysis categorized the WD40 proteins into 5 distinct sub-families (I-V. Gene Ontology annotation revealed the biological roles of the WD40 proteins along with its cellular components and molecular functions. In silico comparative mapping with sorghum, maize and rice demonstrated the orthologous relationships and chromosomal rearrangements including duplication, inversion and deletion of WD40 genes. Estimation of synonymous and non-synonymous substitution rates revealed its evolutionary significance in terms of gene-duplication and divergence. Expression profiling against abiotic stresses provided novel insights into specific and/or overlapping expression patterns of SiWD40 genes. Homology modeling enabled three-dimensional structure prediction was performed to understand the molecular functions of WD40 proteins. Although, recent findings had shown the importance of WD40 domains in acting as hubs for cellular networks during many biological processes, it has invited a lesser research attention unlike other common domains. Being a most promiscuous interactors, WD40 domains are versatile in mediating critical cellular functions and hence this genome-wide study especially in the model crop foxtail millet would serve as a blue-print for functional characterization of WD40s in millets and bioenergy grass species. In addition, the present analyses would also assist the research community in choosing the candidate WD40s for comprehensive studies towards crop improvement

  13. Genome-wide investigation and expression analyses of WD40 protein family in the model plant foxtail millet (Setaria italica L.).

    Science.gov (United States)

    Mishra, Awdhesh Kumar; Muthamilarasan, Mehanathan; Khan, Yusuf; Parida, Swarup Kumar; Prasad, Manoj

    2014-01-01

    WD40 proteins play a crucial role in diverse protein-protein interactions by acting as scaffolding molecules and thus assisting in the proper activity of proteins. Hence, systematic characterization and expression profiling of these WD40 genes in foxtail millet would enable us to understand the networks of WD40 proteins and their biological processes and gene functions. In the present study, a genome-wide survey was conducted and 225 potential WD40 genes were identified. Phylogenetic analysis categorized the WD40 proteins into 5 distinct sub-families (I-V). Gene Ontology annotation revealed the biological roles of the WD40 proteins along with its cellular components and molecular functions. In silico comparative mapping with sorghum, maize and rice demonstrated the orthologous relationships and chromosomal rearrangements including duplication, inversion and deletion of WD40 genes. Estimation of synonymous and non-synonymous substitution rates revealed its evolutionary significance in terms of gene-duplication and divergence. Expression profiling against abiotic stresses provided novel insights into specific and/or overlapping expression patterns of SiWD40 genes. Homology modeling enabled three-dimensional structure prediction was performed to understand the molecular functions of WD40 proteins. Although, recent findings had shown the importance of WD40 domains in acting as hubs for cellular networks during many biological processes, it has invited a lesser research attention unlike other common domains. Being a most promiscuous interactors, WD40 domains are versatile in mediating critical cellular functions and hence this genome-wide study especially in the model crop foxtail millet would serve as a blue-print for functional characterization of WD40s in millets and bioenergy grass species. In addition, the present analyses would also assist the research community in choosing the candidate WD40s for comprehensive studies towards crop improvement of millets and

  14. WdStuAp, an APSES transcription factor, is a regulator of yeast-hyphal transitions in Wangiella (Exophiala) dermatitidis.

    Science.gov (United States)

    Wang, Qin; Szaniszlo, Paul J

    2007-09-01

    APSES transcription factors are well-known regulators of fungal cellular development and differentiation. To study the function of an APSES protein in the fungus Wangiella dermatitidis, a conidiogenous and polymorphic agent of human phaeohyphomycosis with yeast predominance, the APSES transcription factor gene WdSTUA was cloned, sequenced, disrupted, and overexpressed. Analysis showed that its derived protein was most similar to the APSES proteins of other conidiogenous molds and had its APSES DNA-binding domain located in the amino-terminal half. Deletion of WdSTUA in W. dermatitidis induced convoluted instead of normal smooth colony surface growth on the rich yeast maintenance agar medium yeast extract-peptone-dextrose agar (YPDA) at 37 degrees C. Additionally, deletion of WdSTUA repressed aerial hyphal growth, conidiation, and invasive hyphal growth on the nitrogen-poor, hypha-inducing agar medium potato dextrose agar (PDA) at 25 degrees C. Ectopic overexpression of WdSTUA repressed the convoluted colony surface growth on YPDA at 37 degrees C, and also strongly repressed hyphal growth on PDA at 25 degrees C and 37 degrees C. These new results provide additional insights into the diverse roles played by APSES factors in fungi. They also suggest that the transcription factor encoded by WdSTUA is both a positive and negative morphotype regulator in W. dermatitidis and possibly other of the numerous human pathogenic, conidiogenous fungi capable of yeast growth.

  15. Participação das enfermeiras no processo de implantação de práticas obstétricas humanizadas na maternidade Alexander Fleming (1998-2004 Participación de las enfermeras en el proceso de implementación de prácticas de obstetricia humanizada en la maternidade Alexander Fleming (1998-2004 Participation of nurses in the process of implementation of obstetrical practices in the maternity humanized Alexander Fleming (1998-2004

    Directory of Open Access Journals (Sweden)

    Jane Márcia Progianti

    2012-09-01

    Full Text Available Estudo de natureza histórico-social cujo objetivo é analisar o processo de inserção das enfermeiras na assistência ao parto e as lutas dessas profissionais para implantar as práticas obstétricas humanizadas na Maternidade Alexander Fleming. Utilizou-se a história oral temática como método. As etapas da análise foram: ordenação, classificação e triangulação dos dados. Para sustentação da análise, utilizamos os conceitos de campo, habitus, poder simbólico e capital, de Pierre Bourdieu. Os resultados apontaram que a inserção das enfermeiras na assistência ao parto ocorreu mediante a lotação de recursos humanos para este projeto e de uma capacitação intensiva. Ao serem inseridas no centro obstétrico, as enfermeiras criaram um espaço próprio de atuação e elaboraram um protocolo assistencial. Concluímos que as estratégias de luta simbólica utilizadas pelas enfermeiras contribuíram para a conquista de espaços que as distinguiram no campo pelo desenvolvimento de práticas humanizadas que estavam de acordo com seu habitus.Se trata de un estudio de carácter histórico y social cuya finalidad es analizar el proceso de inserción de las enfermeras en el momento de la entrega y la lucha de estos profesionales para implementar las prácticas obstétricas humanizadas en la Maternidade Alexander Fleming. El método utilizado fue la historia oral temática. Los pasos del análisis fueron: ordenación, clasificación y triangulación de los datos. Para sustentación del análisis se utilizó los conceptos de campo, habitus, poder simbólico y capital, de Pierre Bourdieu. Los resultados mostraron que la inclusión de las enfermeras en la atención del parto se produjo a través de la capacidad de recursos humanos para este proyecto y de un entrenamiento intensivo. Al ser insertado en el centro obstétrico, las enfermeras han creado su propio espacio para la acción y han desarrollado un protocolo de atención. Concluimos que

  16. Overexpression of MIP2, a novel WD-repeat protein, promotes proliferation of H9c2 cells

    International Nuclear Information System (INIS)

    Wei, Xing; Song, Lan; Jiang, Lei; Wang, Guiliang; Luo, Xinjing; Zhang, Bin; Xiao, Xianzhong

    2010-01-01

    WD40 repeat proteins have a wide range of diverse biological functions including signal transduction, cell cycle regulation, RNA splicing, and transcription. Myocardial ischemic preconditioning up-regulated protein 2 (MIP2) is a novel member of the WD40 repeat proteins superfamily that contains five WD40 repeats. Little is known about its biological role, and the purpose of this study was to determine the role of MIP2 in regulating cellular proliferation. Transfection and constitutive expression of MIP2 in the rat cardiomyoblast cell line H9c2 results in enhanced growth of those cells as measured by cell number and is proportional to the amount of MIP2 expressed. Overexpression of MIP2 results in a shorter cell cycle, as measured by flow cytometry. Collectively, these data suggest that MIP2 may participate in the progression of cell proliferation in H9c2 cells.

  17. Extraction of resins from WD-22 tank in Jose Cabrera Nuclear Power Plant

    International Nuclear Information System (INIS)

    Benavides, E.

    1997-01-01

    The Spent Resin Tank (WD-22) is located in the Auxiliary Building of Jose Cabrera Nuclear Plant (PWR 150 Mwe). This tank has a nominal capacity of 4 m 3 and is almost full of spent resins that has been stored from the late sixties to early eighties. As the lines are completely plugged with resins and due to the difficulties in the pipe lay-out, it has not been possible to transfer the resins to the cementation plant since that date. The plant decided, by an open bid quotation, to select the most suitable process to transfer the resins to the cementation plant avoiding the high doses existing in the tank cubicle and in a reasonable time schedule. The solution given in this paper contemplates that sometimes there is an imaginative answer to a problem that seems to be difficult to solve. (authors)

  18. Molecular mapping of qBK1 WD , a major QTL for bakanae disease resistance in rice.

    Science.gov (United States)

    Lee, Sais-Beul; Hur, Yeon-Jae; Cho, Jun-Hyeon; Lee, Jong-Hee; Kim, Tae-Heon; Cho, Soo-Min; Song, You-Chun; Seo, Young-Su; Lee, Jungkwan; Kim, Tae-Sung; Park, Yong-Jin; Oh, Myung-Kyu; Park, Dong-Soo

    2018-01-10

    Bakanae or foot rot disease is a prominent disease of rice caused by Gibberella fujikuroi. This disease may infect rice plants from the pre-emergence stage to the mature stage. In recent years, raising rice seedlings in seed boxes for mechanical transplanting has increased the incidence of many seedling diseases; only a few rice varieties have been reported to exhibit resistance to bakanae disease. In this study, we attempted to identify quantitative trait loci (QTLs) conferring bakanae disease resistance from the highly resistant japonica variety Wonseadaesoo. A primary QTL study using the genotypes/phenotypes of the recombinant inbred lines (RILs) indicated that the locus qBK1 WD conferring resistance to bakanae disease from Wonseadaesoo was located in a 1.59 Mb interval delimited on the physical map between chr01_13542347 (13.54 Mb) and chr01_15132528 (15.13 Mb). The log of odds (LOD) score of qBK1 WD was 8.29, accounting for 20.2% of the total phenotypic variation. We further identified a gene pyramiding effect of two QTLs, qBK WD and previously developed qBK1. The mean proportion of healthy plant for 31 F 4 RILs that had no resistance genes was 35.3%, which was similar to that of the susceptible check variety Ilpum. The proportion of healthy plants for the lines with only qBK WD or qBK1 was 66.1% and 55.5%, respectively, which was significantly higher than that of the lines without resistance genes and that of Ilpum. The mean proportion of the healthy plant for 15 F 4 RILs harboring both qBK WD and qBK1 was 80.2%, which was significantly higher than that of the lines with only qBK WD or qBK1. Introducing qBK WD or pyramiding the QTLs qBK WD and qBK1 could provide effective tools for breeding rice with bakanae disease resistance. To our knowledge, this is the first report on a gene pyramiding effect that provides higher resistance against bakanae disease.

  19. Rancang Bangun Robot 6WD Dengan Sensor Gas TGS2600 Menggunakan Metode Wall Following Berbasis Arduino Mega 2560

    Directory of Open Access Journals (Sweden)

    I Made Arya Budhana

    2017-07-01

    Full Text Available Intisari— Perkembangan teknologi khususnya dibidang robotika saat ini sangat pesat, Salah satu bentuk aplikasi dari teknologi robotika yang erat kaitannya dengan sistem kontrol adalah wheel mobile robot. Beberapa metode dapat dilakukan untuk mendistribusikan gas alam salah satunya dengan pipa. Distribusi gas alam dengan menggunakan pipa sering mengalami kendala kebocoran yang disebabkan usia dari pipa distribusi yang sudah cukup tua. Untuk mempermudah pemantauan pipa gas yang berada di bawah tanah digunakan robot 6 WD (wheel drive yang memiliki 6 roda dan penggerak pada setiap rodanya untuk mengatasi medan yang berat. Pergerakan dari robot 6 WD mengacu pada sensor ultrasonik SRF HC-SR04, metode ini dinamakan wall following. Sensor gas tipe TGS dari figaro dimanfaatkan untuk mengetahui adanya kebocoran gas  pada pipa atau tidak. Selain itu, robot ini juga dilengkapi dengan kamera untuk mengirim gambar kerusakan pipa pada user agar dapat segera dilakukan perbaikan. Arduino Mega 2560 digunakan sebagai otak pada robot 6 WD yang bertugas untuk mengolah data yang masuk dan memberikan instruksi pada robot 6WD. Pengiriman data dari robot 6 WD pada pengguna meliputi, data sensor gas, data sensor kompas, data sensor jarak dan gambar kerusakan pada pipa. Seluruh data dapat dilihat pada GCS (Ground Control Station.   [TRUNITIN CHECK 20%, 26042017

  20. Evaluating the Effects of Restraint Systems on 4WD Testing Methodologies: A Collaborative Effort between the NVFEL and ANL

    Science.gov (United States)

    Testing vehicles for emissions and fuel economy has traditionally been conducted with a single-axle chassis dynamometer. The 2006 SAE All Wheel Drive Symposium cited four wheel drive (4WD) and all wheel drive (AWD) sales as climbing from 20% toward 30% of a motor vehicle mar...

  1. Dgp71WD is required for the assembly of the acentrosomal Meiosis I spindle, and is not a general targeting factor for the γ-TuRC

    Directory of Open Access Journals (Sweden)

    Richard F. Reschen

    2012-03-01

    Dgp71WD/Nedd1 proteins are essential for mitotic spindle formation. In human cells, Nedd1 targets γ-tubulin to both centrosomes and spindles, but in other organisms the function of Dgp71WD/Nedd1 is less clear. In Drosophila cells, Dgp71WD plays a major part in targeting γ-tubulin to spindles, but not centrosomes, while in Xenopus egg extracts, Nedd1 acts as a more general microtubule (MT organiser that can function independently of γ-tubulin. The interpretation of these studies, however, is complicated by the fact that some residual Dgp71WD/Nedd1 is likely present in the cells/extracts analysed. Here we generate a Dgp71WD null mutant lacking all but the last 12 nucleotides of coding sequence. The complete loss of Dgp71WD has no quantifiable effect on γ-tubulin or Centrosomin recruitment to the centrosome in larval brain cells. The recruitment of γ-tubulin to spindle MTs, however, is severely impaired, and spindle MT density is reduced in a manner that is indistinguishable from cells lacking Augmin or γ-TuRC function. In contrast, the absence of Dgp71WD leads to defects in the assembly of the acentrosomal female Meiosis I spindle that are more severe than those seen in Augmin or γ-TuRC mutants, indicating that Dgp71WD has additional functions that are independent of these complexes in oocytes. Moreover, the localisation of bicoid RNA during oogenesis, which requires γ-TuRC function, is unperturbed in Dgp71WD120 mutants. Thus, Dgp71WD is not simply a general cofactor required for γ-TuRC and/or Augmin targeting, and it appears to have a crucial role independent of these complexes in the acentrosomal Meiosis I spindle.

  2. Ternary WD40 repeat-containing protein complexes: evolution, composition and roles in plant immunity

    Directory of Open Access Journals (Sweden)

    Jimi C. Miller

    2016-01-01

    Full Text Available Plants, like mammals, rely on their innate immune system to perceive and discriminate among the majority of their microbial pathogens. Unlike mammals, plants respond to this molecular dialogue by unleashing a complex chemical arsenal of defense metabolites to resist or evade pathogen infection. In basal or non-host resistance, plants utilize signal transduction pathways to detect non-self, damaged-self and altered-self-associated molecular patterns and translate these danger signals into largely inducible chemical defenses. The WD40 repeat (WDR-containing proteins Gβ and TTG1 are constituents of two independent ternary protein complexes functioning at opposite ends of a plant immune signaling pathway. Gβ and TTG1 are also encoded by single-copy genes that are ubiquitous in higher plants, implying the limited diversity and functional conservation of their respective complexes. In this review, we summarize what is currently known about the evolutionary history of these WDR-containing ternary complexes, their repertoire and combinatorial interactions, and their downstream effectors and pathways in plant defense.

  3. Stealing the spotlight: CUL4-DDB1 ubiquitin ligase docks WD40-repeat proteins to destroy

    Directory of Open Access Journals (Sweden)

    Zhang Hui

    2007-02-01

    Full Text Available Abstract Recent investigation of Cullin 4 (CUL4 has ushered this class of multiprotein ubiquitin E3 ligases to center stage as critical regulators of diverse processes including cell cycle regulation, developmental patterning, DNA replication, DNA damage and repair, and epigenetic control of gene expression. CUL4 associates with DNA Damage Binding protein 1 (DDB1 to assemble an ubiquitin E3 ligase that targets protein substrates for ubiquitin-dependent proteolysis. CUL4 ligase activity is also regulated by the covalent attachment of the ubiquitin-like protein NEDD8 to CUL4, or neddylation, and the COP9 signalosome complex (CSN that removes this important modification. Recently, multiple WD40-repeat proteins (WDR were found to interact with DDB1 and serve as the substrate-recognition subunits of the CUL4-DDB1 ubiquitin ligase. As more than 150–300 WDR proteins exist in the human genome, these findings impact a wide array of biological processes through CUL4 ligase-mediated proteolysis. Here, we review the recent progress in understanding the mechanism of CUL4 ubiquitin E3 ligase and discuss the architecture of CUL4-assembled E3 ubiquitin ligase complexes by comparison to CUL1-based E3s (SCF. Then, we will review several examples to highlight the critical roles of CUL4 ubiquitin ligase in genome stability, cell cycle regulation, and histone lysine methylation. Together, these studies provide insights into the mechanism of this novel ubiquitin ligase in the regulation of important biological processes.

  4. WD40-repeat proteins in plant cell wall formation: current evidence and research prospects

    Directory of Open Access Journals (Sweden)

    Gea eGuerriero

    2015-12-01

    Full Text Available The metabolic complexity of living organisms relies on supramolecular protein structures which ensure vital processes, such as signal transduction, transcription, translation and cell wall synthesis. In eukaryotes WD40-repeat (WDR proteins often function as molecular hubs mediating supramolecular interactions. WDR proteins may display a variety of interacting partners and participate in the assembly of complexes involved in distinct cellular functions. In plants, the formation of lignocellulosic biomass involves extensive synthesis of cell wall polysaccharides, a process that requires the assembly of large transmembrane enzyme complexes, intensive vesicle trafficking, interactions with the cytoskeleton, and coordinated gene expression. Because of their function as supramolecular hubs, WDR proteins could participate in each or any of these steps, although to date only few WDR proteins have been linked to the cell wall by experimental evidence. Nevertheless, several potential cell wall-related WDR proteins were recently identified using in silico aproaches, such as analyses of co-expression, interactome and conserved gene neighbourhood. Notably, some WDR genes are frequently genomic neighbours of genes coding for GT2-family polysaccharide synthases in eukaryotes, and this WDR-GT2 collinear microsynteny is detected in diverse taxa. In angiosperms, two WDR genes are collinear to cellulose synthase genes, CESAs, whereas in ascomycetous fungi several WDR genes are adjacent to chitin synthase genes, chs. In this Perspective we summarize and discuss experimental and in silico studies on the possible involvement of WDR proteins in plant cell wall formation. The prospects of biotechnological engineering for enhanced biomass production are discussed.

  5. The pleiotropic effect of WD-40 domain containing proteins on cellular differentiation and production of secondary metabolites in Streptomyces coelicolor

    Czech Academy of Sciences Publication Activity Database

    Ulrych, Aleš; Goldová, Jana; Petříček, Miroslav; Benada, Oldřich; Kofroňová, Olga; Rampírová, Petra; Petříčková, Kateřina; Branny, Pavel

    2013-01-01

    Roč. 9, č. 6 (2013), s. 1453-1469 ISSN 1742-206X R&D Projects: GA MŠk LH12191; GA MŠk LH12055; GA MŠk 2B08064 Institutional support: RVO:61388971 Keywords : AERIAL MYCELIUM FORMATION * WD-REPEAT PROTEINS * BIOSYNTHESIS GENE-CLUSTER Subject RIV: EE - Microbiology, Virology Impact factor: 3.183, year: 2013

  6. Repair and maintenance costs of 4WD tractors and self propelled combine harvesters in Italy

    Directory of Open Access Journals (Sweden)

    Aldo Calcante

    2013-09-01

    Full Text Available Purchasing and maintaining tractors and operating machines are two of the most considerable costs of the agricultural sector, which includes farm equipment manufacturers, farm contractors and farms. In this context, repair and maintenance costs (R&M costs generally constitute 10-15% of the total costs related to agricultural equipment and tend to increase with the age of the equipment; hence, an important consideration in farm management is the optimal time for equipment replacement. Classical, R&M cost estimation models, calculated as a function of accumulated working hours, are usually developed by ASAE/ASABE for the United States operating conditions. However, R&M costs are strongly influenced by farming practices, operative conditions, crop and soil type, climatic conditions, etc. which can be specific for individual countries. In this study, R&M cost model parameters were recalculated for the current Italian situation. For this purpose, data related to the R&M costs of 100 4WD tractors with engine power ranging from 59 to 198 kW, and of 20 SP combine harvesters (10 straw walkers combines and 10 axial flow combines with engine power ranging from 159 to 368 kW working in Italy were collected. According to the model, which was obtained by interpolating the data through a two-parameter power function (proposed by ASAE/ASABE, the R&M cost incidence on the list price of Italian tractors at 12,000 working hours (estimated life of the machines was 48.6%, as compared with 43.2% calculated through the most recent U.S. model while, for self propelled combine harvesters, the R&M cost incidence at 3,000 working hours was 23.1 % as compared with 40.2% calculated through the same U.S. model.

  7. Missense mutations in the WD40 domain of AHI1 cause non-syndromic retinitis pigmentosa.

    Science.gov (United States)

    Nguyen, Thanh-Minh T; Hull, Sarah; Roepman, Ronald; van den Born, L Ingeborgh; Oud, Machteld M; de Vrieze, Erik; Hetterschijt, Lisette; Letteboer, Stef J F; van Beersum, Sylvia E C; Blokland, Ellen A; Yntema, Helger G; Cremers, Frans P M; van der Zwaag, Paul A; Arno, Gavin; van Wijk, Erwin; Webster, Andrew R; Haer-Wigman, Lonneke

    2017-09-01

    Recent findings suggesting that Abelson helper integration site 1 ( AHI1 ) is involved in non-syndromic retinal disease have been debated, as the functional significance of identified missense variants was uncertain. We assessed whether AHI1 variants cause non-syndromic retinitis pigmentosa (RP). Exome sequencing was performed in three probands with RP. The effects of the identified missense variants in AHI1 were predicted by three-dimensional structure homology modelling. Ciliary parameters were evaluated in patient's fibroblasts, and recombinant mutant proteins were expressed in ciliated retinal pigmented epithelium cells. In the three patients with RP, three sets of compound heterozygous variants were detected in AHI1 (c.2174G>A; p.Trp725* and c.2258A>T; p.Asp753Val, c.660delC; p.Ser221Glnfs*10 and c.2090C>T; p.Pro697Leu, c.2087A>G; p.His696Arg and c.2429C>T; p.Pro810Leu). All four missense variants were present in the conserved WD40 domain of Jouberin, the ciliary protein encoded by AHI1 , with variable predicted implications for the domain structure. No significant changes in the percentage of ciliated cells, nor in cilium length or intraflagellar transport were detected. However, expression of mutant recombinant Jouberin in ciliated cells showed a significantly decreased enrichment at the ciliary base. This report confirms that mutations in AHI1 can underlie autosomal recessive RP. Moreover, it structurally and functionally validates the effect of the RP-associated AHI1 variants on protein function, thus proposing a new genotype-phenotype correlation for AHI1 mutation associated retinal ciliopathies. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  8. VizieR Online Data Catalog: WD+dMs from the SUPERBLINK proper motion survey (Skinner+, 2017)

    Science.gov (United States)

    Skinner, J. N.; Morgan, D. P.; West, A. A.; Lepine, S.; Thorstensen, J. R.

    2018-06-01

    To select for nearby WD+dMs, we used the SUPERBLINK proper motion survey (Lepine et al. 2002, J/AJ/124/1190; Lepine & Shara 2005, Cat. I/298), an ongoing all-sky survey that identifies and characterizes stars with proper motions μ>40 mas/yr. For this study, we used the 2011 July version of SUPERBLINK, which listed 2270481 stars, and was estimated to be >90% complete to V=19.0. We selected WD+dMs based on a combination of V magnitudes derived from the DSS plates (see Lepine & Shara 2005, Cat. I/298), near-UV magnitudes from GALEX, and Ks magnitudes from 2MASS. Using the UV-optical-IR color selection outlined in Skinner et al. (2014AJ....148..115S), we selected targets for spectroscopic follow-up (see bottom panel of Figure 1). We acquired optical spectroscopy of 178 newly identified WD+dM candidates, with the Boller and Chivens CCD spectrograph (CCDS), using both the Hiltner 2.4 m and McGraw-Hill 1.3 m telescopes located at the MDM Observatory. (3 data files).

  9. Integrating population variation and protein structural analysis to improve clinical interpretation of missense variation: application to the WD40 domain.

    Science.gov (United States)

    Laskowski, Roman A; Tyagi, Nidhi; Johnson, Diana; Joss, Shelagh; Kinning, Esther; McWilliam, Catherine; Splitt, Miranda; Thornton, Janet M; Firth, Helen V; Wright, Caroline F

    2016-03-01

    We present a generic, multidisciplinary approach for improving our understanding of novel missense variants in recently discovered disease genes exhibiting genetic heterogeneity, by combining clinical and population genetics with protein structural analysis. Using six new de novo missense diagnoses in TBL1XR1 from the Deciphering Developmental Disorders study, together with population variation data, we show that the β-propeller structure of the ubiquitous WD40 domain provides a convincing way to discriminate between pathogenic and benign variation. Children with likely pathogenic mutations in this gene have severely delayed language development, often accompanied by intellectual disability, autism, dysmorphology and gastrointestinal problems. Amino acids affected by likely pathogenic missense mutations are either crucial for the stability of the fold, forming part of a highly conserved symmetrically repeating hydrogen-bonded tetrad, or located at the top face of the β-propeller, where 'hotspot' residues affect the binding of β-catenin to the TBLR1 protein. In contrast, those altered by population variation are significantly less likely to be spatially clustered towards the top face or to be at buried or highly conserved residues. This result is useful not only for interpreting benign and pathogenic missense variants in this gene, but also in other WD40 domains, many of which are associated with disease. © The Author 2016. Published by Oxford University Press.

  10. Experimental investigations on the fluid flow through an asymmetric rod bundle (W/D = 1.026)

    International Nuclear Information System (INIS)

    Rehme, K.

    1982-05-01

    Measurements of the distributions of the mean velocity, the wall shear stresses and the turbulence were performed in a wall subchannel of a rod bundle of four parallel rods arranged asymmetrically in a rectangular channel (P/D = 1.07, W/D = 1.026). The Reynolds number of this investigation was Re = 5.46 x 10 4 . The experimental results show that the momentum transport is highly anisotropic especially in the gaps of the rod bundle. Influences of secondary flow cannot be detected in the distribution of the time-mean velocity, however, such influences are found in the distributions of the turbulence intensities and the kinetic energy of turbulence. The comparison between experimental wall shear stress distributions and those calculated with the VELASCO-code shows discrepancies especially in the gap between the rod and channel walls. (orig.) [de

  11. High attributable risk due to arsenic for lung cancer in Yunnan tin mine reported by WD Hazelton et al

    International Nuclear Information System (INIS)

    Sun Shiquan

    2004-01-01

    Using two-stage clonal expansion model with data-base provided by Lubin, WD Hazelton et al indicated the high risk of arsenic, but not radon, in the etiology of Yunnan tin miner's lung cancer. The author of this review iterated the problems in the data-base of Lubin, and considered that it may result in low estimate for the risk of radon in paper of Hazelton et al. Attributable risk was estimated by them with changing exposure patterns of each individual ,but the efficacy of this two-stage model will be violated by the invariability of appointed radon/arsenic exposures. Risk comparison was used to distinguish the contribution from radon/arsenic, which was hampered by the high correlation between their joint exposures. As Lubin, Hazelton et al neglected the confounding from environmental arsenic pollution in early years. From all of above, their viewpoint is worth to be deliberated

  12. WD40 domain of Apc1 is critical for the coactivator-induced allosteric transition that stimulates APC/C catalytic activity.

    Science.gov (United States)

    Li, Qiuhong; Chang, Leifu; Aibara, Shintaro; Yang, Jing; Zhang, Ziguo; Barford, David

    2016-09-20

    The anaphase-promoting complex/cyclosome (APC/C) is a large multimeric cullin-RING E3 ubiquitin ligase that orchestrates cell-cycle progression by targeting cell-cycle regulatory proteins for destruction via the ubiquitin proteasome system. The APC/C assembly comprises two scaffolding subcomplexes: the platform and the TPR lobe that together coordinate the juxtaposition of the catalytic and substrate-recognition modules. The platform comprises APC/C subunits Apc1, Apc4, Apc5, and Apc15. Although the role of Apc1 as an APC/C scaffolding subunit has been characterized, its specific functions in contributing toward APC/C catalytic activity are not fully understood. Here, we report the crystal structure of the N-terminal domain of human Apc1 (Apc1N) determined at 2.2-Å resolution and provide an atomic-resolution description of the architecture of its WD40 (WD40 repeat) domain (Apc1(WD40)). To understand how Apc1(WD40) contributes to APC/C activity, a mutant form of the APC/C with Apc1(WD40) deleted was generated and evaluated biochemically and structurally. We found that the deletion of Apc1(WD40) abolished the UbcH10-dependent ubiquitination of APC/C substrates without impairing the Ube2S-dependent ubiquitin chain elongation activity. A cryo-EM structure of an APC/C-Cdh1 complex with Apc1(WD40) deleted showed that the mutant APC/C is locked into an inactive conformation in which the UbcH10-binding site of the catalytic module is inaccessible. Additionally, an EM density for Apc15 is not visible. Our data show that Apc1(WD40) is required to mediate the coactivator-induced conformational change of the APC/C that is responsible for stimulating APC/C catalytic activity by promoting UbcH10 binding. In contrast, Ube2S activity toward APC/C substrates is not dependent on the initiation-competent conformation of the APC/C.

  13. Spectroscopic Evolution of Disintegrating Planetesimals: Minute to Month Variability in the Circumstellar Gas Associated with WD 1145+017

    Energy Technology Data Exchange (ETDEWEB)

    Redfield, Seth; Cauley, P. Wilson; Duvvuri, Girish M. [Astronomy Department and Van Vleck Observatory, Wesleyan University, Middletown, CT 06459 (United States); Farihi, Jay [Department of Physics and Astronomy, University College London, London WC1E 6BT (United Kingdom); Parsons, Steven G. [Department of Physics and Astronomy, University of Sheffield, Sheffield, S3 7RH (United Kingdom); Gänsicke, Boris T., E-mail: sredfield@wesleyan.edu [Department of Physics, University of Warwick, Coventry CV4 7AL (United Kingdom)

    2017-04-10

    With the recent discovery of transiting planetary material around WD 1145+017, a critical target has been identified that links the evolution of planetary systems with debris disks and their accretion onto the star. We present a series of observations, five epochs over a year, taken with Keck and the VLT, which for the first time show variability of circumstellar absorption in the gas disk surrounding WD 1145+017 on timescales of minutes to months. Circumstellar absorption is measured in more than 250 lines of 14 ions among 10 different elements associated with planetary composition, e.g., O, Mg, Ca, Ti, Cr, Mn, Fe, and Ni. Broad circumstellar gas absorption with a velocity spread of 225 km s{sup −1} is detected, but over the course of a year blueshifted absorption disappears, while redshifted absorption systematically increases. A correlation of equivalent width and oscillator strength indicates that the gas is not highly optically thick (median τ ≈ 2). We discuss simple models of an eccentric disk coupled with magnetospheric accretion to explain the basic observed characteristics of these high-resolution and high signal-to-noise observations. Variability is detected on timescales of minutes in the two most recent observations, showing a loss of redshifted absorption for tens of minutes, coincident with major transit events and consistent with gas hidden behind opaque transiting material. This system currently presents a unique opportunity to learn how the gas causing the spectroscopic, circumstellar absorption is associated with the ongoing accretion evidenced by photospheric contamination, as well as the transiting planetary material detected in photometric observations.

  14. MUTATION ON WD DIPEPTIDE MOTIFS OF THE p48 SUBUNIT OF CHROMATIN ASSEMBLY FACTOR-1 CAUSING VIABILITY AND GROWTH OF DT40 CHICKEN B CELL LINE

    Directory of Open Access Journals (Sweden)

    Ahyar Ahmad

    2010-07-01

    Full Text Available Chromatin assembly factor-1 (CAF-1, a protein complex consisting of three subunits, p150, p60, and p48, is highly conserved from yeast to humans and facilitated nucleosome assembly of newly replicated DNA. The p48 subunit, CAF-1p48 (p48, with seven WD (Trp-Asp repeat motifs, is a member of the WD protein family. The immunoprecipitation experiment revealed that ß-propeller structure of p48 was less stringent for it's binding to HDAC-1, but more stringent for its binding to both histones H4 and CAF-1p60 but not to ASF-1, indicating that the proper ß-propeller structure of p48 is essential for the binding to these two proteins histone H4 and CAF-1p60. Complementation experiments, involving missense and truncated mutants of FLAG-tagged p48, revealed that mutations of every of seven WD dipeptide motifs, like both the N-terminal and C-terminal truncated mutations, could not rescue for the tet-induced lethality. These results indicate not only that p48 is essential for the viability of vertebrate cells, although the yeast p48 homolog is nonessential, but also that all the seven WD dipeptide motifs are necessary for the maintenance of the proper structure of p48 that is fundamentally important for cell viability.   Keywords: Chromatin assembly factor-1, complementation experiments, viability

  15. DETECTION OF WEAK CIRCUMSTELLAR GAS AROUND THE DAZ WHITE DWARF WD 1124-293: EVIDENCE FOR THE ACCRETION OF MULTIPLE ASTEROIDS

    Energy Technology Data Exchange (ETDEWEB)

    Debes, J. H. [Space Telescope Science Institute, 3700 San Martin Dr., Baltimore, MD 21218 (United States); Kilic, M. [Homer L. Dodge Department of Physics and Astronomy, The University of Oklahoma, 440 W. Brooks St., Norman, OK 73019 (United States); Faedi, F. [Astrophysics Research Centre, School of Mathematics and Physics, Queen' s University Belfast, University Road, Belfast, BT7 1NN (United Kingdom); Shkolnik, E. L. [Lowell Observatory, Flagstaff, AZ 86001 (United States); Lopez-Morales, M. [Institut de Ciencies de l' Espai (CSIC-IEEC), Campus UAB, Facultat de Ciencies, Torre C5, parell, 2a pl, E-08193 Bellaterra, Barcelona (Spain); Weinberger, A. J.; Slesnick, C. [Department of Terrestrial Magnetism, Carnegie Institution of Washington, 5249 Broad Branch RD, N.W., Washington, DC 20015 (United States); West, R. G. [Department of Physics and Astronomy, University of Leicester, University Road, Leicester, LE1 7RH (United Kingdom)

    2012-07-20

    Single metal-polluted white dwarfs with no dusty disks are believed to be actively accreting metals from a circumstellar disk of gas caused by the destruction of asteroids perturbed by planetary systems. We report, for the first time, the detection of circumstellar Ca II gas in absorption around the DAZ WD 1124-293, which lacks an infrared excess. We constrain the gas to >7 R{sub WD} and <32000 AU, and estimate it to be at {approx}54 R{sub WD}, well within WD 1124-293's tidal disruption radius. This detection is based on several epochs of spectroscopy around the Ca II H and K lines ({lambda} = 3968 A, 3933 A) with the MIKE spectrograph on the Magellan/Clay Telescope at Las Campanas Observatory. We confirm the circumstellar nature of the gas by observing nearby sightlines and finding no evidence for gas from the local interstellar medium. Through archival data we have measured the equivalent width of the two photospheric Ca lines over a period of 11 years. We see <5%-7% epoch-to-epoch variation in equivalent widths over this time period, and no evidence for long term trends. The presence of a circumstellar gas implies a near edge-on inclination to the system, thus we place limits to short period transiting planetary companions with R > R{sub Circled-Plus} using the Wide Angle Search for Planets survey. The presence of gas in orbit around WD 1124-293 implies that most DAZs could harbor planetary systems. Since 25%-30% of white dwarfs show metal line absorption, the dynamical process for perturbing small bodies must be robust.

  16. WD-repeat instability and diversification of the Podospora anserina hnwd non-self recognition gene family.

    Science.gov (United States)

    Chevanne, Damien; Saupe, Sven J; Clavé, Corinne; Paoletti, Mathieu

    2010-05-06

    Genes involved in non-self recognition and host defence are typically capable of rapid diversification and exploit specialized genetic mechanism to that end. Fungi display a non-self recognition phenomenon termed heterokaryon incompatibility that operates when cells of unlike genotype fuse and leads to the cell death of the fusion cell. In the fungus Podospora anserina, three genes controlling this allorecognition process het-d, het-e and het-r are paralogs belonging to the same hnwd gene family. HNWD proteins are STAND proteins (signal transduction NTPase with multiple domains) that display a WD-repeat domain controlling recognition specificity. Based on genomic sequence analysis of different P. anserina isolates, it was established that repeat regions of all members of the gene family are extremely polymorphic and undergoing concerted evolution arguing for frequent recombination within and between family members. Herein, we directly analyzed the genetic instability and diversification of this allorecognition gene family. We have constituted a collection of 143 spontaneous mutants of the het-R (HNWD2) and het-E (hnwd5) genes with altered recognition specificities. The vast majority of the mutants present rearrangements in the repeat arrays with deletions, duplications and other modifications as well as creation of novel repeat unit variants. We investigate the extreme genetic instability of these genes and provide a direct illustration of the diversification strategy of this eukaryotic allorecognition gene family.

  17. A prefoldin-associated WD-repeat protein (WDR92) is required for the correct architectural assembly of motile cilia

    Science.gov (United States)

    Patel-King, Ramila S.; King, Stephen M.

    2016-01-01

    WDR92 is a highly conserved WD-repeat protein that has been proposed to be involved in apoptosis and also to be part of a prefoldin-like cochaperone complex. We found that WDR92 has a phylogenetic signature that is generally compatible with it playing a role in the assembly or function of specifically motile cilia. To test this hypothesis, we performed an RNAi-based knockdown of WDR92 gene expression in the planarian Schmidtea mediterranea and were able to achieve a robust reduction in mRNA expression to levels undetectable under our standard RT-PCR conditions. We found that this treatment resulted in a dramatic reduction in the rate of organismal movement that was caused by a switch in the mode of locomotion from smooth, cilia-driven gliding to muscle-based, peristaltic contractions. Although the knockdown animals still assembled cilia of normal length and in similar numbers to controls, these structures had reduced beat frequency and did not maintain hydrodynamic coupling. By transmission electron microscopy we observed that many cilia had pleiomorphic defects in their architecture, including partial loss of dynein arms, incomplete closure of the B-tubule, and occlusion or replacement of the central pair complex by accumulated electron-dense material. These observations suggest that WDR92 is part of a previously unrecognized cytoplasmic chaperone system that is specifically required to fold key components necessary to build motile ciliary axonemes. PMID:26912790

  18. 'From Man to Bacteria': W.D. Hamilton, the theory of inclusive fitness, and the post-war social order.

    Science.gov (United States)

    Swenson, Sarah A

    2015-02-01

    W.D. Hamilton's theory of inclusive fitness aimed to define the evolved limits of altruism with mathematical precision. Although it was meant to apply universally, it has been almost irretrievably entwined with the particular case of social insects that featured in his famous 1964 papers. The assumption that social insects were central to Hamilton's early work contradicts material in his rich personal archive. In fact, careful study of Hamilton's notes, letters, diaries, and early essays indicates the extent to which he had humans in mind when he decided altruism was a topic worthy of biological inquiry. For this reason, this article reconsiders the role of extra-scientific factors in Hamilton's early theorizing. In doing so, it offers an alternative perspective as to why Hamilton saw self-sacrifice to be an important subject. Although the traditional narrative prioritizes his distaste for benefit-of-the-species explanations as a motivating factor behind his foundational work, I argue that greater attention ought to be given to Hamilton's hope that science could be used to address social ills. By reconsidering the meaning Hamilton intended inclusive fitness to have, we see that while he was no political ideologue, the socio-political relevance of his theory was nevertheless integral to its development. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Constraining convection parameters from the light curve shapes of pulsating white dwarf stars: the cases of EC 14012-1446 and WD 1524-0030

    Energy Technology Data Exchange (ETDEWEB)

    Handler, G; Lendl, M; Beck, P [Institut fuer Astronomie, Universitaet Wien, Tuerkenschanzstrasse 17, A-1180 Wien (Austria); Provencal, J L; Montgomery, M H [Mt. Cuba Observatory and Department of Physics and Astronomy, University of Delaware, 223 Sharp Laboratory, Newark, DE 19716 (Cuba); Romero-Colmenero, E [South AfricAN Astronomical Observatory, PO Box 9, Observatory 7935 (South Africa); Sanchawala, K; Chen, W-P [Graduate Institute of Astronomy, National Central University, Chung-Li 32054, Taiwan (China); Wood, M A; Silver, I [Department of Physics and Space Sciences and SARA Observatory, Florida Institute of Technology, Melbourne, FL 32901 (United States)], E-mail: handler@astro.univie.ac.at

    2008-10-15

    Montgomery [1] developed a method to probe convection in pulsating white dwarf stars which allows the recovery of the thermal response time of the convection zone by fitting observed nonsinusoidal light curves. He applied this method to two objects; the Whole Earth Telescope (WET) observed the pulsating DB white dwarf GD 358 for just this purpose. Given this WET run's success, it is time to extend Montgomery's method to pulsating DA white dwarf (ZZ Ceti) stars. We present observations of two ZZ Ceti stars, WD 1524-0030 and EC 14012-1446, both observed from multiple sites. EC 14012-1446 seems better suited thAN WD1524-0030 for a future WET run because it has more pulsation modes excited and because it pulsation spectrum appears to be more stable in time. We call for participation in this effort to take place in April 2008.

  20. Analysis of heterogeneous gallstones using laser-induced breakdown spectroscopy (LIBS) and wavelength dispersive X-ray fluorescence (WD-XRF).

    Science.gov (United States)

    Jaswal, Brij Bir S; Kumar, Vinay; Sharma, Jitendra; Rai, Pradeep K; Gondal, Mohammed A; Gondal, Bilal; Singh, Vivek K

    2016-04-01

    Laser-induced breakdown spectroscopy (LIBS) is an emerging analytical technique with numerous advantages such as rapidity, multi-elemental analysis, no specific sample preparation requirements, non-destructiveness, and versatility. It has been proven to be a robust elemental analysis tool attracting interest because of being applied to a wide range of materials including biomaterials. In this paper, we have performed spectroscopic studies on gallstones which are heterogeneous in nature using LIBS and wavelength dispersive X-ray fluorescence (WD-XRF) techniques. It has been observed that the presence and relative concentrations of trace elements in different kind of gallstones (cholesterol and pigment gallstones) can easily be determined using LIBS technique. From the experiments carried out on gallstones for trace elemental mapping and detection, it was found that LIBS is a robust tool for such biomedical applications. The stone samples studied in the present paper were classified using the Fourier transform infrared (FTIR) spectroscopy. WD-XRF spectroscopy has been applied for the qualitative and quantitative analysis of major and trace elements present in the gallstone which was compared with the LIBS data. The results obtained in the present paper show interesting prospects for LIBS and WD-XRF to study cholelithiasis better.

  1. A pomegranate (Punica granatum L.) WD40-repeat gene is a functional homologue of Arabidopsis TTG1 and is involved in the regulation of anthocyanin biosynthesis during pomegranate fruit development.

    Science.gov (United States)

    Ben-Simhon, Zohar; Judeinstein, Sylvie; Nadler-Hassar, Talia; Trainin, Taly; Bar-Ya'akov, Irit; Borochov-Neori, Hamutal; Holland, Doron

    2011-11-01

    Anthocyanins are the major pigments responsible for the pomegranate (Punica granatum L.) fruit skin color. The high variability in fruit external color in pomegranate cultivars reflects variations in anthocyanin composition. To identify genes involved in the regulation of anthocyanin biosynthesis pathway in the pomegranate fruit skin we have isolated, expressed and characterized the pomegranate homologue of the Arabidopsis thaliana TRANSPARENT TESTA GLABRA1 (TTG1), encoding a WD40-repeat protein. The TTG1 protein is a regulator of anthocyanins and proanthocyanidins (PAs) biosynthesis in Arabidopsis, and acts by the formation of a transcriptional regulatory complex with two other regulatory proteins: bHLH and MYB. Our results reveal that the pomegranate gene, designated PgWD40, recovered the anthocyanin, PAs, trichome and seed coat mucilage phenotype in Arabidopsis ttg1 mutant. PgWD40 expression and anthocyanin composition in the skin were analyzed during pomegranate fruit development, in two accessions that differ in skin color intensity and timing of appearance. The results indicate high positive correlation between the total cyanidin derivatives quantity (red pigments) and the expression level of PgWD40. Furthermore, strong correlation was found between the steady state levels of PgWD40 transcripts and the transcripts of pomegranate homologues of the structural genes PgDFR and PgLDOX. PgWD40, PgDFR and PgLDOX expression also correlated with the expression of pomegranate homologues of the regulatory genes PgAn1 (bHLH) and PgAn2 (MYB). On the basis of our results we propose that PgWD40 is involved in the regulation of anthocyanin biosynthesis during pomegranate fruit development and that expression of PgWD40, PgAn1 and PgAn2 in the pomegranate fruit skin is required to regulate the expression of downstream structural genes involved in the anthocyanin biosynthesis.

  2. Identification of histone H4-like TAF in Schizosaccharomyces pombe as a protein that interacts with WD repeat-containing TAF

    OpenAIRE

    Mitsuzawa, Hiroshi; Ishihama, Akira

    2002-01-01

    The general transcription factor TFIID consists of the TATA-binding protein (TBP) and multiple TBP-associated factors (TAFs). We previously identified two distinct WD repeat-containing TAFs, spTAF72 and spTAF73, in the fission yeast Schizosaccharomyces pombe. Here we report the identification of another S.pombe TAF, spTAF50, which is the S.pombe homolog of histone H4-like TAFs such as human TAF80, Drosophila TAF60 and Saccharomyces cerevisiae TAF60. spTAF50 was identified in a two-hybrid scre...

  3. 'Public theology' from within the church? A reflection on aspects of the theology of W.D. Jonker (1929-2006)

    OpenAIRE

    Naudé, Piet J.

    2014-01-01

    In this essay, aspects of the work of theologian W.D. (Willie) Jonker are reframed to complement current debates about �public theology� in South Africa. The introduction points out that Jonker worked during a crucial period in South Africa�s history and that his theology is intrinsically linked to the church struggle between 1955 and 1994. The second part reframes Jonker�s theology as a public theology from within the church by referring to his understanding of preaching, confessions and pub...

  4. Loss of γ-tubulin, GCP-WD/NEDD1 and CDK5RAP2 from the Centrosome of Neurons in Developing Mouse Cerebral and Cerebellar Cortex

    International Nuclear Information System (INIS)

    Yonezawa, Satoshi; Shigematsu, Momoko; Hirata, Kazuto; Hayashi, Kensuke

    2015-01-01

    It has been recently reported that the centrosome of neurons does not have microtubule nucleating activity. Microtubule nucleation requires γ-tubulin as well as its recruiting proteins, GCP-WD/NEDD1 and CDK5RAP2 that anchor γ-tubulin to the centrosome. Change in the localization of these proteins during in vivo development of brain, however, has not been well examined. In this study we investigate the localization of γ-tubulin, GCP-WD and CDK5RAP2 in developing cerebral and cerebellar cortex with immunofluorescence. We found that γ-tubulin and its recruiting proteins were localized at centrosomes of immature neurons, while they were lost at centrosomes in mature neurons. This indicated that the loss of microtubule nucleating activity at the centrosome of neurons is due to the loss of γ-tubulin-recruiting proteins from the centrosome. RT-PCR analysis revealed that these proteins are still expressed after birth, suggesting that they have a role in microtubule generation in cell body and dendrites of mature neurons. Microtubule regrowth experiments on cultured mature neurons showed that microtubules are nucleated not at the centrosome but within dendrites. These data indicated the translocation of microtubule-organizing activity from the centrosome to dendrites during maturation of neurons, which would explain the mixed polarity of microtubules in dendrites

  5. Glove box adaptation, installation and commissioning of WD-XRF system for determination of PuO2 in MOX fuel samples

    International Nuclear Information System (INIS)

    Aher, Sachin; Pandey, Ashish; Khan, F.A.; Das, D.K.; Kumar, Surendra; Behere, P.G.; Mohd Afzal

    2015-01-01

    Glove Box facility forms the foremost important confinement system at nuclear fuel fabrication facility for handling of Plutonium based MOX fuels. Due to limited resources of Natural Uranium and maximum utilization of thorium, India has adopted 'Close Fuel Cycle Strategy' which involves use of Plutonium based fuels in Thermal and Fast reactors. Plutonium being radio toxic material with a higher biological half-life, Plutonium based fuel fabrication facility requires special techniques and confinement as a primary method for protection against spreading of powder contamination. Glove Box along with dynamic ventilation and HEPA Filters forms the preeminent facility for safe handling of plutonium based MOX fuels. Various equipment's, systems and instruments associated with MOX fuel production are need to be adapted inside the Glove Box with considerations of safety, ergonomics, accessibility for operations and maintenance, connections of various feed through like electrical connections, gas line supply etc. Quality Control plays the vital role in production of MOX fuels to ensure the finest quality of product to meet the defined specifications of MOX fuels. Presently AFFF is fabricating MOX fuel containing 21% and 28% PuO 2 along with DDUO 2 the first core of PFBR. Precise quantification of PuO 2 in MOX fuel pellets is necessary process control steps after batch preparation in Milling and Mixing operation. At AFFF, WD-XRF is one of the system used for determination of percentage of PuO 2 in MOX fuel batch. Glove Box adaptation of WD-XRF system along with 30 Tones Hydraulic press for sample preparation is being carried out in Type VI and Type IV Glove Boxes connected through transfer tunnel. Due to restrictions of space inside the Glove Box, a special mechanism is developed and installed for safe titling of WD-XRF system inside the Glove Box during the need of maintenance. These Glove Boxes are leak tested by various leak testing technique to meet the

  6. Effects of disrupting the polyketide synthase gene WdPKS1 in Wangiella [Exophiala] dermatitidis on melanin production and resistance to killing by antifungal compounds, enzymatic degradation, and extremes in temperature

    Directory of Open Access Journals (Sweden)

    Mandal Piyali

    2006-06-01

    Full Text Available Abstract Background Wangiella dermatitidis is a human pathogenic fungus that is an etiologic agent of phaeohyphomycosis. W. dermatitidis produces a black pigment that has been identified as a dihydroxynaphthalene melanin and the production of this pigment is associated with its virulence. Cell wall pigmentation in W. dermatitidis depends on the WdPKS1 gene, which encodes a polyketide synthase required for generating the key precursor for dihydroxynaphthalene melanin biosynthesis. Results We analyzed the effects of disrupting WdPKS1 on dihydroxynaphthalene melanin production and resistance to antifungal compounds. Transmission electron microscopy revealed that wdpks1Δ-1 yeast had thinner cell walls that lacked an electron-opaque layer compared to wild-type cells. However, digestion of the wdpks1Δ-1 yeast revealed small black particles that were consistent with a melanin-like compound, because they were acid-resistant, reacted with melanin-binding antibody, and demonstrated a free radical signature by electron spin resonance analysis. Despite lacking the WdPKS1 gene, the mutant yeast were capable of catalyzing the formation of melanin from L-3,4-dihyroxyphenylalanine. The wdpks1Δ-1 cells were significantly more susceptible to killing by voriconazole, amphotericin B, NP-1 [a microbicidal peptide], heat and cold, and lysing enzymes than the heavily melanized parental or complemented strains. Conclusion In summary, W. dermatitidis makes WdPKS-dependent and -independent melanins, and the WdPKS1-dependent deposition of melanin in the cell wall confers protection against antifungal agents and environmental stresses. The biological role of the WdPKS-independent melanin remains unclear.

  7. Experimental investigations on the fluid flow through an asymmetric rod bundle (P/D = 1.148, W/D = 1.045)

    International Nuclear Information System (INIS)

    Rehme, K.

    1983-11-01

    Measurements of the distributions of the mean velocity, the wall shear stresses and the turbulence were performed in a wall subchannel of a rod bundle of four parallel rods arranged asymmetrically in a rectangular channel (P/D = 1.148, W/D = 1.045). The Reynolds number of this investigations was Re = 5.88 x 10 4 . The experimental results show that the momentum transport is highly anisotropic especially in the gaps of the rod bundle. Influences of secondary flow cannot be detected in the distribution of the time-mean velocity. The comparison between experimental wall shear stress distributions and those calculated with the VELASCO-code shows discrepancies both in the gap between the rod and channel walls and in the gap between the rods caused by the high momentum transport between the two subchannels. (orig.) [de

  8. Experimental investigations on the fluid flow through an asymmetric rod bundle (P/D = 1.148, W/D = 1.074)

    International Nuclear Information System (INIS)

    Rehme, K.

    1984-12-01

    Measurements of the distributions of the mean velocity, the wall shear stresses and the turbulence were performed in a wall subchannel of a rod bundle of four prallel rods arranged asymmetrically in a rectangular (P/D = 1.148, W/D = 1.074). The Reynolds number of this investigations was Re = 7.89 x 10 4 . The results obtained by a fully automated rig are compared with those from manual operation. The experimental results show that the momentum transport is highly anisotropyc especially in the gaps of the rod bundle. Influences of secondary flow cannot be detected in the distribution of the time-mean velocity. The comparison between experimental wall shear stress distributions and those calculated with the VELASCO-code shows discrepancies both in the gap between the rod and channel walls and in the gap between the rods caused by the high momentum transport between the two subchannels. (orig.) [de

  9. Experimental investigations on the fluid flow through a wall subchannel of a rod bundle (P/D = 1.036, W/D = 1.072)

    International Nuclear Information System (INIS)

    Rehme, K.

    1982-07-01

    Measurements of the distributions of the mean velocity, the wall shear stresses and the turbulence were performed in a wall subchannel of a rod bundle of four parallel rods arranged symmetrically in a rectangular channel (P/D = 1.036, W/D = 1.072). The Reynolds number of this investigation was Re = 7.60 x 10 4 . The experimental results show that the momentum transport is highly anisotropic especially in the gaps of the rod bundle. Influences of secondary flow cannot be detected in the distribution of the time-mean velocity, however, such influences are found in the distributions of the turbulence intensities and the kinetic energy of turbulence. Very high turbulence intensities were observed in the gap between the rods. The comparison between experimental wall shear stress distributions and those calculated with the VELASCO-code shows discrepancies especially in the gap between the rods. (orig.) [de

  10. RING finger and WD repeat domain 3 (RFWD3) associates with replication protein A (RPA) and facilitates RPA-mediated DNA damage response.

    Science.gov (United States)

    Liu, Shangfeng; Chu, Jessica; Yucer, Nur; Leng, Mei; Wang, Shih-Ya; Chen, Benjamin P C; Hittelman, Walter N; Wang, Yi

    2011-06-24

    DNA damage response is crucial for maintaining genomic integrity and preventing cancer by coordinating the activation of checkpoints and the repair of damaged DNA. Central to DNA damage response are the two checkpoint kinases ATM and ATR that phosphorylate a wide range of substrates. RING finger and WD repeat domain 3 (RFWD3) was initially identified as a substrate of ATM/ATR from a proteomic screen. Subsequent studies showed that RFWD3 is an E3 ubiquitin ligase that ubiquitinates p53 in vitro and positively regulates p53 levels in response to DNA damage. We report here that RFWD3 associates with replication protein A (RPA), a single-stranded DNA-binding protein that plays essential roles in DNA replication, recombination, and repair. Binding of RPA to single-stranded DNA (ssDNA), which is generated by DNA damage and repair, is essential for the recruitment of DNA repair factors to damaged sites and the activation of checkpoint signaling. We show that RFWD3 is physically associated with RPA and rapidly localizes to sites of DNA damage in a RPA-dependent manner. In vitro experiments suggest that the C terminus of RFWD3, which encompass the coiled-coil domain and the WD40 domain, is necessary for binding to RPA. Furthermore, DNA damage-induced phosphorylation of RPA and RFWD3 is dependent upon each other. Consequently, loss of RFWD3 results in the persistent foci of DNA damage marker γH2AX and the repair protein Rad51 in damaged cells. These findings suggest that RFWD3 is recruited to sites of DNA damage and facilitates RPA-mediated DNA damage signaling and repair.

  11. Enhanced Expression of WD Repeat-Containing Protein 35 via Nuclear Factor-Kappa B Activation in Bupivacaine-Treated Neuro2a Cells

    Science.gov (United States)

    Huang, Lei; Kondo, Fumio; Harato, Misako; Feng, Guo-Gang; Ishikawa, Naoshisa; Fujiwara, Yoshihiro; Okada, Shoshiro

    2014-01-01

    The family of WD repeat proteins comprises a large number of proteins and is involved in a wide variety of cellular processes such as signal transduction, cell growth, proliferation, and apoptosis. Bupivacaine is a sodium channel blocker administered for local infiltration, nerve block, epidural, and intrathecal anesthesia. Recently, we reported that bupivacaine induces reactive oxygen species (ROS) generation and p38 mitogen-activated protein kinase (MAPK) activation, resulting in an increase in the expression of WD repeat-containing protein 35 (WDR35) in mouse neuroblastoma Neuro2a cells. It has been shown that ROS activate MAPK through phosphorylation, followed by activation of nuclear factor-kappa B (NF-κB) and activator protein 1 (AP-1). The present study was undertaken to test whether NF-κB and c-Jun/AP-1 are involved in bupivacaine-induced WDR35 expression in Neuro2a cells. Bupivacaine activated both NF-κB and c-Jun in Neuro2a cells. APDC, an NF-κB inhibitor, attenuated the increase in NF-κB activity and WDR35 protein expression in bupivacaine-treated Neuro2a cells. GW9662, a selective peroxisome proliferator-activated receptor-γ antagonist, enhanced the increase in NF-κB activity and WDR35 protein expression in bupivacaine-treated Neuro2a cells. In contrast, c-Jun siRNA did not inhibit the bupivacaine-induced increase in WDR35 mRNA expression. These results indicate that bupivacaine induces the activation of transcription factors NF-κB and c-Jun/AP-1 in Neuro2a cells, while activation of NF-κB is involved in bupivacaine-induced increases in WDR35 expression. PMID:24466034

  12. Essential role of the NH2-terminal WD/EPF motif in the phosphorylation-activated protective function of mammalian Hsp27.

    Science.gov (United States)

    Thériault, Jimmy R; Lambert, Herman; Chávez-Zobel, Aura T; Charest, Gabriel; Lavigne, Pierre; Landry, Jacques

    2004-05-28

    Hsp27 is expressed at high levels after mild heat shock and contributes to making cells extremely resistant to subsequent treatments. The activity of the protein is regulated at the transcriptional level, but also by phosphorylation, which occurs rapidly during stress and is responsible for causing the dissociation of large 700-kDa Hsp27 oligomers into dimers. We investigated the mechanism by which phosphorylation and oligomerization modulate the protective activity of Chinese hamster Hsp27. In contrast to oligomer dissociation, which only required Ser90 phosphorylation, activation of Hsp27 thermoprotective activity required the phosphorylation of both Ser90 and Ser15. Replacement of Ser90 by Ala90, which prevented the dissociation of the oligomer upon stress, did cause a severe defect in the protective activity. Dissociation was, however, not a sufficient condition to activate the protein because replacement of Ser15 by Ala15, which caused little effect in the oligomeric organization of the protein, also yielded an inactive protein. Analyzes of mutants with short deletions in the NH2 terminus identified the Hsp27 WD/EPF or PF-rich domain as essential for protection, maintenance of the oligomeric structure, and in vitro chaperone activity of the protein. In light of a three-dimensional model of Hsp27 based on the crystallographic structure of wheat Hsp16.9, we propose that the conserved WD/EPF motif of mammalian Hsp27 mediates important intramolecular interactions with hydrophic surfaces of the alpha-crystallin domain of the protein. These interactions are destabilized by Ser90 phosphorylation, making the motif free to interact with heterologous molecular targets upon the additional phosphorylation of the nearby Ser15.

  13. A study of small-scale foliation in lengths of core enclosing fault zones in borehole WD-3, Permit Area D, Lac du Bonnet Batholith

    Energy Technology Data Exchange (ETDEWEB)

    Ejeckam, R. B.

    1992-12-01

    Small-scale foliation measurements in lengths of core from borehole WD-3 of Permit Area D of the Lac du Bonnet Batholith have defined five major mean orientation sets. They strike NW, N and NE. The orientations (strike to the left of the dip direction/dip) of these sets are as follows: Set I - 028/74 deg; II - 001/66 deg; III - 100/58 deg; IV - 076/83 deg; and V - 210/40 deg. The small-scale foliations were defined by different mineral types such as biotite crystals, plagioclase, mineral banding and quartz lenses. Well-developed biotite foliation is commonly present whenever well-developed plagioclase foliation exists, but as the strength of development weakens, the preferred orientations of plagioclase foliation do not correspond to those of biotite. It is also noted that the foliations appear to strike in directions orthogonal to the fractures in the fracture zones in the same depth interval. No significant change in foliation orientation was observed in Zones I to IV. Set V, however, whose mean orientation is 210/40 deg, is absent from the Zone IV interval, ranging from 872 to 905 m. (auth)

  14. Two novel WD40 domain–containing proteins, Ere1 and Ere2, function in the retromer-mediated endosomal recycling pathway

    Science.gov (United States)

    Shi, Yufeng; Stefan, Christopher J.; Rue, Sarah M.; Teis, David; Emr, Scott D.

    2011-01-01

    Regulated secretion, nutrient uptake, and responses to extracellular signals depend on cell-surface proteins that are internalized and recycled back to the plasma membrane. However, the underlying mechanisms that govern membrane protein recycling to the cell surface are not fully known. Using a chemical-genetic screen in yeast, we show that the arginine transporter Can1 is recycled back to the cell surface via two independent pathways mediated by the sorting nexins Snx4/41/42 and the retromer complex, respectively. In addition, we identify two novel WD40-domain endosomal recycling proteins, Ere1 and Ere2, that function in the retromer pathway. Ere1 is required for Can1 recycling via the retromer-mediated pathway, but it is not required for the transport of other retromer cargoes, such as Vps10 and Ftr1. Biochemical studies reveal that Ere1 physically interacts with internalized Can1. Ere2 is present in a complex containing Ere1 on endosomes and functions as a regulator of Ere1. Taken together, our results suggest that Snx4/41/42 and the retromer comprise two independent pathways for the recycling of internalized cell-surface proteins. Moreover, a complex containing the two novel proteins Ere1 and Ere2 mediates cargo-specific recognition by the retromer pathway. PMID:21880895

  15. 'Morals can not be drawn from facts but guidance may be': the early life of W.D. Hamilton's theory of inclusive fitness.

    Science.gov (United States)

    Swenson, Sarah A

    2015-12-01

    W.D. Hamilton's theory of inclusive fitness saw the evolution of altruism from the point of view of the gene. It was at heart a theory of limits, redefining altruistic behaviours as ultimately selfish. This theory inspired two controversial texts published almost in tandem, E.O. Wilson's Sociobiology: The New Synthesis (1975) and Richard Dawkins's The Selfish Gene (1976). When Wilson and Dawkins were attacked for their evolutionary interpretations of human societies, they claimed a distinction between reporting what is and declaring what ought to be. Can the history of sociobiological theories be so easily separated from its sociopolitical context? This paper draws upon unpublished materials from the 1960s and early 1970s and documents some of the ways in which Hamilton saw his research as contributing to contemporary concerns. It pays special attention to the 1969 Man and Beast Smithsonian Institution symposium in order to explore the extent to which Hamilton intended his theory to be merely descriptive versus prescriptive. From this, we may see that Hamilton was deeply concerned about the political chaos he perceived in the world around him, and hoped to arrive at a level of self-understanding through science that could inform a new social order.

  16. Enhanced Expression of WD Repeat-Containing Protein 35 via CaMKK/AMPK Activation in Bupivacaine-Treated Neuro2a Cells

    Science.gov (United States)

    Huang, Lei; Kondo, Fumio; Gosho, Masahiko; Feng, Guo-Gang; Harato, Misako; Xia, Zhong-yuan; Ishikawa, Naohisa; Fujiwara, Yoshihiro; Okada, Shoshiro

    2014-01-01

    We previously reported that bupivacaine induces reactive oxygen species (ROS) generation, p38 mitogen-activated protein kinase (MAPK) activation and nuclear factor-kappa B activation, resulting in an increase in expression of WD repeat-containing protein 35 (WDR35) in mouse neuroblastoma Neuro2a cells. However, the identity of signaling upstream of p38 MAPK pathways to WDR35 expression remains unclear. It has been shown that AMP-activated protein kinase (AMPK) can activate p38 MAPK through diverse mechanisms. In addition, several kinases acting upstream of AMPK have been identified including Ca2+/calmodulin-dependent protein kinase kinase (CaMKK). Recent studies reported that AMPK may be involved in bupivacaine-induced cytotoxicity in Schwann cells and in human neuroblastoma SH-SY5Y cells. The present study was undertaken to test whether CaMKK and AMPK are involved in bupivacaine-induced WDR35 expression in Neuro2a cells. Our results showed that bupivacaine induced activation of AMPK and p38 MAPK in Neuro2a cells. The AMPK inhibitors, compound C and iodotubercidin, attenuated the bupivacaine-induced activation of AMPK and p38 MAPK, resulting in an inhibition of the bupivacaine-induced increase in WDR35 expression. Treatment with the CaMKK inhibitor STO-609 also attenuated the bupivacaine-induced activation of AMPK and p38 MAPK, resulting in an inhibition of the bupivacaine-induced increase in WDR35 expression. These results suggest that bupivacaine activates AMPK and p38 MAPK via CaMKK in Neuro2a cells, and that the CaMKK/AMPK/p38 MAPK pathway is involved in regulating WDR35 expression. PMID:24859235

  17. Upon Infection the Cellular WD Repeat-containing Protein 5 (WDR5) Localizes to Cytoplasmic Inclusion Bodies and Enhances Measles Virus Replication.

    Science.gov (United States)

    Ma, Dzwokai; George, Cyril X; Nomburg, Jason; Pfaller, Christian K; Cattaneo, Roberto; Samuel, Charles E

    2017-12-13

    Replication of negative-strand RNA viruses occurs in association with discrete cytoplasmic foci called inclusion bodies. Whereas inclusion bodies represent a prominent subcellular structure induced by viral infection, our knowledge of the cellular protein components involved in inclusion body formation and function is limited. Using measles virus-infected HeLa cells, we found that the WD repeat-containing protein 5 (WDR5), a subunit of histone H3 lysine 4 methyltransferases, was selectively recruited to virus-induced inclusion bodies. Furthermore, WDR5 was found in complexes containing viral proteins associated with RNA replication. WDR5 was not detected with mitochondria, stress granules, or other known secretory or endocytic compartments of infected cells. WDR5 deficiency decreased both viral protein production and infectious virus yields. Interferon production was modestly increased in WDR5 deficient cells. Thus, our study identifies WDR5 as a novel viral inclusion body-associated cellular protein and suggests a role for WDR5 in promoting viral replication. IMPORTANCE Measles virus is a human pathogen that remains a global concern with more than 100,000 measles-related deaths annually despite the availability of an effective vaccine. As measles continues to cause significant morbidity and mortality, understanding the virus-host interactions at the molecular level that affect virus replication efficiency is important for development and optimization of treatment procedures. Measles virus is an RNA virus that encodes six genes and replicates in the cytoplasm of infected cells in discrete cytoplasmic replication bodies, though little is known of the biochemical nature of these structures. Here we show that the cellular protein WDR5 is enriched in the cytoplasmic viral replication factories and enhances virus growth. WDR5-containing protein complex includes viral proteins responsible for viral RNA replication. Thus, we have identified WDR5 as a host factor that

  18. The Jasmonate-ZIM-domain proteins interact with the WD-Repeat/bHLH/MYB complexes to regulate Jasmonate-mediated anthocyanin accumulation and trichome initiation in Arabidopsis thaliana.

    Science.gov (United States)

    Qi, Tiancong; Song, Susheng; Ren, Qingcuo; Wu, Dewei; Huang, Huang; Chen, Yan; Fan, Meng; Peng, Wen; Ren, Chunmei; Xie, Daoxin

    2011-05-01

    Jasmonates (JAs) mediate plant responses to insect attack, wounding, pathogen infection, stress, and UV damage and regulate plant fertility, anthocyanin accumulation, trichome formation, and many other plant developmental processes. Arabidopsis thaliana Jasmonate ZIM-domain (JAZ) proteins, substrates of the CORONATINE INSENSITIVE1 (COI1)-based SCF(COI1) complex, negatively regulate these plant responses. Little is known about the molecular mechanism for JA regulation of anthocyanin accumulation and trichome initiation. In this study, we revealed that JAZ proteins interact with bHLH (Transparent Testa8, Glabra3 [GL3], and Enhancer of Glabra3 [EGL3]) and R2R3 MYB transcription factors (MYB75 and Glabra1), essential components of WD-repeat/bHLH/MYB transcriptional complexes, to repress JA-regulated anthocyanin accumulation and trichome initiation. Genetic and physiological evidence showed that JA regulates WD-repeat/bHLH/MYB complex-mediated anthocyanin accumulation and trichome initiation in a COI1-dependent manner. Overexpression of the MYB transcription factor MYB75 and bHLH factors (GL3 and EGL3) restored anthocyanin accumulation and trichome initiation in the coi1 mutant, respectively. We speculate that the JA-induced degradation of JAZ proteins abolishes the interactions of JAZ proteins with bHLH and MYB factors, allowing the transcriptional function of WD-repeat/bHLH/MYB complexes, which subsequently activate respective downstream signal cascades to modulate anthocyanin accumulation and trichome initiation.

  19. The Jasmonate-ZIM-Domain Proteins Interact with the WD-Repeat/bHLH/MYB Complexes to Regulate Jasmonate-Mediated Anthocyanin Accumulation and Trichome Initiation in Arabidopsis thaliana[C][W

    Science.gov (United States)

    Qi, Tiancong; Song, Susheng; Ren, Qingcuo; Wu, Dewei; Huang, Huang; Chen, Yan; Fan, Meng; Peng, Wen; Ren, Chunmei; Xie, Daoxin

    2011-01-01

    Jasmonates (JAs) mediate plant responses to insect attack, wounding, pathogen infection, stress, and UV damage and regulate plant fertility, anthocyanin accumulation, trichome formation, and many other plant developmental processes. Arabidopsis thaliana Jasmonate ZIM-domain (JAZ) proteins, substrates of the CORONATINE INSENSITIVE1 (COI1)–based SCFCOI1 complex, negatively regulate these plant responses. Little is known about the molecular mechanism for JA regulation of anthocyanin accumulation and trichome initiation. In this study, we revealed that JAZ proteins interact with bHLH (Transparent Testa8, Glabra3 [GL3], and Enhancer of Glabra3 [EGL3]) and R2R3 MYB transcription factors (MYB75 and Glabra1), essential components of WD-repeat/bHLH/MYB transcriptional complexes, to repress JA-regulated anthocyanin accumulation and trichome initiation. Genetic and physiological evidence showed that JA regulates WD-repeat/bHLH/MYB complex-mediated anthocyanin accumulation and trichome initiation in a COI1-dependent manner. Overexpression of the MYB transcription factor MYB75 and bHLH factors (GL3 and EGL3) restored anthocyanin accumulation and trichome initiation in the coi1 mutant, respectively. We speculate that the JA-induced degradation of JAZ proteins abolishes the interactions of JAZ proteins with bHLH and MYB factors, allowing the transcriptional function of WD-repeat/bHLH/MYB complexes, which subsequently activate respective downstream signal cascades to modulate anthocyanin accumulation and trichome initiation. PMID:21551388

  20. Simulação da estabilidade de tratores agrícolas 4x2 Simulation of the stability of 2wd agricultural tractors

    Directory of Open Access Journals (Sweden)

    Joseph Kalil Khoury Junior

    2009-01-01

    Full Text Available O objetivo do trabalho foi simular computacionalmente a estabilidade de tratores agrícolas 4x2. Experimentos de simulação foram realizados visando analisar o comportamento dinâmico de um trator agrícola 4x2 trabalhando em diferentes condições de operação e de terreno. Nas simulações em que se variaram as posições do trator sobre uma pista inclinada até o tombamento lateral, o ângulo de posição igual a 60º foi o de pior situação, o que corresponde ao trator descer por uma diagonal em pista inclinada para a esquerda. A bitola e a localização do centro de gravidade na vertical foram os fatores que mais afetaram a estabilidade do trator em tombamentos laterais. Já, a localização do centro de gravidade na longitudinal e a distância entre eixos afetaram mais a estabilidade do trator em tombamentos para trás. O trator deslizou os rodados do lado do tombamento ou perdeu a dirigibilidade dos pneus frontais com ângulos inferiores aos limites de estabilidade para tombamento.The objective of this work was to predict the loss of 2WD tractors stability. Simulations were done to analyze the dynamic behavior of an agricultural tractor working in different operation and surface conditions. Simulating different tractor positions on an inclined track until its side overturn, the tractor angle position of 60º presented the worst situation, what represented a tractor moving diagonally down on a left inclined track. Changing the tractor geometry and weight in the simulations, the vertical position of tractor central mass and its tread width were the parameters that most affected the tractor stability to side overturn. The longitudinal position of tractor central mass and the distance between its axes influenced on the tractor stability to rearward overturning. The tractor either slip the wheels at the side overturning or lost the front tire controlling at angles less than the overturning limits.

  1. Estimation of a stress field in the earth`s crust using drilling-induced tensile fractures observed at well WD-1 in the Kakkonda geothermal field; Kakkonda WD-1 sei de kansokusareta drilling induced tensile fracture ni yoru chikaku oryokuba no suitei

    Energy Technology Data Exchange (ETDEWEB)

    Okabe, T. [GERD Geothermal Energy Research and Development Co. Ltd., Tokyo (Japan); Hayashi, K. [Tohoku Univ., Sendai (Japan). Inst. of Fluid Science; Kato, O.; Doi, N.; Miyazaki, S. [Japan Metals and Chemicals Co. Ltd., Tokyo (Japan); Uchida, T. [New Energy and Industrial Technology Development Organization, Tokyo, (Japan)

    1997-05-27

    This paper describes estimation of a stress field in the earth`s crust in the Kakkonda geothermal field. Formation micro imager (FMI) logging known as a crack detecting logging was performed in the well WD-1. This FMI logging has made observation possible on cracks along well axis thought to indicate size and direction of the crust stress, and drilling-induced tensile fractures (DTF). It was verified that these DTFs are generated initially in an azimuth determined by in-situ stress (an angle up to the DTF as measured counterclockwise with due north as a starting point, expressed in {theta}) in the well`s circumferential direction. It was also confirmed that a large number of cracks incline at a certain angle to the well axis (an angle made by the well axis and the DTF, expressed in {gamma}). The DTF is a crack initially generated on well walls as a result of such tensile stresses as mud pressure and thermal stress acting on the well walls during well excavation, caused by the in-situ stress field. Measurement was made on the {theta} and {gamma} from the FMI logging result, and estimation was given on a three-dimensional stress field. Elucidating the three-dimensional crust stress field in a geothermal reservoir is important in making clear the formation mechanism thereof and the growth of water-permeable cracks. This method can be regarded as an effective method. 9 refs., 8 figs., 1 tab.

  2. Genome-wide identification, sequence characterization, and protein-protein interaction properties of DDB1 (damaged DNA binding protein-1)-binding WD40-repeat family members in Solanum lycopersicum.

    Science.gov (United States)

    Zhu, Yunye; Huang, Shengxiong; Miao, Min; Tang, Xiaofeng; Yue, Junyang; Wang, Wenjie; Liu, Yongsheng

    2015-06-01

    One hundred DDB1 (damaged DNA binding protein-1)-binding WD40-repeat domain (DWD) family genes were identified in the S. lycopersicum genome. The DWD genes encode proteins presumably functioning as the substrate recognition subunits of the cullin4-ring ubiquitin E3 ligase complex. These findings provide candidate genes and a research platform for further gene functionality and molecular breeding study. A subclass of DDB1 (damaged DNA binding protein-1)-binding WD40-repeat domain (DWD) family proteins has been demonstrated to function as the substrate recognition subunits of the cullin4-ring ubiquitin E3 ligase complex. However, little information is available about the cognate subfamily genes in tomato (S. lycopersicum). In this study, based on the recently released tomato genome sequences, 100 tomato genes encoding DWD proteins that potentially interact with DDB1 were identified and characterized, including analyses of the detailed annotations, chromosome locations and compositions of conserved amino acid domains. In addition, a phylogenetic tree, which comprises of three main groups, of the subfamily genes was constructed. The physical interaction between tomato DDB1 and 14 representative DWD proteins was determined by yeast two-hybrid and co-immunoprecipitation assays. The subcellular localization of these 14 representative DWD proteins was determined. Six of them were localized in both nucleus and cytoplasm, seven proteins exclusively in cytoplasm, and one protein either in nucleus and cytoplasm, or exclusively in cytoplasm. Comparative genomic analysis demonstrated that the expansion of these subfamily members in tomato predominantly resulted from two whole-genome triplication events in the evolution history.

  3. DIGITAL FLOOD INSURANCE RATE MAP DATABASE, FLEMING COUNTY, KY

    Data.gov (United States)

    Federal Emergency Management Agency, Department of Homeland Security — The Digital Flood Insurance Rate Map (DFIRM) Database depicts flood risk information and supporting data used to develop the risk data. The primary risk...

  4. Spatial Fleming-Viot models with selection and mutation

    CERN Document Server

    Dawson, Donald A

    2014-01-01

    This book constructs a rigorous framework for analysing selected phenomena in evolutionary theory of populations arising due to the combined effects of migration, selection and mutation in a spatial stochastic population model, namely the evolution towards fitter and fitter types through punctuated equilibria. The discussion is based on a number of new methods, in particular multiple scale analysis, nonlinear Markov processes and their entrance laws, atomic measure-valued evolutions and new forms of duality (for state-dependent mutation and multitype selection) which are used to prove ergodic theorems in this context and are applicable for many other questions and renormalization analysis for a variety of phenomena (stasis, punctuated equilibrium, failure of naive branching approximations, biodiversity) which occur due to the combination of rare mutation, mutation, resampling, migration and selection and make it necessary to mathematically bridge the gap (in the limit) between time and space scales.

  5. Capturing complexity in work disability research: application of system dynamics modeling methodology.

    Science.gov (United States)

    Jetha, Arif; Pransky, Glenn; Hettinger, Lawrence J

    2016-01-01

    Work disability (WD) is characterized by variable and occasionally undesirable outcomes. The underlying determinants of WD outcomes include patterns of dynamic relationships among health, personal, organizational and regulatory factors that have been challenging to characterize, and inadequately represented by contemporary WD models. System dynamics modeling (SDM) methodology applies a sociotechnical systems thinking lens to view WD systems as comprising a range of influential factors linked by feedback relationships. SDM can potentially overcome limitations in contemporary WD models by uncovering causal feedback relationships, and conceptualizing dynamic system behaviors. It employs a collaborative and stakeholder-based model building methodology to create a visual depiction of the system as a whole. SDM can also enable researchers to run dynamic simulations to provide evidence of anticipated or unanticipated outcomes that could result from policy and programmatic intervention. SDM may advance rehabilitation research by providing greater insights into the structure and dynamics of WD systems while helping to understand inherent complexity. Challenges related to data availability, determining validity, and the extensive time and technical skill requirements for model building may limit SDM's use in the field and should be considered. Contemporary work disability (WD) models provide limited insight into complexity associated with WD processes. System dynamics modeling (SDM) has the potential to capture complexity through a stakeholder-based approach that generates a simulation model consisting of multiple feedback loops. SDM may enable WD researchers and practitioners to understand the structure and behavior of the WD system as a whole, and inform development of improved strategies to manage straightforward and complex WD cases.

  6. Written Disclosure Treatment for Posttraumatic Stress Disorder in Substance Use Disorder Inpatients

    Science.gov (United States)

    Bragdon, Rodney A.; Lombardo, Thomas W.

    2012-01-01

    Comprehensive exposure-based approaches to treating posttraumatic stress disorder (PTSD) are effective, but they are time intensive and not widely used because of factors such as client noncompliance and fears of iatrogenic effects. Exposure by writing disclosure (WD), modeled after Pennebaker's brief stress-reduction procedure, may circumvent…

  7. Discovery of a Highly Potent, Cell-Permeable Macrocyclic Peptidomimetic (MM-589) Targeting the WD Repeat Domain 5 Protein (WDR5)–Mixed Lineage Leukemia (MLL) Protein–Protein Interaction

    Energy Technology Data Exchange (ETDEWEB)

    Karatas, Hacer; Li, Yangbing; Liu, Liu; Ji, Jiao; Lee, Shirley; Chen, Yong; Yang, Jiuling; Huang, Liyue; Bernard, Denzil; Xu, Jing; Townsend, Elizabeth C.; Cao, Fang; Ran, Xu; Li, Xiaoqin; Wen, Bo; Sun, Duxin; Stuckey, Jeanne A; Lei, Ming; Dou, Yali; Wang, Shaomeng (Michigan)

    2017-06-06

    We report herein the design, synthesis, and evaluation of macrocyclic peptidomimetics that bind to WD repeat domain 5 (WDR5) and block the WDR5–mixed lineage leukemia (MLL) protein–protein interaction. Compound 18 (MM-589) binds to WDR5 with an IC50 value of 0.90 nM (Ki value <1 nM) and inhibits the MLL H3K4 methyltransferase (HMT) activity with an IC50 value of 12.7 nM. Compound 18 potently and selectively inhibits cell growth in human leukemia cell lines harboring MLL translocations and is >40 times better than the previously reported compound MM-401. Cocrystal structures of 16 and 18 complexed with WDR5 provide structural basis for their high affinity binding to WDR5. Additionally, we have developed and optimized a new AlphaLISA-based MLL HMT functional assay to facilitate the functional evaluation of these designed compounds. Compound 18 represents the most potent inhibitor of the WDR5–MLL interaction reported to date, and further optimization of 18 may yield a new therapy for acute leukemia.

  8. Enhanced expression of WD repeat-containing protein 35 (WDR35 stimulated by domoic acid in rat hippocampus: involvement of reactive oxygen species generation and p38 mitogen-activated protein kinase activation

    Directory of Open Access Journals (Sweden)

    Tsunekawa Koji

    2013-01-01

    Full Text Available Abstract Background Domoic acid (DA is an excitatory amino acid analogue of kainic acid (KA that acts via activation of glutamate receptors to elicit a rapid and potent excitotoxic response, resulting in neuronal cell death. Recently, DA was shown to elicit reactive oxygen species (ROS production and induce apoptosis accompanied by activation of p38 mitogen-activated protein kinase (MAPK in vitro. We have reported that WDR35, a WD-repeat protein, may mediate apoptosis in several animal models. In the present study, we administered DA to rats intraperitoneally, then used liquid chromatography/ion trap tandem mass spectrometry (LC-MS/MS to identify and quantify DA in the brains of the rats and performed histological examinations of the hippocampus. We further investigated the potential involvement of glutamate receptors, ROS, p38 MAPK, and WDR35 in DA-induced toxicity in vivo. Results Our results showed that intraperitoneally administered DA was present in the brain and induced neurodegenerative changes including apoptosis in the CA1 region of the hippocampus. DA also increased the expression of WDR35 mRNA and protein in a dose- and time-dependent manner in the hippocampus. In experiments using glutamate receptor antagonists, the AMPA/KA receptor antagonist NBQX significantly attenuated the DA-induced increase in WDR35 protein expression, but the NMDA receptor antagonist MK-801 did not. In addition, the radical scavenger edaravone significantly attenuated the DA-induced increase in WDR35 protein expression. Furthermore, NBQX and edaravone significantly attenuated the DA-induced increase in p38 MAPK phosphorylation. Conclusion In summary, our results indicated that DA activated AMPA/KA receptors and induced ROS production and p38 MAPK phosphorylation, resulting in an increase in the expression of WDR35 in vivo.

  9. White dwarf stars: cosmic chronometers and dark matter probes

    Science.gov (United States)

    Salaris, Maurizio; Cassisi, Santi

    2018-04-01

    White dwarfs (WD) are the endpoint of the evolution of the large majority of stars formed in our galaxy. In the last two decades observations and theory have improved to a level that makes it possible to employ WD for determining ages of the stellar populations in the disk of the Milky Way and in the nearest star clusters, and constrain the existence and properties of dark matter (DM) candidates. This review is centred on WD models, age-dating, and DM identification methods, recent results and future developments of the field.

  10. Gravitational wave radiation from a double white dwarf system inside our galaxy: a potential method for seeking strange dwarfs

    Institute of Scientific and Technical Information of China (English)

    Zhan-Kui Lü; Shi-Wei Wu; Zhi-Cheng Zeng

    2009-01-01

    Like the investigation of double white dwarf (DWD) systems, strange dwarf (SD) - white dwarf (WD) system evolution in Laser Interferometer Space Antenna (LISA)'s absolute amplitude-frequency diagram is investigated. Since there is a strange quark core inside an SD, SDs' radii are significantly smaller than the value predicted by the standard WD model, which may strongly affect the gravitational wave (GW) signal in the mass-transferring phases of binary systems. We study how an SD-WD binary evolves across LISA's absolute amplitude-frequency diagram. In principle, we provide an executable way to detect SDs in the Galaxy's DWD systems by radically new windows offered by GW detectors.

  11. Quality-Related Monitoring and Grading of Granulated Products by Weibull-Distribution Modeling of Visual Images with Semi-Supervised Learning.

    Science.gov (United States)

    Liu, Jinping; Tang, Zhaohui; Xu, Pengfei; Liu, Wenzhong; Zhang, Jin; Zhu, Jianyong

    2016-06-29

    The topic of online product quality inspection (OPQI) with smart visual sensors is attracting increasing interest in both the academic and industrial communities on account of the natural connection between the visual appearance of products with their underlying qualities. Visual images captured from granulated products (GPs), e.g., cereal products, fabric textiles, are comprised of a large number of independent particles or stochastically stacking locally homogeneous fragments, whose analysis and understanding remains challenging. A method of image statistical modeling-based OPQI for GP quality grading and monitoring by a Weibull distribution(WD) model with a semi-supervised learning classifier is presented. WD-model parameters (WD-MPs) of GP images' spatial structures, obtained with omnidirectional Gaussian derivative filtering (OGDF), which were demonstrated theoretically to obey a specific WD model of integral form, were extracted as the visual features. Then, a co-training-style semi-supervised classifier algorithm, named COSC-Boosting, was exploited for semi-supervised GP quality grading, by integrating two independent classifiers with complementary nature in the face of scarce labeled samples. Effectiveness of the proposed OPQI method was verified and compared in the field of automated rice quality grading with commonly-used methods and showed superior performance, which lays a foundation for the quality control of GP on assembly lines.

  12. Application of MRIL-WD (Magnetic Resonance Imaging Logging While Drilling) for irreducible water saturation, total reservoir, free-fluid, bound-fluid porosity measurements and its value for the petrophysical analysis of RT/RM data from the Shah Deniz well

    Science.gov (United States)

    Amirov, Elnur

    2016-04-01

    Sperry-Sun (Sperry Drilling Services) is the leader in MWD/LWD reliability, has developed the industry's first LWD NMR/MRIL-WD (nuclear magnetic resonance) tool. The MRIL-WD (magnetic resonance imaging logging-while-drilling) service directly measures the T1 component of hydrogen in subsurface rock units while drilling to obtain total reservoir porosity and to dissect the observed total porosity into its respective components of free fluid and bound fluid porosity. These T1 data are used to secure accurate total, free-fluid, capillary-bound water, and clay-bound water porosity of the reservoir sections which can be drilled in the several Runs. Over the last decade, results from Magnetic Resonance Imaging logs (NMR) have added significant value to petrophysical analysis and understanding by providing total, free-fluid and bound-fluid porosities, combined with fluid typing capabilities. With MRIL-WD very valuable Real-Time or Recorded Memory data/information is now available during or shortly after the drilling operation (formation properties measurement can be taken right after a drill bit penetration), while trip in and trip out as well. A key point in utilizing MRIL in an LWD environment is motion-tolerant measurements. Recent MRIL-WD logging runs from the Shah Deniz wells located in the Khazarian-Caspian Sea of the Azerbaijan Republic helped to delineate and assess hydrocarbon bearing zones. Acquired results demonstrate how MRIL data can be acquired while-drilling and provide reliable/high quality measurements. Magnetic Resonance Imaging logs at some developments wells have become a cornerstone in formation evaluation and petrophysical understanding. By providing total, free-fluid, and bound-fluid porosities together with fluid typing, MRIL results have significantly added to the assessment of reservoirs. In order to reduce NPT (Non-Productive Time) and save the rig operations time, there is always the desire to obtain logging results as soon as possible

  13. Hydrogeologic investigation of the Maxey Flats radioactive waste burial site, Fleming County, Kentucky

    Science.gov (United States)

    Zehner, H.H.

    1983-01-01

    Burial trenches at the Maxey Flats radioactive waste burial site cover an area of about 20 acres, and are located on a plateau, about 300 to 400 feet above surrounding valleys. All waste is buried in the Nancy Member of the Borden Formation, and most is in the weathered shale (regolith) part of this member. Recharge to the rocks is probably by infiltration of rainfall through regolith at the top of the hill. At least two water tables are present: near the base of the regolith, at a depth of about 25 feet and; in the Ohio Shale, at a depth of about 300 feet. About 95 percent of ground-water discharge to streams is from colluvium on hillsides and valley alluvium. The remaining 5 percent is discharge from bedrock, of which about 0.5 percent is from rocks underlying the burial area. Waste radionuclides in the subsurface, other than tritium, were observed only in the regolith of the Nancy Member. Only tritium was observed with certainty in deeper rocks and in the adjacent valley alluvium. Other waste radionuclides were in streamwater and stream sediment, and may have been transported with overland runoff from the surface of the burial site. (USGS)

  14. Isolation and characterization of a novel Bacillus subtilis WD23 ...

    African Journals Online (AJOL)

    ONOS

    2010-08-23

    Aug 23, 2010 ... laccases are also widespread among bacteria (Alexandre and Zhulin, 2000). ... pollutant degradation, only a few novel bacterial strains displaying ... Soil samples were collected in sterilized plastic bags from a depth of 5 cm ...

  15. Mass-accreting white dwarfs and type Ia supernovae

    Science.gov (United States)

    Wang, Bo

    2018-05-01

    Type Ia supernovae (SNe Ia) play a prominent role in understanding the evolution of the Universe. They are thought to be thermonuclear explosions of mass-accreting carbon-oxygen white dwarfs (CO WDs) in binaries, although the mass donors of the accreting WDs are still not well determined. In this article, I review recent studies on mass-accreting WDs, including H- and He-accreting WDs. I also review currently most studied progenitor models of SNe Ia, i.e., the single-degenerate model (including the WD+MS channel, the WD+RG channel and the WD+He star channel), the double-degenerate model (including the violent merger scenario) and the sub-Chandrasekhar mass model. Recent progress on these progenitor models is discussed, including the initial parameter space for producing SNe Ia, the binary evolutionary paths to SNe Ia, the progenitor candidates for SNe Ia, the possible surviving companion stars of SNe Ia, some observational constraints, etc. Some other potential progenitor models of SNe Ia are also summarized, including the hybrid CONe WD model, the core-degenerate model, the double WD collision model, the spin-up/spin-down model and the model of WDs near black holes. To date, it seems that two or more progenitor models are needed to explain the observed diversity among SNe Ia.

  16. Intergroup Reconciliation between Flemings and Walloons: The Predictive Value of Cognitive Style, Authoritarian Ideology, and Intergroup Emotions

    Directory of Open Access Journals (Sweden)

    Jasper Van Assche

    2017-11-01

    Full Text Available Testifying to the gap in fundamental research on positive intergroup outcomes, we investigated reconciliation attitudes in a non-violent intergroup context (i.e., the linguistic conflict in Belgium. By incorporating both important predictors of negative outgroup attitudes (i.e., individual differences in rigid cognitive styles and authoritarian ideologies, and important predictors of reconciliation (i.e., intergroup emotions, we aimed to contribute to a more comprehensive theoretical framework for the analysis of intergroup relations. We recruited one Flemish ('N' = 310 and one Walloon ('N' = 365 undergraduate students sample to test the proposed model. Structural equation analyses with maximum likelihood estimation were conducted using the Lavaan package. In both samples, similar patterns were found. More in particular, the need for cognitive closure appeared to be the basic predictor of right-wing attitudes (i.e., right-wing authoritarianism and social dominance orientation and essentialist thinking, which were then associated with less outgroup empathy and trust, and more outgroup anger. Furthermore, outgroup trust and empathy were positively related to reconciliation. Interestingly, some differences between the Flemish and Walloon sample were found, such as the direct effects of need for closure and social dominance orientation in the first sample, and the non-significant effects of essentialism in the latter sample. Considering the ongoing public and political debate about the linguistic conflict in Belgium, these findings shed a new light on how individual differences relate to specific outgroup emotions, and how these are associated with important intergroup outcomes in the face of intergroup conflict.

  17. Spectroscopic ellipsometry characterization of amorphous and crystalline TiO2 thin films grown by atomic layer deposition at different temperatures

    Science.gov (United States)

    Saha, D.; Ajimsha, R. S.; Rajiv, K.; Mukherjee, C.; Gupta, M.; Misra, P.; Kukreja, L. M.

    2014-10-01

    TiO2 thin films of widely different structural and morphological characteristics were grown on Si (1 0 0) substrates using Atomic Layer Deposition (ALD) by varying the substrate temperature (Ts) in a wide range (50 °C ≤ Ts ≤ 400 °C). Spectroscopic ellipsometry (SE) measurements were carried out to investigate the effect of growth temperature on the optical properties of the films. Measured SE data were analyzed by considering double layer optical model for the sample together with the single oscillator Tauc-Lorentz dispersion relation. Surface roughness was taken into consideration due to the columnar growths of grains in crystalline films. The refractive index was found to be increased from amorphous (Ts ≤ 150 °C) to the nanocrystalline films (2500 < Ts ≤ 400 °C). The pronounced surface roughening for the large-grained anatase film obtained at the amorphous to crystalline phase transformation temperature of 200 °C, impeded SE measurement. The dispersions of refractive indices below the interband absorption edge were found to be strongly correlated with the single oscillator Wemple-DiDomenico (WD) model. The increase in dispersion energy parameter in WD model from disordered amorphous to the more ordered nanocrystalline films was found to be associated with the increase in the film density and coordination number.

  18. White dwarf stars and the age of the Galactic disk

    Science.gov (United States)

    Wood, M. A.

    1990-01-01

    The history of the Galaxy is written in its oldest stars, the white dwarf (WD) stars. Significant limits can be placed on both the Galactic age and star formation history. A wide range of input WD model sequences is used to derive the current limits to the age estimates suggested by fitting to the observed falloff in the WD luminosity function. The results suggest that the star formation rate over the history of the Galaxy has been relatively constant, and that the disk age lies in the range 6-12 billion years, depending upon the assumed structure of WD stars, and in particular on the core composition and surface helium layer mass. Using plausible mixed C/O core input models, the estimates for the disk age range from 8-10.5 Gyr, i.e.,sustantially younger than most age estimates for the halo globular clusters. After speculating on the significance of the results, expected observational and theoretical refinements which will further enhance the reliability of the method are discussed.

  19. The double helium-white dwarf channel for the formation of AM CVn binaries

    Science.gov (United States)

    Zhang, Xian-Fei; Liu, Jin-Zhong; Jeffery, C. Simon; Hall, Philip D.; Bi, Shao-Lan

    2018-01-01

    Most close double helium white dwarfs will merge within a Hubble time due to orbital decay by gravitational wave radiation. However, a significant fraction with low mass ratios will survive for a long time as a consequence of stable mass transfer. Such stable mass transfer between two helium white dwarfs (HeWDs) provides one channel for the production of AM CVn binary stars. In previous calculations of double HeWD progenitors, the accreting HeWD was treated as a point mass. We have computed the evolution of 16 double HeWD models in order to investigate the consequences of treating the evolution of both components in detail. We find that the boundary between binaries having stable and unstable mass transfer is slightly modified by this approach. By comparing with observed periods and mass ratios, we redetermine masses of eight known AM CVn stars by our double HeWDs channel, i.e. HM Cnc, AM CVn, V406 Hya, J0926, J1240, GP Com, Gaia14aae and V396 Hya.We propose that central spikes in the triple-peaked emission spectra of J1240, GP Com and V396 Hya and the surface abundance ratios of N/C/O in GP Com can be explained by the stable double HeWD channel. The mass estimates derived from our calculations are used to discuss the predicted gravitational wave signal in the context of the Laser Interferometer Space Antenna (LISA) project.

  20. Electronic differential control of 2WD electric vehicle considering steering stability

    Science.gov (United States)

    Hua, Yiding; Jiang, Haobin; Geng, Guoqing

    2017-03-01

    Aiming at the steering wheel differential steering control technology of rear wheel independent driving electric wheel, considering the assisting effect of electronic differential control on vehicle steering, based on the high speed steering characteristic of electric wheel car, the electronic differential speed of auxiliary wheel steering is also studied. A yaw moment control strategy is applied to the vehicle at high speed. Based on the vehicle stability reference value, yaw rate is used to design the fuzzy controller to distribute the driving wheel torque. The simulation results show that the basic electronic differential speed function is realized based on the yaw moment control strategy, while the vehicle stability control is improved and the driving safety is enhanced. On the other hand, the torque control strategy can also assist steering of vehicle.

  1. Exogenous lipoid pneumonia due to inhalation of spray lubricant (WD-40 lung).

    Science.gov (United States)

    Glynn, K P; Gale, N A

    1990-05-01

    An elderly woman developed lipoid pneumonia due to the inhalation of mist from a spray lubricant that she was using as a liniment for sore back and neck muscles. This unusual practice is reported to be common among older people bothered by rheumatism. The potential for this complication to occur in other patients leads us to present this case report.

  2. The contributions of W.D. Stevenson to the development of neurosurgery in Atlantic Canada.

    Science.gov (United States)

    Mukhida, K; Mendez, I

    1999-08-01

    The establishment of a neurosurgical department in Halifax in January 1948 marked the beginnings of the first dedicated neurosurgical service in Atlantic Canada. The development of neurosurgery in Halifax occurred in a receptive place and time. The Victoria General Hospital, the region's largest tertiary care centre, and the Dalhousie University Faculty of Medicine were in a period of growth associated with medical specialization and departmentalization, changes inspired in part by the Flexner Report of 1910. Atlantic Canadians during this period were increasingly looking to specialists for their medical care. Although this social environment encouraged the establishment of surgical specialty services, the development of neurosurgery in Halifax, as in other parts of Canada, was closely associated with the efforts of individual neurosurgeons, such as William D. Stevenson. After training with Kenneth G. McKenzie in Toronto, Stevenson was recruited to Halifax and established the first neurosurgical department in Atlantic Canada. From the outset and over his twenty-six years as Department Head at the Victoria General Hospital and Dalhousie University, Stevenson worked to maintain the department's commitment to clinical practice, medical education, and research. Although Stevenson single-handedly ran the service for several years after its inception, by the time of his retirement in 1974 the neurosurgery department had grown to include five attending staff surgeons who performed over two thousand procedures each year. This paper highlights the importance of Stevenson's contributions to the development of neurosurgery in Atlantic Canada within the context of the social and medical environment of the region.

  3. Innovative design and fabrication of safety enclosure for WD-XRF spectrometer

    International Nuclear Information System (INIS)

    Anwar, M.K.; Khan, A.M.; Bangash, M.A.

    2011-01-01

    A wavelength dispersive X-ray fluorescence spectrometer, Pan Analytical (Philips) model. Magix was purchased in 2002 for chemical analysis of nuclear related materials. The required analytical work could not be done in open atmosphere due to active nature of the samples. The Glove box adapted models of these instruments are banned for our country. Therefore modification and Glove box (GB) adaptation was required. It was very innovative and time consuming assignment as only sample handling part of the instrument had to be placed inside GB, leaving rest of the instrument available for later repair/maintenance work. Different options were considered for adaptation point of view, keeping in mind the isolation and negative pressure inside the GB. One of such option was finalized which involved placing a tray in between the spectrometer and top shield plate. An intricate and complex geometrical shaped tray was designed which extended outward in the shape of a glove box. In this way originality of the instrument was maintained as well as the required objectives were achieved. (author)

  4. Re-appraisal of the P, T-odd interaction constant Wd in YbF ...

    Indian Academy of Sciences (India)

    *Corresponding author. E-mail: ... structure providing a high level of reliability and accuracy in accounting for both relativistic and correlation .... molecular electric field at the un-paired electron to be (the contribution of all the paired electrons ...

  5. Re-appraisal of the P, T-odd interaction constant Wd in YbF ...

    Indian Academy of Sciences (India)

    ... Lecture Workshops · Refresher Courses · Symposia · Live Streaming. Home; Journals; Pramana – Journal of Physics; Volume 73; Issue 3. Re-appraisal of the , -odd interaction constant d in YbF: Relativistic configuration interaction approach. Malaya K Nayak Rajat K Chaudhuri. Volume 73 Issue 3 September 2009 ...

  6. Spectroscopic ellipsometry characterization of amorphous and crystalline TiO{sub 2} thin films grown by atomic layer deposition at different temperatures

    Energy Technology Data Exchange (ETDEWEB)

    Saha, D., E-mail: babaisps@rrcat.gov.in [Laser Materials Processing Division, Raja Ramanna Centre for Advanced Technology, Indore 452013 (India); Ajimsha, R.S. [Laser Materials Processing Division, Raja Ramanna Centre for Advanced Technology, Indore 452013 (India); Rajiv, K.; Mukherjee, C. [Mechanical and Optical Support Section, Raja Ramanna Centre for Advanced Technology, Indore 452013 (India); Gupta, M. [UGC-DAE Consortium, Indore Centre, Khandwa Road, Indore 452017 (India); Misra, P.; Kukreja, L.M. [Laser Materials Processing Division, Raja Ramanna Centre for Advanced Technology, Indore 452013 (India)

    2014-10-01

    Highlights: • Refractive index was found to be increased from amorphous to the nanocrystalline films. • Refractive index was found to be inversely proportional with growth per cycle. • Large-grained anatase films showed lower refractive indices than the amorphous films. • Roughness was taken into consideration due to the columnar growths of crystalline films. - Abstract: TiO{sub 2} thin films of widely different structural and morphological characteristics were grown on Si (1 0 0) substrates using Atomic Layer Deposition (ALD) by varying the substrate temperature (T{sub s}) in a wide range (50 °C ≤ T{sub s} ≤ 400 °C). Spectroscopic ellipsometry (SE) measurements were carried out to investigate the effect of growth temperature on the optical properties of the films. Measured SE data were analyzed by considering double layer optical model for the sample together with the single oscillator Tauc-Lorentz dispersion relation. Surface roughness was taken into consideration due to the columnar growths of grains in crystalline films. The refractive index was found to be increased from amorphous (T{sub s} ≤ 150 °C) to the nanocrystalline films (250{sup 0} < T{sub s} ≤ 400 °C). The pronounced surface roughening for the large-grained anatase film obtained at the amorphous to crystalline phase transformation temperature of 200 °C, impeded SE measurement. The dispersions of refractive indices below the interband absorption edge were found to be strongly correlated with the single oscillator Wemple–DiDomenico (WD) model. The increase in dispersion energy parameter in WD model from disordered amorphous to the more ordered nanocrystalline films was found to be associated with the increase in the film density and coordination number.

  7. THE EFFECT OF A SUPEROUTBURST ON THE WHITE DWARF AND DISK OF VW HYDRI AS OBSERVED WITH FUSE

    International Nuclear Information System (INIS)

    Long, Knox S.; Gaensicke, Boris T.; Knigge, Christian; Froning, Cynthia S.; Monard, Berto

    2009-01-01

    We have used Far Ultraviolet Spectroscopic Explorer (FUSE) to obtain a series of 13 observations of the nearby dwarf nova VW Hyi that cover the period from the end of a superoutburst through the following normal outburst of the system. Here, we present the quiescent spectra taken after each outburst event. The spectra obtained during quiescence contain at least three components. The dominant component over most of the FUSE wavelength range is the white dwarf (WD), which cools following the superoutburst. The amount of cooling is dependent on the WD models utilized. For log g of 8.0, the temperature drops from 24,000 K just after the outburst to 20,000 K just before the normal outburst. For this model, and for a distance of 65 pc, the radius of the WD is approximately 8 x 10 8 cm and v sin(i) is ∼420 km s -1 . The fact that the derived radius is smaller than expected for a WD with log g = 8 suggests a higher gravity WD or that VW Hyi is somewhat further than its canonical distance of 65 pc. Either is possible given the current uncertainty (±20 pc) in the distance to VW Hyi. Earlier suggestions that the WD photosphere show evidence of CNO processed material are confirmed, but our analysis also highlights the fact that significant issues remain in terms of analyzing the spectra of WDs in such unusual physical situations. The second component is relatively featureless and shows substantial modulation on the orbital (and just after outburst, the superhump) period. The second component is most likely associated with the hot spot where material from the secondary encounters the disk, rather than emission from the boundary layer region between the inner disk and WD. This second component fades about 10 days after the superoutburst. There is also a third component, clearly visible in terms of broad emission lines of C III λ977, N III λ991, and a combination of Lyβ and O VI λλ1032, 1038, which appears to be accompanied by a flat continuum. The strength of the

  8. THE ELM SURVEY. I. A COMPLETE SAMPLE OF EXTREMELY LOW-MASS WHITE DWARFS

    International Nuclear Information System (INIS)

    Brown, Warren R.; Kilic, Mukremin; Kenyon, Scott J.; Prieto, Carlos Allende

    2010-01-01

    We analyze radial velocity observations of the 12 extremely low-mass (ELM), with ≤0.25 M sun , white dwarfs (WDs) in the MMT Hypervelocity Star Survey. Eleven of the twelve WDs are binaries with orbital periods shorter than 14 hr; the one non-variable WD is possibly a pole-on system among our non-kinematically selected targets. Our sample is unique: it is complete in a well-defined range of apparent magnitude and color. The orbital mass functions imply that the unseen companions are most likely other WDs, although neutron star companions cannot be excluded. Six of the eleven systems with orbital solutions will merge within a Hubble time due to the loss of angular momentum through gravitational wave radiation. The quickest merger is J0923+3028, a g = 15.7 ELM WD binary with a 1.08 hr orbital period and a ≤130 Myr merger time. The chance of a supernova Ia event among our ELM WDs is only 1%-7%, however. Three binary systems (J0755+4906, J1233+1602, and J2119-0018) have extreme mass ratios and will most likely form stable mass-transfer AM CVn systems. Two of these objects, SDSS J1233+1602 and J2119-0018, are the lowest surface gravity WDs ever found; both show Ca II absorption likely from accretion of circumbinary material. We predict that at least one of our WDs is an eclipsing detached double WD system, important for constraining helium core WD models.

  9. What Powers the 2006 Outburst of the Symbiotic Star BF Cygni?

    Directory of Open Access Journals (Sweden)

    A. Skopal

    2015-02-01

    Full Text Available BF Cygni is a classical symbiotic binary. Its optical light curve occasionally shows outbursts of the Z And-type, whose nature is not well understood. During the 2006 August, BF Cyg underwent the recent outburst, and continues its active phase to the present. The aim of this contribution is to determine the fundamental parameters of the hot component in the binary during the active phase. For this purpose we used a high- and low-resolution optical spectroscopy and the multicolour UBV RCIC photometry. Our photometric monitoring revealed that a high level of the star’s brightness lasts for unusually long time of > 7 years. A sharp violet-shifted absorption component and broad emission wings in the Hα profile developed during the whole active phase. From 2009, our spectra revealed a bipolar ejection from the white dwarf (WD. Modelling the spectral energy distribution (SED of the low-resolution spectra showed simultaneous presence of a warm (< 10 000 K disk-like pseudophotosphere and a strong nebular component of radiation (emission measure of ~1061 cm−3. The luminosity of the hot active object was estimated to > 5−8×103 Lʘ. Such high luminosity, sustained for the time of years, can be understood as a result of an enhanced transient accretion rate throughout a large disk, leading also to formation of collimated ejection from the WD.

  10. On the evolutionary status and pulsations of the recently discovered blue large-amplitude pulsators (BLAPs)

    Science.gov (United States)

    Romero, Alejandra D.; Córsico, A. H.; Althaus, L. G.; Pelisoli, I.; Kepler, S. O.

    2018-06-01

    The blue large-amplitude pulsators (BLAPs) constitute a new class of pulsating stars. They are hot stars with effective temperatures of ˜30 000 K and surface gravities of log g ˜ 4.9, that pulsate with periods in the range 20-40 min. Until now, their origin and evolutionary state, as well as the nature of their pulsations, were not been unveiled. In this paper, we propose that the BLAPs are the hot counterpart of the already known pulsating pre-extremely low mass (pre-ELM) white dwarf (WD) stars, that are He-core low-mass stars resulting from interacting binary evolution. Using fully evolutionary sequences, we show that the BLAPs are well represented by pre-ELM WD models with high effective temperature and stellar masses ˜0.34 M⊙. From the analysis of their pulsational properties, we find that the observed variabilities can be explained by high-order non-radial g-mode pulsations or, in the case of the shortest periods, also by low-order radial modes, including the fundamental radial mode. The theoretical modes with periods in the observed range are unstable due to the κ mechanism associated with the Z-bump in the opacity at log T ˜ 5.25.

  11. Head-on collisions of binary white dwarf-neutron stars: Simulations in full general relativity

    International Nuclear Information System (INIS)

    Paschalidis, Vasileios; Etienne, Zachariah; Liu, Yuk Tung; Shapiro, Stuart L.

    2011-01-01

    We simulate head-on collisions from rest at large separation of binary white dwarf-neutron stars (WDNSs) in full general relativity. Our study serves as a prelude to our analysis of the circular binary WDNS problem. We focus on compact binaries whose total mass exceeds the maximum mass that a cold-degenerate star can support, and our goal is to determine the fate of such systems. A fully general relativistic hydrodynamic computation of a realistic WDNS head-on collision is prohibitive due to the large range of dynamical time scales and length scales involved. For this reason, we construct an equation of state (EOS) which captures the main physical features of neutron stars (NSs) while, at the same time, scales down the size of white dwarfs (WDs). We call these scaled-down WD models 'pseudo-WDs (pWDs)'. Using pWDs, we can study these systems via a sequence of simulations where the size of the pWD gradually increases toward the realistic case. We perform two sets of simulations; One set studies the effects of the NS mass on the final outcome, when the pWD is kept fixed. The other set studies the effect of the pWD compaction on the final outcome, when the pWD mass and the NS are kept fixed. All simulations show that after the collision, 14%-18% of the initial total rest mass escapes to infinity. All remnant masses still exceed the maximum rest mass that our cold EOS can support (1.92M · ), but no case leads to prompt collapse to a black hole. This outcome arises because the final configurations are hot. All cases settle into spherical, quasiequilibrium configurations consisting of a cold NS core surrounded by a hot mantle, resembling Thorne-Zytkow objects. Extrapolating our results to realistic WD compactions, we predict that the likely outcome of a head-on collision of a realistic, massive WDNS system will be the formation of a quasiequilibrium Thorne-Zytkow-like object.

  12. Cloning of a cDNA encoding a novel human nuclear phosphoprotein belonging to the WD-40 family

    DEFF Research Database (Denmark)

    Honoré, B; Leffers, H; Madsen, Peder

    1994-01-01

    We have cloned and expressed in vaccinia virus a cDNA encoding an ubiquitous 501-amino-acid (aa) phosphoprotein that corresponds to protein IEF SSP 9502 (79,400 Da, pI 4.5) in the master 2-D-gel keratinocyte protein database [Celis et al., Electrophoresis 14 (1993) 1091-1198]. The deduced aa...

  13. Modeling of interaction between cytochrome c and the WD domains of Apaf-1: bifurcated salt bridges underlying apoptosome assembly.

    Science.gov (United States)

    Shalaeva, Daria N; Dibrova, Daria V; Galperin, Michael Y; Mulkidjanian, Armen Y

    2015-05-27

    Binding of cytochrome c, released from the damaged mitochondria, to the apoptotic protease activating factor 1 (Apaf-1) is a key event in the apoptotic signaling cascade. The binding triggers a major domain rearrangement in Apaf-1, which leads to oligomerization of Apaf-1/cytochrome c complexes into an apoptosome. Despite the availability of crystal structures of cytochrome c and Apaf-1 and cryo-electron microscopy models of the entire apoptosome, the binding mode of cytochrome c to Apaf-1, as well as the nature of the amino acid residues of Apaf-1 involved remain obscure. We investigated the interaction between cytochrome c and Apaf-1 by combining several modeling approaches. We have applied protein-protein docking and energy minimization, evaluated the resulting models of the Apaf-1/cytochrome c complex, and carried out a further analysis by means of molecular dynamics simulations. We ended up with a single model structure where all the lysine residues of cytochrome c that are known as functionally-relevant were involved in forming salt bridges with acidic residues of Apaf-1. This model has revealed three distinctive bifurcated salt bridges, each involving a single lysine residue of cytochrome c and two neighboring acidic resides of Apaf-1. Salt bridge-forming amino acids of Apaf-1 showed a clear evolutionary pattern within Metazoa, with pairs of acidic residues of Apaf-1, involved in bifurcated salt bridges, reaching their highest numbers in the sequences of vertebrates, in which the cytochrome c-mediated mechanism of apoptosome formation seems to be typical. The reported model of an Apaf-1/cytochrome c complex provides insights in the nature of protein-protein interactions which are hard to observe in crystallographic or electron microscopy studies. Bifurcated salt bridges can be expected to be stronger than simple salt bridges, and their formation might promote the conformational change of Apaf-1, leading to the formation of an apoptosome. Combination of structural and sequence analyses provides hints on the evolution of the cytochrome c-mediated apoptosis.

  14. A WD40-repeat protein controls proanthocyanidin and phytomelanin pigmentation in the seed coats of the Japanese morning glory.

    Science.gov (United States)

    Park, Kyeung-Il; Hoshino, Atsushi

    2012-03-15

    The protein complex composed of the transcriptional regulators containing R2R3-MYB domains, bHLH domains, and WDR in plants controls various epidermal traits, including anthocyanin and proanthocyanidin pigmentation, trichome and root hair formation, and vacuolar pH. In the Japanese morning glory (Ipomoea nil), InMYB1 having R2R3-MYB domains and InWDR1 containing WDR were shown to regulate anthocyanin pigmentation in flowers, and InWDR1 was reported to control dark-brown pigmentation and trichome formation on seed coats. Here, we report that the seed pigments of I. nil mainly comprise proanthocyanidins and phytomelanins and that these pigments are drastically reduced in the ivory seed coats of an InWDR1 mutant. In addition, a transgenic plant of the InWDR1 mutant carrying the active InWDR1 gene produced dark-brown seeds, further confirming that InWDR1 regulates seed pigmentation. Early steps in anthocyanin and proanthocyanidin biosynthetic pathways are thought to be common. In the InWDR1 mutant, none of the structural genes for anthocyanin biosynthesis that showed reduced expression in the white flowers were down-regulated in the ivory seeds, which suggests that InWDR1 may activate different sets of the structural genes for anthocyanin biosynthesis in flowers and proanthocyanidin production in seeds. As in the flowers, however, we noticed that the expression of InbHLH2 encoding a bHLH regulator was down-regulated in the seeds of the InWDR1 mutant. We discuss the implications of these results with respect to the proanthocyanidin biosynthesis in the seed coats. Copyright © 2011 Elsevier GmbH. All rights reserved.

  15. Nonaffiliated Users in Academic Libraries: Using W.D. Ross's Ethical Pluralism to Make Sense of the Tough Questions

    Science.gov (United States)

    Lenker, Mark; Kocevar-Weidinger, Elizabeth

    2010-01-01

    Though the academic library's primary mission is to serve the students, faculty, and staff of its parent institution, would-be users not officially associated with the institution frequently call upon the library to provide services and/or resources. Requests by these nonaffiliated users (sometimes called community users) pose a moral quandary for…

  16. Molecular mapping of qBK1 WD , a major QTL for bakanae disease resistance in rice

    OpenAIRE

    Lee, Sais-Beul; Hur, Yeon-Jae; Cho, Jun-Hyeon; Lee, Jong-Hee; Kim, Tae-Heon; Cho, Soo-Min; Song, You-Chun; Seo, Young-Su; Lee, Jungkwan; Kim, Tae-sung; Park, Yong-Jin; Oh, Myung-Kyu; Park, Dong-Soo

    2018-01-01

    Background Bakanae or foot rot disease is a prominent disease of rice caused by Gibberella fujikuroi. This disease may infect rice plants from the pre-emergence stage to the mature stage. In recent years, raising rice seedlings in seed boxes for mechanical transplanting has increased the incidence of many seedling diseases; only a few rice varieties have been reported to exhibit resistance to bakanae disease. In this study, we attempted to identify quantitative trait loci (QTLs) conferring ba...

  17. Evolving R Coronae Borealis Stars with MESA

    Science.gov (United States)

    Clayton, Geoffrey C.; Lauer, Amber; Chatzopoulos, Emmanouil; Frank, Juhan

    2018-01-01

    R Coronae Borealis (RCB) stars form a small class of cool, carbon-rich supergiants that have almost no hydrogen. They undergo extreme, irregular declines in brightness of up to 8 magnitudes due to the formation of thick clouds of carbon dust. Two scenarios have been proposed for the origin of an RCB star: the merger of a CO/He white dwarf (WD) binary and a final helium-shell flash. We are using a combination of 3D hydrodynamics codes and the 1D MESA (Modules for Experiments in Stellar Astrophysics) stellar evolution code including nucleosynthesis to construct post-merger spherical models based on realistic merger progenitor models and on our hydrodynamical simulations, and then following the evolution into the region of the HR diagram where RCB stars are located. We are investigating nucleosynthesis in the dynamically accreting material of CO/He WD mergers which may provide a suitable environment for significant production of 18O and the very low 16O/18O values observed.Our MESA modeling consists of two steps: first mimicking the WD merger event using two different techniques, (a) by choosing a very high mass accretion rate with appropriate abundances and (b) by applying "stellar engineering" to an initial CO WD model to account for the newly merged material by applying an entropy adjusting procedure. Second, we follow the post-merger evolution using a large nuclear reaction network including the effects of convective and rotational instabilities to the mixing of material in order to match the observed RCB abundances. MESA follows the evolution of the merger product as it expands and cools to become an RCB star. We then examine the surface abundances and compare them to the observed RCB abundances. We also investigate how long fusion continues in the He shell near the core and how this processed material is mixed up to the surface of the star. We then model the later evolution of RCB stars to determine their likely lifetimes and endpoints when they have returned to

  18. Effect of deposition temperature on the structural and optical properties of CdSe QDs thin films deposited by CBD method

    International Nuclear Information System (INIS)

    Laatar, F.; Harizi, A.; Smida, A.; Hassen, M.; Ezzaouia, H.

    2016-01-01

    Highlights: • Synthesis of CdSe QDs with L-Cysteine capping agent for applications in nanodevices. • The films of CdSe QDs present uniform and good dispersive particles at the surface. • Effect of bath temperature on the structural and optical properties of CdSe QDs thin films. • Investigation of the optical constants and dispersion parameters of CdSe QDs thin films. - Abstract: Cadmium selenide quantum dots (CdSe QDs) thin films were deposited onto glass substrates by a chemical bath deposition (CBD) method at different temperatures from an aqueous solution containing L-Cysteine (L-Cys) as capping agent. The evolution of the surface morphology and elemental composition of the CdSe films were studied by AFM, SEM, and EDX analyses. Structural and optical properties of CdSe thin films were investigated by XRD, UV–vis and PL spectroscopy. The dispersion behavior of the refractive index is described using the single oscillator Wemple-DiDomenico (W-D) model, and the physical dispersion parameters are calculated as a function of deposition temperature. The dispersive optical parameters such as average oscillator energy (E_o), dispersion energy (E_d), and static refractive index (n_o) were found to vary with the deposition temperature. Besides, the electrical free carrier susceptibility (χ_e) and the carrier concentration of the effective mass ratio (N/m*) were evaluated according to the Spitzer-Fan model.

  19. Effect of deposition temperature on the structural and optical properties of CdSe QDs thin films deposited by CBD method

    Energy Technology Data Exchange (ETDEWEB)

    Laatar, F., E-mail: fakher8laatar@gmail.com [Photovoltaic Laboratory, Centre for Research and Technology Energy, Tourist Route Soliman, BP 95, 2050 Hammam-Lif (Tunisia); Harizi, A. [Photovoltaic and Semiconductor Materials Laboratory, Engineering Industrial Department, ENIT, Tunis El Manar University, BP 37, Le Belvédère, 1002 Tunis (Tunisia); Smida, A. [Photovoltaic Laboratory, Centre for Research and Technology Energy, Tourist Route Soliman, BP 95, 2050 Hammam-Lif (Tunisia); Hassen, M. [Photovoltaic Laboratory, Centre for Research and Technology Energy, Tourist Route Soliman, BP 95, 2050 Hammam-Lif (Tunisia); Higher Institute of Applied Science and Technology of Sousse, City Taffala (Ibn Khaldun), 4003 Sousse (Tunisia); Ezzaouia, H. [Photovoltaic Laboratory, Centre for Research and Technology Energy, Tourist Route Soliman, BP 95, 2050 Hammam-Lif (Tunisia)

    2016-06-15

    Highlights: • Synthesis of CdSe QDs with L-Cysteine capping agent for applications in nanodevices. • The films of CdSe QDs present uniform and good dispersive particles at the surface. • Effect of bath temperature on the structural and optical properties of CdSe QDs thin films. • Investigation of the optical constants and dispersion parameters of CdSe QDs thin films. - Abstract: Cadmium selenide quantum dots (CdSe QDs) thin films were deposited onto glass substrates by a chemical bath deposition (CBD) method at different temperatures from an aqueous solution containing L-Cysteine (L-Cys) as capping agent. The evolution of the surface morphology and elemental composition of the CdSe films were studied by AFM, SEM, and EDX analyses. Structural and optical properties of CdSe thin films were investigated by XRD, UV–vis and PL spectroscopy. The dispersion behavior of the refractive index is described using the single oscillator Wemple-DiDomenico (W-D) model, and the physical dispersion parameters are calculated as a function of deposition temperature. The dispersive optical parameters such as average oscillator energy (E{sub o}), dispersion energy (E{sub d}), and static refractive index (n{sub o}) were found to vary with the deposition temperature. Besides, the electrical free carrier susceptibility (χ{sub e}) and the carrier concentration of the effective mass ratio (N/m*) were evaluated according to the Spitzer-Fan model.

  20. WD0837+185: THE FORMATION AND EVOLUTION OF AN EXTREME MASS-RATIO WHITE-DWARF-BROWN-DWARF BINARY IN PRAESEPE

    International Nuclear Information System (INIS)

    Casewell, S. L.; Burleigh, M. R.; Wynn, G. A.; Alexander, R. D.; Lawrie, K. A.; Jameson, R. F.; Napiwotzki, R.; Dobbie, P. D.; Hodgkin, S. T.

    2012-01-01

    There is a striking and unexplained dearth of brown dwarf companions in close orbits ( ☉ (B9). The high mass of the white dwarf means the substellar companion must have been engulfed by the B star's envelope while it was on the late asymptotic giant branch (AGB). Hence, the initial separation of the system was ∼2 AU, with common envelope evolution reducing the separation to its current value. The initial and final orbital separations allow us to constrain the combination of the common envelope efficiency (α) and binding energy parameters (λ) for the AGB star to αλ ∼ 3. We examine the various formation scenarios and conclude that the substellar object was most likely captured by the white dwarf progenitor early in the life of the cluster, rather than forming in situ.

  1. Design, Construction and Evaluation of an Interchangeable Digital System to Measure Slip and Ground Speed of Existing 2WD Tractors in Iran

    Directory of Open Access Journals (Sweden)

    M Khosravi

    2012-05-01

    Full Text Available The majority of existing tractors in Iran are not equipped with any tools to measure and display slip and ground speed. This is mainly due to the lack of national standards for measuring tools and instruments of tractors. In current research, an interchangeable system for two wheel drive tractors has been designed. Furthermore, it has been assessed after construction. To measure actual and theoretical ground speed, four rotary encoders for sensing the rotation of front and rear wheels have been utilized. Slip and ground speed were measured by means of software which has been developed in an ATmega16PU microprocessor. The measured slip and speed are digitally displayed on tractor dashboard. To evaluate the performance of the system, the measured values of ground speed and slip were compared with their calculated values obtained from conventional method. The Micro-controller has been programmed in such a way that the effect of front wheel sliding on slip is eliminated. In all evaluation conditions (in field and on asphalt, the maximum difference between system measurements for slip and speed and calculated slip and speed via conventional method was 2.4% and 0.2 km h-1, respectively. With slight alteration this system can be fitted on any kind of exiting two wheel drive tractors in the country.

  2. Once in a blue moon: detection of “bluing” during debris transits in the white dwarf WD 1145+017

    Czech Academy of Sciences Publication Activity Database

    Hallakoun, N.; Xu, S.; Maoz, D.; Marsh, T. R.; Ivanov, V.D.; Dhillon, V. S.; Boursot, P.; Parsons, S. G.; Kerry, P.; Sharma, S.; Su, K.; Rengaswamy, S.; Pravec, Petr; Kušnirák, Peter; Kučáková, H.; Armstrong, J. D.; Arnold, C.; Gerard, N.; Vanzi, L.

    2017-01-01

    Roč. 469, č. 3 (2017), s. 3213-3224 ISSN 0035-8711 Institutional support: RVO:67985815 Keywords : planetary-atmospheres * scattering * white dwarfs Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 4.961, year: 2016

  3. TheoSSA - Model WD Spectra on Demand: The Impact of Ne, Na, Mg, and Iron-group Elements on the Balmer Lines

    Science.gov (United States)

    Reindl, N.; Rauch, T.

    2015-06-01

    The registered German Astrophysical Virtual Observatory (GAVO) service TheoSSA provides easy access to synthetic stellar spectra. This GAVO database contains already ten thousands of these, which were calculated with different chemical compositions of the elements H to Ni. In addition to the database, it is possible to calculate individual spectra for hot, compact stars based on the Tübingen NLTE Model-Atmosphere Package (TMAP) via the TMAW service. The TMAW models were, in the pilot phase, restricted to the elements H, He, C, N, and O. Now, TMAW is extended to additionally consider opacities from Ne, Na, and Mg. Soon, TMAW will also be able to include the opacities from the so-called iron-group elements (Ca - Ni). We describe the improvements and show the impact of Ne, Na, Mg, and iron-group elements on the Balmer lines.

  4. Functional analyses of lupulin gland-specific regulatory factors from WD40, bHLH and Myb families of hop (Humulus lupulus L.) show formation of crucial complexes activating chs_H1

    Czech Academy of Sciences Publication Activity Database

    Matoušek, Jaroslav; Patzak, J.; Kocábek, Tomáš; Füssy, Zoltán; Stehlík, Jan; Orctová, Lidmila; Duraisamy, Ganesh Selvaraj

    2011-01-01

    Roč. 64, č. 6 (2011), s. 151-155 ISSN 1613-2041 R&D Projects: GA ČR GA521/08/0740; GA MZe QH81052 Institutional research plan: CEZ:AV0Z50510513 Keywords : lupulin metabolome * Humulus lupulus L. * protein complexes * transcription factors Subject RIV: EB - Genetics ; Molecular Biology

  5. Determination of the inorganic components in the Brazilian medicinal plants from 'in natura' and capsule forms, using X-ray fluorescence techniques (WD and ED systems). Quantitative inorganic profile definition

    International Nuclear Information System (INIS)

    Ferreira, Manuel Octavio Marques

    2004-01-01

    The Na, Mg, P, S, CI, K, Ca, Mn, Fe, Ni, Cu, Zn, Rb and Sr concentrations in the Stryphnodendron barbatiman (Barbatimao), Malva officinalis (Malva), Salvia officinalis (Salvia), Ginkgo folium (Ginkgo biloba), Echinodorus macrophylius (Chapeu de couro), Paulina cupana (Guarana), Valeriana officinalis (Valeriana), Cordia salicifolia (Porangaba), Calendula officinalis (Calendula), Solidago microglossa (Arnica), Arnica montana (Arnica) and Schinus molle (Aroeira) species were concentrations. The specimens were sampled 'in natura' (leaves, flowers, barks and seeds) and capsule (powder) forms from different commercial labels. The elemental determination was outlined by wavelength dispersive (WDXRF) and energy dispersive (EDXRF) X-ray fluorescence techniques using, respectively, linear regression and fundamental parameter methods. The repeatability and accuracy of the methods were evaluated using the certified reference material NIST 1547 - 'Peach Leaves'. Statistical treatments, such as Chauvenet and Cochrane, ANOVA and Z-score tests, were applied. A quantitative inorganic profile was obtained for each specie from 'in natura' and capsule forms. Different inorganic compositions were observed in the different parts (leaves, flowers, barks and seeds) of the Schinus molle (Aroeira), Arnica montana (Arnica), Calendula officinalis (Calendula) and Echinodorus macrophylius (Chapeu de couro) species. (author)

  6. Influenza pandemics and avian flu

    OpenAIRE

    Fleming, Douglas

    2005-01-01

    Douglas Fleming is general practitioner in a large suburban practice in Birmingham. In this article he seeks to clarify clinical issues relating to potential pandemics of influenza, including avian influenza

  7. One-pot Reductive Amination of Carbonyl Compounds with NaBH4 ...

    Indian Academy of Sciences (India)

    Chemistry Department, Faculty of Science, Shahid Chamran University of Ahvaz, Ahvaz, Iran ... amination of aldehydes and ketones.1 Reductive ami- nation is a great and ..... sive Organic Synthesis B M Trost and I Fleming (Eds.) Vol.

  8. FDA Response to the Fukushima Dai-ichi Nuclear Power Facility Incident

    Science.gov (United States)

    ... ThyroShield Solution (65 mg/mL), Fleming & Company Pharmaceuticals, Fenton, Mo. http://www.thyroshield.com When administered at ... legal requirements under the Federal Food, Drug, and Cosmetic Act (FFDCA). If a drug is approved and ...

  9. Massenet "Thaisi" näeb otseülekandes kinolinal / Toomas Kuter

    Index Scriptorium Estoniae

    Kuter, Toomas, 1965-

    2008-01-01

    Forum Cinemas toob oktoobrist maini Tallinnas Coca-Cola Plazas ja Tartus Ekraanis publikuni New Yorgi Metropolitan Opera etenduste HD-otseülekanded, 20. dets. kantakse üle Jules Massenet' ooper "Thais", peaosas Renee Fleming

  10. African Zoology - Vol 47, No 1 (2012)

    African Journals Online (AJOL)

    Lygodactylus capensis) (Gekkonidae) · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Patricia A. Fleming, Philip W. Bateman, 55-59. http://dx.doi.org/10.3377/004.047.0110 ...

  11. Application of meshless EFG method in fluid flow problems

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    viewpoint of computer time but require less time in the preparation of data. ..... Krongauz Y, Organ D, Fleming M, Krysl P 1996 Meshless methods: an overview and ... Dolbow J, Belytschko T 1998 An introduction to programming the meshless ...

  12. Integrated corridor management initiative : demonstration phase evaluation, San Diego institutional and organizational analysis test plan.

    Science.gov (United States)

    2003-03-01

    In March of 2001, the Federal Highway Administration (FHWA), in conjunction with the Federal Transit Administration (FTA), engaged Gannett Fleming, Inc., to develop the first ever Tunnel Management System to benefit both highway and rail transit tunn...

  13. Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1996-01-01

    Uuest heliplaadist "Schmidt. Sinfonie Nr. 1 E-Dur; Strauss. Vier sinfonische Zwischenspiele aus Intermezzo. Detroit Symphony Orchestra, Neeme Järvi. Chandos/Koch CD 9357 (WD: 68'20") DDD (WD:114'36")

  14. Wilson Disease

    Science.gov (United States)

    ... and inappropriate behavior, depression accompanied by suicidal thoughts, neurosis, or psychosis. WD is diagnosed with tests that ... and inappropriate behavior, depression accompanied by suicidal thoughts, neurosis, or psychosis. WD is diagnosed with tests that ...

  15. Protein (Cyanobacteria): 479132094 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 30 696747:230 ... WD-40 repeat protein Arthrospira platensis NIES-39 MVIASGGASLFNLATGEAVWEIDCPALGGAVSADGRLLALRSNKDIYLWDLSTGQLLRQLTGHTST...VNSVRFSRRGQTLASGSGDNTVRLWDVATGRELRQLTGHTSTVNSVRFSRRGQTLASGSGDNTVRLWDVATGRELRQLTGHTSTVYSVSFSRRGQTLASGSDDGVVRLWRVGF

  16. Diet-induced obesity, energy metabolism and gut microbiota in C57BL/6J mice fed Western diets based on lean seafood or lean meat mixtures.

    Science.gov (United States)

    Holm, Jacob Bak; Rønnevik, Alexander; Tastesen, Hanne Sørup; Fjære, Even; Fauske, Kristin Røen; Liisberg, Ulrike; Madsen, Lise; Kristiansen, Karsten; Liaset, Bjørn

    2016-05-01

    High protein diets may protect against diet-induced obesity, but little is known regarding the effects of different protein sources consumed at standard levels. We investigated how a mixture of lean seafood or lean meat in a Western background diet modulated diet-induced obesity, energy metabolism and gut microbiota. Male C57BL/6J mice fed a Western diet (WD) containing a mixture of lean seafood (seafood WD) for 12weeks accumulated less fat mass than mice fed a WD containing a mixture of lean meat (meat WD). Meat WD-fed mice exhibited increased fasting blood glucose, impaired glucose clearance, elevated fasting plasma insulin and increased plasma and liver lipid levels. We observed no first choice preference for either of the WDs, but over time, mice fed the seafood WD consumed less energy than mice fed the meat WD. Mice fed the seafood WD exhibited higher spontaneous locomotor activity and a lower respiratory exchange ratio (RER) than mice fed the meat WD. Thus, higher activity together with the decreased energy intake contributed to the different phenotypes observed in mice fed the seafood WD compared to mice fed the meat WD. Comparison of the gut microbiomes of mice fed the two WDs revealed significant differences in the relative abundance of operational taxonomic units (OTUs) belonging to the orders Bacteroidales and Clostridiales, with genes involved in metabolism of aromatic amino acids exhibiting higher relative abundance in the microbiomes of mice fed the seafood WD. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. Development of the Wave Energy Converter

    DEFF Research Database (Denmark)

    Kofoed, Jens Peter; Frigaard, Peter; Sørensen, Hans Christian

    2000-01-01

    The development of the wave energy converter Wave Dragon (WD) is presented. The WD is based on the overtopping principle. Initially a description of the WD is given. Then the development over time in terms of the various research and development projects working with the concept is described. Thi...

  18. Single Degenerate Models for Type Ia Supernovae: Progenitor's Evolution and Nucleosynthesis Yields

    Science.gov (United States)

    Nomoto, Ken'ichi; Leung, Shing-Chi

    2018-06-01

    We review how the single degenerate models for Type Ia supernovae (SNe Ia) works. In the binary star system of a white dwarf (WD) and its non-degenerate companion star, the WD accretes either hydrogen-rich matter or helium and undergoes hydrogen and helium shell-burning. We summarize how the stability and non-linear behavior of such shell-burning depend on the accretion rate and the WD mass and how the WD blows strong wind. We identify the following evolutionary routes for the accreting WD to trigger a thermonuclear explosion. Typically, the accretion rate is quite high in the early stage and gradually decreases as a result of mass transfer. With decreasing rate, the WD evolves as follows: (1) At a rapid accretion phase, the WD increase its mass by stable H burning and blows a strong wind to keep its moderate radius. The wind is strong enough to strip a part of the companion star's envelope to control the accretion rate and forms circumstellar matter (CSM). If the WD explodes within CSM, it is observed as an "SN Ia-CSM". (X-rays emitted by the WD are absorbed by CSM.) (2) If the WD continues to accrete at a lower rate, the wind stops and an SN Ia is triggered under steady-stable H shell-burning, which is observed as a super-soft X-ray source: "SN Ia-SSXS". (3) If the accretion continues at a still lower rate, H shell-burning becomes unstable and many flashes recur. The WD undergoes recurrent nova (RN) whose mass ejection is smaller than the accreted matter. Then the WD evolves to an "SN Ia-RN". (4) If the companion is a He star (or a He WD), the accretion of He can trigger He and C double detonations at the sub-Chandrasekhar mass or the WD grows to the Chandrasekhar mass while producing a He-wind: "SN Ia-He CSM". (5) If the accreting WD rotates quite rapidly, the WD mass can exceed the Chandrasekhar mass of the spherical WD, which delays the trigger of an SN Ia. After angular momentum is lost from the WD, the (super-Chandra) WD contracts to become a delayed SN Ia

  19. A COMPREHENSIVE PROGENITOR MODEL FOR SNe Ia

    International Nuclear Information System (INIS)

    Meng, X.; Yang, W.

    2010-01-01

    Although the nature of the progenitor of Type Ia supernovae (SNe Ia) is still unclear, the single-degenerate (SD) channel for the progenitor is currently accepted, in which a carbon-oxygen white dwarf (CO WD) accretes hydrogen-rich material from its companion, increases its mass to the Chandrasekhar mass limit, and then explodes as an SN Ia. The companion may be a main sequence or a slightly evolved star (WD + MS), or a red giant star (WD + RG). Incorporating the effect of mass stripping and accretion-disk instability on the evolution of the WD binary, we carried out binary stellar evolution calculations for more than 1600 close WD binaries. As a result, the initial parameter spaces for SNe Ia are presented in an orbital period-secondary mass (log P i , M i 2 ) plane. We confirmed that in a WD + MS system, the initial companion leading to SNe Ia may have mass from 1 M sun to 5 M sun . The initial WD mass for SNe Ia from WD + MS channel is as low as 0.565 M sun , while the lowest WD mass from the WD + RG channel is 1.0 M sun . Adopting the above results, we studied the birth rate of SNe Ia via a binary population synthesis approach. We found that the Galactic SNe Ia birth rate from SD model is (2.55-2.9) x 10 -3 yr -1 (including WD + He star channel), which is slightly smaller than that from observation. If a single starburst is assumed, the distribution of the delay time of SNe Ia from the SD model may be a weak bimodality, where WD + He channel contributes to SNe Ia with delay time shorter than 10 8 yr and WD + RG channel to those with age longer than 6 Gyr.

  20. Surface ozone over southern Africa; synthesis of monitoring results during the cross border air pollution impact assessment project

    CSIR Research Space (South Africa)

    Zunckel, M

    2004-11-01

    Full Text Available -261-2509. E-mail address: mzunckel@csir.co.za (M. Zunckel). result in damage to vegetation (Emberson et al., 2001), and be harmful to materials (Lee et al., 1996; Massey, 1999). In southern Africa anthropogenic sources of NOx occur throughout the region... (Fleming and van der Merwe,2002) and also result from soil emission (Levine et al., 1996). VOC emissions occur throughout the region from vegetation (Greenberget al., 2003; Harleyet al., 2003), and from anthropogenic activities (Fleming and van der Merwe...

  1. Replacing Fish Oil with Vegetable Oils in Salmon Feed Increases Hepatic Lipid Accumulation and Reduces Insulin Sensitivity in Mice

    DEFF Research Database (Denmark)

    Midtbø, Lisa Kolden

    Background: Due to a growing global aquaculture production, fish oil (FO) and fish meal (FM) are partly replaced with vegetable ingredients in aqua feed for Atlantic salmon. These replacements in the feed lead to an altered fatty acid composition in the salmon fillet. We aimed to investigate how...... these changes affects obesity development and insulin sensitivity in mice eating the salmon. In addition, we wanted to investigate how the background diet affects the antiobesity effect of FO. Results: Western diets (WDs) were produced containing salmon fed either FO (WD-FO), or with partly replacement (80......%) of FO with different vegetable oils (VOs); rape seed oil (WDRO), olive oil (WD-OO) or soybean oil (WD-SO). These diets were given to C57BL/6J mice, and mice had higher hepatic lipid accumulation and lower insulin sensitivity when given WD-SO compared with WD-FO. Mice given WD-SO had higher hepatic...

  2. Determination of the inorganic components in the Brazilian medicinal plants from 'in natura' and capsule forms, using X-ray fluorescence techniques (WD and ED systems). Quantitative inorganic profile definition; Determinacao de componentes inorganicos em plantas medicinais, comercializadas em formas de po (capsulas) e 'in natura', utilizando a tecnica de fluorescencia de raios X por dispersao de comprimento de onda (WDXRF) e por dispersao de energia (EDXRF). Definicao de perfis inorganicos quantitativos

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Manuel Octavio Marques

    2004-07-01

    The Na, Mg, P, S, CI, K, Ca, Mn, Fe, Ni, Cu, Zn, Rb and Sr concentrations in the Stryphnodendron barbatiman (Barbatimao), Malva officinalis (Malva), Salvia officinalis (Salvia), Ginkgo folium (Ginkgo biloba), Echinodorus macrophylius (Chapeu de couro), Paulina cupana (Guarana), Valeriana officinalis (Valeriana), Cordia salicifolia (Porangaba), Calendula officinalis (Calendula), Solidago microglossa (Arnica), Arnica montana (Arnica) and Schinus molle (Aroeira) species were concentrations. The specimens were sampled 'in natura' (leaves, flowers, barks and seeds) and capsule (powder) forms from different commercial labels. The elemental determination was outlined by wavelength dispersive (WDXRF) and energy dispersive (EDXRF) X-ray fluorescence techniques using, respectively, linear regression and fundamental parameter methods. The repeatability and accuracy of the methods were evaluated using the certified reference material NIST 1547 - 'Peach Leaves'. Statistical treatments, such as Chauvenet and Cochrane, ANOVA and Z-score tests, were applied. A quantitative inorganic profile was obtained for each specie from 'in natura' and capsule forms. Different inorganic compositions were observed in the different parts (leaves, flowers, barks and seeds) of the Schinus molle (Aroeira), Arnica montana (Arnica), Calendula officinalis (Calendula) and Echinodorus macrophylius (Chapeu de couro) species. (author)

  3. Determination of the inorganic components in the Brazilian medicinal plants from 'in natura' and capsule forms, using X-ray fluorescence techniques (WD and ED systems). Quantitative inorganic profile definition; Determinacao de componentes inorganicos em plantas medicinais, comercializadas em formas de po (capsulas) e 'in natura', utilizando a tecnica de fluorescencia de raios X por dispersao de comprimento de onda (WDXRF) e por dispersao de energia (EDXRF). Definicao de perfis inorganicos quantitativos

    Energy Technology Data Exchange (ETDEWEB)

    Ferreira, Manuel Octavio Marques

    2004-07-01

    The Na, Mg, P, S, CI, K, Ca, Mn, Fe, Ni, Cu, Zn, Rb and Sr concentrations in the Stryphnodendron barbatiman (Barbatimao), Malva officinalis (Malva), Salvia officinalis (Salvia), Ginkgo folium (Ginkgo biloba), Echinodorus macrophylius (Chapeu de couro), Paulina cupana (Guarana), Valeriana officinalis (Valeriana), Cordia salicifolia (Porangaba), Calendula officinalis (Calendula), Solidago microglossa (Arnica), Arnica montana (Arnica) and Schinus molle (Aroeira) species were concentrations. The specimens were sampled 'in natura' (leaves, flowers, barks and seeds) and capsule (powder) forms from different commercial labels. The elemental determination was outlined by wavelength dispersive (WDXRF) and energy dispersive (EDXRF) X-ray fluorescence techniques using, respectively, linear regression and fundamental parameter methods. The repeatability and accuracy of the methods were evaluated using the certified reference material NIST 1547 - 'Peach Leaves'. Statistical treatments, such as Chauvenet and Cochrane, ANOVA and Z-score tests, were applied. A quantitative inorganic profile was obtained for each specie from 'in natura' and capsule forms. Different inorganic compositions were observed in the different parts (leaves, flowers, barks and seeds) of the Schinus molle (Aroeira), Arnica montana (Arnica), Calendula officinalis (Calendula) and Echinodorus macrophylius (Chapeu de couro) species. (author)

  4. Neutrino burst of white dwarf being absorbed by a primordial black hole

    CERN Document Server

    Tikhomirov, V V

    2003-01-01

    Primordial black holes (PBHS) of masses M>=5x10 sup 4 g are able to absorb white dwarfs (WD), giving rise to formation of black holes of WD masses. The WD absorption is accomplained by up to 10 sup 5 sup 2 erg neutrino bursts which can be readily detected by modern neutrino detectors. We calculate time characteristics of such a burst in this paper. (authors)

  5. Water deficit mechanisms in perennial shrubs Cerasus humilis leaves revealed by physiological and proteomic analyses.

    Science.gov (United States)

    Yin, Zepeng; Ren, Jing; Zhou, Lijuan; Sun, Lina; Wang, Jiewan; Liu, Yulong; Song, Xingshun

    2016-01-01

    Drought (Water deficit, WD) poses a serious threat to extensively economic losses of trees throughout the world. Chinese dwarf cherry ( Cerasus humilis ) is a good perennial plant for studying the physiological and sophisticated molecular network under WD. The aim of this study is to identify the effect of WD on C. humilis through physiological and global proteomics analysis and improve understanding of the WD resistance of plants. Currently, physiological parameters were applied to investigate C. humilis response to WD. Moreover, we used two-dimensional gel electrophoresis (2DE) to identify differentially expressed proteins in C. humilis leaves subjected to WD (24 d). Furthermore, we also examined the correlation between protein and transcript levels. Several physiological parameters, including relative water content and Pn were reduced by WD. In addition, the malondialdehyde (MDA), relative electrolyte leakage (REL), total soluble sugar, and proline were increased in WD-treated C. humilis . Comparative proteomic analysis revealed 46 protein spots (representing 43 unique proteins) differentially expressed in C. humilis leaves under WD. These proteins were mainly involved in photosynthesis, ROS scavenging, carbohydrate metabolism, transcription, protein synthesis, protein processing, and nitrogen and amino acid metabolisms, respectively. WD promoted the CO 2 assimilation by increase light reaction and Calvin cycle, leading to the reprogramming of carbon metabolism. Moreover, the accumulation of osmolytes (i.e., proline and total soluble sugar) and enhancement of ascorbate-glutathione cycle and glutathione peroxidase/glutathione s-transferase pathway in leaves could minimize oxidative damage of membrane and other molecules under WD. Importantly, the regulation role of carbohydrate metabolisms (e. g. glycolysis, pentose phosphate pathways, and TCA) was enhanced. These findings provide key candidate proteins for genetic improvement of perennial plants metabolism under

  6. Data of evolutionary structure change: 1DKEC-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DKEC-2ZLWD 1DKE 2ZLW C D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...dex> 2ZLW D 2ZLWD WD

  7. Data of evolutionary structure change: 1DXUC-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DXUC-2ZLWD 1DXU 2ZLW C D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...dex> 2ZLW D 2ZLWD WD

  8. Data of evolutionary structure change: 1NQPA-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1NQPA-2ZLWD 1NQP 2ZLW A D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...dex> 2ZLW D 2ZLWD WD

  9. Data of evolutionary structure change: 1BABA-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1BABA-2ZLWD 1BAB 2ZLW A D MELSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...dex> 2ZLW D 2ZLWD WD

  10. Dream Recall Frequencies and Dream Content in Wilson's Disease with and without REM Sleep Behaviour Disorder: A Neurooneirologic Study.

    Science.gov (United States)

    Tribl, Gotthard G; Trindade, Mateus C; Schredl, Michael; Pires, Joana; Reinhard, Iris; Bittencourt, Thais; Lorenzi-Filho, Geraldo; Alves, Rosana Cardoso; de Andrade, Daniel Ciampi; Fonoff, Erich T; Bor-Seng-Shu, Edson; Machado, Alexandre A; Teixeira, Manoel J; Barbosa, Egberto R

    2016-01-01

    Objective. Violent dream content and its acting out during rapid eye movement sleep are considered distinctive for rapid eye movement sleep behaviour disorder (RBD). This study reports first quantitative data on dreaming in a cohort of patients with treated Wilson's disease (WD) and in patients with WD with RBD. Methods. Retrospective questionnaires on different dimensions of dreaming and a prospective two-week home dream diary with self-rating of emotions and blinded, categorical rating of content by an external judge. Results. WD patients showed a significantly lower dream word count and very few other differences in dream characteristics compared to age- and sex-matched healthy controls. Compared to WD patients without RBD, patients with WD and RBD reported significantly higher nightmare frequencies and more dreams with violent or aggressive content retrospectively; their prospectively collected dream reports contained significantly more negative emotions and aggression. Conclusions. The reduction in dream length might reflect specific cognitive deficits in WD. The lack of differences regarding dream content might be explained by the established successful WD treatment. RBD in WD had a strong impact on dreaming. In accordance with the current definition of RBD, violent, aggressive dream content seems to be a characteristic of RBD also in WD.

  11. Dream Recall Frequencies and Dream Content in Wilson’s Disease with and without REM Sleep Behaviour Disorder: A Neurooneirologic Study

    Directory of Open Access Journals (Sweden)

    Gotthard G. Tribl

    2016-01-01

    Full Text Available Objective. Violent dream content and its acting out during rapid eye movement sleep are considered distinctive for rapid eye movement sleep behaviour disorder (RBD. This study reports first quantitative data on dreaming in a cohort of patients with treated Wilson’s disease (WD and in patients with WD with RBD. Methods. Retrospective questionnaires on different dimensions of dreaming and a prospective two-week home dream diary with self-rating of emotions and blinded, categorical rating of content by an external judge. Results. WD patients showed a significantly lower dream word count and very few other differences in dream characteristics compared to age- and sex-matched healthy controls. Compared to WD patients without RBD, patients with WD and RBD reported significantly higher nightmare frequencies and more dreams with violent or aggressive content retrospectively; their prospectively collected dream reports contained significantly more negative emotions and aggression. Conclusions. The reduction in dream length might reflect specific cognitive deficits in WD. The lack of differences regarding dream content might be explained by the established successful WD treatment. RBD in WD had a strong impact on dreaming. In accordance with the current definition of RBD, violent, aggressive dream content seems to be a characteristic of RBD also in WD.

  12. Screening for Wilson disease in acute liver failure: a comparison of currently available diagnostic tests

    DEFF Research Database (Denmark)

    Korman, J.D.; Volenberg, I.; Balko, J.

    2008-01-01

    a diagnostic sensitivity of 21% and specificity of 84% while, by nephelometry, a sensitivity of 56% and specificity of 63%. Serum copper levels exceeded 200 microg/dL in all ALF-WD patients measured (13/16), but were also elevated in non-WD ALF. An alkaline phosphatase (AP) to total bilirubin (TB) ratio ... and specificity of 100%. CONCLUSION: Conventional WD testing utilizing serum ceruloplasmin and/or serum copper levels are less sensitive and specific in identifying patients with ALF-WD than other available tests. More readily available laboratory tests including alkaline phosphatase, bilirubin and serum...

  13. Unilateral rubral tremors in Wilson′s disease treated with dimercaprol

    Directory of Open Access Journals (Sweden)

    Rahul T Chakor

    2015-01-01

    Full Text Available Tremors are reported as the most frequent neurological manifestation of Wilson′s disease (WD in some series. Postural tremors, rest tremors, action tremors and wing-beating (rubral tremors are the different types of tremors seen in WD. We report a patient of WD with unilateral rubral tremors refractory to 1-year therapy with Penicillamine and anti-tremor medications. The tremors decreased considerably after adding chelation therapy with dimercaprol. Combination of Penicillamine and dimercaprol is an effective decoppering measure in rubral tremors of WD.

  14. Wave-equation dispersion inversion of surface waves recorded on irregular topography

    KAUST Repository

    Li, Jing

    2017-08-17

    Significant topographic variations will strongly influence the amplitudes and phases of propagating surface waves. Such effects should be taken into account, otherwise the S-velocity model inverted from the Rayleigh dispersion curves will contain significant inaccuracies. We now show that the recently developed wave-equation dispersion inversion (WD) method naturally takes into account the effects of topography to give accurate S-velocity tomograms. Application of topographic WD to demonstrates that WD can accurately invert dispersion curves from seismic data recorded over variable topography. We also apply this method to field data recorded on the crest of mountainous terrain and find with higher resolution than the standard WD tomogram.

  15. Wave-equation dispersion inversion of surface waves recorded on irregular topography

    KAUST Repository

    Li, Jing; Schuster, Gerard T.; Lin, Fan-Chi; Alam, Amir

    2017-01-01

    Significant topographic variations will strongly influence the amplitudes and phases of propagating surface waves. Such effects should be taken into account, otherwise the S-velocity model inverted from the Rayleigh dispersion curves will contain significant inaccuracies. We now show that the recently developed wave-equation dispersion inversion (WD) method naturally takes into account the effects of topography to give accurate S-velocity tomograms. Application of topographic WD to demonstrates that WD can accurately invert dispersion curves from seismic data recorded over variable topography. We also apply this method to field data recorded on the crest of mountainous terrain and find with higher resolution than the standard WD tomogram.

  16. Neural stem cells for disease modeling of Wolman disease and evaluation of therapeutics.

    Science.gov (United States)

    Aguisanda, Francis; Yeh, Charles D; Chen, Catherine Z; Li, Rong; Beers, Jeanette; Zou, Jizhong; Thorne, Natasha; Zheng, Wei

    2017-06-28

    Wolman disease (WD) is a rare lysosomal storage disorder that is caused by mutations in the LIPA gene encoding lysosomal acid lipase (LAL). Deficiency in LAL function causes accumulation of cholesteryl esters and triglycerides in lysosomes. Fatality usually occurs within the first year of life. While an enzyme replacement therapy has recently become available, there is currently no small-molecule drug treatment for WD. We have generated induced pluripotent stem cells (iPSCs) from two WD patient dermal fibroblast lines and subsequently differentiated them into neural stem cells (NSCs). The WD NSCs exhibited the hallmark disease phenotypes of neutral lipid accumulation, severely deficient LAL activity, and increased LysoTracker dye staining. Enzyme replacement treatment dramatically reduced the WD phenotype in these cells. In addition, δ-tocopherol (DT) and hydroxypropyl-beta-cyclodextrin (HPBCD) significantly reduced lysosomal size in WD NSCs, and an enhanced effect was observed in DT/HPBCD combination therapy. The results demonstrate that these WD NSCs are valid cell-based disease models with characteristic disease phenotypes that can be used to evaluate drug efficacy and screen compounds. DT and HPBCD both reduce LysoTracker dye staining in WD cells. The cells may be used to further dissect the pathology of WD, evaluate compound efficacy, and serve as a platform for high-throughput drug screening to identify new compounds for therapeutic development.

  17. Remediation of the Maxey Flats Site

    International Nuclear Information System (INIS)

    1990-01-01

    This report describes issues associated with remedial action of Maxey Flats, a low-level radioactive waste disposal site from 1963-1977, located in Fleming County, Kentucky. Present remedial action alternatives being considered are discussed along with emergency plans, ground water monitoring plans, and budgets

  18. 77 FR 536 - Qualification of Drivers; Exemption Applications; Diabetes Mellitus

    Science.gov (United States)

    2012-01-05

    ... INFORMATION: Electronic Access You may see all the comments online through the Federal Document Management..., except Federal holidays. Privacy Act: Anyone may search the electronic form of all comments received into...), Gerald R. Curran (PA), Shawn K. Fleming (PA), Daniel C. French (VA), Garry W. Garrison (WI), Gregory L...

  19. Michael Faraday· Discovery of Electromagnetic Induction -R-ES ...

    Indian Academy of Sciences (India)

    by his friend R Phillips to write a historical account of the work on electricity and .... due to a magnetic field, H - this is called Fleming's left hand rule. Current. Fooce / ... But as a chemist this new mechanical picture of molecules and currents ...

  20. the place of quinolones in the treatment of enteric fevers in the 21st ...

    African Journals Online (AJOL)

    Dr. Jombo

    occlusive abdominal crisis was made, to rule out other causes of acute abdomen. Patient was ... and Fleming, 1996). In this case, the mother denied noticing hands and feet syndrome in infancy however; the patient admitted to having pains in the bones of the limbs but this was overshadowed by the abdominal crisis.

  1. Evidence for the complicated Fermi surface in 2H- and 4H-NbSe2

    Indian Academy of Sciences (India)

    Both single crystals show anisotropic ρ/ρ0, which are described by Kohler's rule, two-band model and magnetic breakdown model. In the present ... rule is derived only for the isotropic model of closed Fermi surface, it describes the .... [13] Witney D A, Fleming R M and Coleman R V 1976 Solid State. Commun. 18 399.

  2. Zadetõje za svjatoje / Nargiz Assadova

    Index Scriptorium Estoniae

    Assadova, Nargiz

    2006-01-01

    Islamimaailm nõuab lääneriikidelt vabandusi Taani ajalehes prohvet Muhamedi kohta ilmunud karikatuuride pärast, konflikti haaratud maailma poliitilised jõud püüavad olukorrast maksimaalselt kasu lõigata. Vt. samas: Ajalehe Jyllands-Posten kultuuriosakonna toimetaja Fleming Rose selgitused, miks karikatuurid ilmusid

  3. Teaching New Keynesian Open Economy Macroeconomics at the Intermediate Level

    Science.gov (United States)

    Bofinger, Peter; Mayer, Eric; Wollmershauser, Timo

    2009-01-01

    For the open economy, the workhorse model in intermediate textbooks still is the Mundell-Fleming model, which basically extends the investment and savings, liquidity preference and money supply (IS-LM) model to open economy problems. The authors present a simple New Keynesian model of the open economy that introduces open economy considerations…

  4. Intoxication of sheep exposed to ozark milkweed (Asclepias viridis Walter).

    Science.gov (United States)

    Smith, R A; Scharko, P; Bolin, D; Hong, C B

    2000-12-01

    Some 20 sheep died 1 at a time on a farm in Fleming County, KY, in late July of 1999 after consumption of Asclepias viridis Walter. Major histological lesions were mild multifocal nonsuppurative myocarditis. Gross pathology revealed wet and heavy lungs. Many affected animals had a hunched appearance, and marked posterior paresis was also observed.

  5. Uterjannõi mir, uterjannoje stshastje / Lauri Vahtre

    Index Scriptorium Estoniae

    Vahtre, Lauri, 1960-

    2006-01-01

    Maailma populaarsemaid mängufilme "Tuulest viidud" ("Gone with the Wind") Margaret Mitchelli romaani järgi : režissöörid Victor Fleming, George Cucor, Sam Wood : Ameerika Ühendriigid 1939. Algteose loomisest ja selle filmiks saamisest

  6. On the 75th anniversary of Prontosil

    DEFF Research Database (Denmark)

    Wainwright, M.; Kristiansen, J. E.

    2011-01-01

    While much of the credit for the beginning of the antibiotic era is given to Fleming the first clinically available antibacterial agents were the sulphonamides discovered as by-products of the azo dye Prontosil This was given its general release i e outside Germany in 1935 and rapidly became...

  7. 76 FR 54196 - Membership of the Departmental Performance Review Board

    Science.gov (United States)

    2011-08-31

    .... Chief Financial Officer and Assistant Secretary for Administration, William J. Fleming, Director for... Assistant Secretary for Regional Affairs, Sandra Walters, Chief Financial Officer and Director of..., Robert J. Byrd, Chief Financial Officer/Chief Administrative Officer, NWS, Joseph, F. Klimavicz, Chief...

  8. 75 FR 62354 - Approval and Promulgation of Implementation Plans; Tennessee: Approval of Section 110(a)(1...

    Science.gov (United States)

    2010-10-08

    ... comprehensive inventories of volatile organic compounds (VOC) and nitrogen oxide (NO X ) emissions from area, point, on-road mobile, non-road mobile, and aircraft, locomotive, and commercial marine (ALM) sources... organic compounds. Authority: 42 U.S.C. 7401 et seq. Dated: September 28, 2010. Gwendolyn Keyes Fleming...

  9. Spiritual Well-Being Scale Ethnic Differences between Caucasians and African-Americans: Follow Up Analyses.

    Science.gov (United States)

    Miller, Geri; Gridley, Betty; Fleming, Willie

    This follow up study is in response to Miller, Fleming, and Brown-Andersons (1998) study of ethnic differences between Caucasians and African-Americans where the authors suggested that the Spiritual Well-Being (SWB) Scale may need to be interpreted differently depending on ethnicity. In this study, confirmatory factor analyses were conducted for…

  10. SSC San Diego Command History Calendar Year 2007

    Science.gov (United States)

    2008-03-01

    Camargo , Sylvia Salazar, Karen Manley-Guerrero, Dina Demuth, Clay Oeholke, Gannon Graue, Dee Johnson, Erwin Mier, Hoa Nguyen. Navy Multiband Terminal...Davenport, Brian Devine, Greg Doriguzzi, Richard Felkins, John Fleming, Cheryl Francisco , Sid Graser, Eric Hillis, Craig LaMaster, Susan Manor, Joel

  11. Fulltext PDF

    Indian Academy of Sciences (India)

    2000; Fleming & Stone 2003), discs in dwarf nova systems (Gammie & Menou 1998), the .... The term on the right-hand side of the energy equation, Qdiss, is the rate of heating of the gas by the dissipation and ..... the right-hand side of equation (31), and c6 is the ratio of the resistive dissipation to the viscous dissipation.

  12. Squamous Cell Carcinoma of the Palm in Nigeria

    African Journals Online (AJOL)

    Fleming ID, Barnawell JR, Burlison PE, Rankin JS. Skin cancer in ... Thomas M. Malignant tumours of the hand and wrist. Indian J. Plast Surg 2011;44:337‑47. 8. ... Chakrabarti I, Watson JD, Dorrance H. Skin tumours of the hand. A 10‑year ...

  13. Browse Title Index

    African Journals Online (AJOL)

    Items 1 - 50 of 59 ... Vol 62 (2013), Cape Town's central city development: A strategy of partnership and inclusion, Abstract PDF. A Fleming, B Makalima-Ngewana. Vol 66 (2015), Compiling a land audit in ... C Green, G Mans, P Schmitz, D McKelly, M te Water. Vol 60 (2012), Planning innovation for better urban communities in ...

  14. Contract Training Services Strategic Business Plan.

    Science.gov (United States)

    Sir Sandford Fleming Coll., Peterborough (Ontario).

    Recommending organizational structures and strategies to achieve growth in contract training services (CTS) at Ontario's (Canada) Fleming College, this report reviews external conditions and proposes effective college responses. Following an overview of results and a recommended organizational chart, the planning process is reviewed and a…

  15. 29 CFR 776.23 - Employment in the construction industry.

    Science.gov (United States)

    2010-07-01

    ... work for or on behalf of a firm which is engaged in interstate commerce or in the production of goods for such commerce. 8 8 Mitchell v. Joyce Agency, 348 U.S. 945, affirming 110 F. Supp. 918; Fleming v... employee is engaged in both covered and non-covered work during the workweek he is entitled to the benefits...

  16. Four Alternative Policies to Restore Balance of Payments Equilibrium

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1952-01-01

    textabstractStimulated by Fleming's study on a related subject, the author compares four methods to eliminate balance of payments disequilibria between high-employment countries forming a closed group: (i) "discriminatory" import duties and subsidies, (ii) "discriminatory" duties only or the

  17. Disease: H01506 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available H01506 Hepatic encephalopathy; Hepatic coma Hepatic encephalopathy (HE) is a brain...of current therapies for hepatic encephalopathy in liver cirrhosis. ... JOURNAL ... World J Gastroenterol 21:118... ... Wakim-Fleming J ... TITLE ... Hepatic encephalopathy: suspect it early in patients with cirrhosis. ... JOURNAL ... Cleve Clin J Med 78:597-605 (2011) DOI:10.3949/ccjm.78a10117

  18. Cover picture: eur. J. Immunol. 9/11

    NARCIS (Netherlands)

    Gordon, Siamon; Hamann, Jörg; Lin, Hsi-Hsien; Stacey, Martin

    2011-01-01

    This month's cover depicts, by virtue of the scales, the balance of experts' opinions that are provided in the featured Macrophage Viewpoint series. Superimposed on the scales are cartoon drawings of the different macrophage subtypes (classical, alternative and regulatory) discussed by Fleming and

  19. 77 FR 5775 - Western Pacific Fishery Management Council; Public Meetings

    Science.gov (United States)

    2012-02-06

    ... the Council's Executive and Budget Standing Committee. DATES: The meetings will be held between....; the Council's Executive and Budget Standing Committee on March 4, 2012, between 2 p.m. and 4 p.m. The... held at The Fleming Hotel, Tinian; the Merizo Community Meeting will be held at the Merizo Community...

  20. A contribution to the rove beetles (Coleoptera: Staphylinidae, Paederinae in north of Iran

    Directory of Open Access Journals (Sweden)

    Masoud Mohammadi Dehcheshmeh

    2016-12-01

    Full Text Available In this paper, 19 species of rove beetles (Coleoptera: Staphylinidae, belonging to the subfamily Paederinae Fleming 1821, were collected from Mazandaran province, north of Iran, during 2015-2016. Two species, Rugilus angustatus Geoffroy 1758 and Astenus lyonessius (joy 1908 are reported for the first time from Iran.

  1. Genomic Wake-Up Call : Activating Silent Biosynthetic Pathways for Novel Metabolites in Penicillium chrysogenum

    NARCIS (Netherlands)

    Samol, Marta

    2015-01-01

    Verborgen schatten in het DNA van Penicillium chrysogenum De draadschimmel Penicillium chrysogenum werd in 1928 door Alexander Fleming ontdekt en wordt veel gebruikt in de industrie voor de productie van β-lactam antibiotica. Antibiotica en andere natuurlijke producten (secundaire metabolieten)

  2. Outbreak of Streptococcus pneumoniae in a Psychiatric Unit

    Centers for Disease Control (CDC) Podcasts

    2012-11-02

    Dr. Katherine Fleming-Dutra, an epidemiologist at CDC, discusses her investigation of a Streptococcus pneumoniae outbreak in a pediatric psychiatric unit.  Created: 11/2/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID); National Center for Immunization and Respiratory Diseases (NCIRD).   Date Released: 11/5/2012.

  3. Scarlet Fever

    Centers for Disease Control (CDC) Podcasts

    2011-06-09

    Katherine Fleming-Dutra, pediatrician, discusses scarlet fever, its cause, how to treat it, and how to prevent its spread.  Created: 6/9/2011 by National Center for Immunization and Respiratory Diseases (NCIRD).   Date Released: 6/9/2011.

  4. Kadunud maailm, kaotatud õnn / Lauri Vahtre

    Index Scriptorium Estoniae

    Vahtre, Lauri, 1960-

    2006-01-01

    Maailma populaarsemaid mängufilme "Tuulest viidud" ("Gone with the Wind") Margaret Mitchelli romaani järgi : režissöörid Victor Fleming, George Cucor, Sam Wood : Ameerika Ühendriigid 1939. Algteose loomisest ja selle filmiks saamisest

  5. Intelligence and Schooling. Fueling the Education Explosion: Proceedings of Conference 2 (Cleveland, Ohio, November 17-18, 1983).

    Science.gov (United States)

    Gardner, Mary, Ed.; Reed-Mundell, Charlene, Ed.

    These proceedings contain presentations from a conference whose major topics were real-world intelligence, artificial intelligence, and linkage between the education and corporate sectors. "People, Perspectives...Potential and Possibilities" (Elyse S. Fleming), which was the conference's closing speech, briefly summarizes the information…

  6. A Importância da Pesquisa Baseada em Fenômenos em Estratégia para os Pesquisadores Iberoamericanos

    Directory of Open Access Journals (Sweden)

    Fernando Antonio Ribeiro Serra

    2017-07-01

    Full Text Available In the end, careful observation, rigorous pattern-finding and targeted problem solving can be valuable forms of research. We must take care not to crowd out the Flemings, Bantings and Semmelweises of our discipline due to our obsession with theory-building or theory-testing.

  7. Peaceful Protest, Political Regimes, and the Social Media Challenge

    Science.gov (United States)

    2016-06-01

    University, 2012 Randolph J. Fleming, II Major, United States Army B.A., Virginia Commonwealth University, 2004 Submitted in partial fulfillment of...intermediate regimes or transitioning regimes carrying the burden of instability and conflict.23 In a similar vein, Henderson identifies democracies, as...spreading infectious ideologies through ICT.25 Furthermore, Regan and Henderson indicate that intermediate, anocratic regimes tend to oppress

  8. Universal "Imaginary Closed Circuit Method" and Formula for Determination of Direction of Induced EMF/Current

    Science.gov (United States)

    Atram, Dattatraya Balaram

    2011-01-01

    Fleming's right-hand rule and the right-flat-hand rule are generally applied for determining the direction of flow of induced emf/current in straight conductors. The right-hand-fingers rule is applied for coils only. The right-hand-thumb rule can be applied for either straight conductors or coils. Different rules have to be applied for different…

  9. International recognition for ageing research: John Scott Award-2014 to Leonard Hayflick and Paul Moorhead

    DEFF Research Database (Denmark)

    Rattan, Suresh

    2014-01-01

    is the oldest scientific award in the United States and, as a legacy to Benjamin Franklin, they are in the historic company of past winners who include Marie Curie, Thomas Edison, Jonas Salk, Irving Langmuir, Nicola Tesla, Guglielmo Marconi, R. Buckminister Fuller, Sir Alexander Fleming, Sir Howard Florey...

  10. Genetic engineering of Penicillium chrysogenum for the reactivation of biosynthetic pathways with potential pharmaceutical value

    NARCIS (Netherlands)

    Guzmán Chávez, Fernando

    2018-01-01

    Sinds de ontdekking van penicilline door Alexander Fleming wordt de filamenteuze schimmel Penicillium chrysogenum op grote schaal gebruikt voor de industriële productie van β-lactam antibiotica. Van origine kan deze schimmel ook andere, mogelijk bruikbare, biologisch actieve componenten produceren.

  11. A Canadian Approach to Training Technicians and Technologists In the Earth Sciences.

    Science.gov (United States)

    Watts, Stephen H.

    1983-01-01

    Describes two- and three-year undergraduate curricula for training earth science technicians at Sir Sanford Fleming College (Canada), emphasizing practical aspects and close student-faculty interaction. List of employment opportunities for geology graduates based on past placement data and geology curriculum outline are provided in tables. (JN)

  12. Deficiency of the complement regulator CD59a exacerbates Wallerian degeneration

    NARCIS (Netherlands)

    Ramaglia, Valeria; King, Rosalind Helen Mary; Morgan, Bryan Paul; Baas, Frank

    2009-01-01

    The complement system is implicated in Wallerian degeneration (WD). We have previously shown that the membrane attack complex (MAC) the terminal activation product of the complement cascade, mediates rapid axonal degradation and myelin clearance during WD after peripheral nerve injury. In this study

  13. A strange dwarf scenario for the formation of the peculiar double white dwarf binary SDSS J125733.63+542850.5

    Science.gov (United States)

    Jiang, Long; Chen, Wen-Cong; Li, Xiang-Dong

    2018-05-01

    The Hubble Space Telescope observation of the double white dwarf (WD) binary SDSS J125733.63+542850.5 reveals that the massive WD has a surface gravity log g1 ˜ 8.7 (which implies a mass of M1 ˜ 1.06 M⊙) and an effective temperature T1 ˜ 13 000 K, while the effective temperature of the low-mass WD (M2 dwarf (SD) scenario to explain the formation of this double WD binary. We assume that the massive WD is a SD originating from a phase transition (PT) in a ˜1.1 M⊙ WD, which has experienced accretion and spin-down processes. Its high effective temperature could arise from the heating process during the PT. Our simulations suggest that the progenitor of SDSS J125733.63+542850.5 can be a binary system consisting of a 0.65 M⊙ WD and a 1.5 M⊙ main-sequence star in a 1.492 d orbit. Especially, the secondary star (i.e. the progenitor of the low-mass WD) is likely to have an ultra-low metallicity of Z = 0.0001.

  14. Identification of p38 MAPK and JNK as New Targets for Correction of Wilson Disease-Causing ATP7B Mutants

    NARCIS (Netherlands)

    Chesi, Giancarlo; Hegde, Ramanath N.; Iacobacci, Simona; Concilli, Mafalda; Parashuraman, Seetharaman; Festa, Beatrice Paola; Polishchuk, Elena V.; Di Tullio, Giuseppe; Carissimo, Annamaria; Montefusco, Sandro; Canetti, Diana; Monti, Maria; Amoresano, Angela; Pucci, Piero; Sluis, van de Bart; Lutsenko, Svetlana; Luini, Alberto; Polishchuk, Roman S.

    Wilson disease (WD) is an autosomal recessive disorder that is caused by the toxic accumulation of copper (Cu) in the liver. The ATP7B gene, which is mutated in WD, encodes a multitransmembrane domain adenosine triphosphatase that traffics from the trans-Golgi network to the canalicular area of

  15. BEER ANALYSIS OF KEPLER AND CoRoT LIGHT CURVES. IV. DISCOVERY OF FOUR NEW LOW-MASS WHITE DWARF COMPANIONS IN THE KEPLER DATA

    Energy Technology Data Exchange (ETDEWEB)

    Faigler, S.; Kull, I.; Mazeh, T.; Kiefer, F. [School of Physics and Astronomy, Raymond and Beverly Sackler Faculty of Exact Sciences, Tel Aviv University, Tel Aviv 69978 (Israel); Latham, D. W. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Bloemen, S. [Department of Astrophysics, IMAPP, Radboud University Nijmegen, P.O. BOX 9010, NL-6500 GL Nijmegen (Netherlands)

    2015-12-10

    We report the discovery of four short-period eclipsing systems in the Kepler light curves, consisting of an A-star primary and a low-mass white dwarf (WD) secondary (dA+WD)—KIC 4169521, KOI-3818, KIC 2851474, and KIC 9285587. The systems show BEaming, Ellipsoidal and Reflection (BEER) phase modulations together with primary and secondary eclipses. These add to the 6 Kepler and 18 WASP short-period eclipsing dA+WD binaries that were previously known. The light curves, together with follow-up spectroscopic observations, allow us to derive the masses, radii, and effective temperatures of the two components of the four systems. The orbital periods, of 1.17–3.82 days, and WD masses, of 0.19–0.22 M{sub ⊙}, are similar to those of the previously known systems. The WD radii of KOI-3818, KIC 2851474, and KIC 9285587 are 0.026, 0.035, and 0.026 R{sub ⊙}, respectively, the smallest WD radii derived so far for short-period eclipsing dA+WD binaries. These three binaries extend the previously known population to older systems with cooler and smaller WD secondaries. KOI-3818 displays evidence for a fast-rotating primary and a minute but significant eccentricity, ∼1.5 × 10{sup −3}. These features are probably the outcome of the mass-transfer process.

  16. Biomass dynamics in a logged forest

    NARCIS (Netherlands)

    Nam, Vu Thanh; Anten, Niels P.R.; Kuijk, van Marijke

    2018-01-01

    Wood density (WD) is believed to be a key trait in driving growth strategies of tropical forest species, and as it entails the amount of mass per volume of wood, it also tends to correlate with forest carbon stocks. Yet there is relatively little information on how interspecific variation in WD

  17. FORMATION OF BLACK HOLE X-RAY BINARIES IN GLOBULAR CLUSTERS

    International Nuclear Information System (INIS)

    Ivanova, N.; Heinke, C. O.; Woods, T. E.; Chaichenets, S.; Fregeau, J.; Lombardi, J. C.

    2010-01-01

    Inspired by the recent identification in extragalactic globular clusters of the first candidate black hole-white dwarf (BH-WD) X-ray binaries, where the compact accretors may be stellar-mass black holes (BHs), we explore how such binaries could be formed in a dynamical environment. We provide analyses of the formation rates via well-known formation channels like binary exchange and physical collisions and propose that the only possibility of forming BH-WD binaries is via coupling these usual formation channels with subsequent hardening and/or triple formation. In particular, we find that the most important mechanism for the creation of a BH-WD X-ray binary from an initially dynamically formed BH-WD binary is mass transfer induced in a triple system via the Kozai mechanism. Furthermore, we find that BH-WD binaries that evolve into X-ray sources can be formed by exchanges of a BH into a WD-WD binary or possibly by collisions of a BH and a giant star. If BHs undergo significant evaporation from the cluster or form a completely detached subcluster of BHs, then we cannot match the observationally inferred production rates even using the most optimistic estimates of formation rates. To explain the observations with stellar-mass BH-WD binaries, at least 1% of all formed BHs, or presumably 10% of the BHs present in the core now, must be involved in interactions with the rest of the core stellar population.

  18. Clinical and Radiological Features of Wallerian Degeneration of the Middle Cerebellar Peduncles Secondary to Pontine Infarction

    Directory of Open Access Journals (Sweden)

    Zhi-Yong Zhang

    2018-01-01

    Conclusions: Despite the rarity of bilateral and symmetrical lesions of MCPs, secondary WD should be highly suspected if these lesions occur within 6 months after pontine infarction, particularly paramedian pons. Conventional MRI appears to be a relatively sensitive method for detecting WD of MCPs, which might affect the short-term prognosis.

  19. Introduction & Overview to Symposium 240: Binary Stars as Critical Tools and Tests in Contemporary Astrophysics

    Science.gov (United States)

    2006-01-01

    neutron stars and black holes properties of condensed matter Post CE Binaries V471 Tau (K2 V + wd) Symbiotic Binaries (M III + wd) X-ray Binaries CH...low-mass stars the respect they deserve, since these stars may be the dominant contributor to baryonic mass in the Universe. Ben Lane discussed recent

  20. Liver transplantation for Wilson disease.

    Science.gov (United States)

    Catana, Andreea M; Medici, Valentina

    2012-01-27

    The aim of this paper is to review the current status of liver transplantation (LT) for Wilson disease (WD), focusing on indications and controversies, especially in patients with neuropsychiatric disease, and on identification of acute liver failure (ALF) cases related to WD. LT remains the treatment of choice for patients with ALF, as initial presentation of WD or when anti-copper agents are stopped, and for patients with chronic liver disease progressed to cirrhosis, unresponsive to chelating medications or not timely treated with copper chelating agents. The indication for LT in WD remains highly debated in patients with progressive neurological deterioration and failure to improve with appropriate medical treatment. In case of Wilsonian ALF, early identification is key as mortality is 100% without emergency LT. As many of the copper metabolism parameters are believed to be less reliable in ALF, simple biochemical tests have been proposed for diagnosis of acute WD with good sensitivity and specificity. LT corrects copper metabolism and complications resulting from WD with excellent 1 and 5 year survival. Living related liver transplantation represents an alternative to deceased donor LT with excellent long-term survival, without disease recurrence. Future options may include hepatocyte transplantation and gene therapy. Although both of these have shown promising results in animal models of WD, prospective human studies are much needed to demonstrate their long-term beneficial effects and their potential to replace the need for medical therapy and LT in patients with WD.

  1. Increased cerebral iron uptake in Wilson's disease : A (52)Fe-citrate PET study

    NARCIS (Netherlands)

    Bruehlmeier, M; Leenders, KL; Vontobel, P; Calonder, C; Antonini, A; Weindl, A

    Toxicity of abundant copper is the main cause of brain and liver tissue damage in patients with Wilson's disease (WD). However, there is also evidence of a disturbed iron metabolism in this genetically determined disorder. This PET study was undertaken to assess cerebral iron metabolism in WD

  2. Chronic consumption of a western diet modifies the DNA methylation profile in the frontal cortex of mice.

    Science.gov (United States)

    Yokoyama, Amy S; Dunaway, Keith; Rutkowsky, Jennifer; Rutledge, John C; Milenkovic, Dragan

    2018-02-21

    In our previous work in mice, we have shown that chronic consumption of a Western diet (WD; 42% kcal fat, 0.2% total cholesterol and 34% sucrose) is correlated with impaired cognitive function. Cognitive decline has also been associated with alterations in DNA methylation. Additionally, although there have been many studies analyzing the effect of maternal consumption of a WD on DNA methylation in the offspring, few studies have analyzed how an individual's consumption of a WD can impact his/her DNA methylation. Since the frontal cortex is involved in the regulation of cognitive function and is often affected in cases of cognitive decline, this study aimed to examine how chronic consumption of a WD affects DNA methylation in the frontal cortex of mice. Eight-week-old male mice were fed either a control diet (CD) or a WD for 12 weeks, after which time alterations in DNA methylation were analyzed. Assessment of global DNA methylation in the frontal cortex using dot blot analysis revealed that there was a decrease in global DNA methylation in the WD-fed mice compared with the CD-fed mice. Bioinformatic analysis identified several networks and pathways containing genes displaying differential methylation, particularly those involved in metabolism, cell adhesion and cytoskeleton integrity, inflammation and neurological function. In conclusion, the results from this study suggest that consumption of a WD alters DNA methylation in the frontal cortex of mice and could provide one of the mechanisms by which consumption of a WD impairs cognitive function.

  3. Brain and behavioral perturbations in rats following Western diet access.

    Science.gov (United States)

    Hargrave, Sara L; Davidson, Terry L; Lee, Tien-Jui; Kinzig, Kimberly P

    2015-10-01

    Energy dense "Western" diets (WD) are known to cause obesity as well as learning and memory impairments, blood-brain barrier damage, and psychological disturbances. Impaired glucose (GLUT1) and monocarboxylate (MCT1) transport may play a role in diet-induced dementia development. In contrast, ketogenic diets (KD) have been shown to be neuroprotective. We assessed the effect of 10, 40 and 90 days WD, KD and Chow maintenance on spontaneous alternation (SA) and vicarious trial and error (VTE) behaviors in male rats, then analyzed blood glucose, insulin, and ketone levels; and hippocampal GLUT1 and MCT1 mRNA. Compared to Chow and KD, rats fed WD had increased 90 day insulin levels. SA was decreased in WD rats at 10, but not 40 or 90 days. VTE was perturbed in WD-fed rats, particularly at 10 and 90 days, indicating hippocampal deficits. WD rats had lower hippocampal GLUT1 and MCT1 expression compared to Chow and KD, and KD rats had increased 90 day MCT1 expression compared to Chow and WD. These data suggest that WD reduces glucose and monocarboxylate transport at the hippocampus, which may result in learning and memory deficits. Further, KD consumption may be useful for MCT1 transporter recovery, which may benefit cognition. Copyright © 2015 Elsevier Ltd. All rights reserved.

  4. Investigation of Wave Transmission from a Floating Wave Dragon Wave Energy Converter

    DEFF Research Database (Denmark)

    Nørgaard, Jørgen Harck; Andersen, Thomas Lykke

    2012-01-01

    This paper focuses on the calibration of the MIKE21BW model against the measured wave height reduction behind a 24 kW/m Wave Dragon (WD) wave energy converter. A numerical model is used to determine the wave transmission through the floating WD in varying wave conditions. The transmission obtained...

  5. Wave Dragon

    DEFF Research Database (Denmark)

    Kramer, Morten; Frigaard, Peter

    På foranledning af Löwenmark F.R.I, er der udført numeriske beregninger af Wave Dragons (herefter WD) armes effektivitet for forskellige geometriske udformninger. 5 geometriske modeller, hvor WD's arme er forkortet/forlænget er undersøgt for 3 forskellige drejninger af armene. I alt er 15...

  6. Gorecki. Sonata No 1, Four Preludes. Pärt, Arvo. Für Alina / Bernhard Uske

    Index Scriptorium Estoniae

    Uske, Bernhard

    1995-01-01

    Uuest heliplaadist "Gorecki. Sonata No 1, Four Preludes. Pärt, Arvo. Für Alina, Variationen zur Gesundung von Arinuschka. Ustvolskaya. Twelve Preludes, Sonata No 6. David Arden AD: 1994. Koch CD 3-7301-2 (WD: 55'12") (WD: 59'54")

  7. Dynamical Masses of Cool White Dwarfs in Double-Degenerate Visual Binaries

    Science.gov (United States)

    Bond, Howard E.; Nelan, E. P.; Schaefer, G.

    2014-01-01

    The cool white dwarfs (WDs) WD 1639+153 and WD 1818+126 were originally resolved into close visual binaries containing two WDs each during a survey with the Hubble Space Telescope (HST) and its Fine Guidance Sensors (FGS). Follow up FGS observations of these two double-degenerate (DD) systems, along with the previously known DD G 107-70, have yielded the orbital elements of all three visual binaries. We find orbital periods of 3.88 yr, 12.19 yr, and 18.84 yr for WD 1639+153, WD 1818+126, and G 107-70, respectively. Moreover, for each of the systems we have been observing nearby field stars with FGS1r in POS mode to determine the local inertial reference frame, from which we obtain the parallax and proper motion of the DD, along with the motion of each WD about its system barycenter. This leads directly to a dynamical mass for each WD. We have also used HST STIS observations to obtain individual spectra of each of the six WDs, which provide the effective temperature and subclass of each WD. This provides insight into the cooling age of each star. From the cooling ages and dynamical masses, we obtain constraints on the initial-mass/final-mass relation for WD stars.

  8. EST Table: DC553749 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC553749 E_FL_wd--_05C24_F_0 10/09/28 97 %/175 aa ref|NP_001036831.1| saposin-relat...a gnl|Amel|GB16561-PA 10/09/10 41 %/175 aa gi|91077504|ref|XP_966852.1| PREDICTED: similar to saposin isoform 1 [Tribolium castaneum] FS791050 wd-- ...

  9. Theoretical uncertainties of the Type Ia supernova rate

    NARCIS (Netherlands)

    Claeys, J.S.W.; Pols, O.R.; Izzard, R.G.; Vink, J.; Verbunt, F.W.M.

    2014-01-01

    It is thought that Type Ia supernovae (SNe Ia) are explosions of carbon-oxygen white dwarfs (CO WDs). Two main evolutionary channels are proposed for the WD to reach the critical density required for a thermonuclear explosion: the single degenerate (SD) scenario, in which a CO WD accretes from a

  10. Value of Tropheryma whipplei quantitative polymerase chain reaction assay for the diagnosis of Whipple disease: usefulness of saliva and stool specimens for first-line screening.

    Science.gov (United States)

    Fenollar, Florence; Laouira, Sonia; Lepidi, Hubert; Rolain, Jean-Marc; Raoult, Didier

    2008-09-01

    Whipple disease (WD) is a chronic infectious disease caused by Tropheryma whipplei. WD DNA has been found in stool and saliva specimens from patients and asymptomatic carriers. A total of 4418 samples that were sent to our center for determination of WD were tested by a T. whipplei-specific quantitative polymerase chain reaction (PCR) based on repetitive sequences. Definite WD was diagnosed in 71 patients, including 55 patients with classic WD (defined by positive results of periodic acid-Schiff staining and/or specific immunohistochemistry of small-bowel biopsy specimens) and 16 patients with localized WD (including patients with endocarditis, neurologic infection, and uveitis). Of the persons without WD, 2.3% had stool specimens positive for T. whipplei by PCR and 0.2% had saliva specimens positive for T. whipplei by PCR. Diagnosis of WD was likely in patients with positive results of both PCR of saliva specimens and PCR of stool specimens (positive predictive value, 95.2%). When the bacterial load was >10(4) colony-forming units per g of stool, the positive predictive value was 100%. A negative result of PCR of a saliva or stool specimen had a negative predictive value of 99.2% for classic WD. For localized WD, positive results of both PCR of saliva specimens and PCR of stool specimens had a sensitivity of 58% (compared with 94% for classic WD). The positive predictive value of testing of blood, cerebrospinal fluid, and urine specimens was 100% for each, and the positive predictive value for testing of duodenal biopsy specimens was 97.5%. T. whipplei-specific quantitative PCR of saliva and stool specimens should be performed as first-line noninvasive screening for WD. When the results for both types of specimens are positive, diagnosis of classic WD should be highly suspected, especially if a high bacterial load is detected. Because PCR of saliva and stool specimens lacks sensitivity for determination of localized WD, invasive samples should be tested on the

  11. Wilson’s disease presenting with HELLP syndrome; A case report

    Directory of Open Access Journals (Sweden)

    Sümeyra Nergiz Avcıoğlu

    2015-03-01

    Full Text Available Wilson’s disease (WD is an autosomal recessive disorder. It is characterized by toxic accumulation of copper mainly in the liver and brain but also in cornea and kidney due to a defect in biliary excretion of copper. The hepatic manifestation of WD is diverse and may include asymptomatic elevation of aminotransferase, chronic hepatitis, cirrhosis, or acute/fulminant hepatic failure. Characteristic of acute hepatic failure in WD is concomitance of acute intravascular hemolytic anemia. Acute intravascular hemolytic anemia and thrombocytopenia in WD may be interpreted as a feature of Hemolysis, Elevated Liver Enzymes, Low Platelet Count (HELLP syndrome besides acute liver failure. The differential diagnosis may be very difficult. Here, WD in pregnancy presenting with clinical symptoms of HELLP syndrome and developing acute liver failure in postpartum period is discussed.

  12. The WIRED Survey. 2; Infrared Excesses in the SDSS DR7 White Dwarf Catalog

    Science.gov (United States)

    Debes, John H.; Hoard, D. W.; Wachter, Stefanie; Leisawitz, David T.; Cohen, Martin

    2011-01-01

    With the launch of the Wide-field Infrar.ed Survey Explorer (WISE), a new era of detecting planetary debris and brown dwarfs (BDs) around white dwarfs (WDs) has begun with the WISE InfraRed Excesses around Degenerates (WIRED) Survey. The WIRED Survey is sensitive to substellar objects and dusty debris around WDs out to distances exceeding 100 pc, well beyond the completeness level of local WDs. In this paper, we present a cross-correlation of the preliminary Sloan Digital Sky Survey (SDSS) Data Release 7 (DR7) WD catalog between the WISE, Two-Micron All Sky Survey (2MASS), UKIRT Infrared Deep Sky Survey (UKIDSS), and SDSS DR7 photometric catalogs. From -18,000 input targets, there are WISE detections comprising 344 "naked" WDs (detection of the WD photosphere only), 1020 candidate WD+M dwarf binaries, 42 candidate WD+BD systems, 52 candidate WD+dust disk systems, and 69 targets with indeterminate infrared excess. We classified all of the detected targets through spectral energy distribution model fitting of the merged optical, near-IR, and WISE photometry. Some of these detections could be the result of contaminating sources within the large (approx. 6") WISE point-spread function; we make a preliminary estimate for the rates of contamination for our WD+BD and WD+disk candidates and provide notes for each target of interest. Each candidate presented here should be confirmed with higher angular resolution infrared imaging or infrared spectroscopy. We also present an overview of the observational characteristics of the detected WDs in the WISE photometric bands, including the relative frequencies of candidate WD+M, WD+BD, and WD+disk systems.

  13. Mapping wood density globally using remote sensing and climatological data

    Science.gov (United States)

    Moreno, A.; Camps-Valls, G.; Carvalhais, N.; Kattge, J.; Robinson, N.; Reichstein, M.; Allred, B. W.; Running, S. W.

    2017-12-01

    Wood density (WD) is defined as the oven-dry mass divided by fresh volume, varies between individuals, and describes the carbon investment per unit volume of stem. WD has been proven to be a key functional trait in carbon cycle research and correlates with numerous morphological, mechanical, physiological, and ecological properties. In spite of the utility and importance of this trait, there is a lack of an operational framework to spatialize plant WD measurements at a global scale. In this work, we present a consistent modular processing chain to derive global maps (500 m) of WD using modern machine learning techniques along with optical remote sensing data (MODIS/Landsat) and climate data using the Google Earth Engine platform. The developed approach uses a hierarchical Bayesian approach to fill in gaps in the plant measured WD data set to maximize its global representativeness. WD plant species are then aggregated to Plant Functional Types (PFT). The spatial abundance of PFT at 500 m spatial resolution (MODIS) is calculated using a high resolution (30 m) PFT map developed using Landsat data. Based on these PFT abundances, representative WD values are estimated for each MODIS pixel with nearby measured data. Finally, random forests are used to globally estimate WD from these MODIS pixels using remote sensing and climate. The validation and assessment of the applied methods indicate that the model explains more than 72% of the spatial variance of the calculated community aggregated WD estimates with virtually unbiased estimates and low RMSE (<15%). The maps thus offer new opportunities to study and analyze the global patterns of variation of WD at an unprecedented spatial coverage and spatial resolution.

  14. Acromioclavicular joint dislocation: a comparative biomechanical study of the palmaris-longus tendon graft reconstruction with other augmentative methods in cadaveric models

    Directory of Open Access Journals (Sweden)

    Sengupta S

    2007-11-01

    Full Text Available Abstract Background Acromioclavicular injuries are common in sports medicine. Surgical intervention is generally advocated for chronic instability of Rockwood grade III and more severe injuries. Various methods of coracoclavicular ligament reconstruction and augmentation have been described. The objective of this study is to compare the biomechanical properties of a novel palmaris-longus tendon reconstruction with those of the native AC+CC ligaments, the modified Weaver-Dunn reconstruction, the ACJ capsuloligamentous complex repair, screw and clavicle hook plate augmentation. Hypothesis There is no difference, biomechanically, amongst the various reconstruction and augmentative methods. Study Design Controlled laboratory cadaveric study. Methods 54 cadaveric native (acromioclavicular and coracoclavicular ligaments were tested using the Instron machine. Superior loading was performed in the 6 groups: 1 in the intact states, 2 after modified Weaver-Dunn reconstruction (WD, 3 after modified Weaver-Dunn reconstruction with acromioclavicular joint capsuloligamentous repair (WD.ACJ, 4 after modified Weaver-Dunn reconstruction with clavicular hook plate augmentation (WD.CP or 5 after modified Weaver-Dunn reconstruction with coracoclavicular screw augmentation (WD.BS and 6 after modified Weaver-Dunn reconstruction with mersilene tape-palmaris-longus tendon graft reconstruction (WD. PLmt. Posterior-anterior (horizontal loading was similarly performed in all groups, except groups 4 and 5. The respective failure loads, stiffnesses, displacements at failure and modes of failure were recorded. Data analysis was carried out using a one-way ANOVA, with Student's unpaired t-test for unpaired data (S-PLUS statistical package 2005. Results Native ligaments were the strongest and stiffest when compared to other modes of reconstruction and augmentation except coracoclavicular screw, in both posterior-anterior and superior directions (p WD.ACJ provided additional

  15. INVERTING COLOR-MAGNITUDE DIAGRAMS TO ACCESS PRECISE STAR CLUSTER PARAMETERS: A NEW WHITE DWARF AGE FOR THE HYADES

    International Nuclear Information System (INIS)

    DeGennaro, Steven; Von Hippel, Ted; Jefferys, William H.; Stein, Nathan; Jeffery, Elizabeth; Van Dyk, David

    2009-01-01

    We have extended our Bayesian modeling of stellar clusters-which uses main-sequence stellar evolution models, a mapping between initial masses and white dwarf (WD) masses, WD cooling models, and WD atmospheres-to include binary stars, field stars, and two additional main-sequence stellar evolution models. As a critical test of our Bayesian modeling technique, we apply it to Hyades UBV photometry, with membership priors based on proper motions and radial velocities, where available. Under the assumption of a particular set of WD cooling models and atmosphere models, we estimate the age of the Hyades based on cooling WDs to be 648 ± 45 Myr, consistent with the best prior analysis of the cluster main-sequence turnoff (MSTO) age by Perryman et al. Since the faintest WDs have most likely evaporated from the Hyades, prior work provided only a lower limit to the cluster's WD age. Our result demonstrates the power of the bright WD technique for deriving ages and further demonstrates complete age consistency between WD cooling and MSTO ages for seven out of seven clusters analyzed to date, ranging from 150 Myr to 4 Gyr.

  16. SDSS J184037.78+642312.3: THE FIRST PULSATING EXTREMELY LOW MASS WHITE DWARF

    Energy Technology Data Exchange (ETDEWEB)

    Hermes, J. J.; Montgomery, M. H.; Winget, D. E. [Department of Astronomy, University of Texas at Austin, Austin, TX 78712 (United States); Brown, Warren R.; Kenyon, Scott J. [Smithsonian Astrophysical Observatory, 60 Garden St, Cambridge, MA 02138 (United States); Kilic, Mukremin, E-mail: jjhermes@astro.as.utexas.edu [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks St., Norman, OK 73019 (United States)

    2012-05-10

    We report the discovery of the first pulsating extremely low mass (ELM) white dwarf (WD), SDSS J184037.78+642312.3 (hereafter J1840). This DA (hydrogen-atmosphere) WD is by far the coolest and the lowest-mass pulsating WD, with T{sub eff} = 9100 {+-} 170 K and log g = 6.22 {+-} 0.06, which corresponds to a mass of {approx}0.17 M{sub Sun }. This low-mass pulsating WD greatly extends the DAV (or ZZ Ceti) instability strip, effectively bridging the log g gap between WDs and main-sequence stars. We detect high-amplitude variability in J1840 on timescales exceeding 4000 s, with a non-sinusoidal pulse shape. Our observations also suggest that the variability is multi-periodic. The star is in a 4.6 hr binary with another compact object, most likely another WD. Future, more extensive time-series photometry of this ELM WD offers the first opportunity to probe the interior of a low-mass, presumably He-core WD using the tools of asteroseismology.

  17. SDSS J184037.78+642312.3: THE FIRST PULSATING EXTREMELY LOW MASS WHITE DWARF

    International Nuclear Information System (INIS)

    Hermes, J. J.; Montgomery, M. H.; Winget, D. E.; Brown, Warren R.; Kenyon, Scott J.; Kilic, Mukremin

    2012-01-01

    We report the discovery of the first pulsating extremely low mass (ELM) white dwarf (WD), SDSS J184037.78+642312.3 (hereafter J1840). This DA (hydrogen-atmosphere) WD is by far the coolest and the lowest-mass pulsating WD, with T eff = 9100 ± 170 K and log g = 6.22 ± 0.06, which corresponds to a mass of ∼0.17 M ☉ . This low-mass pulsating WD greatly extends the DAV (or ZZ Ceti) instability strip, effectively bridging the log g gap between WDs and main-sequence stars. We detect high-amplitude variability in J1840 on timescales exceeding 4000 s, with a non-sinusoidal pulse shape. Our observations also suggest that the variability is multi-periodic. The star is in a 4.6 hr binary with another compact object, most likely another WD. Future, more extensive time-series photometry of this ELM WD offers the first opportunity to probe the interior of a low-mass, presumably He-core WD using the tools of asteroseismology.

  18. Hybrid Wavelet De-noising and Rank-Set Pair Analysis approach for forecasting hydro-meteorological time series

    Science.gov (United States)

    WANG, D.; Wang, Y.; Zeng, X.

    2017-12-01

    Accurate, fast forecasting of hydro-meteorological time series is presently a major challenge in drought and flood mitigation. This paper proposes a hybrid approach, Wavelet De-noising (WD) and Rank-Set Pair Analysis (RSPA), that takes full advantage of a combination of the two approaches to improve forecasts of hydro-meteorological time series. WD allows decomposition and reconstruction of a time series by the wavelet transform, and hence separation of the noise from the original series. RSPA, a more reliable and efficient version of Set Pair Analysis, is integrated with WD to form the hybrid WD-RSPA approach. Two types of hydro-meteorological data sets with different characteristics and different levels of human influences at some representative stations are used to illustrate the WD-RSPA approach. The approach is also compared to three other generic methods: the conventional Auto Regressive Integrated Moving Average (ARIMA) method, Artificial Neural Networks (ANNs) (BP-error Back Propagation, MLP-Multilayer Perceptron and RBF-Radial Basis Function), and RSPA alone. Nine error metrics are used to evaluate the model performance. The results show that WD-RSPA is accurate, feasible, and effective. In particular, WD-RSPA is found to be the best among the various generic methods compared in this paper, even when the extreme events are included within a time series.

  19. Endocrine and mood responses to two working days in female teachers.

    Science.gov (United States)

    Serrano, Miguel Angel; Moya-Albiol, Luís; Salvador, Alicia

    2014-01-01

    Currently, a considerable amount of work stress is present in school teachers, one of the occupational groups with the highest levels of job strain and burnout. As chronic stress produces significant modifications in emotional adjustment and neuroendocrine functioning, we aimed to investigate the role of these work stress constructs in the endocrine and mood responses of a group of female teachers during two working days (WD) at different moments in the academic year. We studied mood as well as levels of cortisol and testosterone, representative of a predominant catabolic or anabolic balance. Our results showed that higher "control" was associated with higher positive mood (p = .028 on WD1 and p = .057 on WD2) and salivary testosterone (Tsal) (p = .022 on WD1), whereas "demands" and "total job strain" were related to negative mood (p = .011 and p = .015, respectively). Participants with higher scores on "total burnout" and "emotional exhaustion" also had higher negative mood (p < .05 in all cases). Depersonalization correlated positively with negative mood (p = .019 and p = .006 on WD1 and WD2, respectively). Finally, personal accomplishment showed an inverse relationship with negative mood (p = .038 on WD2). These results are useful for job risk prevention and interventions that should focus on the control dimension of the job strain questionnaire and on personal accomplishment from the burnout scale.

  20. Sleep disorders of Whipple's disease of the brain.

    Science.gov (United States)

    Panegyres, P K; Goh, J

    2015-02-01

    To understand the effects of Whipple's disease (WD) of the brain on sleep function. Clinical and polysomnographic studies of two patients with severe disruption of sleep due to WD: a 48-year-old female with primary WD of the brain and a 41-year-old male with secondary WD of the brain. The patient with primary WD had hypersomnolence with severe obstructive sleep apnoea, reduced sleep efficiency, frequent waking and sleep fragmentation. The patient with secondary WD was also hypersomnolent with oculomastictory myorhythmia. He was shown to have severe sleep initiation insomnia with poor sleep efficiency, severe obstructive sleep apnoea/hypopnoea and oculomasticatory myorhythmia at sleep-wake transitions. WD of the brain may affect sleep biology in its primary and secondary forms leading to hypersomnolence from obstructive sleep apnoea, sleep fragmentation, reduced sleep efficiency, sleep initiation insomnia and intrusive oculomasticatory myorhythmia. © The Author 2014. Published by Oxford University Press on behalf of the Association of Physicians. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  1. Percutaneous coronary intervention and the management of acute coronary syndromes in patients with von Willebrand disease.

    Science.gov (United States)

    Rathore, Sulaiman; Deleon, Dexter; Akram, Hafsa; Sane, David; Ball, Timothy

    2013-04-01

    Von Willebrand disease (vWD) results from quantitative or qualitative deficiency of von Willebrand factor (vWF). The occurrence of myocardial infarction is very rare in patients with vWD. A few case reports of acute coronary syndrome (ACS) in vWD patients are present in the literature, but no definite management recommendations are available for such patients. We report a case of successful percutaneous coronary intervention (PCI) with bare-metal stent (BMS) implantation in a 46-year-old woman with type 1 vWD and history of coronary artery disease (CAD). She received periprocedural dual-antiplatelet therapy for 2 weeks and then continued aspirin without any bleeding complications. The optimal management of patients with vWD and ACS is complex and presents a therapeutic challenge. We propose that dual-antiplatelet therapy can be used safely in most vWD patients presenting with ACS as most of them are type 1 vWD. PCI with BMS can be done safely. Long-term management of these patients requires a systemic approach including hematological consultation, ascertaining vWF levels, as well as patient education and close outpatient follow-up.

  2. Modification of Turbulent Pipe Flow Equations to Estimate the Vertical Velocity Profiles Under Woody Debris Jams

    Science.gov (United States)

    Cervania, A.; Knack, I. M. W.

    2017-12-01

    The presence of woody debris (WD) jams in rivers and streams increases the risk of backwater flooding and reduces the navigability of a channel, but adds fish and macroinvertebrate habitat to the stream. When designing river engineering projects engineers use hydraulic models to predict flow behavior around these obstructions. However, the complexities of flow through and beneath WD jams are still poorly understood. By increasing the ability to predict flow behavior around WD jams, landowners and engineers are empowered to develop sustainable practices regarding the removal or placement of WD in rivers and flood plains to balance the desirable and undesirable effects to society and the environment. The objective of this study is to address some of this knowledge gap by developing a method to estimate the vertical velocity profile of flow under WD jams. When flow passes under WD jams, it becomes affected by roughness elements on all sides, similar to turbulent flows in pipe systems. Therefore, the method was developed using equations that define the velocity profiles of turbulent pipe flows: the law of the wall, the logarithmic law, and the velocity defect law. Flume simulations of WD jams were conducted and the vertical velocity profiles were measured along the centerline. A calculated velocity profile was fit to the measured profile through the calibration of eight parameters. An optimal value or range of values have been determined for several of these parameters using cross-validation techniques. The results indicate there may be some promise to using this method in hydraulic models.

  3. Short and Long-Term Temporal Changes in Air Quality in a Seoul Urban Area: The Weekday/Sunday Effect

    Directory of Open Access Journals (Sweden)

    Jan E. Szulejko

    2018-04-01

    Full Text Available We present evidence on the short-term differences in airborne pollution levels in terms of weekday/weekend (WD/WN and weekday/Sunday (WD/Sun intervals. To this end, we analyzed the hourly data of important pollutants (nitric oxide (NO, nitrogen dioxide (NO2, ozone (O3 and carbon monoxide (CO using the data acquired in the Yong-San district of Seoul, Korea from 2009 to 2013. For each week, the pollutant ratio (Rw was estimated through either WD/WN or WD/Sun. Here, a week is defined as Sunday through Saturday, WD as Monday through Friday and WN as Sunday and Saturday. The WD/Sun Rw geometric means (and range were 2.02 (0.27–15.5 for NO, 1.29 (0.49–5.7 for NO2 and 0.89 (0.17–7.2 for O3 while the fraction of Rw (WD/Sun > 1 were 81, 71 and 38%, respectively. NO and CO levels were much higher in October through March (during Autumn and Winter than April through September (during Spring and Summer, reflecting the potential effect of fuel consumption (e.g., in terms of use patterns of nationwide city natural gas. Thus, we provide a broader interpretation on the occurrence patterns of the major pollutants (e.g., NO, NO2, O3 and CO in relation to temporal changes in man-made activities.

  4. Caffeine prevents cognitive impairment induced by chronic psychosocial stress and/or high fat-high carbohydrate diet.

    Science.gov (United States)

    Alzoubi, K H; Abdul-Razzak, K K; Khabour, O F; Al-Tuweiq, G M; Alzubi, M A; Alkadhi, K A

    2013-01-15

    Caffeine alleviates cognitive impairment associated with a variety of health conditions. In this study, we examined the effect of caffeine treatment on chronic stress- and/or high fat-high carbohydrate Western diet (WD)-induced impairment of learning and memory in rats. Chronic psychosocial stress, WD and caffeine (0.3 g/L in drinking water) were simultaneously administered for 3 months to adult male Wistar rats. At the conclusion of the 3 months, and while the previous treatments continued, rats were tested in the radial arm water maze (RAWM) for learning, short-term and long-term memory. This procedure was applied on a daily basis to all animals for 5 consecutive days or until the animal reaches days to criterion (DTC) in the 12th learning trial and memory tests. DTC is the number of days that the animal takes to make zero error in two consecutive days. Chronic stress and/or WD groups caused impaired learning, which was prevented by chronic caffeine administration. In the memory tests, chronic caffeine administration also prevented memory impairment during chronic stress conditions and/or WD. Furthermore, DTC value for caffeine treated stress, WD, and stress/WD groups indicated that caffeine normalizes memory impairment in these groups. These results showed that chronic caffeine administration prevented stress and/or WD-induced impairment of spatial learning and memory. Copyright © 2012 Elsevier B.V. All rights reserved.

  5. Effects of short-term Western diet on cerebral oxidative stress and diabetes related factors in APP x PS1 knock-in mice.

    Science.gov (United States)

    Studzinski, Christa M; Li, Feng; Bruce-Keller, Annadora J; Fernandez-Kim, Sun Ok; Zhang, Le; Weidner, Adam M; Markesbery, William R; Murphy, M Paul; Keller, Jeffrey N

    2009-02-01

    A chronic high fat Western diet (WD) promotes a variety of morbidity factors although experimental evidence for short-term WD mediating brain dysfunction remains to be elucidated. The amyloid precursor protein and presenilin-1 (APP x PS1) knock-in mouse model has been demonstrated to recapitulate some key features of Alzheimer's disease pathology, including amyloid-beta (Abeta) pathogenesis. In this study, we placed 1-month-old APP x PS1 mice and non-transgenic littermates on a WD for 4 weeks. The WD resulted in a significant elevation in protein oxidation and lipid peroxidation in the brain of APP x PS1 mice relative to non-transgenic littermates, which occurred in the absence of increased Abeta levels. Altered adipokine levels were also observed in APP x PS1 mice placed on a short-term WD, relative to non-transgenic littermates. Taken together, these data indicate that short-term WD is sufficient to selectively promote cerebral oxidative stress and metabolic disturbances in APP x PS1 knock-in mice, with increased oxidative stress preceding alterations in Abeta. These data have important implications for understanding how WD may potentially contribute to brain dysfunction and the development of neurodegenerative disorders such as Alzheimer's disease.

  6. CDK4 amplification predicts recurrence of well-differentiated liposarcoma of the abdomen.

    Directory of Open Access Journals (Sweden)

    Sanghoon Lee

    Full Text Available The absence of CDK4 amplification in liposarcomas is associated with favorable prognosis. We aimed to identify the factors associated with tumor recurrence in patients with well-differentiated (WD and dedifferentiated (DD liposarcomas.From 2000 to 2010, surgical resections for 101 WD and DD liposarcomas were performed. Cases in which complete surgical resections with curative intent were carried out were selected. MDM2 and CDK4 gene amplification were analyzed by quantitative real-time polymerase chain reaction (Q-PCR.There were 31 WD and 17 DD liposarcomas. Locoregional recurrence was observed in 11 WD and 3 DD liposarcomas. WD liposarcomas showed better patient survival compared to DD liposarcomas (P<0.05. Q-PCR analysis of the liposarcomas revealed the presence of CDK4 amplification in 44 cases (91.7% and MDM2 amplification in 46 cases (95.8%. WD liposarcomas with recurrence after surgical resection had significantly higher levels of CDK4 amplification compared to those without recurrence (P = 0.041. High level of CDK4 amplification (cases with CDK4 amplification higher than the median 7.54 was associated with poor recurrence-free survival compared to low CDK4 amplification in both univariate (P = 0.012 and multivariate analyses (P = 0.020.Level of CDK4 amplification determined by Q-PCR was associated with the recurrence of WD liposarcomas after surgical resection.

  7. A hybrid wavelet de-noising and Rank-Set Pair Analysis approach for forecasting hydro-meteorological time series.

    Science.gov (United States)

    Wang, Dong; Borthwick, Alistair G; He, Handan; Wang, Yuankun; Zhu, Jieyu; Lu, Yuan; Xu, Pengcheng; Zeng, Xiankui; Wu, Jichun; Wang, Lachun; Zou, Xinqing; Liu, Jiufu; Zou, Ying; He, Ruimin

    2018-01-01

    Accurate, fast forecasting of hydro-meteorological time series is presently a major challenge in drought and flood mitigation. This paper proposes a hybrid approach, wavelet de-noising (WD) and Rank-Set Pair Analysis (RSPA), that takes full advantage of a combination of the two approaches to improve forecasts of hydro-meteorological time series. WD allows decomposition and reconstruction of a time series by the wavelet transform, and hence separation of the noise from the original series. RSPA, a more reliable and efficient version of Set Pair Analysis, is integrated with WD to form the hybrid WD-RSPA approach. Two types of hydro-meteorological data sets with different characteristics and different levels of human influences at some representative stations are used to illustrate the WD-RSPA approach. The approach is also compared to three other generic methods: the conventional Auto Regressive Integrated Moving Average (ARIMA) method, Artificial Neural Networks (ANNs) (BP-error Back Propagation, MLP-Multilayer Perceptron and RBF-Radial Basis Function), and RSPA alone. Nine error metrics are used to evaluate the model performance. Compared to three other generic methods, the results generated by WD-REPA model presented invariably smaller error measures which means the forecasting capability of the WD-REPA model is better than other models. The results show that WD-RSPA is accurate, feasible, and effective. In particular, WD-RSPA is found to be the best among the various generic methods compared in this paper, even when the extreme events are included within a time series. Copyright © 2017 Elsevier Inc. All rights reserved.

  8. PCR analysis is superior to histology for diagnosis of Whipple's disease mimicking seronegative rheumatic diseases.

    Science.gov (United States)

    Lehmann, P; Ehrenstein, B; Hartung, W; Dragonas, C; Reischl, U; Fleck, M

    2017-03-01

    The diagnosis of Whipple's disease (WD) is commonly confirmed by histology demonstrating Periodic Acid Schiff (PAS)-positive macrophages in the duodenal mucosa. Analysis of intestinal tissue or other specimens using polymerase chain reaction (PCR) is a more sensitive method. However, the relevance of positive PCR findings is still controversial. Therefore, we evaluated the relevance of histology and PCR findings to establishing the diagnosis of WD in a series of WD patients initially presenting with suspected rheumatic diseases. Between 2006 and 2014, 20 patients with seronegative rheumatic diseases tested positive for Tropheryma whipplei (Tw) by PCR and/or histology and were enrolled in a retrospective analysis of the diagnostic value of both procedures. Seven of the 20 cases (35%) were diagnosed with 'classic' WD as indicated by PAS-positive macrophages. In the remaining 13 patients, the presence of Tw was detected by intestinal (n = 10) or synovial PCR analysis (n = 3). Two of the 20 patients (10%) with evidence of Tw did not respond to antibiotic therapy. They were not considered to suffer from WD. Therefore, relying only on histological findings of intestinal biopsies would have missed 11 (61%) of the 18 patients with WD in our cohort. In comparison, PCR of intestinal biopsies detected Tw-DNA in 14 (93%) of the 15 WD patients evaluated. Patients with a positive histology did not differ from PCR-positive patients with regard to sex, age, or duration of disease, but more often presented with gastrointestinal symptoms. A substantial number of WD patients present without typical intestinal histology findings. Additional PCR analysis of intestinal tissue or synovial fluid increased the sensitivity of the diagnostic evaluation and should be considered particularly in patients presenting with atypical seronegative rheumatic diseases and a high-risk profile for WD.

  9. Bipolar disorders and Wilson’s disease

    Directory of Open Access Journals (Sweden)

    Carta Mauro

    2012-05-01

    Full Text Available Abstract Background The aim of this study was to determine the risk for Bipolar Disorder (BD in Wilson’s disease (WD and to measure the impaired Quality of Life (QL in BD with WD using standardized psychiatric diagnostic tools and a case control design. Methods This was a case control study. The cases were 23 consecutive patients with WD treated at the University Hospital in Cagliari, Italy, and the controls were 92 sex- and age-matched subjects with no diagnosis of WD who were randomly selected from a database used previously for an epidemiological study. Psychiatric diagnoses according to DSM-IV criteria were determined by physicians using structured interview tools (ANTAS-SCID. QL was measured by means of SF-12. Results Compared to controls, WD patients had lower scores on the SF-12 and higher lifetime prevalence of DSM-IV major depressive disorders (OR = 5.7, 95% CI 2.4–17.3 and bipolar disorders (OR = 12.9, 95% CI 3.6–46.3. BD was associated with lower SF-12 in WD patients. Conclusions This study was the first to show an association between BD and WD using standardized diagnostic tools and a case control design. Reports in the literature about increased schizophrenia-like psychosis in WD and a lack of association with bipolar disorders may thus have been based on a more inclusive diagnosis of schizophrenia in the past. Our findings may explain the frequent reports of loss of emotional control, hyperactivity, loss of sexual inhibition, and irritability in WD patients. This study was limited by a small sample size.

  10. p.H1069Q mutation in ATP7B and biochemical parameters of copper metabolism and clinical manifestation of Wilson's disease.

    Science.gov (United States)

    Gromadzka, Graznya; Schmidt, Harmut H J; Genschel, Janine; Bochow, Bettina; Rodo, M; Tarnacka, Beatek; Litwin, Thomas; Chabik, Grzegorz; Członkowska, Anna

    2006-02-01

    We compared the effect of the p.H1069Q mutation and other non-p.H1069Q mutations in ATP7B on the phenotypic expression of Wilson's disease (WD), and assessed whether the clinical phenotype of WD in compound heterozygotes depends on the type of mutation coexisting with the p.H1069Q. One hundred forty-two patients with clinically, biochemically, and genetically diagnosed WD were studied. The mutational analysis of ATP7B was performed by direct sequencing. A total number of 26 mutations in ATP7B were identified. The p.His1069Gln was the most common mutation (allelic frequency: 72%). Seventy-three patients were homozygous for this mutation. Of compound heterozygotes, 37 had frameshift/nonsense mutation, and 20 had other missense mutation on one of their ATP7B alleles. Twelve patients had two non-p.H1069Q mutations. Patients homozygous for the p.H1069Q mutation had the less severe disturbances of copper metabolism and the latest presentation of first WD symptoms. The most severely disturbed copper metabolism and the earliest age at initial disease manifestation was noticed in non-p.H1069Q patients. In compound heterozygotes, the type of mutation coexisting with the p.H1069Q to a small extent influenced WD phenotype. The phenotype of WD varied considerably among patients with the same genotype. The p.H1069Q mutation is associated with late WD manifestation and with a mild disruption of copper metabolism. In compound heterozygotes, the phenotype of WD to a small extent depends on the type of mutation coexisting with the p.H1069Q. Besides genotype, additional modifying factors seem to determine WD manifestations. Copyright (c) 2005 Movement Disorder Society.

  11. Prevalence and causes of work disability among working-age U.S. adults, 2011-2013, NHIS.

    Science.gov (United States)

    Theis, Kristina A; Roblin, Douglas W; Helmick, Charles G; Luo, Ruiyan

    2018-01-01

    Chronic conditions are among the major causes of work disability (WD), which is associated with lower employment, less economic activity, and greater dependence on social programs, while limiting access to the benefits of employment participation. We estimated the overall prevalence of WD among working-age (18-64 years) U.S. adults and the most common causes of WD overall and by sex. Next, we estimated the prevalence and most common causes of WD among adults with 12 common chronic conditions by sex and age. We hypothesized that musculoskeletal conditions would be among the most common causes of WD overall and for individuals with other diagnosed chronic conditions. Data were obtained from years 2011, 2012, and 2013 of the National Health Interview Survey. WD was defined by a "yes" response to one or both of: "Does a physical, mental, or emotional problem NOW keep you from working at a job or business?" and "Are you limited in the kind OR amount of work you can do because of a physical, mental or emotional problem?" Overall, 20.1 million adults (10.4% (95% CI = 10.1-10.8) of the working-age population) reported WD. The top three most commonly reported causes of WD were back/neck problems 30.3% (95% CI = 29.1-31.5), depression/anxiety/emotional problems 21.0% (19.9-22.0), and arthritis/rheumatism 18.6 (17.6-19.6). Musculoskeletal conditions were among the three most common causes of WD overall and by age- and sex-specific respondents across diagnosed chronic conditions. Quantifying the prevalence and causes of work disability by age and sex can help prioritize interventions. Published by Elsevier Inc.

  12. Effect of conditioning by PAM polymers with different charges on the structural and characteristic evolutions of water treatment residuals.

    Science.gov (United States)

    Yan, W L; Wang, Y L; Chen, Y J

    2013-11-01

    Three types of polyacrylamide (PAM) flocculants with different charges (cationic PAM WD4960, nonionic PAM M351, and anionic PAM WDA110) were used for water treatment residuals (WTRs) conditioning, and the physicochemical, morphological and structural characteristics of raw and conditioned WTRs were investigated. Rheological methods were employed to analyze the internal structural transition between the raw and conditioned WTRs under a typical dosage of WD4960. Results showed that when the raw WTRs were conditioned with the polymers, the optimum dosage of WD4960 was 4.82 g/kg total suspended solid (TSS) while that of both M351 and WDA110 was 7.24 g/kg TSS. The residual PAM content in the supernatant of the WTR matrix conditioned at the optimum WD4960 dosage was 5.59 mg/L, which is the least among the supernatants obtained with the three types of PAM. Furthermore, the visible fulvic acid (FA) in the supernatant disappeared and the intensity of the ultraviolet FA decreased. The average diameter of irregularly shaped aggregates in the WTR suspensions increased from 35.73 μm to several hundred micrometers with increasing PAM dosage. The size of WTR aggregates conditioned at the optimum WD4960 dosage was much larger than that of aggregates obtained at the optimum M351 or WDA110 dosages. Two-dimensional fractal dimension (D2) values presented an increasing trend with increasing PAM dosage. D2 values of the conditioned WTR aggregates were 1.87, 1.76, and 1.83 at optimum WD4960, M351, and WDA110 dosages, respectively. The cationic PAM (CPAM) WD4960 thus appears to be a more ideal conditioner for WTRs. Consistent relationships were observed among the capillary suction time (CST), average particle size, and D2 values of the conditioned WTR aggregates at the optimum WD4960 dosage. Mass fractal dimensions (D(f)) indicated that both the raw and WD4960-conditioned WTRs behave like weak-link flocs/aggregates. D(f) values (log G'-log TSS) of the WTR aggregates before and after

  13. Modeling solute segregation during the solidification of γ-phase U-Mo alloys

    Energy Technology Data Exchange (ETDEWEB)

    Steiner, M.A., E-mail: mas4cw@virginia.edu [University of Virginia, Material Science and Engineering, 395 McCormick Rd, Charlottesville, VA 22904 (United States); Garlea, E. [Y-12 National Security Complex, Oak Ridge, TN 37831 (United States); Agnew, S.R. [University of Virginia, Material Science and Engineering, 395 McCormick Rd, Charlottesville, VA 22904 (United States)

    2016-06-15

    Using first principles calculations, it is demonstrated that solute segregation during U-Mo solidification can be modeled using the classic Brody-Fleming limited diffusion framework. The necessary supporting equations specific to the U-Mo alloy, along with careful verification of the assumptions underpinning the Brody-Fleming model are developed, allowing for concentration profile predictions as a function of alloy composition and cooling rate. The resulting model is compared to experimental solute concentration profiles, showing excellent agreement. Combined with complementary modeling of dendritic feature sizes, the solute segregation model can be used to predict the complete microstructural state of individual U-Mo volume elements based upon cooling rates, informing ideal processing routes.

  14. [Great discoveries: from the painstaking efforts of researchers to the contribution of accidental findings and the dissemination of study results].

    Science.gov (United States)

    Garattini, Silvio

    2015-06-01

    This article takes its cue from the original work of sir Alexander Fleming on penicillin, published in the first issue of Recenti Progressi in Medicina in 1946 and reproduced here on the occasion of the approaching 70-year anniversary of the journal. The path that brought Fleming to the discovery of penicillin, one of the major milestones in the history of clinical pharmacology, provides insight for a range of considerations: the painstaking efforts of researchers, the contribution from accidental findings, and the dissemination of study results. Although the discovery of penicillin has changed the course of medicine, the benefits deriving from such an important advance are most likely to be offset by the overprescription of antibiotics, which is the leading cause of antimicrobial resistance and one of the most serious public health problems of our time.

  15. Maternal exposure to Western diet affects adult body composition and voluntary wheel running in a genotype-specific manner in mice.

    Science.gov (United States)

    Hiramatsu, Layla; Kay, Jarren C; Thompson, Zoe; Singleton, Jennifer M; Claghorn, Gerald C; Albuquerque, Ralph L; Ho, Brittany; Ho, Brett; Sanchez, Gabriela; Garland, Theodore

    2017-10-01

    Some human diseases, including obesity, Type II diabetes, and numerous cancers, are thought to be influenced by environments experienced in early life, including in utero. Maternal diet during the perinatal period may be especially important for adult offspring energy balance, potentially affecting both body composition and physical activity. This effect may be mediated by the genetic background of individuals, including, for example, potential "protective" mechanisms for individuals with inherently high levels of physical activity or high basal metabolic rates. To examine some of the genetic and environmental factors that influence adult activity levels, we used an ongoing selection experiment with 4 replicate lines of mice bred for high voluntary wheel running (HR) and 4 replicate, non-selected control lines (C). Dams (half HR and half C) were fed a "Western" diet (WD, high in fat and sucrose) or a standard diet (SD) from 2weeks prior to mating until their pups could feed on solid food (14days of age). We analyzed dam and litter characteristics from birth to weaning, and offspring mass and physical activity into adulthood. One male offspring from each litter received additional metabolic and behavioral tests. Maternal WD caused pups to eat solid food significantly earlier for C litters, but not for HR litters (interaction of maternal environment and genotype). With dam mass as a covariate, mean pup mass was increased by maternal WD but litter size was unaffected. HR dams had larger litters and tended to have smaller pups than C dams. Home-cage activity of juvenile focal males was increased by maternal WD. Juvenile lean mass, fat mass, and fat percent were also increased by maternal WD, but food consumption (with body mass as a covariate) was unaffected (measured only for focal males). Behavior in an elevated plus maze, often used to indicate anxiety, was unaffected by maternal WD. Maximal aerobic capacity (VO 2 max) was also unaffected by maternal WD, but HR had

  16. Catalog of Audiovisual Productions. Volume 2. Navy and Marine Corps Productions

    Science.gov (United States)

    1984-06-01

    HAS BEEN CALLED THE -RAW NERVE OF INSTANT DEATH-. FLEMINGS CAREFULLY LAID BARREL, A AMERICAN DEMOCRATIC SOCIETY.. PLANS ARE UPSET WHEN HIS DAUGHTER AND...NoTCLEARED UNCL NoT CLEARED CONF SPAGHETTI, NOODLES , BEANS, MEAL, CEREALS. THIS FILM IS CLASSIFIED CONFIDENTIAL REMARKS: AVAILABLE AT NAVY GENERAL...TESTING. SHOWS USE OF ILLUSIGS, THE IMPORTANCE OF RECOGNIZING SATELLITE OPERATIONS IN RELATION TO INSTANT CRITERION REFERENCED TESTS TO MILITARY

  17. Living Labs in South Africa: An analysis based on five case studies

    CSIR Research Space (South Africa)

    Coetzee, H

    2012-08-01

    Full Text Available participants according to individuals? previous experiences (Carr and Kemmis, 1986). It is in the social context that one can find various groups interacting with one another and with objects within a given context. Therefore interpretive researchers underpin... the priority is much more about developing specific services for people. Existing research areas include User Centred Design, User Experience (ISTAG EAR report, 2004; Aarts & Marzano, 2003; de Ruyter et al., 2007), User Group Experience (Fleming, 1998...

  18. Tbe use of drama tecbniques as a teacbing resource to tbe development of speaking and listening skills in tbe language classroom in Chile

    OpenAIRE

    PENA, VICTOR

    2009-01-01

    It is commonly assumed that drama and drama techniques implies the act of reading and performing plays or presentations (Fleming, 1998: 1; Holden, 1981:8) rather than acting as strategies or aids that support the teaching and leaming processes. Notwithstanding the lack of literature devoted to sorne drama techniques, this study aims to unpack the drama techniques used by English secondary teachers in the development of the listening and speaking skills in a Chilean context. Motivated by m y ...

  19. THE USE OF DRAMA TECHNIQUES AS A TEACHING RESOURCE TO THE DEVELOPMENT OF SPEAKING AND LISTENING SKILLS IN THE LANGUAGE CLASSROOM IN CHILE

    OpenAIRE

    PENA AMOS; VICTOR; PENA AMOS; VICTOR

    2009-01-01

    It is commonly assumed that drama and drama techniques implies the act of reading and performing plays or presentations (Fleming, 1998: 1; Holden, 1981:8) rather than acting as strategies or aids that support the teaching and leaming processes. Notwithstanding the lack of literature devoted to sorne drama techniques, this study aims to unpack the drama techniques used by English secondary teachers in the development of the listening and speaking skills in a Chilean context. Motivated by...

  20. Knowledge sharing in intercultural team work : what factors can influence knowledge sharing process in intercultural team work? the case of Finnish and Vietnamese team

    OpenAIRE

    Truong, Minh Chau

    2010-01-01

    The transition from an industrial to a post industrial knowledge economy provides and increases in the proportion of jobs that are knowledge intensive. There are statistical analyses typically show that managerial and professional work regarding to knowledge intensive becoming one of the fastest growing occupational groups since the 1980s. Elias and Gregory; Fleming et al. (1994, cited in Hislop 2013:7). Knowledge management, therefore is a contemporary field which provides many interesting ...

  1. Tension Tests On Bored Piles In Sand

    DEFF Research Database (Denmark)

    Krabbenhøft, Sven; Clausen, Johan; Damkilde, Lars

    2006-01-01

    The lengths of the bored piles varied from 2 m to 6 m and all were of a diameter of 140 mm. The piles were tested to failure in tension and the load-displacement relations were recorded. The investigation has shown pronounced differences between the load bearing capacities obtained by different...... design methods. The methods proposed by Fleming et al. and Reese & O’Neill seem to produce the best match with the test results....

  2. Assessment of Antibiotic Resistant Commensal Bacteria in Food

    Science.gov (United States)

    2006-01-01

    mold Penicillium was able to inhibit the growth of some bacteria. (37). In 1928, a Brittish physician Alexander Fleming observed the similar...phenomenon. One of his bacterial plate cultures was contaminated with the blue-green mold Penicillium , and the bacterial colonies in close approximation to...sliced chicken lunchmeat, and the strain was identified as Pseudomonas sp . ART bacteria were isolated sporadically in 32 lunchmeat, which is

  3. Synthesis of all eight L-glycopyranosyl donors using C-H activation

    DEFF Research Database (Denmark)

    Frihed, Tobias; Pedersen, Christian Marcus; Bols, Mikael

    2014-01-01

    by an intramolecular C-H activation of the methyl group in g-position; both steps were catalyzed by iridium. The following Fleming-Tamao oxidation and acetylation gave the suitably protected L-hexoses. This is the first general method for the preparation of all eight L-hexoses as their thioglycosyl donors ready...... for glycosylation and the first example of an iridium-catalyzed C(sp3)-H activation on sulfide-containing compounds....

  4. Understanding adolescent loneliness : longitudinal and cross-sectional relationships with attachment, emotion regulation, and coping.

    OpenAIRE

    Heinrich, Liesl Michelle

    2017-01-01

    Loneliness is an emotionally unpleasant experience which is associated with a host of psychosocial and mental health problems, such as low self-esteem, poor social skills, fewer and poorer quality friendships, social anxiety, depression, poorer life satisfaction, and suicidal thoughts and behaviour (e.g., see Heinrich & Gullone, 2006, for a review). It affects as many as 74% of adolescents in any given 12 month period (Fleming & Jacobsen, 2009), with painful and persistent feelings of lonelin...

  5. Frugivores and seed dispersal: mechanisms and consequences for biodiversity of a key ecological interaction

    OpenAIRE

    Jordano, Pedro; Forget, Pierre-Michel; Lambert, Joanna E.; Böhning-Gaese, Katrin; Traveset, Anna; Wright, S. Joseph

    2010-01-01

    The 5th Symposium on Frugivores and Seed Dis- persal, held in Montpellier (France), 13 – 18 June 2010, brought together more than 220 researchers exemplifying a wide diversity of approaches to the study of frugivory and dispersal of seeds. Fol- lowing Ted Fleming and Alejandro Estrada’s initiative in 1985, this event was a celebration of the 25th anniversary of the first meeting in Veracruz, Mexico. Frugivory and seed dispersal are active research areas that hav...

  6. It cannot kill a mouse, though it can heal a man

    DEFF Research Database (Denmark)

    Alstrup, Aage Kristian Olsen

    2015-01-01

    Selvom dyreforsøg har været altafgørende for forståelsen af menneskets fysiologi og sygdomme, så er der også ret mange eksempler på, at dyreforsøg har vildledt forskerne. Blandt forskere florerer der en påstand om, at hvis Alexander Fleming havde testet penicillin på gnavere, så ville de være død...

  7. The Shock and Vibration Digest. Volume 16, Number 7

    Science.gov (United States)

    1984-07-01

    Dr. Lynn Rogers 7 O A&I Mr. William Flannelly Mr. J.B. Sandifer * TABj Mr. William Flathau Dr. Richard Skop TB Dr. David Fleming Mr. David Smallwood ...Wang and A. Olabimtan A. Cabelli and I.C. Shepherd Univ. of Oklahoma, Norman , OK, Rept. No. FSEL/ Commonwealth Scientific and Industrial Res. Organi...and the ability to excite structures from simple harmonic motion to ex- D.O. Smallwood pected multifrequency response-time histories are possible

  8. THE DETERMINATION OF THE COSTA RICA COLON/USD EXCHANGE RATE

    OpenAIRE

    Yu Hsing

    2009-01-01

    The purpose of this paper is to compare four major exchange rate models for the Costa Rica Colon. We examine exchange rate data for the Costa Rica/U.S. dollar relationship from 1981-2007 and find that monetary models have a higher explanatory ability whereas the Mundell-Fleming model performs better in forecasting exchange rates than other models. The coefficient of the interest rate differential in the uncovered interest parity model has a wrong sign.

  9. Monetary shocks and stock returns: identification through the impossible trinity

    OpenAIRE

    Ali K. Ozdagli; Yifan Yu

    2012-01-01

    This paper attempts to identify how monetary policy shocks affect stock prices by using Mundell and Fleming's theory of the "Impossible Trinity." According to this theory, it is impossible to simultaneously have a fixed exchange rate, free capital movement (an absence of capital controls), and an independent monetary policy. The authors present evidence that Hong Kong's monetary policy is heavily dependent on the monetary policy of the United States, a stance which is consistent with this the...

  10. Some Ethical-Moral Concerns in Administration.

    Science.gov (United States)

    Enns, Frederick

    1981-01-01

    Presents and analyzes moral-ethical issues that arise in administration and concludes that past descriptive, objective, and scientific approaches to administration have failed to take full account of the moral-ethical dimension of human existence. (Author/WD)

  11. ARTIFICIAL NEURAL NETWORK AND WAVELET DECOMPOSITION IN THE FORECAST OF GLOBAL HORIZONTAL SOLAR RADIATION

    Directory of Open Access Journals (Sweden)

    Luiz Albino Teixeira Júnior

    2015-04-01

    Full Text Available This paper proposes a method (denoted by WD-ANN that combines the Artificial Neural Networks (ANN and the Wavelet Decomposition (WD to generate short-term global horizontal solar radiation forecasting, which is an essential information for evaluating the electrical power generated from the conversion of solar energy into electrical energy. The WD-ANN method consists of two basic steps: firstly, it is performed the decomposition of level p of the time series of interest, generating p + 1 wavelet orthonormal components; secondly, the p + 1 wavelet orthonormal components (generated in the step 1 are inserted simultaneously into an ANN in order to generate short-term forecasting. The results showed that the proposed method (WD-ANN improved substantially the performance over the (traditional ANN method.

  12. Data of evolutionary structure change: 1A01A-2ZLWD [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1A01A-2ZLWD 1A01 2ZLW A D -VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPT...R VQLSGEEKAAVLALWDKVN--EEEVGGEALGRLLVVYPWTQRFFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSEL...dex> 2ZLW D 2ZLWD WD

  13. Mismanagement of Wilson's disease as psychotic disorder.

    Science.gov (United States)

    Bidaki, Reza; Zarei, Mina; Mirhosseini, S M Mahdy; Moghadami, Samar; Hejrati, Maral; Kohnavard, Marjan; Shariati, Behnam

    2012-01-01

    Wilson's disease (WD) or hepatolenticular degeneration is an inherited neurodegenerative disorder of copper metabolism (autosomal recessive, chromosome13). Psychiatric disorders in WD include dementia, characterized by mental slowness, poor concentration, and memory impairment. Symptoms may progress rapidly, especially in younger patients, but are more often gradual in development with periods of remission and exacerbation. Delusional disorder and schizophrenia-like psychosis are rare forms of psychiatric presentation. In this report, the patient with WD presented by psychosis symptoms and treated mistaken as schizophrenia for almost ten years. Although he has treated with antipsychotics, he had periods of remissions and relapses and never was symptoms free. Since psychosis can be the manifestation of medical diseases such as WD, overall view of these patients is necessary and medical diseases should be considered as a differential diagnosis.

  14. Schostakowitsch: Fünf Ballettsuiten, Suite aus Katerina Ismailova, Festliche Ouvertüre op. 96. Royal Scottisch National Orchestra, Neeme Järvi / Helge Grünewald

    Index Scriptorium Estoniae

    Grünewald, Helge

    1995-01-01

    Uuest heliplaadist "Schostakowitsch: Fünf Ballettsuiten, Suite aus Katerina Ismailova, Festliche Ouvertüre op. 96. Royal Scottisch National Orchestra, Neeme Järvi. Chandos/Koch 2 CD 700/1 (WD:114'36")

  15. How to Get What You Need When You Go Eyeball-to-Eyeball with Lawmakers.

    Science.gov (United States)

    Holcomb, John H.

    1981-01-01

    Offers guidelines for educators who are invited to testify before lawmakers, whether a committee of Congress, a state legislature, or a local zoning board. Includes advice on pretestimony strategy, presenting the testimony, and follow-up. (WD)

  16. Poliomyelitis

    Science.gov (United States)

    ... poliomyelitis in most people (immunization is over 90% effective). Alternative Names ... S, Arnold WD. Motor neuron diseases. In: Cifu DX, ed. Braddom's Physical Medicine and Rehabilitation . 5th ed. Philadelphia, PA: Elsevier; 2016: ...

  17. Evocatin of the Spirit: A-capella-Werke von Gorecki, Pärt, Martin, Barber und Schönberg / Gerhard Pätzig

    Index Scriptorium Estoniae

    Pätzig, Gerhard

    1995-01-01

    Uuest heliplaadist "Evocatin of the Spirit: A-capella-Werke von Gorecki, Pärt, Martin, Barber und Schönberg. Robert Shaw Festival Singers. Robert Shaw (AD: 1994). Telarc/in-akustik CD 80406 (WD: 72'15")

  18. Public Service? Tax Credits?

    Science.gov (United States)

    Shanker, Albert

    1982-01-01

    Acknowledges the good work of private schools but resists the provision of further direct or indirect government aid to these schools. Argues that tax credits will adversely affect public education and American society. (Author/WD)

  19. Wilson's Disease in Children : A Position Paper by the Hepatology Committee of the European Society for Paediatric Gastroenterology, Hepatology and Nutrition

    NARCIS (Netherlands)

    Socha, Piotr; Janczyk, Wojciech; Dhawan, Anil; Baumann, Ulrich; D'Antiga, Lorenzo; Tanner, Stuart; Iorio, Raffaele; Vajro, Pietro; Houwen, Roderick; Fischler, Björn; Dezsofi, Antal; Hadzic, Nedim; Hierro, Loreto; Jahnel, Jörg; McLin, Valérie; Nobili, Valerio; Smets, Francoise; Verkade, Henkjan J.; Debray, Dominique

    BACKGROUND: Clinical presentations of Wilson's disease (WD) in childhood ranges from asymptomatic liver disease to cirrhosis or acute liver failure, whereas neurological and psychiatric symptoms are rare. The basic diagnostic approach includes serum ceruloplasmin and 24-hour urinary copper

  20. Soil structure changes evaluated with computed tomography;Mudancas na estrutura do solo avaliada com uso de tomografia computadorizada

    Energy Technology Data Exchange (ETDEWEB)

    Pires, Luiz Fernando [Universidade Estadual de Ponta Grossa (UEPG), PR (Brazil). Dept. de Fisica; Bacchi, Osny Oliveira Santos, E-mail: osny@cena.usp.b [Centro de Energia Nuclear na Agricultura (CENA/USP), Piracicaba, SP (Brazil)

    2010-04-15

    The objective of this work was to evaluate in millimetric scale changes in soil bulk density and porosity, using the gamma-ray computed tomography in soil samples with disturbed structure due to wetting and drying (W-D) cycles. Soil samples with 98.1 cm{sup 3} were sieved using a 2 mm mesh and homogeneously packed in PVC cylinders. Soil samples were submitted to 1, 2, and 3 W-D cycles. Control samples were not submitted to W-D cycles. After repetitions of W-D cycles, soil sample porosity decreased and soil layers became denser. Computed tomography allowed a continuous analysis of soil bulk density and also soil porosity along millimetric (0.08 cm) layers, what cannot be provided by traditional methods used in soil physics. (author)

  1. Pärt: Fratres in sechs Versionen. Festina lente. Summa / C. S.

    Index Scriptorium Estoniae

    C. S.

    1997-01-01

    Uuest heliplaadist "Pärt: Fratres in sechs Versionen. Festina lente. Summa. Cantus in memoriam Benjamin Britten. Orchester der Ungarischen Staatsoper, Tamas Benedek". Naxos CD 8 553 750 (WD:79'06") DDD

  2. TIDAL NOVAE IN COMPACT BINARY WHITE DWARFS

    International Nuclear Information System (INIS)

    Fuller, Jim; Lai Dong

    2012-01-01

    Compact binary white dwarfs (WDs) undergoing orbital decay due to gravitational radiation can experience significant tidal heating prior to merger. In these WDs, the dominant tidal effect involves the excitation of outgoing gravity waves in the inner stellar envelope and the dissipation of these waves in the outer envelope. As the binary orbit decays, the WDs are synchronized from outside in (with the envelope synchronized first, followed by the core). We examine the deposition of tidal heat in the envelope of a carbon-oxygen WD and study how such tidal heating affects the structure and evolution of the WD. We show that significant tidal heating can occur in the star's degenerate hydrogen layer. This layer heats up faster than it cools, triggering runaway nuclear fusion. Such 'tidal novae' may occur in all WD binaries containing a CO WD, at orbital periods between 5 minutes and 20 minutes, and precede the final merger by 10 5 -10 6 years.

  3. System for indicating fuel-efficient aircraft altitude

    Science.gov (United States)

    Gary, B. L. (Inventor)

    1984-01-01

    A method and apparatus are provided for indicating the altitude at which an aircraft should fly so the W/d ratio (weight of the aircraft divided by the density of air) more closely approaches the optimum W/d for the aircraft. A passive microwave radiometer on the aircraft is directed at different angles with respect to the horizon to determine the air temperature, and therefore the density of the air, at different altitudes. The weight of the aircraft is known. The altitude of the aircraft is changed to fly the aircraft at an altitude at which is W/d ratio more closely approaches the optimum W/d ratio for that aircraft.

  4. The Molecular Genetics of von Willebrand Disease

    Directory of Open Access Journals (Sweden)

    Ergül Berber

    2012-12-01

    Full Text Available Quantitative and/or qualitative deficiency of von Willebrand factor (vWF is associated with the most common inherited bleeding disease von Willebrand disease (vWD. vWD is a complex disease with clinical and genetic heterogeneity. Incomplete penetrance and variable expression due to genetic and environmental factors contribute to its complexity. vWD also has a complex molecular pathogenesis. Some vWF gene mutations are associated with the affected vWF biosynthesis and multimerization, whereas others are associated with increased clearance and functional impairment. Moreover, in addition to a particular mutation, type O blood may result in the more severe phenotype. The present review aimed to provide a summary of the current literature on the molecular genetics of vWD.

  5. The molecular genetics of von Willebrand disease.

    Science.gov (United States)

    Berber, Ergül

    2012-12-01

    Quantitative and/or qualitative deficiency of von Willebrand factor (vWF) is associated with the most common inherited bleeding disease von Willebrand disease (vWD). vWD is a complex disease with clinical and genetic heterogeneity. Incomplete penetrance and variable expression due to genetic and environmental factors contribute to its complexity. vWD also has a complex molecular pathogenesis. Some vWF gene mutations are associated with the affected vWF biosynthesis and multimerization, whereas others are associated with increased clearance and functional impairment. Moreover, in addition to a particular mutation, type O blood may result in the more severe phenotype. The present review aimed to provide a summary of the current literature on the molecular genetics of vWD. None declared.

  6. Robust Imaging Methodology for Challenging Environments: Wave Equation Dispersion Inversion of Surface Waves

    KAUST Repository

    Li, Jing; Schuster, Gerard T.; Zeng, Zhaofa

    2017-01-01

    A robust imaging technology is reviewed that provide subsurface information in challenging environments: wave-equation dispersion inversion (WD) of surface waves for the shear velocity model. We demonstrate the benefits and liabilities of the method

  7. Effects of Periwinkle Shell Ash on Lime-Stabilized Lateritic Soil ...

    African Journals Online (AJOL)

    ADOWIE PERE

    Keywords: atterberg limits, lateritic soil, lime stabilization, periwinkle shell ash .... specimen were prepared by carefully and completely ..... Fourth Edition. Canada: CENGAGE Learning. Holtz, RD; Kovacs, WD (1981). ... Potentials of Sugar cane.

  8. Middle-aged heterozygous carriers of Wilson's disease do not ...

    Indian Academy of Sciences (India)

    957 Warsaw, Poland. 2Medical University of Warsaw, Department of Experimental and Clinical Pharmacology, 00–325 Warsaw, Poland. Introduction. Wilson disease (WD) is an autosomal recessive disor- der of copper (Cu) metabolism (OMIM ...

  9. Organisational Role Climates: Success-Failure Configurations in Educational Leadership (or Are Educational Administrators Doomed to Succeed?)

    Science.gov (United States)

    Inbar, Dan E.

    1980-01-01

    Presents an analytical framework based on a threefold classification--unequivocal failure, "satisficing," and unequivocal success--and four basic role climates--apathetic, frustrating, tense, and tranquil--that is applied to the elementary school principalship. (Author/WD)

  10. Soil structure changes evaluated with computed tomography

    International Nuclear Information System (INIS)

    Pires, Luiz Fernando

    2010-01-01

    The objective of this work was to evaluate in millimetric scale changes in soil bulk density and porosity, using the gamma-ray computed tomography in soil samples with disturbed structure due to wetting and drying (W-D) cycles. Soil samples with 98.1 cm 3 were sieved using a 2 mm mesh and homogeneously packed in PVC cylinders. Soil samples were submitted to 1, 2, and 3 W-D cycles. Control samples were not submitted to W-D cycles. After repetitions of W-D cycles, soil sample porosity decreased and soil layers became denser. Computed tomography allowed a continuous analysis of soil bulk density and also soil porosity along millimetric (0.08 cm) layers, what cannot be provided by traditional methods used in soil physics. (author)

  11. Win, Lose, Draw: The Grievance Process in Practice.

    Science.gov (United States)

    Dalton, Dan R.; Todor, William D.

    1981-01-01

    Discusses types of grievances in American industrial relations, their costs, and ways of resolving them. Accompanying tables indicate the frequency of different categories of grievances and resolutions. (Author/WD)

  12. Nabothian cyst

    Science.gov (United States)

    ... Procedures for Primary Care . 3rd ed. Philadelphia, PA: Elsevier Mosby; 2011:chap 135. Dolan MS, Hill C, ... FA, eds. Comprehensive Gynecology . 7th ed. Philadelphia, PA: Elsevier; 2017:chap 18. Hertzberg BS, Middleton WD. Pelvis ...

  13. Raynaud phenomenon

    Science.gov (United States)

    ... eds. Current Surgical Therapy . 12th ed. Philadelphia, PA: Elsevier; 2017:1047-1052. Herrick AL, Muir L. Raynaud's ... eds. Rutherford's Vascular Surgery. 8th ed. Philadelphia, PA: Elsevier Saunders; 2014:chap 122. James WD, Elston DM, ...

  14. COX-2 disruption leads to increased central vasopressin stores and impaired urine concentrating ability in mice

    DEFF Research Database (Denmark)

    Norregaard, Rikke; Madsen, Kirsten Morill; Hansen, Pernille Bl

    2011-01-01

    It was hypothesized that cyclooxygenase-2 (COX-2) activity promotes urine concentrating ability through stimulation of vasopressin (AVP) release after water deprivation (WD). COX-2-deficient (COX-2(-/-), C57BL/6) and wild-type (WT) mice were water deprived for 24 h, and water balance, central AVP m...... osmolality in COX-2(-/-) mice irrespective of gender. Hypothalamic AVP mRNA level increased and was unchanged between COX-2(-/-) and WT after WD. AVP peptide content was higher in COX-2(-/-) compared with WT. At baseline, plasma AVP concentration was elevated in conscious chronically catheterized COX-2......(-/-) mice, but after WD plasma AVP was unchanged between COX-2(-/-) and WT mice (43 ± 11 vs. 70 ± 16 pg/ml). Renal V2 receptor abundance was downregulated in COX-2(-/-) mice. Medullary interstitial osmolality increased and did not differ between COX-2(-/-) and WT after WD. Aquaporin-2 (AQP2; cortex...

  15. BIBLIOGRAFIE

    African Journals Online (AJOL)

    . 1981. The South African churches in a revolutionary situation. Maryknoll NY: Orbis. JONKER, W.D.. 1962. Die Sendingbepalinge van die Ned. Gereformeerde Kerk van Transvaal. Pot chefstroom: StudieGroep: Kerk en Wêreld. Studiereeks No ...

  16. Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris / Hanspeter Krellmann

    Index Scriptorium Estoniae

    Krellmann, Hanspeter

    1990-01-01

    Uuest heliplaadist "Kalinnikov: Sinfonie Nr.2 A-Dur, Ouvertüre Zar Boris, Die Zeder und die Palme. Scottish National Orchestra, Neeme Järvi" (AD: 1989) Chandos / Koch Records CD 8805 (WD: 59'40") DDD

  17. Simulation-based Agent Support in a Synthetic Team-based C2 Task Environment

    National Research Council Canada - National Science Library

    Elliott, Linda R; Chaiken, Scott; Dalrymple, Mathieu; Petrov, Plamen; Stoyen, Alexander

    2000-01-01

    In our long-term program of research in command and control (C2) teamwork and performance, we have extensively analyzed the roles, responsibilities, and interdependencies of Airborne Warning and Control System (AWACS) Weapons Director (WD...

  18. Do Managers Clone Themselves?

    Science.gov (United States)

    Baron, Alma S.

    1981-01-01

    A recent questionnaire survey provides statistics on male managers' views of female managers. The author recommends that male managers break out of their cloning behavior and that the goal ought to be a plurality in management. (Author/WD)

  19. Bartok: Der holzgeschnitzte Prinz / Bernhard Uske

    Index Scriptorium Estoniae

    Uske, Bernhard

    1991-01-01

    Uuest heliplaadist "Bartok: Der holzgeschnitzte Prinz [The Wooden Prince complete ballet] op. 13. Ungarische Bilder [Hungarian Pictures]. Philharmonia Orchestra [The Philharmonia] Neeme Järvi". Chandos/Koch Records CD 8895 (WD:65'51") DDD

  20. A white dwarf companion to the main-sequence star 4 Omicron(1) Orionis and the binary hypothesis for the origin of peculiar red giants

    Science.gov (United States)

    Ake, Thomas B.; Johnson, Hollis R.

    1988-01-01

    Ultraviolet spectra of the peculiar red giants (PRGs) called MS stars are investigated, and the discovery of a white dwarf (WD) companion to the MS star 4 Omicron(1) Orionis is reported. The observations and data analysis are discussed and compared with those for field WDs in order to derive parameters for the WD and the luminosity of the primary. Detection limits for the other MS stars investigated are derived, and the binary hypothesis for PRGs is reviewed.

  1. Repeated restraint stress exposure during early withdrawal accelerates incubation of cue-induced cocaine craving.

    Science.gov (United States)

    Glynn, Ryan M; Rosenkranz, J Amiel; Wolf, Marina E; Caccamise, Aaron; Shroff, Freya; Smith, Alyssa B; Loweth, Jessica A

    2018-01-01

    A major challenge for treating cocaine addiction is the propensity for abstinent users to relapse. Two important triggers for relapse are cues associated with prior drug use and stressful life events. To study their interaction in promoting relapse during abstinence, we used the incubation model of craving and relapse in which cue-induced drug seeking progressively intensifies ('incubates') during withdrawal from extended-access cocaine self-administration. We tested rats for cue-induced cocaine seeking on withdrawal day (WD) 1. Rats were then subjected to repeated restraint stress or control conditions (seven sessions held between WD6 and WD14). All rats were tested again for cue-induced cocaine seeking on WD15, 1 day after the last stress or control session. Although controls showed a time-dependent increase in cue-induced cocaine seeking (incubation), rats exposed to repeated stress in early withdrawal exhibited a more robust increase in seeking behavior between WD1 and WD15. In separate stressed and control rats, equivalent cocaine seeking was observed on WD48. These results indicate that repeated stress in early withdrawal accelerates incubation of cocaine craving, although craving plateaus at the same level were observed in controls. However, 1 month after the WD48 test, rats subjected to repeated stress in early withdrawal showed enhanced cue-induced cocaine seeking following acute (24 hours) food deprivation stress. Together, these data indicate that chronic stress exposure enhances the initial rate of incubation of craving during early withdrawal, resulting in increased vulnerability to cue-induced relapse during this period, and may lead to a persistent increase in vulnerability to the relapse-promoting effects of stress. © 2016 Society for the Study of Addiction.

  2. Study protocol for a group randomized controlled trial of a classroom-based intervention aimed at preventing early risk factors for drug abuse: integrating effectiveness and implementation research.

    Science.gov (United States)

    Poduska, Jeanne; Kellam, Sheppard; Brown, C Hendricks; Ford, Carla; Windham, Amy; Keegan, Natalie; Wang, Wei

    2009-09-02

    While a number of preventive interventions delivered within schools have shown both short-term and long-term impact in epidemiologically based randomized field trials, programs are not often sustained with high-quality implementation over time. This study was designed to support two purposes. The first purpose was to test the effectiveness of a universal classroom-based intervention, the Whole Day First Grade Program (WD), aimed at two early antecedents to drug abuse and other problem behaviors, namely, aggressive, disruptive behavior and poor academic achievement. The second purpose--the focus of this paper--was to examine the utility of a multilevel structure to support high levels of implementation during the effectiveness trial, to sustain WD practices across additional years, and to train additional teachers in WD practices. The WD intervention integrated three components, each previously tested separately: classroom behavior management; instruction, specifically reading; and family-classroom partnerships around behavior and learning. Teachers and students in 12 schools were randomly assigned to receive either the WD intervention or the standard first-grade program of the school system (SC). Three consecutive cohorts of first graders were randomized within schools to WD or SC classrooms and followed through the end of third grade to test the effectiveness of the WD intervention. Teacher practices were assessed over three years to examine the utility of the multilevel structure to support sustainability and scaling-up. The design employed in this trial appears to have considerable utility to provide data on WD effectiveness and to inform the field with regard to structures required to move evidence-based programs into practice. NCT00257088.

  3. Amiloride Improves Endothelial Function and Reduces Vascular Stiffness in Female Mice Fed a Western Diet

    Directory of Open Access Journals (Sweden)

    Luis A. Martinez-Lemus

    2017-06-01

    Full Text Available Obese premenopausal women lose their sex related cardiovascular disease protection and develop greater arterial stiffening than age matched men. In female mice, we have shown that consumption of a Western diet (WD, high in fat and refined sugars, is associated with endothelial dysfunction and vascular stiffening, which occur via activation of mineralocorticoid receptors and associated increases in epithelial Na+ channel (ENaC activity on endothelial cells (EnNaC. Herein our aim was to determine the effect that reducing EnNaC activity with a very-low-dose of amiloride would have on decreasing endothelial and arterial stiffness in young female mice consuming a WD. To this end, we fed female mice either a WD or control diet and treated them with or without a very-low-dose of the ENaC-inhibitor amiloride (1 mg/kg/day in the drinking water for 20 weeks beginning at 4 weeks of age. Mice consuming a WD were heavier and had greater percent body fat, proteinuria, and aortic stiffness as assessed by pulse-wave velocity than those fed control diet. Treatment with amiloride did not affect body weight, body composition, blood pressure, urinary sodium excretion, or insulin sensitivity, but significantly reduced the development of endothelial and aortic stiffness, aortic fibrosis, aortic oxidative stress, and mesenteric resistance artery EnNaC abundance and proteinuria in WD-fed mice. Amiloride also improved endothelial-dependent vasodilatory responses in the resistance arteries of WD-fed mice. These results indicate that a very-low-dose of amiloride, not affecting blood pressure, is sufficient to improve endothelial function and reduce aortic stiffness in female mice fed a WD, and suggest that EnNaC-inhibition may be sufficient to ameliorate the pathological vascular stiffening effects of WD-induced obesity in females.

  4. Inter-relationships among Diet, Obesity and Hippocampal-dependent Cognitive Function

    OpenAIRE

    Davidson, Terry L.; Hargrave, Sara L.; Swithers, Susan E.; Sample, Camille H.; Fu, Xue; Kinzig, Kimberly P.; Zheng, Wei

    2013-01-01

    Intake of a Western diet (WD), which is high in saturated fat and sugar, is associated with deficits in hippocampal-dependent learning and memory processes as well as with markers of hippocampal pathology. In the present study, rats were trained to asymptote on hippocampal-dependent serial feature negative (FN) and hippocampal-independent simple discrimination problems. Performance was then assessed following 7 days on ad libitum chow and after 10, 24, 40, 60, and 90 days of maintenance on WD...

  5. Measles Virus Nucleocapsid (MVNP) Gene Expression and RANK Receptor Signaling in Osteoclast Precursors, Osteoclast Inhibitors Peptide Therapy for Pagets Disease

    Science.gov (United States)

    2008-10-01

    PS, Zurbriggen A, Cosby SL, Dickson GR, Fraser WD, Ooi CG, Selby PL, Crisp AJ, Wallace RG, Kahn S, Ralston SH 2000 A negative search for a...Zurbriggen A, Cosby SL, Dickson GR, Fraser WD, Ooi CG, Selby PL, Crisp AJ, Wallace RG, Kahn S, Ralston SH. 2000. A negative search for a paramyxoviral...van Hul W, Whyte MP, Nakatsuka K, Hovy L, Anderson DM . 2000. Mutations in TNFRSF11A, affecting the signal peptide of RANK, cause familial expansile

  6. Uric acid promotes vascular stiffness, maladaptive inflammatory responses and proteinuria in western diet fed mice.

    Science.gov (United States)

    Aroor, Annayya R; Jia, Guanghong; Habibi, Javad; Sun, Zhe; Ramirez-Perez, Francisco I; Brady, Barron; Chen, Dongqing; Martinez-Lemus, Luis A; Manrique, Camila; Nistala, Ravi; Whaley-Connell, Adam T; Demarco, Vincent G; Meininger, Gerald A; Sowers, James R

    2017-09-01

    Aortic vascular stiffness has been implicated in the development of cardiovascular disease (CVD) and chronic kidney disease (CKD) in obese individuals. However, the mechanism promoting these adverse effects are unclear. In this context, promotion of obesity through consumption of a western diet (WD) high in fat and fructose leads to excess circulating uric acid. There is accumulating data implicating elevated uric acid in the promotion of CVD and CKD. Accordingly, we hypothesized that xanthine oxidase(XO) inhibition with allopurinol would prevent a rise in vascular stiffness and proteinuria in a translationally relevant model of WD-induced obesity. Four-week-old C57BL6/J male mice were fed a WD with excess fat (46%) and fructose (17.5%) with or without allopurinol (125mg/L in drinking water) for 16weeks. Aortic endothelial and extracellular matrix/vascular smooth muscle stiffness was evaluated by atomic force microscopy. Aortic XO activity, 3-nitrotyrosine (3-NT) and aortic endothelial sodium channel (EnNaC) expression were evaluated along with aortic expression of inflammatory markers. In the kidney, expression of toll like receptor 4 (TLR4) and fibronectin were assessed along with evaluation of proteinuria. XO inhibition significantly attenuated WD-induced increases in plasma uric acid, vascular XO activity and oxidative stress, in concert with reductions in proteinuria. Further, XO inhibition prevented WD-induced increases in aortic EnNaC expression and associated endothelial and subendothelial stiffness. XO inhibition also reduced vascular pro-inflammatory and maladaptive immune responses induced by consumption of a WD. XO inhibition also decreased WD-induced increases in renal TLR4 and fibronectin that associated proteinuria. Consumption of a WD leads to elevations in plasma uric acid, increased vascular XO activity, oxidative stress, vascular stiffness, and proteinuria all of which are attenuated with allopurinol administration. Copyright © 2017 Elsevier Inc

  7. По зимнему бездорожью на полном приводе / Велиматти Хонканен, Яри Питкаярви и Ярмо Сукава

    Index Scriptorium Estoniae

    Хонканен, Велиматти

    2003-01-01

    Audi A4 1,8 T Quattro, BMW 325Xi, Honda HR-V 1,6i, Jaguar X-Type 3,0 V6, Mercedes-Benz E 320 4matic, Renault Scenic RX4 2,0, Škoda Octavia Combi 2,0WD, Subaru Impreza 2,0 GX, Suzuki Liana 1,6 4WD, Volvo S60 AWD

  8. Automatic Control of Freeboard and Turbine Operation

    DEFF Research Database (Denmark)

    Kofoed, Jens Peter; Frigaard, Peter Bak; Friis-Madsen, Erik

    The report deals with the modules for automatic control of freeboard and turbine operation on board the Wave dragon, Nissum Bredning (WD-NB) prototype, and covers what has been going on up to ultimo 2003.......The report deals with the modules for automatic control of freeboard and turbine operation on board the Wave dragon, Nissum Bredning (WD-NB) prototype, and covers what has been going on up to ultimo 2003....

  9. The Next Generation Virgo Cluster Survey. XXVIII. Characterization of the Galactic White Dwarf Population

    Energy Technology Data Exchange (ETDEWEB)

    Fantin, Nicholas J. [Department of Physics and Astronomy,University of Victoria, Victoria, BC, V8P 1A1 (Canada); Côté, Patrick; Gwyn, S. D. J.; Ferrarese, Laura; McConnachie, Alan [National Research Council of Canada, Herzberg Astronomy and Astrophysics Program, 5071 W. Saanich Road, Victoria, BC, V9E 2E7 (Canada); Hanes, David A. [Queen’s University, Department of Physics, Engineering Physics and Astronomy, Kingston, Ontario (Canada); Bianchi, Luciana [Department of Physics and Astronomy, The Johns Hopkins University, 3400 N. Charles Street, Baltimore, MD 21218 (United States); Cuillandre, Jean-Charles [CEA/IRFU/SAp, Laboratoire AIM Paris-Saclay, CNRS/INSU, Université Paris Diderot, Observatoire de Paris, PSL Research University, F-91191 Gif-sur-Yvette Cedex (France); Starkenburg, Else, E-mail: nfantin@uvic.ca [Leibniz Institute for Astrophysics Potsdam (AIP), An der Sternwarte 16, D-14482 Potsdam (Germany)

    2017-07-01

    We use three different techniques to identify hundreds of white dwarf (WD) candidates in the Next Generation Virgo Cluster Survey (NGVS) based on photometry from the NGVS and GUViCS, and proper motions derived from the NGVS and the Sloan Digital Sky Survey (SDSS). Photometric distances for these candidates are calculated using theoretical color–absolute magnitude relations, while effective temperatures are measured by fitting their spectral energy distributions. Disk and halo WD candidates are separated using a tangential velocity cut of 200 km s{sup −1} in a reduced proper motion diagram, which leads to a sample of six halo WD candidates. Cooling ages, calculated for an assumed WD mass of 0.6 M {sub ⊙}, range between 60 Myr and 6 Gyr, although these estimates depend sensitively on the adopted mass. Luminosity functions for the disk and halo subsamples are constructed and compared to previous results from the SDSS and SuperCOSMOS survey. We compute a number density of (2.81 ± 0.52) × 10{sup −3} pc{sup −3} for the disk WD population—consistent with previous measurements. We find (7.85 ± 4.55) × 10{sup −6} pc{sup −3} for the halo, or 0.3% of the disk. Observed stellar counts are also compared to predictions made by the TRILEGAL and Besançon stellar population synthesis models. The comparison suggests that the TRILEGAL model overpredicts the total number of WDs. The WD counts predicted by the Besançon model agree with the observations, although a discrepancy arises when comparing the predicted and observed halo WD populations; the difference is likely due to the WD masses in the adopted model halo.

  10. Neural stem cells for disease modeling of Wolman disease and evaluation of therapeutics

    OpenAIRE

    Aguisanda, Francis; Yeh, Charles D.; Chen, Catherine Z.; Li, Rong; Beers, Jeanette; Zou, Jizhong; Thorne, Natasha; Zheng, Wei

    2017-01-01

    Background Wolman disease (WD) is a rare lysosomal storage disorder that is caused by mutations in the LIPA gene encoding lysosomal acid lipase (LAL). Deficiency in LAL function causes accumulation of cholesteryl esters and triglycerides in lysosomes. Fatality usually occurs within the first year of life. While an enzyme replacement therapy has recently become available, there is currently no small-molecule drug treatment for WD. Results We have generated induced pluripotent stem cells (iPSCs...

  11. EST Table: DC568872 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC568872 E_FL_wd--_16F09_R_0 10/09/28 70 %/139 aa gb|AAX20091.1| chitin synthase 2 [Manduca sext...a] gb|AAX20092.1| chitin synthase 2 [Manduca sexta] 10/09/02 n.h 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS834669 wd-- ...

  12. Update on Wilson disease.

    Science.gov (United States)

    Aggarwal, Annu; Bhatt, Mohit

    2013-01-01

    Wilson disease (WD) is an inherited disorder of chronic copper toxicosis characterized by excessive copper deposition in the body, primarily in the liver and the brain. It is a progressive disease and fatal if untreated. Excessive copper accumulation results from the inability of liver to excrete copper in bile. Copper is an essential trace metal and has a crucial role in many metabolic processes. Almost all of the body copper is protein bound. In WD, the slow but relentless copper accumulation overwhelms the copper chaperones (copper-binding proteins), resulting in high levels of free copper and copper-induced tissue injury. Liver is the central organ for copper metabolism, and copper is initially accumulated in the liver but over time spills to other tissues. WD has protean clinical manifestations mainly attributable to liver, brain, and osseomuscular impairment. Diagnosis of WD is challenging and based on combination of clinical features and laboratory tests. Identification of various high-frequency mutations identified in different population studies across the world has revived interest in developing DNA chips for rapid genetic diagnosis of WD. All symptomatic and all presymptomatic patients require lifelong decoppering with careful clinical tracking. Decoppering ensures that presymptomatic individuals remain symptom free. With judicious decoppering, given time, even patients with severe neurological disability improve and can return to normal life and resume school or work at par with their peers. Treatment regimens and tracking patients using the WD-specific Global Assessment Scale for WD (GAS for WD) are discussed. © 2013 Elsevier Inc. All rights reserved.

  13. Effect of low carbohydrate high protein (LCHP) diet on lipid metabolism, liver and kidney function in rats.

    Science.gov (United States)

    Kostogrys, Renata B; Franczyk-Żarów, Magdalena; Maślak, Edyta; Topolska, Kinga

    2015-03-01

    The objective of this study was to compare effects of Western diet (WD) with low carbohydrate high protein (LCHP) diet on lipid metabolism, liver and kidney function in rats. Eighteen rats were randomly assigned to three experimental groups and fed for the next 2 months. The experimental diets were: Control (7% of soybean oil, 20% protein), WD (21% of butter, 20% protein), and LCHP (21% of butter and 52.4% protein) diet. The LCHP diet significantly decreased the body weight of the rats. Diet consumption was differentiated among groups, however significant changes were observed since third week of the experiment duration. Rats fed LCHP diet ate significantly less (25.2g/animal/day) than those from Control (30.2g/animal/day) and WD (27.8 g/animal/day) groups. Additionally, food efficiency ratio (FER) tended to decrease in LCHP fed rats. Serum homocysteine concentration significantly decreased in rats fed WD and LCHP diets. Liver weights were significantly higher in rats fed WD and LCHP diets. At the end of the experiment (2 months) the triacylglycerol (TAG) was significantly decreased in animals fed LCHP compared to WD. qRT-PCR showed that SCD-1 and FAS were decreased in LCHP fed rats, but WD diet increased expression of lipid metabolism genes. Rats receiving LCHP diet had two fold higher kidney weight and 54.5% higher creatinin level compared to Control and WD diets. In conclusion, LCHP diet decreased animal's body weight and decreased TAG in rat's serum. However, kidney damage in LCHP rats was observed. Copyright © 2015 Elsevier B.V. All rights reserved.

  14. Pricing of Asian temperature risk

    OpenAIRE

    Benth, Fred; Härdle, Wolfgang Karl; López Cabrera, Brenda

    2009-01-01

    Weather derivatives (WD) are different from most financial derivatives because the underlying weather cannot be traded and therefore cannot be replicated by other financial instruments. The market price of risk (MPR) is an important parameter of the associated equivalent martingale measures used to price and hedge weather futures/options in the market. The majority of papers so far have priced non-tradable assets assuming zero MPR, but this assumption underestimates WD prices. We study the MP...

  15. Comparative hydraulic architecture of tropical tree species representing a range of successional stages and wood density.

    Science.gov (United States)

    McCulloh, Katherine A; Meinzer, Frederick C; Sperry, John S; Lachenbruch, Barbara; Voelker, Steven L; Woodruff, David R; Domec, Jean-Christophe

    2011-09-01

    Plant hydraulic architecture (PHA) has been linked to water transport sufficiency, photosynthetic rates, growth form and attendant carbon allocation. Despite its influence on traits central to conferring an overall competitive advantage in a given environment, few studies have examined whether key aspects of PHA are indicative of successional stage, especially within mature individuals. While it is well established that wood density (WD) tends to be lower in early versus late successional tree species, and that WD can influence other aspects of PHA, the interaction of WD, successional stage and the consequent implications for PHA have not been sufficiently explored. Here, we studied differences in PHA at the scales of wood anatomy to whole-tree hydraulic conductance in species in early versus late successional Panamanian tropical forests. Although the trunk WD was indistinguishable between the successional groups, the branch WD was lower in the early successional species. Across all species, WD correlated negatively with vessel diameter and positively with vessel packing density. The ratio of branch:trunk vessel diameter, branch sap flux and whole-tree leaf-specific conductance scaled negatively with branch WD across species. Pioneer species showed greater sap flux in branches than in trunks and a greater leaf-specific hydraulic conductance, suggesting that pioneer species can move greater quantities of water at a given tension gradient. In combination with the greater water storage capacitance associated with lower WD, these results suggest these pioneer species can save on the carbon expenditure needed to build safer xylem and instead allow more carbon to be allocated to rapid growth.

  16. Impact of birth weight and postnatal diet on the gut microbiota of young adult guinea pigs

    Directory of Open Access Journals (Sweden)

    Kait Al

    2017-01-01

    Full Text Available Background The gastrointestinal tract (GIT microbiota is essential to metabolic health, and the prevalence of the Western diet (WD high in fat and sugar is increasing, with evidence highlighting a negative interaction between the GIT and WD, resulting in liver dysfunction. Additionally, an adverse in utero environment such as placental insufficiency resulting in low birth weight (LBW offspring, contributes to an increased risk of metabolic diseases such as fatty liver infiltration and liver dysfunction in later life. We sought to understand the potential interactive effects of exposure to a WD upon growing LBW offspring. We postulated that LBW offspring when challenged with a poor postnatal diet, would display an altered microbiota and more severe liver metabolic dysfunction. Methods The fecal microbiota of normal birth weight (NBW and LBW young guinea pig offspring, weaned onto either a control diet (CD or WD was determined with 16S rRNA gene next generation sequencing at young adulthood following the early rapid growth phase after weaning. A liver blood chemistry profile was also performed. Results The life-long consumption of WD following weaning into young adulthood resulted in increased total cholesterol, triglycerides and alanine aminotransferase levels in association with an altered GIT microbiota when compared to offspring consuming CD. Neither birth weight nor sex were associated with any significant changes in microbiota alpha diversity, by measuring the Shannon’s diversity index. One hundred forty-eight operational taxonomic units were statistically distinct between the diet groups, independent of birth weight. In the WD group, significant decreases were detected in Barnesiella, Methanobrevibacter smithii and relatives of Oscillospira guillermondii, while Butyricimonas and Bacteroides spp. were increased. Discussion These results describe the GIT microbiota in a guinea pig model of LBW and WD associated metabolic syndrome and

  17. Study protocol for a group randomized controlled trial of a classroom-based intervention aimed at preventing early risk factors for drug abuse: integrating effectiveness and implementation research

    Directory of Open Access Journals (Sweden)

    Keegan Natalie

    2009-09-01

    Full Text Available Abstract Background While a number of preventive interventions delivered within schools have shown both short-term and long-term impact in epidemiologically based randomized field trials, programs are not often sustained with high-quality implementation over time. This study was designed to support two purposes. The first purpose was to test the effectiveness of a universal classroom-based intervention, the Whole Day First Grade Program (WD, aimed at two early antecedents to drug abuse and other problem behaviors, namely, aggressive, disruptive behavior and poor academic achievement. The second purpose--the focus of this paper--was to examine the utility of a multilevel structure to support high levels of implementation during the effectiveness trial, to sustain WD practices across additional years, and to train additional teachers in WD practices. Methods The WD intervention integrated three components, each previously tested separately: classroom behavior management; instruction, specifically reading; and family-classroom partnerships around behavior and learning. Teachers and students in 12 schools were randomly assigned to receive either the WD intervention or the standard first-grade program of the school system (SC. Three consecutive cohorts of first graders were randomized within schools to WD or SC classrooms and followed through the end of third grade to test the effectiveness of the WD intervention. Teacher practices were assessed over three years to examine the utility of the multilevel structure to support sustainability and scaling-up. Discussion The design employed in this trial appears to have considerable utility to provide data on WD effectiveness and to inform the field with regard to structures required to move evidence-based programs into practice. Trial Registration Clinical Trials Registration Number: NCT00257088

  18. Behavioral and physiological changes during heat stress in Corriedale ewes exposed to water deprivation.

    Science.gov (United States)

    Ghassemi Nejad, Jalil; Sung, Kyung-Il

    2017-01-01

    This study was conducted to investigate the behavioral and physiological changes of heat stressed Corriedale ewes exposed to water deprivation. Nine Corriedale ewes (average BW = 45 ± 3.7 kg) were individually fed diets based on maintenance requirements in metabolic crates. Ewes were assigned into three groups (9 sheep per treatment) according to a 3 × 3 Latin square design for 3 periods with 21-d duration for each period. The control (CON) group was given free access to water, 2 h water deprivation (2hWD), and 3 h water deprivation (3hWD) following feeding. No differences were found in fecal excretion frequency, standing frequency (number/d), and sitting frequency among the groups ( p  > 0.05). Measurements of standing duration (min/d) and urine excretion frequency (number/d) showed a significant decrease whereas sitting duration (min/d) showed a significant increase in the 2hWD and 3hWD groups when compared with the CON group ( p   0.05). However, respiratory rate (number/min) and panting score were found to be significantly higher in the 2hWD and 3hWD groups than in the CON group ( p  ewes. Daily adaptation to the extreme environmental conditions may occur actively in ewes.

  19. The Solar Neighborhood. XXXIX. Parallax Results from the CTIOPI and NOFS Programs: 50 New Members of the 25 parsec White Dwarf Sample

    International Nuclear Information System (INIS)

    Subasavage, John P.; Harris, Hugh C.; Dahn, Conard C.; Jao, Wei-Chun; Lépine, Sébastien; Henry, Todd J.; Ianna, Philip A.; Bergeron, P.; Dufour, P.; Dunlap, Bart H.; Barlow, Brad N.; Margheim, Steven J.

    2017-01-01

    We present 114 trigonometric parallaxes for 107 nearby white dwarf (WD) systems from both the Cerro Tololo Inter-American Observatory Parallax Investigation (CTIOPI) and the U. S. Naval Observatory Flagstaff Station (NOFS) parallax programs. Of these, 76 parallaxes for 69 systems were measured by the CTIOPI program and 38 parallaxes for as many systems were measured by the NOFS program. A total of 50 systems are confirmed to be within the 25-pc horizon of interest. Coupled with a spectroscopic confirmation of a common proper-motion companion to a Hipparcos star within 25 pc as well as confirmation parallax determinations for two WD systems included in the recently released Tycho Gaia Astrometric Solution catalog, we add 53 new systems to the 25-pc WD sample—a 42% increase. Our sample presented here includes four strong candidate halo systems, a new metal-rich DAZ WD, a confirmation of a recently discovered nearby short-period ( P  = 2.85 hr) double degenerate, a WD with a new astrometric perturbation (long period, unconstrained with our data), and a new triple system where the WD companion main-sequence star has an astrometric perturbation ( P  ∼ 1.6 year).

  20. Higher P-Wave Dispersion in Migraine Patients with Higher Number of Attacks

    Directory of Open Access Journals (Sweden)

    A. Koçer

    2012-01-01

    Full Text Available Objective and Aim. An imbalance of the sympathetic system may explain many of the clinical manifestations of the migraine. We aimed to evaluate P-waves as a reveal of sympathetic system function in migraine patients and healthy controls. Materials and Methods. Thirty-five episodic type of migraine patients (complained of migraine during 5 years or more, BMI < 30 kg/m2 and 30 controls were included in our study. We measured P-wave durations (minimum, maximum, and dispersion from 12-lead ECG recording during pain-free periods. ECGs were transferred to a personal computer via a scanner and then used for magnification of x400 by Adobe Photoshop software. Results. P-wave durations were found to be similar between migraine patients and controls. Although P WD (P-wave dispersion was similar, the mean value was higher in migraine subjects. P WD was positively correlated with P max (P<0.01. Attacks number per month and male gender were the factors related to the P WD (P<0.01. Conclusions. Many previous studies suggested that increased sympathetic activity may cause an increase in P WD. We found that P WD of migraine patients was higher than controls, and P WD was related to attacks number per month and male gender. Further studies are needed to explain the chronic effects of migraine.

  1. Western Diet-Induced Dysbiosis in Farnesoid X Receptor Knockout Mice Causes Persistent Hepatic Inflammation after Antibiotic Treatment.

    Science.gov (United States)

    Jena, Prasant K; Sheng, Lili; Liu, Hui-Xin; Kalanetra, Karen M; Mirsoian, Annie; Murphy, William J; French, Samuel W; Krishnan, Viswanathan V; Mills, David A; Wan, Yu-Jui Yvonne

    2017-08-01

    Patients who have liver cirrhosis and liver cancer also have reduced farnesoid X receptor (FXR). The current study analyzes the effect of diet through microbiota that affect hepatic inflammation in FXR knockout (KO) mice. Wild-type and FXR KO mice were on a control (CD) or Western diet (WD) for 10 months. In addition, both CD- and WD-fed FXR KO male mice, which had hepatic lymphocyte and neutrophil infiltration, were treated by vancomycin, polymyxin B, and Abx (ampicillin, neomycin, metronidazole, and vancomycin). Mice were subjected to morphological analysis as well as gut microbiota and bile acid profiling. Male WD-fed FXR KO mice had the most severe steatohepatitis. FXR KO also had reduced Firmicutes and increased Proteobacteria, which could be reversed by Abx. In addition, Abx eliminated hepatic neutrophils and lymphocytes in CD-fed, but not WD-fed, FXR KO mice. Proteobacteria and Bacteroidetes persisted in WD-fed FXR KO mice even after Abx treatment. Only polymyxin B could reduce hepatic lymphocytes in WD-fed FXR KO mice. The reduced hepatic inflammation by antibiotics was accompanied by decreased free and conjugated secondary bile acids as well as changes in gut microbiota. Our data revealed that Lactococcus, Lactobacillus, and Coprococcus protect the liver from inflammation. Copyright © 2017 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

  2. Transgenesis of the Wolffian duct visualizes dynamic behavior of cells undergoing tubulogenesis in vivo.

    Science.gov (United States)

    Atsuta, Yuji; Tadokoro, Ryosuke; Saito, Daisuke; Takahashi, Yoshiko

    2013-05-01

    Deciphering how the tubulogenesis is regulated is an essential but unsolved issue in developmental biology. Here, using Wolffian duct (WD) formation in chicken embryos, we have developed a novel method that enables gene manipulation during tubulogenesis in vivo. Exploiting that WD arises from a defined site located anteriorly in the embryo (pronephric region), we targeted this region with the enhanced green fluorescent protein (EGFP) gene by the in ovo electroporation technique. EGFP-positive signals were detected in a wide area of elongating WD, where transgenic cells formed an epithelial component in a mosaic manner. Time-lapse live imaging analyses further revealed dynamic behavior of cells during WD elongation: some cells possessed numerous filopodia, and others exhibited cellular tails that repeated elongation and retraction. The retraction of the tail was precisely regulated by Rho activity via actin dynamics. When electroporated with the C3 gene, encoding Rho inhibitor, WD cells failed to contract their tails, resulting in an aberrantly elongated process. We further combined with the Tol2 transposon-mediated gene transfer technique, and could trace EGFP-positive cells at later stages in the ureteric bud sprouting from WD. This is the first demonstration that exogenous gene(s) can directly be introduced into elongating tubular structures in living amniote embryos. This method has opened a way to investigate how a complex tubulogenesis proceeds in higher vertebrates. © 2013 The Authors Development, Growth & Differentiation © 2013 Japanese Society of Developmental Biologists.

  3. The Solar Neighborhood. XXXIX. Parallax Results from the CTIOPI and NOFS Programs: 50 New Members of the 25 parsec White Dwarf Sample

    Energy Technology Data Exchange (ETDEWEB)

    Subasavage, John P.; Harris, Hugh C.; Dahn, Conard C. [U.S. Naval Observatory, 10391 West Naval Observatory Road, Flagstaff, AZ 86005-8521 (United States); Jao, Wei-Chun; Lépine, Sébastien [Department of Physics and Astronomy, Georgia State University, Atlanta, GA 30302-4106 (United States); Henry, Todd J.; Ianna, Philip A. [RECONS Institute, Chambersburg, PA 17201 (United States); Bergeron, P.; Dufour, P. [Département de Physique, Université de Montréal, C.P. 6128, Succ. Centre-Ville, Montréal, Québec H3C 3J7 (Canada); Dunlap, Bart H. [University of North Carolina at Chapel Hill, Dept. of Physics and Astronomy, Chapel Hill, NC 27599 (United States); Barlow, Brad N. [Department of Physics, High Point University, One University Parkway, High Point, NC 27268 (United States); Margheim, Steven J., E-mail: jsubasavage@nofs.navy.mil [Gemini Observatory, Southern Operations Center, Casilla 603, La Serena (Chile)

    2017-07-01

    We present 114 trigonometric parallaxes for 107 nearby white dwarf (WD) systems from both the Cerro Tololo Inter-American Observatory Parallax Investigation (CTIOPI) and the U. S. Naval Observatory Flagstaff Station (NOFS) parallax programs. Of these, 76 parallaxes for 69 systems were measured by the CTIOPI program and 38 parallaxes for as many systems were measured by the NOFS program. A total of 50 systems are confirmed to be within the 25-pc horizon of interest. Coupled with a spectroscopic confirmation of a common proper-motion companion to a Hipparcos star within 25 pc as well as confirmation parallax determinations for two WD systems included in the recently released Tycho Gaia Astrometric Solution catalog, we add 53 new systems to the 25-pc WD sample—a 42% increase. Our sample presented here includes four strong candidate halo systems, a new metal-rich DAZ WD, a confirmation of a recently discovered nearby short-period ( P  = 2.85 hr) double degenerate, a WD with a new astrometric perturbation (long period, unconstrained with our data), and a new triple system where the WD companion main-sequence star has an astrometric perturbation ( P  ∼ 1.6 year).

  4. Wallerian Degeneration Beyond the Corticospinal Tracts: Conventional and Advanced MRI Findings.

    Science.gov (United States)

    Chen, Yin Jie; Nabavizadeh, Seyed Ali; Vossough, Arastoo; Kumar, Sunil; Loevner, Laurie A; Mohan, Suyash

    2017-05-01

    Wallerian degeneration (WD) is defined as progressive anterograde disintegration of axons and accompanying demyelination after an injury to the proximal axon or cell body. Since the 1980s and 1990s, conventional magnetic resonance imaging (MRI) sequences have been shown to be sensitive to changes of WD in the subacute to chronic phases. More recently, advanced MRI techniques, such as diffusion-weighted imaging (DWI) and diffusion tensor imaging (DTI), have demonstrated some of earliest changes attributed to acute WD, typically on the order of days. In addition, there is increasing evidence on the value of advanced MRI techniques in providing important prognostic information related to WD. This article reviews the utility of conventional and advanced MRI techniques for assessing WD, by focusing not only on the corticospinal tract but also other neural tracts less commonly thought of, including corticopontocerebellar tract, dentate-rubro-olivary pathway, posterior column of the spinal cord, corpus callosum, limbic circuit, and optic pathway. The basic anatomy of these neural pathways will be discussed, followed by a comprehensive review of existing literature supported by instructive clinical examples. The goal of this review is for readers to become more familiar with both conventional and advanced MRI findings of WD involving important neural pathways, as well as to illustrate increasing utility of advanced MRI techniques in providing important prognostic information for various pathologies. Copyright © 2016 by the American Society of Neuroimaging.

  5. The separation distribution and merger rate of double white dwarfs: improved constraints

    Science.gov (United States)

    Maoz, Dan; Hallakoun, Na'ama; Badenes, Carles

    2018-05-01

    We obtain new and precise information on the double white dwarf (DWD) population and on its gravitational-wave-driven merger rate by combining the constraints on the DWD population from two previous studies on radial velocity variation. One of the studies is based on a sample of white dwarfs (WDs) from the Sloan Digital Sky Survey (SDSS, which with its low spectral resolution probes systems at separations a distribution of initial WD separations (at the start of solely gravitational-wave-driven binary evolution), N(a)da ∝ aαda, is α = -1.30 ± 0.15 (1σ) +0.05 (systematic). The Galactic WD merger rate per WD is Rmerge = (9.7 ± 1.1) × 10-12 yr-1. Integrated over the Galaxy lifetime, this implies that 8.5-11 per cent of all WDs ever formed have merged with another WD. If most DWD mergers end as more-massive WDs, then some 10 per cent of WDs are DWD-merger products, consistent with the observed fraction of WDs in a `high-mass bump' in the WD mass function. The DWD merger rate is 4.5-7 times the Milky Way's specific Type Ia supernova (SN Ia) rate. If most SN Ia explosions stem from the mergers of some DWDs (say, those with massive-enough binary components) then ˜15 per cent of all WD mergers must lead to a SN Ia.

  6. MONTE CARLO POPULATION SYNTHESIS OF POST-COMMON-ENVELOPE WHITE DWARF BINARIES AND TYPE Ia SUPERNOVA RATE

    Energy Technology Data Exchange (ETDEWEB)

    Ablimit, Iminhaji [Key Laboratory for Optical Astronomy, National Astronomical Observatories, Chinese Academy of Sciences, Beijing 100012 (China); Maeda, Keiichi [Department of Astronomy, Kyoto University, Kitashirakawa-Oiwake-cho, Sakyo-ku, Kyoto 606-8502 (Japan); Li, Xiang-Dong [Department of Astronomy, Nanjing University, Nanjing 210046 (China)

    2016-07-20

    Binary population synthesis (BPS) studies provide a comprehensive way to understand the evolution of binaries and their end products. Close white dwarf (WD) binaries have crucial characteristics for examining the influence of unresolved physical parameters on binary evolution. In this paper, we perform Monte Carlo BPS simulations, investigating the population of WD/main-sequence (WD/MS) binaries and double WD binaries using a publicly available binary star evolution code under 37 different assumptions for key physical processes and binary initial conditions. We considered different combinations of the binding energy parameter ( λ {sub g}: considering gravitational energy only; λ {sub b}: considering both gravitational energy and internal energy; and λ {sub e}: considering gravitational energy, internal energy, and entropy of the envelope, with values derived from the MESA code), CE efficiency, critical mass ratio, initial primary mass function, and metallicity. We find that a larger number of post-CE WD/MS binaries in tight orbits are formed when the binding energy parameters are set by λ {sub e} than in those cases where other prescriptions are adopted. We also determine the effects of the other input parameters on the orbital periods and mass distributions of post-CE WD/MS binaries. As they contain at least one CO WD, double WD systems that evolved from WD/MS binaries may explode as type Ia supernovae (SNe Ia) via merging. In this work, we also investigate the frequency of two WD mergers and compare it to the SNe Ia rate. The calculated Galactic SNe Ia rate with λ = λ {sub e} is comparable to the observed SNe Ia rate, ∼8.2 × 10{sup 5} yr{sup 1} – ∼4 × 10{sup 3} yr{sup 1} depending on the other BPS parameters, if a DD system does not require a mass ratio higher than ∼0.8 to become an SNe Ia. On the other hand, a violent merger scenario, which requires the combined mass of two CO WDs ≥ 1.6 M {sub ⊙} and a mass ratio >0.8, results in a much lower

  7. The accretion of solar material onto white dwarfs: No mixing with core material implies that the mass of the white dwarf is increasing

    Directory of Open Access Journals (Sweden)

    Sumner Starrfield

    2014-02-01

    Full Text Available Cataclysmic Variables (CVs are close binary star systems with one component a white dwarf (WD and the other a larger cooler star that fills its Roche Lobe. The cooler star is losing mass through the inner Lagrangian point of the binary and some unknown fraction of this material is accreted by the WD. One consequence of the WDs accreting material, is the possibility that they are growing in mass and will eventually reach the Chandrasekhar Limit. This evolution could result in a Supernova Ia (SN Ia explosion and is designated the Single Degenerate Progenitor (SD scenario. This paper is concerned with the SD scenario for SN Ia progenitors. One problem with the single degenerate scenario is that it is generally assumed that the accreting material mixes with WD core material at some time during the accretion phase of evolution and, since the typical WD has a carbon-oxygen CO core, the mixing results in large amounts of carbon and oxygen being brought up into the accreted layers. The presence of enriched carbon causes enhanced nuclear fusion and a Classical Nova explosion. Both observations and theoretical studies of these explosions imply that more mass is ejected than is accreted. Thus, the WD in a Classical Nova system is losing mass and cannot be a SN Ia progenitor. However, the composition in the nuclear burning region is important and, in new calculations reported here, the consequences to the WD of no mixing of accreted material with core material have been investigated so that the material involved in the explosion has only a Solar composition. WDs with a large range in initial masses and mass accretion rates have been evolved. I find that once sufficient material has been accreted, nuclear burning occurs in all evolutionary sequences and continues until a thermonuclear runaway (TNR occurs and the WD either ejects a small amount of material or its radius grows to about 1012 cm and the evolution is ended. In all cases where mass ejection occurs

  8. The response of the natriuretic peptide system to water deprivation in the desert rodent, Notomys alexis.

    Science.gov (United States)

    Heimeier, Rachel A; Donald, John A

    2006-02-01

    Natriuretic peptides (NPs) are regulatory molecules that cause cGMP-mediated diuresis and natriuresis in mammals. Accordingly, it is interesting to consider their role in desert-adapted animals in which water is often limited. This study investigated the response of the natriuretic peptide (NP) system to varying periods of water deprivation (WD) in the Australian desert rodent species, Notomys alexis. It was hypothesised that the expression of the NP system will be down-regulated in water-deprived N. alexis compared to water-replete animals. The plasma levels of ANP were significantly reduced after 3 days of WD, but were unaffected by 7, 14 and 28 days of WD. Water deprivation for 3, 7, 14 days had a variable effect on the mRNA expression of ANP, CNP, NPR-A, NPR-B, and NPR-C, and a uniform down-regulation was not observed. However, after 28 days of WD, mRNA expression was similar to water-replete animals, except for NPR-A. Surprisingly, 7 and 14 days of WD caused an up-regulation in the ability of ANP to stimulate cGMP; this also occurred at 14 days for CNP. Taken together, the mRNA expression and peptide mediated guanylyl cyclase activity data after WD were in the opposite direction to what was predicted. Interestingly, after 28 days of WD, most parameters were similar to those of water-replete animals, which indicates that a down-regulation of the NP system is not part of the physiological response to an absence of free water in N. alexis.

  9. Sub-Chandrasekhar-mass White Dwarf Detonations Revisited

    Science.gov (United States)

    Shen, Ken J.; Kasen, Daniel; Miles, Broxton J.; Townsley, Dean M.

    2018-02-01

    The detonation of a sub-Chandrasekhar-mass white dwarf (WD) has emerged as one of the most promising Type Ia supernova (SN Ia) progenitor scenarios. Recent studies have suggested that the rapid transfer of a very small amount of helium from one WD to another is sufficient to ignite a helium shell detonation that subsequently triggers a carbon core detonation, yielding a “dynamically driven double-degenerate double-detonation” SN Ia. Because the helium shell that surrounds the core explosion is so minimal, this scenario approaches the limiting case of a bare C/O WD detonation. Motivated by discrepancies in previous literature and by a recent need for detailed nucleosynthetic data, we revisit simulations of naked C/O WD detonations in this paper. We disagree to some extent with the nucleosynthetic results of previous work on sub-Chandrasekhar-mass bare C/O WD detonations; for example, we find that a median-brightness SN Ia is produced by the detonation of a 1.0 {M}ȯ WD instead of a more massive and rarer 1.1 {M}ȯ WD. The neutron-rich nucleosynthesis in our simulations agrees broadly with some observational constraints, although tensions remain with others. There are also discrepancies related to the velocities of the outer ejecta and light curve shapes, but overall our synthetic light curves and spectra are roughly consistent with observations. We are hopeful that future multidimensional simulations will resolve these issues and further bolster the dynamically driven double-degenerate double-detonation scenario’s potential to explain most SNe Ia.

  10. Formation of Extremely Low-mass White Dwarf Binaries

    Science.gov (United States)

    Sun, M.; Arras, P.

    2018-05-01

    Motivated by the discovery of several pulsating, extremely low-mass white dwarfs (ELM WDs, mass M ≲ 0.18 M ⊙) that likely have WD companions, this paper discusses binary formation models for these systems. ELM WDs are formed using angular momentum losses by magnetic braking. Evolutionary models are constructed using the Modules for Experiments in Stellar Astrophysics (MESA), with ELM WD progenitors in the range 1.0 ≲ M d/M ⊙ ≲ 1.5 and WD companions in the range 0.4 ≲ M a/M ⊙ ≲ 0.9. A prescription to reduce magnetic braking for thin surface convection zones is included. Upon the thinning of the evolved donor envelope, the donor star shrinks out of contact and mass transfer (MT) ceases, revealing the ELM WD. Systems with low masses have previously been suggested as possible AM CVNs. Systems with high masses, up to the limit M ≃ 0.18 M ⊙ at which shell flashes occur on the WD cooling track, tend to expand out to orbital periods P orb ≳ 15 hr. In between this range, ELM WDs may become pulsators both as pre-WDs and on the WD cooling track. Brickhill’s criterion for convective mode driving is used to estimate the location of the blue edge of the g-mode instability strip. In the appendix, we show that the formation of an ELM WD by unstable MT or a common-envelope event is unlikely. Stable Roche-lobe overflow with conservative MT produces only M ≳ 0.2 M ⊙.

  11. USING CLOSE WHITE DWARF + M DWARF STELLAR PAIRS TO CONSTRAIN THE FLARE RATES IN CLOSE STELLAR BINARIES

    Energy Technology Data Exchange (ETDEWEB)

    Morgan, Dylan P.; West, Andrew A. [Astronomy Department, Boston University, 725 Commonwealth Ave, Boston, MA 02215 (United States); Becker, Andrew C., E-mail: dpmorg@bu.edu [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States)

    2016-05-01

    We present a study of the statistical flare rates of M dwarfs (dMs) with close white dwarf (WD) companions (WD+dM; typical separations <1 au). Our previous analysis demonstrated that dMs with close WD companions are more magnetically active than their field counterparts. One likely implication of having a close binary companion is increased stellar rotation through disk-disruption, tidal effects, and/or angular momentum exchange; increased stellar rotation has long been associated with an increase in stellar activity. Previous studies show a strong correlation between dMs that are magnetically active (showing H α in emission) and the frequency of stellar flare rates. We examine the difference between the flare rates observed in close WD+dM binary systems and field dMs. Our sample consists of a subset of 181 close WD+dM pairs from Morgan et al. observed in the Sloan Digital Sky Survey Stripe 82, where we obtain multi-epoch observations in the Sloan ugriz -bands. We find an increase in the overall flaring fraction in the close WD+dM pairs (0.09 ± 0.03%) compared to the field dMs (0.0108 ± 0.0007%) and a lower flaring fraction for active WD+dMs (0.05 ± 0.03%) compared to active dMs (0.28 ± 0.05%). We discuss how our results constrain both the single and binary dM flare rates. Our results also constrain dM multiplicity, our knowledge of the Galactic transient background, and may be important for the habitability of attending planets around dMs with close companions.

  12. Dissecting water binding sites at protein-protein interfaces: a lesson from the atomic structures in the Protein Data Bank.

    Science.gov (United States)

    Mukherjee, Sunandan; Nithin, Chandran; Divakaruni, Yasaswi; Bahadur, Ranjit Prasad

    2018-04-04

    We dissect the protein-protein interfaces into water preservation (WP), water hydration (WH) and water dehydration (WD) sites by comparing the water-mediated hydrogen bonds (H-bond) in the bound and unbound states of the interacting subunits. Upon subunit complexation, if a H-bond between an interface water and a protein polar group is retained, we assign it as WP site; if it is lost, we assign it as WD site and if a new H-bond is created, we assign it as WH site. We find that the density of WD sites is highest followed by WH and WP sites except in antigen and (or) antibody complexes, where the density of WH sites is highest followed by WD and WP sites. Furthermore, we find that WP sites are the most conserved followed by WD and WH sites in all class of complexes except in antigen and (or) antibody complexes, where WD sites are the most conserved followed by WH and WP sites. A significant number of WP and WH sites are involved in water bridges that stabilize the subunit interactions. At WH sites, the residues involved in water bridges are significantly better conserved than the other residues. However, no such difference is observed at WP sites. Interestingly, WD sites are generally replaced with direct H-bonds upon subunit complexation. Significantly, we observe many water-mediated H-bonds remain preserved in spite of large conformational changes upon subunit complexation. These findings have implications in predicting and engineering water binding sites at protein-protein interfaces.

  13. Global Liver Gene Expression Analysis on a Murine Metabolic Syndrome Model Treated by Low-molecular-weight Lychee Fruit Polyphenol (Oligonol®).

    Science.gov (United States)

    Uchiyama, Hironobu; Uehara, Kaori; Nagashima, Takayuki; Nakata, Akifumi; Sato, Keisuke; Mihara, Yoshihiro; Komatsu, Ken-Ich; Takanari, Jun; Shimizu, Shigeomi; Wakame, Koji

    2016-07-01

    Oligonol® (OLG) is a low-molecular-weight lychee fruit polyphenol mainly containing catechin-type monomers and oligomers of proanthocyanidins. Dietary OLG supplementation reportedly improves lipid metabolism disorder and lowers the visceral fat level in animal and human studies. Thus, we investigated the mechanism behind the protective and beneficial effects of OLG on a Western diet (WD)-induced metabolic syndrome (MetS) of a murine model. Using the C57BL/6J mouse for the MetS model, mice were divided into three groups: control (normal diet: ND), Western diet (WD) and WD + 0.5% OLG (OLG) groups. The WD group was fed a high-calorie (high fructose plus high fat) diet for 12 weeks to develop MetS. At week 12, all mice were sacrificed and the blood and liver were obtained for histological and biological examinations and RNA sequencing (RNA-Seq). Body weight, liver weight, plasma triglycerides (TG), total cholesterol (T-Cho) and alanine aminotransferase (ATS) levels of both OLG groups were significantly lower than those of the WD group. On histological examination of the liver, the area of fatty deposits was shown to be suppressed by OLG administration. Expression gene analysis in the liver of WD- versus OLG-fed mice by RNA-Seq showed that 464/45,706 genes exhibited a significant change of expression (corrected p-value metabolism-related genes Lpin1, Adig and Cidea were regulated by OLG administration. OLG may function to suppress MetS and the progression of geriatric diseases in WD-fed mice by regulating the expression of lipid metabolism, inflammation and tumor-related genes in the liver. Copyright© 2016 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

  14. Fermentation Profiles of Wheat Dextrin, Inulin and Partially Hydrolyzed Guar Gum Using an in Vitro Digestion Pretreatment and in Vitro Batch Fermentation System Model

    Directory of Open Access Journals (Sweden)

    Joanne Slavin

    2013-05-01

    Full Text Available This study investigated the fermentation and microbiota profiles of three fibers, wheat dextrin (WD, partially hydrolyzed guar gum (PHGG, and inulin, since little is known about the effects of WD and PHGG on gut microbiota. A treatment of salivary amylase, pepsin, and pancreatin was used to better physiologic digestion. Fibers (0.5 g were fermented in triplicate including a control group without fiber for 0, 4, 8, 12, and 24 h. Analysis of pH, gas volume, hydrogen and methane gases, and short chain fatty acid (SCFA concentrations were completed at each time point. Quantitative polymerase chain reaction (qPCR was used to measure Bifidobacteria and Lactobacillus CFUs at 24 h. WD produced the least gas during fermentation at 8, 12, and 24 h (P < 0.0001, while inulin produced the most by 8 h (P < 0.0001. Each fiber reached its lowest pH value at different time points with inulin at 8 h (mean ± SE (5.94 ± 0.03, PHGG at 12 h (5.98 ± 0.01, and WD at 24 h (6.17 ± 0.03. All fibers had higher total SCFA concentrations compared to the negative control (P < 0.05 at 24 h. At 24 h, inulin produced significantly (P = 0.0016 more butyrate than WD with PHGG being similar to both. An exploratory microbial analysis (log10 CFU/µL showed WD had CFU for Bifidobacteria (6.12 and Lactobacillus (7.15 compared with the control (4.92 and 6.35, respectively. Rate of gas production is influenced by fiber source and may affect tolerance in vivo. Exploratory microbiota data hint at high levels of Bifidobacteria for WD, but require more robust investigation to corroborate these findings.

  15. Differential Responses of Water Uptake Pathways and Expression of Two Aquaporin Genes to Water-Deficit in Rice Seedlings of Two Genotypes

    Directory of Open Access Journals (Sweden)

    Xu Ai-hua

    2017-07-01

    Full Text Available Water-deficit (WD is a major abiotic stress constraining crop productivity worldwide. Zhenshan 97 is a drought-susceptible rice genotype, while IRAT109 is a drought-resistant one. However, the physiological basis of the difference remains unclear. These two genotypes had similar total water uptake rates under both WD and well-watered (WW conditions, and their water uptake rates under WD were significantly decreased compared with those under WW. However, the water uptake rate via the cell-to-cell pathway was significantly increased in Zhenshan 97 but decreased in IRAT109 under WD, whereas the opposite trends were observed through the apoplastic pathway. These results indicated that the stress responses and relative contributions of these two water uptake pathways were associated with rice genotype under WD. The expression levels of OsPIP2;4 and OsPIP2;5 genes were significantly higher in roots of Zhenshan 97 than in IRAT109 under the two conditions. OsPIP2;4 expression in roots was significantly up-regulated under WD, while OsPIP2;5 expression showed no significant change. These results suggest that the expression levels of OsPIP2;4 and OsPIP2;5 in rice are dependent on genotype and water availability. Compared with Zhenshan 97, IRAT109 had a higher root dry weight, water uptake rate and xylem sap flow rate, and lower leaf water potential and root porosity under WD, which might be responsible for the drought resistance in IRAT109.

  16. Endothelial Estrogen Receptor-α Does Not Protect Against Vascular Stiffness Induced by Western Diet in Female Mice.

    Science.gov (United States)

    Manrique, Camila; Lastra, Guido; Ramirez-Perez, Francisco I; Haertling, Dominic; DeMarco, Vincent G; Aroor, Annayya R; Jia, Guanghong; Chen, Dongqing; Barron, Brady J; Garro, Mona; Padilla, Jaume; Martinez-Lemus, Luis A; Sowers, James R

    2016-04-01

    Consumption of a diet high in fat and refined carbohydrates (Western diet [WD]) is associated with obesity and insulin resistance, both major risk factors for cardiovascular disease (CVD). In women, obesity and insulin resistance abrogate the protection against CVD likely afforded by estrogen signaling through estrogen receptor (ER)α. Indeed, WD in females results in increased vascular stiffness, which is independently associated with CVD. We tested the hypothesis that loss of ERα signaling in the endothelium exacerbates WD-induced vascular stiffening in female mice. We used a novel model of endothelial cell (EC)-specific ERα knockout (EC-ERαKO), obtained after sequential crossing of the ERα double floxed mice and VE-Cadherin Cre-recombinase mice. Ten-week-old females, EC-ERαKO and aged-matched genopairs were fed either a regular chow diet (control diet) or WD for 8 weeks. Vascular stiffness was measured in vivo by pulse wave velocity and ex vivo in aortic explants by atomic force microscopy. In addition, vascular reactivity was assessed in isolated aortic rings. Initial characterization of the model fed a control diet did not reveal changes in whole-body insulin sensitivity, aortic vasoreactivity, or vascular stiffness in the EC-ERαKO mice. Interestingly, ablation of ERα in ECs reduced WD-induced vascular stiffness and improved endothelial-dependent dilation. In the setting of a WD, endothelial ERα signaling contributes to vascular stiffening in females. The precise mechanisms underlying the detrimental effects of endothelial ERα in the setting of a WD remain to be elucidated.

  17. Hydrodynamic Studies of the Evolution of Recurrent, Symbiotic and Dwarf Novae: the White Dwarf Components are Growing in Mass

    Directory of Open Access Journals (Sweden)

    Starrfield S.

    2012-06-01

    Full Text Available Symbiotic binaries are systems containing white dwarfs (WDs and red giants. Symbiotic novae are those systems in which thermonuclear eruptions occur on the WD components. These are to be distinguished from events driven by accretion disk instabilities analogous to dwarf novae eruptions in cataclysmic variable outbursts. Another class of symbiotic systems are those in which the WD is extremely luminous and it seems likely that quiescent nuclear burning is ongoing on the accreting WD. A fundamental question is the secular evolution of the WD. Do the repeated outbursts or quiescent burning in these accreting systems cause the WD to gain or lose mass? If it is gaining mass, can it eventually reach the Chandrasekhar Limit and become a supernova (a SN Ia if it can hide the hydrogen and helium in the system? In order to better understand these systems, we have begun a new study of the evolution of Thermonuclear Runaways (TNRs in the accreted envelopes of WDs using a variety of initial WD masses, luminosities and mass accretion rates. We use our 1-D hydro code, NOVA, which includes the new convective algorithm of Arnett, Meakin and Young, the Hix and Thielemann nuclear reaction solver, the Iliadis reaction rate library, the Timmes equation of state, and the OPAL opacities. We assume a solar composition (Lodders abundance distribution and do not allow any mixing of accreted material with core material. This assumption strongly influences our results. We report here (1 that the WD grows in mass for all simulations so that ‘steady burning’ does not occur, and (2 that only a small fraction of the accreted matter is ejected in some (but not all simulations. We also find that the accreting systems, before thermonuclear runaway, are too cool to be seen in X-ray searches for SN Ia progenitors.

  18. Western High-Fat Diet Consumption during Adolescence Increases Susceptibility to Traumatic Stress while Selectively Disrupting Hippocampal and Ventricular Volumes

    Science.gov (United States)

    Kalyan-Masih, Priya; Vega-Torres, Julio David; Haddad, Elizabeth; Rainsbury, Sabrina; Baghchechi, Mohsen

    2016-01-01

    Abstract Psychological trauma and obesity co-occur frequently and have been identified as major risk factors for psychiatric disorders. Surprisingly, preclinical studies examining how obesity disrupts the ability of the brain to cope with psychological trauma are lacking. The objective of this study was to determine whether an obesogenic Western-like high-fat diet (WD) predisposes rats to post-traumatic stress responsivity. Adolescent Lewis rats (postnatal day 28) were fed ad libitum for 8 weeks with either the experimental WD diet (41.4% kcal from fat) or the control diet (16.5% kcal from fat). We modeled psychological trauma by exposing young adult rats to a cat odor threat. The elevated plus maze and the open field test revealed increased psychological trauma-induced anxiety-like behaviors in the rats that consumed the WD when compared with control animals 1 week after undergoing traumatic stress (p < 0.05). Magnetic resonance imaging showed significant hippocampal atrophy (20% reduction) and lateral ventricular enlargement (50% increase) in the animals fed the WD when compared with controls. These volumetric abnormalities were associated with behavioral indices of anxiety, increased leptin and FK506-binding protein 51 (FKBP51) levels, and reduced hippocampal blood vessel density. We found asymmetric structural vulnerabilities to the WD, particularly the ventral and left hippocampus and lateral ventricle. This study highlights how WD consumption during adolescence impacts key substrates implicated in post-traumatic stress disorder. Understanding how consumption of a WD affects the developmental trajectories of the stress neurocircuitry is critical, as stress susceptibility imposes a marked vulnerability to neuropsychiatric disorders. PMID:27844058

  19. Waking and sleeping following water deprivation in the rat.

    Directory of Open Access Journals (Sweden)

    Davide Martelli

    Full Text Available Wake-sleep (W-S states are affected by thermoregulation. In particular, REM sleep (REMS is reduced in homeotherms under a thermal load, due to an impairment of hypothalamic regulation of body temperature. The aim of this work was to assess whether osmoregulation, which is regulated at a hypothalamic level, but, unlike thermoregulation, is maintained across the different W-S states, could influence W-S occurrence. Sprague-Dawley rats, kept at an ambient temperature of 24°C and under a 12 h∶12 h light-dark cycle, were exposed to a prolonged osmotic challenge of three days of water deprivation (WD and two days of recovery in which free access to water was restored. Two sets of parameters were determined in order to assess: i the maintenance of osmotic homeostasis (water and food consumption; changes in body weight and fluid composition; ii the effects of the osmotic challenge on behavioral states (hypothalamic temperature (Thy, motor activity, and W-S states. The first set of parameters changed in WD as expected and control levels were restored on the second day of recovery, with the exception of urinary Ca(++ that almost disappeared in WD, and increased to a high level in recovery. As far as the second set is concerned, WD was characterized by the maintenance of the daily oscillation of Thy and by a decrease in activity during the dark periods. Changes in W-S states were small and mainly confined to the dark period: i REMS slightly decreased at the end of WD and increased in recovery; ii non-REM sleep (NREMS increased in both WD and recovery, but EEG delta power, a sign of NREMS intensity, decreased in WD and increased in recovery. Our data suggest that osmoregulation interferes with the regulation of W-S states to a much lesser extent than thermoregulation.

  20. Low Risk of Unemployment, Sick Leave, and Work Disability Among Patients with Inflammatory Bowel Disease: A 7-year Follow-up Study of a Danish Inception Cohort.

    Science.gov (United States)

    Vester-Andersen, Marianne K; Prosberg, Michelle V; Vind, Ida; Andersson, Mikael; Jess, Tine; Bendtsen, Flemming

    2015-10-01

    To assess the occurrence and risk of unemployment (UE), sick leave (SL), and work disability (WD) in incident patients with inflammatory bowel disease (IBD) after 7 years of follow-up compared with the background population and to determine outcome predictors. The study population consisted of patients aged 18 to 67 years (N = 379) from an IBD inception cohort registered January 1, 2003 to December 31, 2004 in the Copenhagen area. Clinical data were retrospectively collected from medical records. Data on UE, SL, and WD were retrieved from national registries. A random subset of the general population (n = 1435) were matched with IBD cases based on sex, age, and residency. The cumulative probabilities of UE, SL, and WD were calculated. A Cox proportional hazard regression was performed to identify possible outcome predictors. There was no difference in UE rates between patients with IBD and controls (P = 0.23). The risk of SL was significantly increased in patients with IBD (hazard ratio 2.0; 95% confidence interval 1.7-2.4). Patients with IBD showed a higher risk of WD (hazard ratio 2.1; 95% confidence interval 1.2-3.8), particularly male patients older than 55 years. The rate of WD in CD (5.8%) was markedly lowered compared with previous studies. Within the IBD population, sex, educational level, disease behavior, smoking status, and surgery were predictors of UE, SL, and WD. The observed increased risk of SL and WD in patients with IBD underscores the need for the early identification of risk factors. A multidisciplinary approach to secure IBD patients' participation in the labor market is recommended.

  1. Fish oil alleviated high-fat diet-induced non-alcoholic fatty liver disease via regulating hepatic lipids metabolism and metaflammation: a transcriptomic study.

    Science.gov (United States)

    Yuan, Fahu; Wang, Hualin; Tian, Yu; Li, Qi; He, Lei; Li, Na; Liu, Zhiguo

    2016-02-01

    Intake of fish oil rich in n-3 polyunsaturated fatty acids (PUFAs) is believed to be beneficial against development of non-alcoholic fatty liver disease (NAFLD). However, the underlying mechanisms remain unclear. This study was to gain further understanding of the potential mechanisms of the protective effects of fish oil against NAFLD. Ten male Sprague-Dawley rats were fed a control diet (CON), a Western style high-fat and high-cholesterol diet (WD), or a WD diet containing fish oil (FOH) for 16 weeks respectively. The development of liver steatosis and fibrosis were verified by histological and biochemical examination. Hepatic transcriptome were extracted for RNA-seq analysis, and particular results were confirmed by real-time polymerase chain reaction (PCR). The consumption of fish oil significantly ameliorated WD-induced dyslipidemia, transaminase elevation, hepatic steatosis, inflammatory infiltration, and fibrosis. Hepatic RNA-Seq analysis showed that long-term intake of fish oil restored the expression of circadian clock-related genes per2 and per3, which were reduced in WD fed animals. Fish oil consumption also corrected the expression levels of genes involved in fatty acid and cholesterol metabolism, such as Srebf1, Fasn, Scd1, Insig2, Cd36, Cyp7a1, Abcg5, Abcg8 and Pcsk9. Moreover, the expression levels of pro-inflammation genes Mcp1, Socs2, Sema4a, and Cd44 in the FOH group were lower than that of WD group, implying that fish oil protects the liver against WD-induced hepatic inflammation. The present study demonstrates fish oil protects against WD-induced NALFD via improving lipid metabolism and ameliorating hepatic inflammation. Our findings add to the current understanding on the benefits of n-3 PUFAs against NAFLD.

  2. Successful Splenectomy for Hypersplenism in Wilson's Disease: A Single Center Experience from China.

    Science.gov (United States)

    Li, Liang-Yong; Yang, Wen-Ming; Chen, Huai-Zhen; Wu, Yun-Hu; Fang, Xiang; Zhang, Jing; Wang, Zhen; Han, Yong-Sheng; Wang, Yu

    2015-01-01

    Splenomegaly and pancytopenia are common in Wilson's disease (WD) and splenectomy is one of the conventional treatments for splenomegaly and the associated pancytopenia. However, splenectomy remained controversial for hypersplenism in WD as it was reported that splenectomy leaded to serious emotional and neurological deterioration in WD patients with hypersplenism. In the current study, we present our experiences in 70 WD patients with hypersplenism who had undergone splenectomy, outlining the safety and efficacy of splenectomy in WD. The clinical database of 70 WD patients with hypersplenism who had undergone splenectomy in our hospital between 2009 and 2013 were reviewed and followed-up regularly. Before splenectomy, all the patients accepted a short period of anti-copper treatment with intravenous sodium 2, 3-dimercapto-1-propane sulfonate (DMPS). All the patients demonstrated a marked improvement in platelet and leucocyte counts after splenectomy. No severe postoperative complication was observed. In particular, none of the 37 patients with mixed neurologic and hepatic presentations experienced neurological deterioration after splenectomy, and none of the patients with only hepatic presentations newly developed neurological symptoms. During the one year follow-up period, no patient presented hepatic failure or hepatic encephalopathy, no hepatic patient newly developed neurological presentations, and only 3 patients with mixed neurologic and hepatic presentations suffered neurological deterioration and these 3 patients had poor compliance of anti-copper treatment. Quantative analysis of the neurological symptoms in the 37 patients using the Unified Wilson's Disease Rating Scale (UWDRS) showed that the neurological symptoms were not changed in a short-term of one week after splenectomy but significantly improved in a long-term of one year after splenectomy. Additionally, compared to that before splenectomy, the esophageal gastric varices in most patients

  3. Successful Splenectomy for Hypersplenism in Wilson’s Disease: A Single Center Experience from China

    Science.gov (United States)

    Chen, Huai-Zhen; Wu, Yun-Hu; Fang, Xiang; Zhang, Jing; Wang, Zhen; Han, Yong-Sheng; Wang, Yu

    2015-01-01

    Splenomegaly and pancytopenia are common in Wilson’s disease (WD) and splenectomy is one of the conventional treatments for splenomegaly and the associated pancytopenia. However, splenectomy remained controversial for hypersplenism in WD as it was reported that splenectomy leaded to serious emotional and neurological deterioration in WD patients with hypersplenism. In the current study, we present our experiences in 70 WD patients with hypersplenism who had undergone splenectomy, outlining the safety and efficacy of splenectomy in WD. The clinical database of 70 WD patients with hypersplenism who had undergone splenectomy in our hospital between 2009 and 2013 were reviewed and followed-up regularly. Before splenectomy, all the patients accepted a short period of anti-copper treatment with intravenous sodium 2, 3-dimercapto-1-propane sulfonate (DMPS). All the patients demonstrated a marked improvement in platelet and leucocyte counts after splenectomy. No severe postoperative complication was observed. In particular, none of the 37 patients with mixed neurologic and hepatic presentations experienced neurological deterioration after splenectomy, and none of the patients with only hepatic presentations newly developed neurological symptoms. During the one year follow-up period, no patient presented hepatic failure or hepatic encephalopathy, no hepatic patient newly developed neurological presentations, and only 3 patients with mixed neurologic and hepatic presentations suffered neurological deterioration and these 3 patients had poor compliance of anti-copper treatment. Quantative analysis of the neurological symptoms in the 37 patients using the Unified Wilson’s Disease Rating Scale (UWDRS) showed that the neurological symptoms were not changed in a short-term of one week after splenectomy but significantly improved in a long-term of one year after splenectomy. Additionally, compared to that before splenectomy, the esophageal gastric varices in most patients

  4. The double-degenerate model for the progenitors of Type Ia supernovae

    Science.gov (United States)

    Liu, D.; Wang, B.; Han, Z.

    2018-02-01

    The double-degenerate (DD) model, involving the merging of massive double carbon-oxygen white dwarfs (CO WDs) driven by gravitational wave radiation, is one of the classical pathways for the formation of Type Ia supernovae (SNe Ia). Recently, it has been proposed that the WD+He subgiant channel has a significant contribution to the production of massive double WDs, in which the primary WD accumulates mass by accreting He-rich matter from an He subgiant. We evolved about 1800 CO WD+He star systems and obtained a large and dense grid for producing SNe Ia through the DD model. We then performed a series of binary population synthesis simulations for the DD model, in which the WD+He subgiant channel is calculated by interpolations in the SN Ia production grid. According to our standard model, the Galactic birth rate of SNe Ia is about 2.4 × 10- 3 yr- 1 for the WD+He subgiant channel of the DD model; the total birth rate is about 3.7 × 10- 3 yr- 1 for all channels, reproducing that of observations. Previous theoretical models still have deficit with the observed SNe Ia with delay times 8 Gyr. After considering the WD+He subgiant channel, we found that the delay time distributions are comparable with the observed results. Additionally, some recent studies proposed that the violent WD mergers are more likely to produce SNe Ia based on the DD model. We estimated that the violent mergers through the DD model may contribute to at most 16 per cent of all SNe Ia.

  5. Overview of platelet physiology and laboratory evaluation of platelet function.

    Science.gov (United States)

    Rodgers, G M

    1999-06-01

    Appropriate laboratory testing for the platelet-type bleeding disorders hinges on an adequate assessment in the history and physical examination. Patients with histories and screening laboratory results consistent with coagulation disorders (hemophilia, disseminated intravascular coagulation) are not appropriate candidates for platelet function testing. In contrast, patients with a lifelong history of platelet-type bleeding symptoms and perhaps a positive family history of bleeding would be appropriate for testing. Figure 6 depicts one strategy to evaluate these patients. Platelet morphology can easily be evaluated to screen for two uncommon qualitative platelet disorders: Bernard-Soulier syndrome (associated with giant platelets) and gray platelet syndrome, a subtype of storage pool disorder in which platelet granulation is morphologically abnormal by light microscopy. If the bleeding disorder occurred later in life (no bleeding with surgery or trauma early in life), the focus should be on acquired disorders of platelet function. For those patients thought to have an inherited disorder, testing for vWD should be done initially because approximately 1% of the population has vWD. The complete vWD panel (factor VIII coagulant activity, vWf antigen, ristocetin cofactor activity) should be performed because many patients will have abnormalities of only one particular panel component. Patients diagnosed with vWD should be classified using multimeric analysis to identify the type 1 vWD patients likely to respond to DDAVP. If vWD studies are normal, platelet aggregation testing should be performed, ensuring that no antiplatelet medications have been ingested at least 1 week before testing. If platelet aggregation tests are normal and if suspicion for an inherited disorder remains high, vWD testing should be repeated. The evaluation of thrombocytopenia may require bone marrow examination to exclude primary hematologic disorders. If future studies with thrombopoietin assays

  6. Regulation of glutamine synthetase isoforms in two differentially drought-tolerant rice (Oryza sativa L.) cultivars under water deficit conditions.

    Science.gov (United States)

    Singh, Kamal Krishna; Ghosh, Shilpi

    2013-02-01

    KEY MESSAGE : The regulation of GS isoforms by WD was organ specific. Two GS isoforms i.e. OsGS1;1 and OsGS2 were differentially regulated in IR-64 (drought-sensitive) and Khitish (drought-tolerant) cultivars of rice. Water deficit (WD) has adverse effect on rice (Oryza sativa L.) and acclimation requires essential reactions of primary metabolism to continue. Rice plants utilize ammonium as major nitrogen source, which is assimilated into glutamine by the reaction of Glutamine synthetase (GS, EC 6.3.1.2). Rice plants possess one gene (OsGS2) for chloroplastic GS2 and three genes (OsGS1;1, OsGS1;2 and OsGS1;3) for cytosolic GS1. Here, we report the effect of WD on regulation of GS isoforms in drought-sensitive (cv. IR-64) and drought-tolerant (cv. Khitish) rice cultivars. Under WD, total GS activity in root and leaf decreased significantly in IR-64 seedlings in comparison to Khitish seedlings. The reduced GS activity in IR-64 leaf was mainly due to decrease in GS2 activity, which correlated with decrease in corresponding transcript and polypeptide contents. GS1 transcript and polypeptide accumulated in leaf during WD, however, GS1 activity was maintained at a constant level. Total GS activity in stem of both the varieties was insensitive to WD. Among GS1 genes, OsGS1;1 expression was differently regulated by WD in the two rice varieties. Its transcript accumulated more abundantly in IR-64 leaf than in Khitish leaf. Following WD, OsGS1;1 mRNA level in stem and root tissues declined in IR-64 and enhanced in Khitish. A steady OsGS1;2 expression patterns were noted in leaf, stem and root of both the cultivars. Results suggest that OsGS2 and OsGS1;1 expression may contribute to drought tolerance of Khitish cultivar under WD conditions.

  7. Fluid-phase immunoradiometric assay for the detection of qualitative abnormalities of factor VIII/von Willebrand factor in variants of von Willebrand's disease

    International Nuclear Information System (INIS)

    Girma, J.P.; Ardaillou, N.; Meyer, D.; Lavergne, J.M.; Larrieu, M.J.

    1979-01-01

    Antigenic reactivity of F.VIII/WF in variants of von Willebrand's disease (vWd) was studied with both fluid-phase and solid-phase immunoradiometric assays. Two different (rabbit and goat) 125 I-labeled specific antibodies against purified F.VIII/WF were used in both their divalent (lgG) and their monovalent (Fab fragment) forms. Dose-response curves obtained by reacting a constant amount of antibody with serial dilutions of plasmas from normal or homozygous vWd demonstrated the specificity of the test. The accuracy was significantly higher with 125 I-Fab fragments of goat anti-F.VIII/WF antiserum than intact goat lgG or rabbit lgG or Fab fragments. The significant decrease of the slope of the dose-response curves obtained with plasma from variants of vWd has been interpreted as due to the presence of abnormal F.VIII/WF molecules with decreased antigenic reactivity. A similar anomaly was found in cryosupernatant prepared from normal plasma, paralleling similarities demonstrated between variants of vWd and cryosupernatant. Results of experiments performed by reacting constant plasma dilutions from control or variants of vWd and varying concentrations of anti-F.VIII/WF Fab fragments (rabbit or goat) confirmed the decreased antigenic reactivity of variant F.VIII/WF

  8. CT differentiation of poorly-differentiated gastric neuroendocrine tumours from well-differentiated neuroendocrine tumours and gastric adenocarcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Seong Ho; Kim, Se Hyung; Shin, Cheong-il; Han, Joon Koo; Choi, Byung Ihn [Seoul National University Hospital, Department of Radiology, Jongno-gu, Seoul (Korea, Republic of); Seoul National University Hospital, Institute of Radiation Medicine, Jongno-gu, Seoul (Korea, Republic of); Kim, Min-A [Seoul National University Hospital, Department of Pathology, Jongno-gu, Seoul (Korea, Republic of)

    2015-07-15

    To evaluate the differential CT features of gastric poorly-differentiated neuroendocrine tumours (PD-NETs) from well-differentiated NETs (WD-NETs) and gastric adenocarcinomas (ADCs) and to suggest differential features of hepatic metastases from gastric NETs and ADCs. Our study population was comprised of 36 patients with gastric NETs (18 WD-NETs, 18 PD-NETs) and 38 patients with gastric ADCs who served as our control group. Multiple CT features were assessed to identify significant differential CT findings of PD-NETs from WD-NETs and ADCs. In addition, CT features of hepatic metastases including the metastasis-to-liver ratio were analyzed to differentiate metastatic NETs from ADCs. The presence of metastatic lymph nodes was the sole differentiator of PD-NETs from WD-NETs (P =.001, odds ratio = 56.67), while the presence of intact overlying mucosa with mucosal tenting was the sole significant CT feature differentiating PD-NETs from ADCs (P =.047, odds ratio = 15.3) For hepatic metastases, metastases from NETs were more hyper-attenuated than those from ADCs. The presence of metastatic LNs and intact overlying mucosa with mucosal tenting are useful CT discriminators of PD-NETs from WD-NETs and ADCs, respectively. In addition, a higher metastasis-to-liver ratio may help differentiate hepatic metastases of gastric NETs from those of gastric ADCs with high accuracy. (orig.)

  9. Post-main-sequence Evolution of Icy Minor Planets. II. Water Retention and White Dwarf Pollution around Massive Progenitor Stars

    Energy Technology Data Exchange (ETDEWEB)

    Malamud, Uri; Perets, Hagai B., E-mail: uri.mal@tx.technion.ac.il, E-mail: hperets@physics.technion.ac.il [Department of Physics, Technion (Israel)

    2017-06-10

    Most studies suggest that the pollution of white dwarf (WD) atmospheres arises from the accretion of minor planets, but the exact properties of polluting material, and in particular the evidence for water in some cases, are not yet understood. Here we study the water retention of small icy bodies in exo-solar planetary systems, as their respective host stars evolve through and off the main sequence and eventually become WDs. We explore, for the first time, a wide range of star masses and metallicities. We find that the mass of the WD progenitor star is of crucial importance for the retention of water, while its metallicity is relatively unimportant. We predict that minor planets around lower-mass WD progenitors would generally retain more water and would do so at closer distances from the WD than compared with high-mass progenitors. The dependence of water retention on progenitor mass and other parameters has direct implications for the origin of observed WD pollution, and we discuss how our results and predictions might be tested in the future as more observations of WDs with long cooling ages become available.

  10. Discovery of a Detached, Eclipsing 40 Minute Period Double White Dwarf Binary and a Friend: Implications for He+CO White Dwarf Mergers

    International Nuclear Information System (INIS)

    Brown, Warren R.; Kilic, Mukremin; Kosakowski, Alekzander; Gianninas, A.

    2017-01-01

    We report the discovery of two detached double white dwarf (WD) binaries, SDSS J082239.546+304857.19 and SDSS J104336.275+055149.90, with orbital periods of 40 and 46 minutes, respectively. The 40 minute system is eclipsing; it is composed of a 0.30 M ⊙ and a 0.52 M ⊙ WD. The 46 minute system is a likely LISA verification binary. The short 20 ± 2 Myr and ∼34 Myr gravitational-wave merger times of the two binaries imply that many more such systems have formed and merged over the age of the Milky Way. We update the estimated Milky Way He+CO WD binary merger rate and affirm our previously published result: He+CO WD binaries merge at a rate at least 40 times greater than the formation rate of stable mass-transfer AM CVn binaries, and so the majority must have unstable mass-transfer. The implication is that spin–orbit coupling in He+CO WD mergers is weak, or perhaps nova-like outbursts drive He+CO WDs into merger, as proposed by Shen.

  11. Discovery of a Detached, Eclipsing 40 Minute Period Double White Dwarf Binary and a Friend: Implications for He+CO White Dwarf Mergers

    Science.gov (United States)

    Brown, Warren R.; Kilic, Mukremin; Kosakowski, Alekzander; Gianninas, A.

    2017-09-01

    We report the discovery of two detached double white dwarf (WD) binaries, SDSS J082239.546+304857.19 and SDSS J104336.275+055149.90, with orbital periods of 40 and 46 minutes, respectively. The 40 minute system is eclipsing; it is composed of a 0.30 M ⊙ and a 0.52 M ⊙ WD. The 46 minute system is a likely LISA verification binary. The short 20 ± 2 Myr and ˜34 Myr gravitational-wave merger times of the two binaries imply that many more such systems have formed and merged over the age of the Milky Way. We update the estimated Milky Way He+CO WD binary merger rate and affirm our previously published result: He+CO WD binaries merge at a rate at least 40 times greater than the formation rate of stable mass-transfer AM CVn binaries, and so the majority must have unstable mass-transfer. The implication is that spin-orbit coupling in He+CO WD mergers is weak, or perhaps nova-like outbursts drive He+CO WDs into merger, as proposed by Shen. Based on observations obtained at the MMT Observatory, a joint facility of the Smithsonian Institution and the University of Arizona, and on observations obtained with the Apache Point Observatory 3.5 m telescope, which is owned and operated by the Astrophysical Research Consortium.

  12. Source Material and Concentration of Wildfire-Produced Pyrogenic Carbon Influence Post-Fire Soil Nutrient Dynamics

    Directory of Open Access Journals (Sweden)

    Lucas A. Michelotti

    2015-04-01

    Full Text Available Pyrogenic carbon (PyC is produced by the thermal decomposition of organic matter in the absence of oxygen (O. PyC affects nutrient availability, may enhance post-fire nitrogen (N mineralization rates, and can be a significant carbon (C pool in fire-prone ecosystems. Our objectives were to characterize PyC produced by wildfires and examine the influence that contrasting types of PyC have on C and N mineralization rates. We determined C, N, O, and hydrogen (H concentrations and atomic ratios of charred bark (BK, charred pine cones (PC, and charred woody debris (WD using elemental analysis. We also incubated soil amended with BK, PC, and WD at two concentrations for 60 days to measure C and N mineralization rates. PC had greater H/C and O/C ratios than BK and WD, suggesting that PC may have a lesser aromatic component than BK and WD. C and N mineralization rates decreased with increasing PyC concentrations, and control samples produced more CO2 than soils amended with PyC. Soils with PC produced greater CO2 and had lower N mineralization rates than soils with BK or WD. These results demonstrate that PyC type and concentration have potential to impact nutrient dynamics and C flux to the atmosphere in post-fire forest soils.

  13. The role

    Directory of Open Access Journals (Sweden)

    Suresh Vellaiyan

    2016-09-01

    Full Text Available Air pollution caused by the diesel engines has shown much interest in the domain of eco-friendly diesel fuels since enhanced environmental and human health are of concern. In order to obtain the efficient energy development with less polluted environment with existing diesel engines, continuous efforts have gone into research and development of water-in-diesel (W/D emulsion fuels, which have the potential to reduce nitric oxides (NOx and particulate matter (PM emissions simultaneously with improved performance level. The current discussion addresses the principle of W/D emulsion fuel, emulsion fuel stability, physico-chemical properties and effect of W/D emulsion fuel on combustion, performance and emission characteristics. In addition, role of nano-additives in W/D emulsion fuel, nano-fuel synthesis and its influence on engine performance and emission characteristics are also discussed. The survey of earlier reports led to the decision that the optimization of engine parameters, nano-particle size confirmation in nano-fuel and its handling from engine exhaust are the details to be studied in the domain of W/D emulsion fuel engine.

  14. Wilson Disease: Case Report

    Directory of Open Access Journals (Sweden)

    Esra Tuğ

    2007-01-01

    Full Text Available Wilson Disease (WD is an autosomal recessive hereditary disease of human copper metabolism, which causes hepatic and neuropsychiatric diseases. Estimated prevalence is 1: 30.000. In WD, ATP7B gene located on chromosome 13 (13q14.3-q21.1, coding the protein for hepatic copper transport and, having an important role in copper metabolism has been affected. Clinical findings in WD are complex and, neurological symptoms such as tremor, disartria and psychiatric disorders, acute liver deficiency, chronic hepatit or cirrhosis may develop. For the last year, 27 years old female patient observed in other medical centre owing to benign positional vertigo applied to our department. Her sister and brother have been diagnosed as WD. No peripheral syptoms of hepatic disease or hepatosplenomegaly existed in our patient. Neurological examination was normal to except for positional tremor. Because our patient had rare clinical features for WD and bad prognosis, presented by us to emphasize necessity of the researched of the most frequent mutations seen in Turkiye.

  15. Development of generalized correlation equation for the local wall shear stress

    International Nuclear Information System (INIS)

    Jeon, Yu Mi; Bae, Jun Ho; Park, Joo Hwan

    2010-01-01

    The pressure drop characteristics for a fuel channel are essential for the design and reliable operation of a nuclear reactor. Over several decades, analytical methods have been developed to predict the friction factor in the fuel bundle flows. In order to enhance the accuracy of prediction for the pressure drop in a rod bundle, the influences of a channel wall and the local shear stress distribution should be considered. Hence, the correlation equation for a local shear stress distribution should be developed in order to secure an analytical solution for the friction factor of a rod bundle. For a side subchannel, which has the influence of the channel wall, the local shear stress distribution is dependent on the ratio of wall to diameter (W/D) as well as the ratio of pitch to diameter (P/D). In the case that W/D has the same value with P/D, the local shear stress distribution can be simply correlated with the function of angular position for each value of P/D. While, in the case that W/D has the different value with P/D, the correlation equation should be developed for each case of P/D and W/D. Hence, in the present study, the generalized correlation equation of a local shear stress distribution is developed for a side subchannel in the case that W/D has the different value with P/D

  16. ARE ULTRA-LONG GAMMA-RAY BURSTS CAUSED BY BLUE SUPERGIANT COLLAPSARS, NEWBORN MAGNETARS, OR WHITE DWARF TIDAL DISRUPTION EVENTS?

    Energy Technology Data Exchange (ETDEWEB)

    Ioka, Kunihito [Center for Gravitational Physics, Yukawa Institute for Theoretical Physics, Kyoto University, Kyoto 606-8502 (Japan); Hotokezaka, Kenta; Piran, Tsvi, E-mail: kunihito.ioka@yukawa.kyoto-u.ac.jp [Racah Institute of Physics, The Hebrew University of Jerusalem, Jerusalem 91904 (Israel)

    2016-12-10

    Ultra-long gamma-ray bursts (ulGRBs) are a new population of GRBs with extreme durations of ∼10{sup 4} s. Leading candidates for their origin are blue supergiant collapsars, magnetars, and white dwarf tidal disruption events (WD-TDEs) caused by massive black holes (BHs). Recent observations of supernova-like (SN-like) bumps associated with ulGRBs challenged both the WD-TDE and the blue supergiant models because of the detection of SNe and the absence of hydrogen lines, respectively. We propose that WD-TDEs can accommodate the observed SN-like bumps if the fallback WD matter releases energy into the unbound WD ejecta. The observed ejecta energy, luminosity, and velocity are explained by the gravitational energy, Eddington luminosity, and escape velocity of the formed accretion disk, respectively. We also show that the observed X-rays can ionize the ejecta, eliminating lines. The SN-like light curves (SN 2011kl) for the ulGRB 111209A are consistent with all three models, although a magnetar model is unnatural because the spin-down time required to power the SN-like bump is a hundred times longer than the GRB. Our results imply that TDEs are a possible energy source for SN-like events in general and for ulGRBs in particular.

  17. Evaluation of maize S2 lines in test cross combinations I : flowering and morphological traits

    International Nuclear Information System (INIS)

    Rahman, H.; Shah, A.Z.; Shah, S.M.A.; Khalil, I.H.

    2010-01-01

    This research work was conducted at N.W.F.P. Agricultural University, Peshawar to test 24 maize S2 lines using line x tester analysis. Data were recorded on days to 50% pollen shedding and silking, anthesis silking interval (ASI), ear height and plant height. Results revealed highly significant differences among the testcrosses for all these parameters. Maximum days to silking (62) were observed for TC-13, using WD 2x8 as a tester, while SCA for day to silking was recorded 3.15. Maximum days to anthesis were observed (60) for TC-36, using WD 3x6 as a tester. Maximum value (3 days) for anthesis silking interval was observed for TC-13, using WD 2x8 as a tester, while SCA for anthesis silking interval was recorded to be 1.60 days. Maximum ear height (82cm) was observed for the TC-21, using WD 3x6 as a tester, while SCA for ear height was 1.5 cm. Maximum plant eight (161 cm) was observed for TC-21, using WD 3x6 as a tester, while SCA for plant height was found to be -17.8 cm. These testcrosses are recommended to be included in further breeding programs for developing maize germplasm with earlier flowering and desirable plant and ear height attributes. (author)

  18. Robust Imaging Methodology for Challenging Environments: Wave Equation Dispersion Inversion of Surface Waves

    KAUST Repository

    Li, Jing

    2017-12-22

    A robust imaging technology is reviewed that provide subsurface information in challenging environments: wave-equation dispersion inversion (WD) of surface waves for the shear velocity model. We demonstrate the benefits and liabilities of the method with synthetic seismograms and field data. The benefits of WD are that 1) there is no layered medium assumption, as there is in conventional inversion of dispersion curves, so that the 2D or 3D S-velocity model can be reliably obtained with seismic surveys over rugged topography, and 2) WD mostly avoids getting stuck in local minima. The synthetic and field data examples demonstrate that WD can accurately reconstruct the S-wave velocity distributions in laterally heterogeneous media if the dispersion curves can be identified and picked. The WD method is easily extended to anisotropic media and the inversion of dispersion curves associated with Love wave. The liability is that is almost as expensive as FWI and only recovers the Vs distribution to a depth no deeper than about 1/2~1/3 wavelength.

  19. Physiology and transcriptomics of water-deficit stress responses in wheat cultivars TAM 111 and TAM 112.

    Science.gov (United States)

    Reddy, Srirama Krishna; Liu, Shuyu; Rudd, Jackie C; Xue, Qingwu; Payton, Paxton; Finlayson, Scott A; Mahan, James; Akhunova, Alina; Holalu, Srinidhi V; Lu, Nanyan

    2014-09-01

    Hard red winter wheat crops on the U.S. Southern Great Plains often experience moderate to severe drought stress, especially during the grain filling stage, resulting in significant yield losses. Cultivars TAM 111 and TAM 112 are widely cultivated in the region, share parentage and showed superior but distinct adaption mechanisms under water-deficit (WD) conditions. Nevertheless, the physiological and molecular basis of their adaptation remains unknown. A greenhouse study was conducted to understand the differences in the physiological and transcriptomic responses of TAM 111 and TAM 112 to WD stress. Whole-plant data indicated that TAM 112 used more water, produced more biomass and grain yield under WD compared to TAM 111. Leaf-level data at the grain filling stage indicated that TAM 112 had elevated abscisic acid (ABA) content and reduced stomatal conductance and photosynthesis as compared to TAM 111. Sustained WD during the grain filling stage also resulted in greater flag leaf transcriptome changes in TAM 112 than TAM 111. Transcripts associated with photosynthesis, carbohydrate metabolism, phytohormone metabolism, and other dehydration responses were uniquely regulated between cultivars. These results suggested a differential role for ABA in regulating physiological and transcriptomic changes associated with WD stress and potential involvement in the superior adaptation and yield of TAM 112. Copyright © 2014 Elsevier GmbH. All rights reserved.

  20. Update on the clinical management of Wilson's disease

    Directory of Open Access Journals (Sweden)

    Hedera P

    2017-01-01

    Full Text Available Peter Hedera Department of Neurology, Vanderbilt University Medical Center, Nashville, TN, USA Abstract: Wilson’s disease (WD, albeit relatively rare, is an important genetic metabolic disease because of highly effective therapies that can be lifesaving. It is a great imitator and requires a high index of suspicion for correct and timely diagnosis. Neurologic, psychiatric and hepatologic problems in WD are very nonspecific, and we discuss the most common clinical phenotypes. The diagnosis remains laboratory based, and here we review the most important challenges and pitfalls in laboratory evaluation of WD, including the emerging role of genetic testing in WD diagnosis. WD is a monogenic disorder but has very high allelic heterogeneity with >500 disease-causing mutations identified, and new insights into phenotype–genotype correlations are also reviewed. The gold standard of therapy is chelation of excessive copper, but many unmet needs exist because of possible clinical deterioration in treated patients and potential adverse effects associated with currently available chelating medications. We also review the most promising novel therapeutic approaches, including chelators targeting specific cell types, cell transplantation and gene therapy. Keywords: Wilson’s disease, copper, ATP7B, chelation, gene therapy

  1. A high-sugar and high-fat diet impairs cardiac systolic and diastolic function in mice.

    Science.gov (United States)

    Carbone, Salvatore; Mauro, Adolfo G; Mezzaroma, Eleonora; Kraskauskas, Donatas; Marchetti, Carlo; Buzzetti, Raffaella; Van Tassell, Benjamin W; Abbate, Antonio; Toldo, Stefano

    2015-11-01

    Heart failure (HF) is a clinical syndrome characterized by dyspnea, fatigue, exercise intolerance and cardiac dysfunction. Unhealthy diet has been associated with increased risk of obesity and heart disease, but whether it directly affects cardiac function, and promotes the development and progression of HF is unknown. We fed 8-week old male or female CD-1 mice with a standard diet (SD) or a diet rich in saturated fat and sugar, resembling a "Western" diet (WD). Cardiac systolic and diastolic function was measured at baseline and 4 and 8 weeks by Doppler echocardiography, and left ventricular (LV) end-diastolic pressure (EDP) by cardiac catheterization prior to sacrifice. An additional group of mice received WD for 4 weeks followed by SD (wash-out) for 8 weeks. WD-fed mice experienced a significant decreased in LV ejection fraction (LVEF), reflecting impaired systolic function, and a significant increase in isovolumetric relaxation time (IRT), myocardial performance index (MPI), and LVEDP, showing impaired diastolic function, without any sex-related differences. Switching to a SD after 4 weeks of WD partially reversed the cardiac systolic and diastolic dysfunction. A diet rich in saturated fat and sugars (WD) impairs cardiac systolic and diastolic function in the mouse. Further studies are required to define the mechanism through which diet affects cardiac function, and whether dietary interventions can be used in patients with, or at risk for, HF. Published by Elsevier Ireland Ltd.

  2. Discovery of a Detached, Eclipsing 40 Minute Period Double White Dwarf Binary and a Friend: Implications for He+CO White Dwarf Mergers

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Warren R. [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Kilic, Mukremin; Kosakowski, Alekzander; Gianninas, A., E-mail: wbrown@cfa.harvard.edu, E-mail: kilic@ou.edu, E-mail: alexg@nhn.ou.edu [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks Street, Norman, OK 73019 (United States)

    2017-09-20

    We report the discovery of two detached double white dwarf (WD) binaries, SDSS J082239.546+304857.19 and SDSS J104336.275+055149.90, with orbital periods of 40 and 46 minutes, respectively. The 40 minute system is eclipsing; it is composed of a 0.30 M {sub ⊙} and a 0.52 M {sub ⊙} WD. The 46 minute system is a likely LISA verification binary. The short 20 ± 2 Myr and ∼34 Myr gravitational-wave merger times of the two binaries imply that many more such systems have formed and merged over the age of the Milky Way. We update the estimated Milky Way He+CO WD binary merger rate and affirm our previously published result: He+CO WD binaries merge at a rate at least 40 times greater than the formation rate of stable mass-transfer AM CVn binaries, and so the majority must have unstable mass-transfer. The implication is that spin–orbit coupling in He+CO WD mergers is weak, or perhaps nova-like outbursts drive He+CO WDs into merger, as proposed by Shen.

  3. Canagliflozin, an SGLT2 inhibitor, attenuates the development of hepatocellular carcinoma in a mouse model of human NASH.

    Science.gov (United States)

    Shiba, Kumiko; Tsuchiya, Kyoichiro; Komiya, Chikara; Miyachi, Yasutaka; Mori, Kentaro; Shimazu, Noriko; Yamaguchi, Shinobu; Ogasawara, Naomi; Katoh, Makoto; Itoh, Michiko; Suganami, Takayoshi; Ogawa, Yoshihiro

    2018-02-05

    Sodium glucose cotransporter 2 (SGLT2) inhibitors, an antidiabetic drug, promotes urinary excretion of glucose by blocking its reabsorption in the renal proximal tubules. It is unclear whether SGLT2 inhibition could attenuate nonalcoholic steatohepatitis (NASH) and NASH-associated hepatocellular carcinoma. We examined the preventive effects of an SGLT2 inhibitor canagliflozin (CANA) in Western diet (WD)-fed melanocortin 4 receptor-deficient (MC4R-KO) mice, a mouse model of human NASH. An eight-week CANA treatment attenuated hepatic steatosis in WD-fed MC4R-KO mice, with increased epididymal fat mass without inflammatory changes. CANA treatment for 20 weeks inhibited the development of hepatic fibrosis in WD-fed MC4R-KO mice. After one year of CANA treatment, the number of liver tumors was significantly reduced in WD-fed MC4R-KO mice. In adipose tissue, CANA suppressed the ratio of oxidative to reduced forms of glutathiones (GSSG/GSH) in WD-fed MC4R-KO mice. Treatment with GSH significantly attenuated the H 2 O 2 -induced upregulation of genes related to NADPH oxidase in 3T3-L1 adipocytes, and that of Il6, Tgfb, and Pdgfb in RAW264.7 cells. This study provides evidence that SGLT2 inhibitors represent the unique class of drugs that can attenuate or delay the onset of NASH and eventually hepatocellular carcinoma, at least partly, through "healthy adipose expansion".

  4. THE MASS DISTRIBUTION OF COMPANIONS TO LOW-MASS WHITE DWARFS

    International Nuclear Information System (INIS)

    Andrews, Jeff J.; Price-Whelan, Adrian M.; Agüeros, Marcel A.

    2014-01-01

    Measuring the masses of companions to single-line spectroscopic binary stars is (in general) not possible because of the unknown orbital plane inclination. Even when the mass of the visible star can be measured, only a lower limit can be placed on the mass of the unseen companion. However, since these inclination angles should be isotropically distributed, for a large enough, unbiased sample, the companion mass distribution can be deconvolved from the distribution of observables. In this work, we construct a hierarchical probabilistic model to infer properties of unseen companion stars given observations of the orbital period and projected radial velocity of the primary star. We apply this model to three mock samples of low-mass white dwarfs (LMWDs; M ≲ 0.45 M ☉ ) and a sample of post-common-envelope binaries. We use a mixture of two Gaussians to model the WD and neutron star (NS) companion mass distributions. Our model successfully recovers the initial parameters of these test data sets. We then apply our model to 55 WDs in the extremely low-mass (ELM) WD Survey. Our maximum a posteriori model for the WD companion population has a mean mass μ WD = 0.74 M ☉ , with a standard deviation σ WD = 0.24 M ☉ . Our model constrains the NS companion fraction f NS to be <16% at 68% confidence. We make samples from the posterior distribution publicly available so that future observational efforts may compute the NS probability for newly discovered LMWDs

  5. NO NEUTRON STAR COMPANION TO THE LOWEST MASS SDSS WHITE DWARF

    International Nuclear Information System (INIS)

    Agueeros, Marcel A.; Camilo, Fernando; Heinke, Craig; Kilic, Mukremin; Anderson, Scott F.; Silvestri, Nicole M.; Freire, Paulo; Kleinman, Scot J.; Liebert, James W.

    2009-01-01

    SDSS J091709.55+463821.8 (hereafter J0917+4638) is the lowest surface gravity white dwarf (WD) currently known, with log g = 5.55 ± 0.05 (M ∼ 0.17 M sun ). Such low-mass white dwarfs (LMWDs) are believed to originate in binaries that evolve into WD/WD or WD/neutron star (NS) systems. An optical search for J0917+4638's companion showed that it must be a compact object with a mass ≥0.28 M sun . Here we report on Green Bank Telescope 820 MHz and XMM-Newton X-ray observations of J0917+4638 intended to uncover a potential NS companion to the LMWD. No convincing pulsar signal is detected in our radio data. Our X-ray observation also failed to detect X-ray emission from J0917+4638's companion, while we would have detected any of the millisecond radio pulsars in 47 Tuc. We conclude that the companion is almost certainly another WD.

  6. Consumption of the Soluble Dietary Fibre Complex PolyGlycopleX® Reduces Glycaemia and Increases Satiety of a Standard Meal Postprandially

    Directory of Open Access Journals (Sweden)

    Vicky A. Solah

    2016-05-01

    Full Text Available The effect of consumption of PolyGlycopleX® (PGX® was compared to wheat dextrin (WD in combination with a standard meal, on postprandial satiety and glycaemia in a double-blind, randomised crossover trial, of 14 healthy subjects trained as a satiety panel. At each of six two-hour satiety sessions, subjects consumed one of three different test meals on two separate occasions. The test meals were: a standard meal plus 5 g PGX; a standard meal plus 4.5 g of PGX as softgels; and a standard meal plus 5 g of WD. Subjects recorded fullness using a labelled magnitude scale at 0, 15, 30, 45, 60, 90, and 120 min and the total area under the curve (AUC, mean fullness vs. time was calculated. The meals with PGX (in granular and softgel form gave higher satiety (AUC (477 ± 121 and 454 ± 242 cm·min, than the meal with WD (215 ± 261 cm·min (p < 0.001. Subjects had blood glucose levels measured after the meals with PGX (granules and WD. Glucose response (AUC was significantly lower (p < 0.001 after the PGX meal than for the WD meal.  The high viscosity reported for PGX is a likely mechanism behind the significant satiety and blood glucose modulating effects observed in this study.

  7. AN X-RAY AND OPTICAL LIGHT CURVE MODEL OF THE ECLIPSING SYMBIOTIC BINARY SMC3

    International Nuclear Information System (INIS)

    Kato, Mariko; Hachisu, Izumi; Mikołajewska, Joanna

    2013-01-01

    Some binary evolution scenarios for Type Ia supernovae (SNe Ia) include long-period binaries that evolve to symbiotic supersoft X-ray sources in their late stage of evolution. However, symbiotic stars with steady hydrogen burning on the white dwarf's (WD) surface are very rare, and the X-ray characteristics are not well known. SMC3 is one such rare example and a key object for understanding the evolution of symbiotic stars to SNe Ia. SMC3 is an eclipsing symbiotic binary, consisting of a massive WD and red giant (RG), with an orbital period of 4.5 years in the Small Magellanic Cloud. The long-term V light curve variations are reproduced as orbital variations in the irradiated RG, whose atmosphere fills its Roche lobe, thus supporting the idea that the RG supplies matter to the WD at rates high enough to maintain steady hydrogen burning on the WD. We also present an eclipse model in which an X-ray-emitting region around the WD is almost totally occulted by the RG swelling over the Roche lobe on the trailing side, although it is always partly obscured by a long spiral tail of neutral hydrogen surrounding the binary in the orbital plane.

  8. Poorly-differentiated colorectal neuroendocrine tumour: CT differentiation from well-differentiated neuroendocrine tumour and poorly-differentiated adenocarcinomas

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Ji Hee [Seoul National University Hospital, Department of Radiology, Seoul (Korea, Republic of); Kim, Se Hyung [Seoul National University Hospital, Department of Radiology, Seoul (Korea, Republic of); Seoul National University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Han, Joon Koo [Seoul National University Hospital, Department of Radiology, Seoul (Korea, Republic of); Seoul National University College of Medicine, Department of Radiology, Seoul (Korea, Republic of); Seoul National University Medical Research Center, Institute of Radiation Medicine, Seoul (Korea, Republic of)

    2017-09-15

    The differentiation of poorly-differentiated neuroendocrine tumours (PD-NETs), well-differentiated NETs (WD-NETs), and adenocarcinomas (ADCs) is important due to different management options and prognoses. This study is to find the differential CT features of colorectal PD-NETs from WD-NETs and ADCs. CT features of 25 colorectal WD-NETs, 36 PD-NETs, and 36 ADCs were retrospectively reviewed. Significant variables were assessed using univariate and multivariate analyses. Receiver operating characteristics analysis determined the optimal cut-off value of tumour and lymph node (LN) size. Large size, rectum location, ulceroinfiltrative morphology without intact overlying mucosa, heterogeneous attenuation with necrosis, presence of ≥3 enlarged LNs, and metastasis were significant variables to differentiate PD-NETs from WD-NETs (P < 0.05). High attenuation on arterial phase, persistently high enhancement pattern, presence of ≥6 enlarged LNs, large LN size, and wash-in/wash-out enhancement pattern of liver metastasis were significant variables to differentiate PD-NETs from ADCs (P < 0.05). Compared to WD-NETs, colorectal PD-NETs are usually large, heterogeneous, and ulceroinfiltrative mass without intact overlying mucosa involving enlarged LNs and metastasis. High attenuation on arterial phase, presence of enlarged LNs with larger size and greater number, and wash-in/wash-out enhancement pattern of liver metastasis can be useful CT discriminators of PD-NETs from ADCs. (orig.)

  9. Hydrogen and helium shell burning during white dwarf accretion

    Science.gov (United States)

    Cui, Xiao; Meng, Xiang-Cun; Han, Zhan-Wen

    2018-05-01

    Type Ia supernovae (SNe Ia) are believed to be thermonuclear explosions of carbon oxygen (CO) white dwarfs (WDs) with masses close to the Chandrasekhar mass limit. How a CO WD accretes matter and grows in mass to this limit is not well understood, hindering our understanding of SN Ia explosions and the reliability of using SNe Ia as a cosmological distance indicator. In this work, we employed the stellar evolution code MESA to simulate the accretion process of hydrogen-rich material onto a 1.0 M ⊙ CO WD at a high rate (over the Eddington limit) of 4.3 × 10‑7 M ⊙ yr‑1. The simulation demonstrates the characteristics of the double shell burning on top of the WD, with a hydrogen shell burning on top of a helium burning shell. The results show that helium shell burning is not steady (i.e. it flashes). Flashes from the helium shell are weaker than those in the case of accretion of helium-rich material onto a CO WD. The carbon to oxygen mass ratio resulting from the helium shell burning is higher than what was previously thought. Interestingly, the CO WD growing due to accretion has an outer part containing a small fraction of helium in addition to carbon and oxygen. The flashes become weaker and weaker as the accretion continues.

  10. Shiningbank energy, Rodney, Ontario : natural channel realignment for protection of an oil field battery

    International Nuclear Information System (INIS)

    Hirvonen, J.

    2005-01-01

    The Rodney Unit 1 battery in Ontario has produced Devonian crude oil with some hydrogen sulfide since 1948. Waterflooding was initiated in 1968, and continues today using recycled produced water as a flushing agent. This presentation provided details of recent upgrades which included replacement of all storage tanks and production lines as well as new lines under the Fleming Creek drain. Upgrades of waterflooding injection systems and the reconstruction of a battery tank farm were also conducted, and old infrastructure and tanks were removed. An environmental conditions investigation revealed oil seepage from Fleming Drain Creek bank, as well as creek erosion which threatened the unit battery. Remediation options required addressing environmental issues due to regulations. Experts hired during the investigation included a hydrogeologist; a fluvial geomorphologist; a fisheries biologist and a restoration contractor. The aim of the project was to extract contaminants from the soil and provide site stability through a realignment of the creek. The site was also revegetated following construction. Various design options were outlined and a construction sequence was presented. A post-construction inspection showed that the Rodney Unit 1 Battery was remediated in accordance with Ontario standards. Soil and groundwater quality now meets Ministry of the Environment standards for the site. The realignment of Fleming Creek Drain in the vicinity of the battery has improved functionality of the drain, and reduced the erosive impact on the battery site as well as enhancing the aquatic habitat in the area. It was concluded that industry applications of ecosystem design solutions have improved pipeline crossings, temporary road impacts and erosion threats. Site decommissioning is also expected to be less costly and time-consuming due to the remediation methods used. refs., tabs., figs

  11. Animation: textural difference and the materiality of Holocaust memory

    OpenAIRE

    Walden, Victoria Grace

    2014-01-01

    The notion of “Holocaust animation” may seem paradoxical; how can a medium which, in the popular eye, is usually associated with comedy, play and fantasy be used to remember one of the 20th century’s most traumatic events? By examining the textural difference of animation to our lived world in texts such as Silence (Yadin and Bringas 1998) and I was a Child of Holocaust Survivors (Ann Marie Fleming 2010), it becomes clear how the medium can emphasise the fragile materiality of Holocaust memor...

  12. Communicating the relevance of the library in the age of Google: Improving undergraduate research skills and information literacy though new models of library instruction

    Directory of Open Access Journals (Sweden)

    Jennifer Rempel

    2013-12-01

    Full Text Available Most academic librarians have long been aware that the ascent of the Internet has posed a challenge to the primacy of the library as information hub. Recent studies have shown that the majority of undergraduate students do not begin their research in the library, but with Google and Wikipedia - and many students end their research here as well (Connaway, Dickey, & Radford, 2011. This trend would seem to bode ill for the quality of the research skills and the level of information literacy among current undergraduates, as many students privilege convenient access to information over quality of content (Colón-Aguirre & Fleming-May, 2012; Connaway, et al., 2011. But how do we prepare undergraduate students for the rigours of academic research given this circumstance? The library instruction session has been the path to information literacy traditionally taken by colleges and universities, but increasingly, librarians have begun questioning the value of these sessions. Many undergraduates do not find library instruction sessions relevant to their practical information needs and to changing modes of information access, and many students do not come away from library information sessions feeling fully prepared - or even fully willing - to move beyond Google and into the library in order to carry out quality information searches (Colón-Aguirre & Fleming-May, 2012. Indeed, many librarians also now feel that the classic model of library instruction no longer fully meets the information needs of undergraduates nor anticipates their Internet-focused research habits, and that library instruction needs to change dramatically in order to do so (Colón-Aguirre & Fleming-May, 2012; Farkas, 2012. Such means of improving library instruction include: breaking away from the single-session model and moving toward a multiple-session model (Farkas, 2012; incorporating discussion of Internet-based and electronic resources more fully into instruction sessions (Col

  13. Project SQUID: Quarterly Progress Report

    Science.gov (United States)

    1950-07-01

    JET ENGINES. ( HYU -eÄl) Submitted by» J» Lemeleon^ New York University, No data on the operations of the glass-walled pulse jet have been...It is felt at HYU that a better understanding of the rela- tively simple phenomenon of the Rijke tube is, therefore, essential before headway...tnd combustion, KYTJ-7R6. Lerge amplitude ges vibration theory 19 HyU -7R7. Photo-ignition 1.4 NYU-7R8. Hydrocorbon Fleme Bends 67 i NYU

  14. [Poet-physicians in German literature].

    Science.gov (United States)

    Perels, C

    1991-12-17

    Starting with standards arising from the relationship between medicine and art in classical antiquity, biblical tradition and teutonic-pagan antiquity, this article roams through german literature from the Middle Ages up to the 20th century, from Hildegard of Bingen to Gottfried Benn and Alfred Döblin, guided by the question, how strongly medical knowledge and medical practise are reflected in the poetry of writing physicians. Individual dispositions and epoque-specific features are discussed. Special attention is given to Paul Fleming and Angelus Silesius, Albrecht von Haller and Friedrich Schiller, romanticism and Georg Büchner.

  15. New records of the rare calcareous sponge Paragrantia waguensis Hôzawa, 1940

    Science.gov (United States)

    Van Soest, Rob W.M.; Hoeksema, Bert W.; Reimer, James D.; De Voogd, Nicole J.

    2015-01-01

    Abstract Paragrantia waguensis Hôzawa is reported from coastal reefs of the island of Okinawa. This rare species was previously known only from Central Japan, Mie Prefecture. It has peculiar apopylar tetractine spicules, so far unique among Calcarea. We present in situ images of the species and a full description including SEM images of skeletal structure and spicule complement. The status of Paragrantia as a separate genus of the family Grantiidae distinct from Grantia Fleming is confirmed on the basis of a morphological and molecular comparison with the European type species of Grantia, Grantia compressa (Fabricius). PMID:26798302

  16. AIDS czar says Manhattan Project is underway. Interview by Cesar Chavez.

    Science.gov (United States)

    Fleming, P

    1995-01-01

    National AIDS Policy Director, Patricia Fleming, was recently interviewed by "Positively Aware". During the interview she stated that she believes the Clinton Administration will deliver on the HIV/AIDS community's call for a Manhattan Project for AIDS. She credited Dr. William Paul (National Institutes for Health) with focusing HIV research on basic science, and stated that her priorities include working on and lobbying for the best possible HIV/AIDS budget, completing a report on AIDS incidence among adolescents, and salvaging the HOPWA program.

  17. Transitions Towards Operational Space-Based Ocean Observations: From Single Research Missions into Series and Constellations

    Science.gov (United States)

    2011-02-16

    have formed the basis of sea ice concentration monitoring over last decades (see Breivik ct al. [20]). As for SST it is importance to secure the...J., Harrison D.E. and Stammer, D.. Eds., ESA Publication WPP- 306, 2010. 12 Gulev, S. Josey. S., Bourassa, M., Breivik , L.-A., Cronin M., Fairall...Harrison D.E. and Stammer, D., Eds., ESA Publication WPP-306, 2010. 20 Breivik , L.-A.. Carrieres, T., Eastwood, S., Fleming, A., Girard-Ardhuin, F

  18. Chaos applications in telecommunications

    CERN Document Server

    Stavroulakis, Peter

    2005-01-01

    IntroductionPeter StavroulakisChaotic Signal Generation and Transmission Antonio Cândido Faleiros,Waldecir João Perrella,TâniaNunes Rabello,Adalberto Sampaio Santos, andNeiYoshihiro SomaChaotic Transceiver Design Arthur Fleming-DahlChaos-Based Modulation and DemodulationTechniques Francis C.M. Lau and Chi K. TseA Chaos Approach to Asynchronous DS-CDMASystems S. Callegari, G. Mazzini, R. Rovatti, and G. SettiChannel Equalization in Chaotic CommunicationSystems Mahmut CiftciOptical Communications using ChaoticTechniques Gregory D. VanWiggerenAPPENDIX AFundamental Concepts of the Theory ofChaos a

  19. Field Tests with Drilled Shafts in Tension in Frictional Soil

    DEFF Research Database (Denmark)

    Krabbenhøft, Sven; Damkilde, Lars; Andersen, Allan

    2009-01-01

    Three series of ten piles each have been installed. The lengths of the piles varied from 2 m to 6 m and the diameters were 14 cm, 25 cm and 60 cm. The piles were constructed above the ground water table using continuous flight augers and the concrete was placed by gravity free fall. All piles were...... tested to failure in axial uplift and the load-displacement relations were recorded and the results from the tests have been compared with theoretical values based on current design practice and the methods proposed by Fleming et al. and Reese & O'Neill seem to produce the best match with the test...

  20. Using the sensor web to detect and monitor the spread of wild fires

    CSIR Research Space (South Africa)

    Moodley, D

    2006-09-01

    Full Text Available is facilitated by the Sensor Web Registry Service – an extended version of the OGC Catalog Service. 3 THE ADVANCED FIRE INFORMATION SYSTEM The Advanced Fire Information System (AFIS) is the first near real-time satellite-based fire monitoring system in Africa.... It was originally developed for the South African electrical power util- ity, ESKOM to mitigate the impact of wild fires on regional elec- tricity supply (Fleming et al., 2005, Frost and Vosloo, 2006). AFIS was first implemented using propriety GIS technology...

  1. Deception and the Mediterranean Campaigns of 1943-1944

    Science.gov (United States)

    1986-03-31

    South East Asia Command; Fleming by the way, • was the brother of Ian I’leming, the British spy novelist. Regardless of these evolutions in the...British. 7. David Mure, MAsJl . "rpn., D IAn &led Webk in - an the Kiddla Ka"e. p. 131. ’ 8. Interviews with Mure. The role of Noel Wild in "A" Force...Supreme Allied Commander, Mediterranean) .’- 175 General Maitland "Jumbo" Wilson to conduct operations against 7 southern France at about the same

  2. A re-appraisal of the conventional history of antibiosis and Penicillin.

    Science.gov (United States)

    Arseculeratne, S N; Arseculeratne, G

    2017-05-01

    The popular perception of the history of antibiosis and penicillin is that Alexander Fleming was the sole researcher on penicillin. The literature, however, has documentation of preceding persons who reported definitively on these topics, from the late 19 th century. Divergent reports on "firsts" in the discovery of antimicrobial activity of Penicillium and on the use of penicillin as a therapeutic agent, are present. This review adds knowledge from diverse sources, and restores historical priorities to the conventional story of Penicillin. © 2017 Blackwell Verlag GmbH.

  3. Congressional Authority to Limit U.S. Military Operations in Iraq

    Science.gov (United States)

    2007-07-11

    consist of “one major, four captains, sixteen first lieutenants, twelve second lieutenants, forty-eight sergeants, forty-eight corporals , thirty-two...after-the-fact financing . In 1994, for example, President Clinton based his authority to order the participation of U.S. forces in NATO actions in...1973). 97 Fleming v. Mohawk Wrecking & Lumber Co., 331 U.S. 111, 116 (1947). See also Berk v. Laird 317 F. Supp. 715, 727-728 (D.C.N.Y. 1970

  4. Congressional Authority to Limit Military Operations

    Science.gov (United States)

    2013-02-19

    corporals , thirty-two drums and fifes, and seven hundred and twenty privates....”33 Congress authorized the President to appoint certain other officers...U.S. Armed Forces to involvements abroad absent any congressional participation other than consultation and after-the-fact financing . In 1994, for...F.2d 1146, 1156-1157 (2nd Cir. 1973). 126 Fleming v. Mohawk Wrecking & Lumber Co., 331 U.S. 111, 116 (1947). See also Berk v. Laird 317 F. Supp. 715

  5. A Critique of Mark Lemley’s “The Myth of the Sole Inventor”

    DEFF Research Database (Denmark)

    Howells, John; Katznelson, RD

    2011-01-01

    in the pioneer invention cases of Edison, the Wright brothers, the Selden automobile patent vis-a-vis Ford, Watt and the steam engine and Fleming and penicillin. We are concerned with the errors in alleged historical and legal facts in what Lemley calls “lessons of history” and “realities of innovation” because......-simultaneous inventions. We illustrate that the lessons of history, when informed by consultation of relevant patents, legal decisions and patent law not only do not support Lemley’s central thesis, but offer valuable insights into how America’s historical patent system and innovation work together to foster development....

  6. Historical Examples of Misrepresentation, Innovation, and Morality in Physical Science and Technology

    Science.gov (United States)

    Buchwald, Jed

    2016-03-01

    The pressures of publication, the desire to be first in innovation, and moral convictions have long been at work in the history of science and technology. Historians think and argue best through stories, so I've chosen three examples that exemplify one or more of these aspects. The first involves the discovery of electric waves by Heinrich Hertz in 1888; the second concerns the controlled production of electromagnetic radiation by Marconi and Fleming in the early 1900s; our final case involves a bitter controversy between the physicist Hermann von Helmholtz and the astronomer Friedrich Zöllner in the 1890s.

  7. An efficient flexible-order model for coastal and ocean water waves

    DEFF Research Database (Denmark)

    Engsig-Karup, Allan Peter; Bingham, Harry B.; Lindberg, Ole

    Current work are directed toward the development of an improved numerical 3D model for fully nonlinear potential water waves over arbitrary depths. The model is high-order accurate, robust and efficient for large-scale problems, and support will be included for flexibility in the description...... as in the original works \\cite{LiFleming1997,BinghamZhang2007}. The new and improved approach employs a GMRES solver with multigrid preconditioning to achieve optimal scaling of the overall solution effort, i.e., directly with $n$ the total number of grid points. A robust method is achieved through a special...

  8. Detection of a white dwarf companion to the Hyades stars HD 27483

    Science.gov (United States)

    Boehm-Vitense, Erika

    1993-01-01

    We observed with IUE a white dwarf (WD) companion to the Hyades F6 V binary stars HD 27483. This system is known to be a close binary of two nearly equal stars with an orbital period of 3.05 days. Our IUE observations revealed the presence of a third star, a white dwarf with an effective temperature of 23,000 +/- 1000 K and a mass of approximately 0.6 solar mass. Its presence in the Hyades cluster with a known age permits me to derive the mass of its progenitor, which must have been about 2.3 solar masses. The presence of the white dwarf in a binary system opens the possibility that some of the envelope material, which was expelled by the WD progenitor, may have been collected by the F6 stars. We may thus be able to study abundance anomalies of the WD progenitor with known mass on the surface of the F6 companions.

  9. Work Disability in Early Systemic Sclerosis

    DEFF Research Database (Denmark)

    Sandqvist, Gunnel; Hesselstrand, Roger; Petersson, Ingemar F

    2015-01-01

    OBJECTIVE: To study work disability (WD) with reference to levels of sick leave and disability pension in early systemic sclerosis (SSc). METHODS: Patients with SSc living in the southern part of Sweden with onset of their first non-Raynaud symptom between 2003 and 2009 and with a followup of 36...... months were included in a longitudinal study. Thirty-two patients (26 women, 24 with limited SSc) with a median age of 47.5 years (interquartile range 43-53) were identified. WD was calculated in 30-day intervals from 12 months prior to disease onset until 36 months after, presented as the prevalence...... of WD per year (0-3) and as the period prevalence of mean net days per month (± SD). Comparisons were made between patients with different disease severity and sociodemographic characteristics, and between patients and a reference group (RG) from the general population. RESULTS: Seventy-eight percent...

  10. Crystallization of carbon-oxygen mixtures in white dwarf stars.

    Science.gov (United States)

    Horowitz, C J; Schneider, A S; Berry, D K

    2010-06-11

    We determine the phase diagram for dense carbon-oxygen mixtures in white dwarf (WD) star interiors using molecular dynamics simulations involving liquid and solid phases. Our phase diagram agrees well with predictions from Ogata et al. and from Medin and Cumming and gives lower melting temperatures than Segretain et al. Observations of WD crystallization in the globular cluster NGC 6397 by Winget et al. suggest that the melting temperature of WD cores is close to that for pure carbon. If this is true, our phase diagram implies that the central oxygen abundance in these stars is less than about 60%. This constraint, along with assumptions about convection in stellar evolution models, limits the effective S factor for the 12C(α,γ)16O reaction to S(300)≤170  keV b.

  11. Asymmetric ejecta of cool supergiants and hypergiants in the massive cluster Westerlund 1

    Science.gov (United States)

    Andrews, H.; Fenech, D.; Prinja, R. K.; Clark, J. S.; Hindson, L.

    2018-06-01

    We report new 5.5 GHz radio observations of the massive star cluster Westerlund 1, taken by the Australia Telescope Compact Array, detecting nine of the ten yellow hypergiants (YHGs) and red supergiants (RSGs) within the cluster. Eight of nine sources are spatially resolved. The nebulae associated with the YHGs Wd1-4a, -12a, and -265 demonstrate a cometary morphology - the first time this phenomenon has been observed for such stars. This structure is also echoed in the ejecta of the RSGs Wd1-20 and -26; in each case the cometary tails are directed away from the cluster core. The nebular emission around the RSG Wd1-237 is less collimated than these systems but once again appears more prominent in the hemisphere facing the cluster. Considered as a whole, the nebular morphologies provide compelling evidence for sculpting via a physical agent associated with Westerlund 1, such as a cluster wind.

  12. Two-Dimensional Optical Processing Of One-Dimensional Acoustic Data

    Science.gov (United States)

    Szu, Harold H.

    1982-10-01

    The concept of carrier-mean-frequency-selective convolution is introduced to solve the undersea problem of passive acoustic surveillance (PAS) and compared with the conventional notion of difference-frequency Doppler-corrected correlation. The former results in the cross-Wigner distribution function (WD), and the latter results in the cross-ambiguity function (AF). When the persistent time of a sound emitter is more important than the characteristic tone of the sound emitter, WD will be more useful than AF for PAS activity detection, and vice versa. Their mutual relationships with the instantaneous power spectrum (IPS) show the importance of the phase information that must be kept in any 2-D representation of a 1 -D signal. If a square-law detector is used, or an unsymmetric version of WD or AF is gener-ated, then one must produce the other 2-D representations directly, rather than transform one to the other.

  13. Regional cerebral glucose consumption measured by positron emission tomography in patients with Wilson's disease

    International Nuclear Information System (INIS)

    Kuwert, T.; Scholz, D.; Milz, M.; Herzog, H.; Feinendegen, L.E.; Hefter, H.; Weiss, P.; Arendt, G.; Loken, M.; Minnesota Univ., Minneapolis, MN; Hennerici, M.

    1992-01-01

    Using positron emission tomography (PET), the regional cerebral metabolic rate of glucose consumption (rCMRGlc) was measured in 14 patients with Wilson's disease (WD) and 23 normal subjects. In WD patients, cerebellar, striatal and - to a lesser extent - cortical and thalamic rCMRGlc were significantly decreased compared with controls. Striatal rCMRGlc was significantly reduced in those 4 patients who had recently started decoppering therapy as compared with striatal rCMRGlc measured in those 10 patients with longer duration of medication. Caudate rCMRGlc correlated significantly with various signs of extrapyramidal dysfunction. Cerebellar, thalamic and cortical rCMRGlc correlated significantly with the severity of pyramidal signs. These data indicate that the PET measurement of rCMRGlc may be a useful tool to evaluate cerebral involvement in WD and to monitor the response to treatment. (orig.)

  14. 24-HOUR ELECTROCARDIOGRAPHY IN CLINICAL HEALTHY CAVALIER KING CHARLES SPANIELS, WIRE-HAIRED DACHSHUNDS AND CAIRN TERRIERS

    DEFF Research Database (Denmark)

    Rasmussen, Caroline Elisabeth; Vesterholm, Stina; Ludvigsen, Trine Pagh

    2010-01-01

    analysis were analyzed for influence by breed, age, gender, relevant heart rate (HR) parameters and bodyweight. CKCS had a significantly higher HRex (mean 121 ± SD 12 bpm) compared to wD (94±18 bpm) (P>0.0001) and CT (102±16bpm) (P=0.0009). The minimum HR (HRmin) measured during Holter recording...... was significantly higher in CKCS (51±10 bpm) compared to wD (42±7 bpm) (P=0.001) and CT (45±7 bpm) (P=0.05). In addition, CKCS had a higher mean HR (HRmean) during Holter recording (83±13 bpm) compared to wD (68±8 bpm) (P>0.0001) and CT (75±10 bpm) (P=0.04). Both HRmean (P>0.0001) and HRmin (P=0.001) were...

  15. ExtLaw_H18: Extinction law code

    Science.gov (United States)

    Hosek, Matthew W., Jr.; Lu, Jessica R.; Anderson, Jay; Do, Tuan; Schlafly, Edward F.; Ghez, Andrea M.; Clarkson, William I.; Morris, Mark R.; Albers, Saundra M.

    2018-03-01

    ExtLaw_H18 generates the extinction law between 0.8 - 2.2 microns. The law is derived using the Westerlund 1 (Wd1) main sequence (A_Ks 0.6 mag) and Arches cluster field Red Clump at the Galactic Center (A_Ks 2.7 mag). To derive the law a Wd1 cluster age of 5 Myr is assumed, though changing the cluster age between 4 Myr - 7 Myr has no effect on the law. This extinction law can be applied to highly reddened stellar populations that have similar foreground material as Wd1 and the Arches RC, namely dust from the spiral arms of the Milky Way in the Galactic Plane.

  16. White Dwarfs in Cataclysmic Variable Stars: Surface Temperatures and Evolution

    Directory of Open Access Journals (Sweden)

    Edward M. Sion

    2012-06-01

    Full Text Available A summary is presented of what is currently known about the surface temperatures of accreting white dwarfs (WDs detected in non-magnetic and magnetic cataclysmic variables (CVs based upon synthetic spectral analyses of far ultraviolet data. A special focus is placed on WD temperatures above and below the CV period gap as a function of the orbital period, Porb. The principal uncertainty of the temperatures for the CV WDs in the Teff - Porb distribution, besides the distance to the CV, is the mass of the WD. Only in eclipsing CV systems, an area of eclipsing binary studies, which was so central to Robert H. Koch’s career, is it possible to know CV WD masses with high precision.

  17. Three-dimensional Modeling of Type Ia Supernova Explosions

    Science.gov (United States)

    Khokhlov, Alexei

    2001-06-01

    A deflagration explosion of a Type Ia Supernova (SNIa) is studied using three-dimensional, high-resolution, adaptive mesh refinement fluid dynamic calculations. Deflagration speed in an exploding Chandrasekhar-mass carbon-oxygen white dwarf (WD) grows exponentially, reaches approximately 30the speed of sound, and then declines due to a WD expansion. Outermost layers of the WD remain unburned. The explosion energy is comparable to that of a Type Ia supernova. The freezing of turbulent motions by expansion appears to be a crucial physical mechanism regulating the strength of a supernova explosion. In contrast to one-dimensional models, three-dimensional calculations predict the formation of Si-group elements and pockets of unburned CO in the middle and in central regions of a supernova ejecta. This, and the presence of unburned outer layer of carbon-oxygen may pose problems for SNIa spectra. Explosion sensitivity to initial conditions and its relation to a diversity of SNIa is discussed.

  18. Discovery of optical flickering from the symbiotic star EF Aquilae

    Science.gov (United States)

    Zamanov, R. K.; Boeva, S.; Nikolov, Y. M.; Petrov, B.; Bachev, R.; Latev, G. Y.; Popov, V. A.; Stoyanov, K. A.; Bode, M. F.; Martí, J.; Tomov, T.; Antonova, A.

    2017-07-01

    We report optical CCD photometry of the recently identified symbiotic star EF Aql. Our observations in Johnson V and B bands clearly show the presence of stochastic light variations with an amplitude of about 0.2 mag on a time scale of minutes. The observations point toward a white dwarf (WD) as the hot component in the system. It is the 11-th object among more than 200 symbiotic stars known with detected optical flickering. Estimates of the mass accretion rate onto the WD and the mass loss rate in the wind of the Mira secondary star lead to the conclusion that less than 1 per cent of the wind is captured by the WD. Eight further candidates for the detection of flickering in similar systems are suggested.

  19. Bearing Stress at Failure of Double-Lap Hybrid Joints in Woven Fabric Kenaf Fiber Composite Plates under Quasi-static Loading

    Directory of Open Access Journals (Sweden)

    Lee Sim Yee

    2017-01-01

    Full Text Available The present paper is focused on the bearing stress at failure of double-lap woven fabric kenaf fiber reinforced polymer (KFRP hybrid bonded-bolted joints in experimental frameworks. The effects of different normalized plate width (plate width/hole diameter, W/d, lay-up types and bolt loads were incorporated in current study as specified in testing series. Generally, hybrid joint coupons separated within adhesive layer prior to net-tension failure or bearing/net-tension failure. The bearing stress at failure increased as W/d ratio increment, critical W/d is given as four and three in clamped and finger tight condition respectively. Lay-up types present insignificant effect to bearing stress at failure due to low volume fiber fraction in kenaf fiber composites. Combination of thicker and clamped conditions plate demonstrated greater bearing stress than equivalent finger-tight (FT conditions due to higher load transferred from friction, as expected.

  20. EVOLVING TO TYPE Ia SUPERNOVAE WITH SHORT DELAY TIMES

    International Nuclear Information System (INIS)

    Wang Bo; Chen Xuefei; Han Zhanwen; Meng Xiangcun

    2009-01-01

    The single-degenerate model is currently a favorable progenitor model for Type Ia supernovae (SNe Ia). Recent investigations on the white dwarf (WD) + He star channel of the single-degenerate model imply that this channel is noteworthy for producing SNe Ia. In this paper, we studied SN Ia birthrates and delay times of this channel via a detailed binary population synthesis approach. We found that the Galactic SN Ia birthrate from the WD + He star channel is ∼0.3 x 10 -3 yr -1 according to our standard model, and that this channel can explain SNe Ia with short delay times (∼4.5 x 10 7 -1.4 x 10 8 yr). Meanwhile, these WD + He star systems may be related to the young supersoft X-ray sources prior to SN Ia explosions.

  1. Low-mass Pre-He White Dwarf Stars in Kepler Eclipsing Binaries with Multi-periodic Pulsations

    Science.gov (United States)

    Zhang, X. B.; Fu, J. N.; Liu, N.; Luo, C. Q.; Ren, A. B.

    2017-12-01

    We report the discovery of two thermally bloated low-mass pre-He white dwarfs (WDs) in two eclipsing binaries, KIC 10989032 and KIC 8087799. Based on the Kepler long-cadence photometry, we determined comprehensive photometric solutions of the two binary systems. The light curve analysis reveals that KIC 10989032 is a partially eclipsed detached binary system containing a probable low-mass WD with the temperature of about 10,300 K. Having a WD with the temperature of about 13,300, KKIC 8087799 is typical of an EL CVn system. By utilizing radial velocity measurements available for the A-type primary star of KIC 10989032, the mass and radius of the WD component are determined to be 0.24+/- 0.02 {M}⊙ and 0.50+/- 0.01 {R}⊙ , respectively. The values of mass and radius of the WD in KIC 8087799 are estimated as 0.16 ± 0.02 M ⊙ and 0.21 ± 0.01 R ⊙, respectively, according to the effective temperature and mean density of the A-type star derived from the photometric solution. We therefore introduce KIC 10989032 and KIC 8087799 as the eleventh and twelfth dA+WD eclipsing binaries in the Kepler field. Moreover, both binaries display marked multi-periodic pulsations superimposed on binary effects. A preliminary frequency analysis is applied to the light residuals when subtracting the synthetic eclipsing light curves from the observations, revealing that the light pulsations of the two systems are both due to the δ Sct-type primaries. We hence classify KIC 10989032 and KIC 8087799 as two WD+δ Sct binaries.

  2. CAN HELIUM ENVELOPES CHANGE THE OUTCOME OF DIRECT WHITE DWARF COLLISIONS?

    International Nuclear Information System (INIS)

    Holcomb, Cole; Kushnir, Doron

    2016-01-01

    A pivotal feature for the viability of white dwarf (WD) collisions as SN Ia progenitors is that a significant fraction of the mass is highly compressed to the densities required for efficient 56 Ni production before the ignition of the detonation wave. Previous studies have employed model WDs composed of carbon–oxygen (CO), whereas WDs typically have a non-negligible helium envelope. Given that helium is more susceptible to explosive burning than CO under the conditions of WD collision, a legitimate concern is whether or not early time He detonation ignition can lead to early time CO detonation, drastically reducing 56 Ni synthesis. We investigate the role of He in determining the fate of WD collisions by performing a series of two-dimensional hydrodynamics calculations. We find that a necessary condition for non-trivial reduction of the CO ignition time is that the He detonation birthed in the contact region successfully propagates into the unshocked shell. We determine the minimal He shell mass as a function of the total WD mass that upholds this condition. Although we utilize a simplified reaction network similar to those used in previous studies, our findings are in good agreement with detailed investigations concerning the impact of network size on He shell detonations. This allows us to extend our results to the case with more realistic burning physics. Based on the comparison of these findings against evolutionary calculations of WD compositions, we conclude that most, if not all, WD collisions will not be drastically impacted by their intrinsic He components.

  3. CAN HELIUM ENVELOPES CHANGE THE OUTCOME OF DIRECT WHITE DWARF COLLISIONS?

    Energy Technology Data Exchange (ETDEWEB)

    Holcomb, Cole [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08540 (United States); Kushnir, Doron [Institute for Advanced Study, Princeton, NJ 08540 (United States)

    2016-08-01

    A pivotal feature for the viability of white dwarf (WD) collisions as SN Ia progenitors is that a significant fraction of the mass is highly compressed to the densities required for efficient {sup 56}Ni production before the ignition of the detonation wave. Previous studies have employed model WDs composed of carbon–oxygen (CO), whereas WDs typically have a non-negligible helium envelope. Given that helium is more susceptible to explosive burning than CO under the conditions of WD collision, a legitimate concern is whether or not early time He detonation ignition can lead to early time CO detonation, drastically reducing {sup 56}Ni synthesis. We investigate the role of He in determining the fate of WD collisions by performing a series of two-dimensional hydrodynamics calculations. We find that a necessary condition for non-trivial reduction of the CO ignition time is that the He detonation birthed in the contact region successfully propagates into the unshocked shell. We determine the minimal He shell mass as a function of the total WD mass that upholds this condition. Although we utilize a simplified reaction network similar to those used in previous studies, our findings are in good agreement with detailed investigations concerning the impact of network size on He shell detonations. This allows us to extend our results to the case with more realistic burning physics. Based on the comparison of these findings against evolutionary calculations of WD compositions, we conclude that most, if not all, WD collisions will not be drastically impacted by their intrinsic He components.

  4. DISCOVERY OF PULSATIONS, INCLUDING POSSIBLE PRESSURE MODES, IN TWO NEW EXTREMELY LOW MASS, He-CORE WHITE DWARFS

    Energy Technology Data Exchange (ETDEWEB)

    Hermes, J. J.; Montgomery, M. H.; Winget, D. E.; Bell, Keaton J.; Harrold, Samuel T. [Department of Astronomy, University of Texas at Austin, Austin, TX 78712 (United States); Brown, Warren R.; Kenyon, Scott J. [Smithsonian Astrophysical Observatory, 60 Garden Street, Cambridge, MA 02138 (United States); Gianninas, A.; Kilic, Mukremin, E-mail: jjhermes@astro.as.utexas.edu [Homer L. Dodge Department of Physics and Astronomy, University of Oklahoma, 440 W. Brooks Street, Norman, OK 73019 (United States)

    2013-03-10

    We report the discovery of the second and third pulsating extremely low mass (ELM) white dwarfs (WDs), SDSS J111215.82+111745.0 (hereafter J1112) and SDSS J151826.68+065813.2 (hereafter J1518). Both have masses < 0.25 M{sub Sun} and effective temperatures below 10, 000 K, establishing these putatively He-core WDs as a cooler class of pulsating hydrogen-atmosphere WDs (DAVs, or ZZ Ceti stars). The short-period pulsations evidenced in the light curve of J1112 may also represent the first observation of acoustic (p-mode) pulsations in any WD, which provide an exciting opportunity to probe this WD in a complimentary way compared to the long-period g-modes that are also present. J1112 is a T{sub eff} =9590 {+-} 140 K and log g =6.36 {+-} 0.06 WD. The star displays sinusoidal variability at five distinct periodicities between 1792 and 2855 s. In this star, we also see short-period variability, strongest at 134.3 s, well short of the expected g-modes for such a low-mass WD. The other new pulsating WD, J1518, is a T{sub eff} =9900 {+-} 140 K and log g =6.80 {+-} 0.05 WD. The light curve of J1518 is highly non-sinusoidal, with at least seven significant periods between 1335 and 3848 s. Consistent with the expectation that ELM WDs must be formed in binaries, these two new pulsating He-core WDs, in addition to the prototype SDSS J184037.78+642312.3, have close companions. However, the observed variability is inconsistent with tidally induced pulsations and is so far best explained by the same hydrogen partial-ionization driving mechanism at work in classic C/O-core ZZ Ceti stars.

  5. Development of Generalized Correlation Equation for the Local Wall Shear Stress

    International Nuclear Information System (INIS)

    Jeon, Yu Mi; Park, Ju Hwan

    2010-06-01

    The pressure drop characteristics for a fuel channel are essential for the design and reliable operation of a nuclear reactor. Over several decades, analytical methods have been developed to predict the friction factor in the fuel bundle flows. In order to enhance the accuracy of prediction for the pressure drop in a rod bundle, the influences of a channel wall and the local shear stress distribution should be considered. Therefore, the correlation equation for a local wall shear stress distribution should be developed in order to secure an analytical solution for the friction factor of a rod bundle. For a side subchannel, which has the influence of the channel wall, the local wall shear stress distribution is dependent on the ratio of wall to diameter (W/D) as well as the ratio of pitch to diameter (P/D). In the case that W/D has the same value with P/D, the local shear stress distribution can be simply correlated with the function of angular position for each value of P/D. While in the case where W/D has a different value than P/D, the correlation equation should be developed for each case of P/D and W/D. Therefore, in the present study, the generalized correlation equation of the local wall shear stress distribution was developed for a side subchannel in the case where W/D has a different value than P/D. Consequently, the generalized correlation equation of a local wall shear stress distribution can be represented by the equivalent pitch to diameter ratio, P'/D for the case that P/D and W/D had a different value

  6. The Continuing Search for Variability Among Cool White Dwarfs

    Science.gov (United States)

    Schaefer, J. J.; Oswalt, T. D.; Johnston, K. B.; Rudkin, M.; Heinz, T.

    2002-12-01

    The Continuing Search for Variability Among Cool White Dwarfs Justin J. Schaefer University of Wyoming Department of Physics and Astronomy P.O. Box 3905 Laramie, Wyoming 82071 USA (schaefju@uwyo.edu) Terry D. Oswalt, Kyle Johnston, Merissa Rudkin, Tamalyn Heinz Florida Institute of Technology and the SARA Observatory Department of Physics & Space Sciences 150 West University Boulevard Melbourne, Florida 32901 USA (oswalt@luyten.astro.fit.edu, kyjohnst@fit.edu, mrudkin@astro.fit.edu, theinz@fit.edu) ABSTRACT We present BVRI photometry of eleven binaries with white dwarf (WD) components. The observations were obtained at the SARA 0.9-meter telescope on Kitt Peak during the summer of 2002. Standard system (B-V), (V-R) and (R-I) color indices of four white dwarfs were determined. This data will be used to estimate the WD cooling ages in wide WD+dM binaries, as part of our ongoing research program to determine the chromospheric activity-age relation for M dwarf stars. Time-series differential photometry was also collected for eight cool white dwarfs as part of a program to explore the variability in the low luminosity, low temperature regime of the WD cooling track. We failed to detect any variability greater than ~0.04 magnitudes in these stars. Several nights of differential photometry data were collected on the DAO WD + K dwarf short-period variable HS1136+6646. From the light variations we determined a likely orbital period of 0.825 +/-0.009 days. Strong evidence is presented for two other possible periods within this light curve, possibly indicative of rotational modulation by the WD component. We gratefully acknowledge support from the National Science Foundation, which funds the SARA Research Experiences for Undergraduates program via grant AST-0097616 to Florida Tech. One of us (TDO) also acknowledges partial support for this work from NASA (subcontract Y701296) and the NSF (AST 0206115).

  7. Illuminating massive black holes with white dwarfs: orbital dynamics and high-energy transients from tidal interactions

    International Nuclear Information System (INIS)

    MacLeod, Morgan; Goldstein, Jacqueline; Ramirez-Ruiz, Enrico; Guillochon, James; Samsing, Johan

    2014-01-01

    White dwarfs (WDs) can be tidally disrupted only by massive black holes (MBHs) with masses less than ∼10 5 M ☉ . These tidal interactions feed material to the MBH well above its Eddington limit, with the potential to launch a relativistic jet. The corresponding beamed emission is a promising indication of an otherwise quiescent MBH of relatively low mass. We show that the mass transfer history, and thus the light curve, is quite different when the disruptive orbit is parabolic, eccentric, or circular. The mass lost each orbit exponentiates in the eccentric-orbit case, leading to the destruction of the WD after several tens of orbits. We examine the stellar dynamics of clusters surrounding MBHs to show that single-passage WD disruptions are substantially more common than repeating encounters. The 10 49 erg s –1 peak luminosity of these events makes them visible to cosmological distances. They may be detectible at rates of as many as tens per year by instruments like Swift. In fact, WD-disruption transients significantly outshine their main-sequence star counterparts and are the tidal interaction most likely to be detected arising from MBHs with masses less than 10 5 M ☉ . The detection or nondetection of such WD-disruption transients by Swift is, therefore, a powerful tool to constrain the lower end of the MBH mass function. The emerging ultralong gamma-ray burst class of events all have peak luminosities and durations reminiscent of WD disruptions, offering a hint that WD-disruption transients may already be present in existing data sets.

  8. High-protein diet improves sensitivity to cholecystokinin and shifts the cecal microbiome without altering brain inflammation in diet-induced obesity in rats.

    Science.gov (United States)

    Wang, Lixin; Jacobs, Jonathan P; Lagishetty, Venu; Yuan, Pu-Qing; Wu, Shuping V; Million, Mulugeta; Reeve, Joseph R; Pisegna, Joseph R; Taché, Yvette

    2017-10-01

    High-protein diet (HPD) curtails obesity and/or fat mass, but it is unknown whether it reverses neuroinflammation or alters glucose levels, CCK sensitivity, and gut microbiome in rats fed a Western diet (WD)-induced obesity (DIO). Male rats fed a WD (high fat and sugar) for 12 wk were switched to a HPD for 6 wk. Body composition, food intake, meal pattern, sensitivity to intraperitoneal CCK-8S, blood glucose, brain signaling, and cecal microbiota were assessed. When compared with a normal diet, WD increased body weight (9.3%) and fat mass (73.4%). CCK-8S (1.8 or 5.2 nmol/kg) did not alter food intake and meal pattern in DIO rats. Switching to a HPD for 6 wk reduced fat mass (15.7%) with a nonsignificantly reduced body weight gain, normalized blood glucose, and decreased feeding after CCK-8S. DIO rats on the WD or switched to a HPD showed comparable microbial diversity. However, in HPD versus WD rats, there was enrichment of 114 operational taxonomic units (OTUs) and depletion of 188 OTUs. Of those, Akkermansia muciniphila (enriched on a HPD), an unclassified Clostridiales, a member of the RF39 order, and a Phascolarctobacterium were significantly associated with fat mass. The WD increased cytokine expression in the hypothalamus and dorsal medulla that was unchanged by switching to HPD. These data indicate that HPD reduces body fat and restores glucose homeostasis and CCK sensitivity, while not modifying brain inflammation. In addition, expansion of cecal Akkermansia muciniphila correlated to fat mass loss may represent a potential peripheral mechanism of HPD beneficial effects.

  9. Investigating the influence of standard staining procedures on the copper distribution and concentration in Wilson's disease liver samples by laser ablation-inductively coupled plasma-mass spectrometry.

    Science.gov (United States)

    Hachmöller, Oliver; Aichler, Michaela; Schwamborn, Kristina; Lutz, Lisa; Werner, Martin; Sperling, Michael; Walch, Axel; Karst, Uwe

    2017-12-01

    The influence of rhodanine and haematoxylin and eosin (HE) staining on the copper distribution and concentration in liver needle biopsy samples originating from patients with Wilson's disease (WD), a rare autosomal recessive inherited disorder of the copper metabolism, is investigated. In contemporary diagnostic of WD, rhodanine staining is used for histopathology, since rhodanine and copper are forming a red to orange-red complex, which can be recognized in the liver tissue using a microscope. In this paper, a laser ablation-inductively coupled plasma-mass spectrometry (LA-ICP-MS) method is applied for the analysis of eight different WD liver samples. Apart from a spatially resolved elemental detection as qualitative information, this LA-ICP-MS method offers also quantitative information by external calibration with matrix-matched gelatine standards. The sample set of this work included an unstained and a rhodanine stained section of each WD liver sample. While unstained sections of WD liver samples showed very distinct structures of the copper distribution with high copper concentrations, rhodanine stained sections revealed a blurred copper distribution with significant decreased concentrations in a range from 20 to more than 90%. This implies a copper removal from the liver tissue by complexation during the rhodanine staining. In contrast to this, a further HE stained sample of one WD liver sample did not show a significant decrease in the copper concentration and influence on the copper distribution in comparison to the unstained section. Therefore, HE staining can be combined with the analysis by means of LA-ICP-MS in two successive steps from one thin section of a biopsy specimen. This allows further information to be gained on the elemental distribution by LA-ICP-MS additional to results obtained by histological staining. Copyright © 2017 Elsevier GmbH. All rights reserved.

  10. Western diet enhances intestinal tumorigenesis in Min/+ mice, associating with mucosal metabolic and inflammatory stress and loss of Apc heterozygosity.

    Science.gov (United States)

    Niku, Mikael; Pajari, Anne-Maria; Sarantaus, Laura; Päivärinta, Essi; Storvik, Markus; Heiman-Lindh, Anu; Suokas, Santeri; Nyström, Minna; Mutanen, Marja

    2017-01-01

    Western-type diet (WD) is a risk factor for colorectal cancer, but the underlying mechanisms are poorly understood. We investigated the interaction of WD and heterozygous mutation in the Apc gene on adenoma formation and metabolic and immunological changes in the histologically normal intestinal mucosa of Apc Min/+ (Min/+) mice. The diet used was high in saturated fat and low in calcium, vitamin D, fiber and folate. The number of adenomas was twofold higher in the WD mice compared to controls, but adenoma size, proliferation or apoptosis did not differ. The ratio of the Min to wild-type allele was higher in the WD mice, indicating accelerated loss of Apc heterozygosity (LOH). Densities of intraepithelial CD3ε + T lymphocytes and of mucosal FoxP3 + regulatory T cells were higher in the WD mice, implying inflammatory changes. Western blot analyses from the mucosa of the WD mice showed suppressed activation of the ERK and AKT pathways and a tendency for reduced activation of the mTOR pathway as measured in phosphoS6/S6 levels. The expression of pyruvate dehydrogenase kinase 4 was up-regulated in both mRNA and protein levels. Gene expression analyses showed changes in oxidation/reduction, fatty acid and monosaccharide metabolic pathways, tissue organization, cell fate and regulation of apoptosis. Together, our results suggest that the high-risk Western diet primes the intestine to tumorigenesis through synergistic effects in energy metabolism, inflammation and oxidative stress, which culminate in the acceleration of LOH of the Apc gene. Copyright © 2016 Elsevier Inc. All rights reserved.

  11. Reconciling Optical and Radio Observations of the Binary Millisecond Pulsar PSR J1640+2224

    Science.gov (United States)

    Vigeland, Sarah J.; Deller, Adam T.; Kaplan, David L.; Istrate, Alina G.; Stappers, Benjamin W.; Tauris, Thomas M.

    2018-03-01

    Previous optical and radio observations of the binary millisecond pulsar PSR J1640+2224 have come to inconsistent conclusions about the identity of its companion, with some observations suggesting that the companion is a low-mass helium-core (He-core) white dwarf (WD), while others indicate that it is most likely a high-mass carbon–oxygen (CO) WD. Binary evolution models predict PSR J1640+2224 most likely formed in a low-mass X-ray binary based on the pulsar’s short spin period and long-period, low-eccentricity orbit, in which case its companion should be a He-core WD with mass about 0.35–0.39 M ⊙, depending on metallicity. If instead it is a CO WD, it would suggest that the system has an unusual formation history. In this paper we present the first astrometric parallax measurement for this system from observations made with the Very Long Baseline Array (VLBA), from which we determine the distance to be {1520}-150+170 {pc}. We use this distance and a reanalysis of archival optical observations originally taken in 1995 with the Wide Field Planetary Camera 2 on the Hubble Space Telescope (HST) to measure the WD’s mass. We also incorporate improvements in calibration, extinction model, and WD cooling models. We find that the existing observations are not sufficient to tightly constrain the companion mass, but we conclude the WD mass is >0.4 M ⊙ with >90% confidence. The limiting factor in our analysis is the low signal-to-noise ratio of the original HST observations.

  12. Recurrent 3-day cycles of water deprivation for over a month depress mating behaviour but not semen characteristics of adult rams.

    Science.gov (United States)

    Khnissi, S; Lassoued, N; Rekik, M; Ben Salem, H

    2016-02-01

    This study aimed to investigate the effect of water deprivation (WD) on reproductive traits of rams. Ten mature rams were used and allocated to two groups balanced for body weight. Control (C) rams had free access to drinking water, while water-restricted rams (WD) were deprived from water for 3 consecutive days and early on the morning of day 4, they had ad libitum access to water for 24 h, similar to C animals. The experiment lasted 32 days, that is eight 4-day cycles of water deprivation and subsequent watering. Feed and water intake were significantly affected by water deprivation; in comparison with C rams, WD rams reduced their feed intake by 18%. During the watering day of the deprivation cycle, WD rams consumed more water than C rams on the same day (11.8 (SD = 3.37) and 8.4 (SD = 1.92) l respectively; p water deprivation. However, testosterone levels were lowered as a result of water deprivation and average values were 10.9 and 6.2 (SEM 1.23) ng/ml for C and WD rams respectively (p cycles 5 and 8 of water deprivation. Several mating behaviour traits were modified as a result of water deprivation. When compared to controls, WD rams had a more prolonged time to first mount attempt (p Water deprivation may have practical implications reducing the libido and therefore the serving capacity of rams under field conditions. Journal of Animal Physiology and Animal Nutrition © 2015 Blackwell Verlag GmbH.

  13. Rapid weight gain in professional boxing and correlation with fight decisions: analysis from 71 title fights.

    Science.gov (United States)

    Daniele, Gianlorenzo; Weinstein, Richard N; Wallace, Paul Wesley; Palmieri, Vincenzo; Bianco, Massimiliano

    2016-11-01

    Boxing is a sport where athletes compete in several weight categories. Professional boxers typically dehydrate to cut their weight for the weigh-in (24 h before the contest) and then rehydrate before the fight. The International Boxing Federation (IBF) mandates a second weigh-in 12 h before the fight. Our objectives were: 1) To quantify the weight gain (WG) from the 1st to the 2nd weigh-in; 2) to investigate whether rapid WG affects boxing performance (win/loss rate) and 3) whether weight discrepancy (WD) 15 between boxers exposes them to increased health risks (rate of fights ended before time limit). From official weigh-in reports of 71 IBF fights (142 fighters) the following data were gathered/calculated for each boxer: age, weight division, 1st weight, 2nd weight, WG between weigh-ins (kg and %), WD between opponents, and fight decision. Between the weigh-ins, the average WG was 2.52 ± 1.37 kg (range -0.3/6.4 kg) and 3.8 ± 2.2% of the initial body weight (range -0.4/9.3%) and the average WD 1.94 ± 1.50 kg (maximum 7.10 kg). Both WG and WD did not affect match outcomes. We observed tendencies for higher loss rate among boxers gaining more weight, and for higher victory rate in boxers with larger WD, however without reaching significance. A significant negative correlation was found between the 1st weight and the WG, both in absolute (r = -0.278, p = 0.001) and relative value (r = -0.497, p boxing performance were not found, single cases with an alarming high WG and WD were noted.

  14. Identifications and limited spectroscopy for Luyten common proper motion stars with probable white dwarf components. I - Pair brighter than 17th magnitude

    Science.gov (United States)

    Oswalt, Terry D.; Hintzen, Paul M.; Luyten, Willem J.

    1988-01-01

    Identifications are provided for 103 bright Luyten common proper motion (CPM) stellar systems with m(pg) less than 17.0 mag containing likely white dwarf (WD) components. New spectral types are presented for 55 components, and spectral types for 51 more are available in the literature. With the CPM systems previously published by Giclas et al. (1978), the Luyten stars provide a uniform sample of nearly 200 pairs or multiples brighter than 17h magnitude. Selection effects biasing the combined samples are discussed; in particular, evidence is presented that fewer than 1 percent of wide WD binaries have been detected.

  15. Do some x-ray stars have white dwarf companions

    Science.gov (United States)

    Mccollum, Bruce

    1995-01-01

    Some Be stars which are intermittent X-ray sources may have white dwarf companions rather than neutron stars. It is not possible to prove or rule out the existence of Be + WD systems using X-ray or optical data. However, the presence of a white dwarf could be established by the detection of its EUV continuum shortward of the Be star's continuum turnover at 100 A. Either the detection or the nondetection of Be + WD systems would have implications for models of Be star variability, models of Be binary system formation and evolution, and models of wind-fed accretion.

  16. EVIDENCE FOR GAS FROM A DISINTEGRATING EXTRASOLAR ASTEROID

    International Nuclear Information System (INIS)

    Xu, S.; Jura, M.; Zuckerman, B.; Dufour, P.

    2016-01-01

    We report high-resolution spectroscopic observations of WD 1145+017—a white dwarf that was recently found to be transitted by multiple asteroid-sized objects within its tidal radius. We discovered numerous circumstellar absorption lines with linewidths of ∼300 km s −1 from Mg, Ca, Ti, Cr, Mn, Fe, and Ni, possibly from several gas streams produced by collisions among the actively disintegrating objects. The atmosphere of WD 1145+017 is polluted with 11 heavy elements, including O, Mg, Al, Si, Ca, Ti, V:, Cr, Mn, Fe, and Ni. Evidently, we are witnessing the active disintegration and subsequent accretion of an extrasolar asteroid

  17. THE EFFECTS OF CLOSE COMPANIONS (AND ROTATION) ON THE MAGNETIC ACTIVITY OF M DWARFS

    International Nuclear Information System (INIS)

    Morgan, Dylan P.; West, Andrew A.; Dhital, Saurav; Fuchs, Miriam; Garcés, Ane; Catalán, Silvia; Silvestri, Nicole M.

    2012-01-01

    We present a study of close white dwarf and M dwarf (WD+dM) binary systems and examine the effect that a close companion has on the magnetic field generation in M dwarfs. We use a base sample of 1602 white dwarf main-sequence binaries from Rebassa-Mansergas et al. to develop a set of color cuts in GALEX, SDSS, UKIDSS, and 2MASS color space. Then using the SDSS Data Release 8 spectroscopic database, we construct a sample of 1756 WD+dM high-quality pairs from our color cuts and previous catalogs. We separate the individual WD and dM from each spectrum using an iterative technique that compares the WD and dM components to best-fit templates. Using the absolute height above the Galactic plane as a proxy for age, and the Hα emission line as an indicator for magnetic activity, we investigate the age-activity relation for our sample for spectral types ≤ M7. Our results show that early-type M dwarfs (≤M4) in close binary systems are more likely to be active and have longer activity lifetimes compared to their field counterparts. However, at a spectral type of M5 (just past the onset of full convection in M dwarfs), the activity fraction and lifetimes of WD+dM binary systems become more comparable to that of the field M dwarfs. One of the implications of having a close binary companion is presumed to be increased stellar rotation through disk disruption, tidal effects, or angular momentum exchange. Thus, we interpret the similarity in activity behavior between late-type dMs in WD+dM pairs and late-type field dMs to be due to a decrease in sensitivity in close binary companions (or stellar rotation), which has implications for the nature of magnetic activity in fully convective stars. Using the WD components of the pairs, we find WD cooling ages to use as an additional constraint on the age-activity relation for our sample. We find that, on average, active early-type dMs tend to be younger and that active late-type dMs span a much broader age regime making them

  18. EVIDENCE FOR GAS FROM A DISINTEGRATING EXTRASOLAR ASTEROID

    Energy Technology Data Exchange (ETDEWEB)

    Xu, S. [European Southern Observatory, Karl-Schwarzschild-Straße 2, D-85748 Garching (Germany); Jura, M.; Zuckerman, B. [Department of Physics and Astronomy, University of California, Los Angeles CA 90095-1562 (United States); Dufour, P., E-mail: sxu@eso.org, E-mail: jura@astro.ucla.edu, E-mail: ben@astro.ucla.edu, E-mail: dufourpa@astro.umontreal.ca [Institut de Recherche sur les Exoplanètes (iREx), Université de Montréal, Montréal, QC H3C 3J7 (Canada)

    2016-01-10

    We report high-resolution spectroscopic observations of WD 1145+017—a white dwarf that was recently found to be transitted by multiple asteroid-sized objects within its tidal radius. We discovered numerous circumstellar absorption lines with linewidths of ∼300 km s{sup −1} from Mg, Ca, Ti, Cr, Mn, Fe, and Ni, possibly from several gas streams produced by collisions among the actively disintegrating objects. The atmosphere of WD 1145+017 is polluted with 11 heavy elements, including O, Mg, Al, Si, Ca, Ti, V:, Cr, Mn, Fe, and Ni. Evidently, we are witnessing the active disintegration and subsequent accretion of an extrasolar asteroid.

  19. Patient with von Willebrand Disease for Gynaecologic Surgery - Perianaesthetic Concerns

    Directory of Open Access Journals (Sweden)

    Rakesh Garg

    2008-01-01

    Patients with vWD do not carry an increased operative risk during elective procedures if appropriate prophylac-tic and corrective therapy is administered. Although the administration of cryoprecipitate and other blood products has traditionally been the cornerstone of treatment for vWD, the recent development of desmopressin(DDAVP for clinical use may provide an effective alternative to replacement therapy with blood products. Further laparaoscopic procedures, taking care during ryle′s tube and foley′s catheter insertion, in such patients are the safer alternative for all kind of gynecologic surgeries.

  20. Rape sentencing

    DEFF Research Database (Denmark)

    Ó Cathaoir, Katharina Eva

    This handbook conducts an analysis of the sentences imposed for rape by Irish courts. Part I examines The People (DPP) v. WD [2007] IEHC 310 by outlining the salient points of the decision, in particular the separation of rape sentences into categories of punishments. The mitigating and aggravating...... factors are also laid out. Part II analyses recent sentences for rape since 2007. All reported Court of Criminal Appeal (CCA) cases post The People (DPP) v. WD are included as well as a survey of two years of Irish Times reports (covering the period November 2010 to November 2012)....

  1. IUE Archival Spectra of 31 Cygni

    Directory of Open Access Journals (Sweden)

    Young Woon Kang

    1991-06-01

    Full Text Available UV light curve of 31 Cygni has been made from the IUE high dispersion spectra. The depth of primary minimum of the light curve is 5.2 magnitudes because the B4 star's steep spectral gradient. The light curve has been analyzed by the method of Wilson and Devinney Differential Correction (WD. The radial velocities have been measured using the Mg II h lines. The spectroscopic elements have been determined by the method of WD. The change of the Mg II resonance doublet has been investigated based on the eight representative spectra taken at well distributed orbital phases.

  2. Wilson's Disease: Expect the Unexpected.

    Science.gov (United States)

    El Imad, Talal; Al Moussawi, Hassan; Haddad, Fady G; Felix, Richard; Mulrooney, Stephen M

    2018-02-08

    A 64-year-old woman, presented with abdominal distention, jaundice and resting tremor, was found to have liver injury and abnormal liver enzymes. A computed tomography (CT) scan of the abdomen and pelvis showed abdominopelvic ascites and signs of liver cirrhosis. An extensive liver disease workup was performed and came back negative; therefore, a liver biopsy was obtained and showed evidence of cirrhosis with elevated liver copper consistent with Wilson's disease (WD). We report a unique case of late-onset WD in which the ceruloplasmin level and 24-h urinary copper excretion were all normal.

  3. Wilson’s Disease: Expect the Unexpected

    Science.gov (United States)

    Al Moussawi, Hassan; Haddad, Fady G.; Felix, Richard; Mulrooney, Stephen M

    2018-01-01

    A 64-year-old woman, presented with abdominal distention, jaundice and resting tremor, was found to have liver injury and abnormal liver enzymes. A computed tomography (CT) scan of the abdomen and pelvis showed abdominopelvic ascites and signs of liver cirrhosis. An extensive liver disease workup was performed and came back negative; therefore, a liver biopsy was obtained and showed evidence of cirrhosis with elevated liver copper consistent with Wilson’s disease (WD). We report a unique case of late-onset WD in which the ceruloplasmin level and 24-h urinary copper excretion were all normal. PMID:29644160

  4. Description of the Power Take-off System on board the Wave Dragon Prototype

    DEFF Research Database (Denmark)

    Kofoed, Jens Peter; Frigaard, Peter; Knapp, Wilfried

    2005-01-01

    The paper describes the power take-off system of the overtopping based wave energy converter Wave Dragon (WD). Focus is put on the hydro turbine arrangement used for the extraction of the potential energy in the water obtained by wave overtopping of the ramp into the reservoir.......The paper describes the power take-off system of the overtopping based wave energy converter Wave Dragon (WD). Focus is put on the hydro turbine arrangement used for the extraction of the potential energy in the water obtained by wave overtopping of the ramp into the reservoir....

  5. Instructor Considerations in the Design of Optimal Training Devices

    Science.gov (United States)

    1988-08-18

    amount of time. In other words, the usage of thq "flag" as a instructional feature makes it feasible for the student to avoid the overhead time...Report 83-22). Williams AFB, TX: Air Force Human Resources Laboratory. Sticha, P.J., Singer, M.J., Blackston , H.R., !4umaw, R.J., & Buede, D.M. (1987...455 = 5,460 - 3.43 for Quarters (WD) W-3 440 = 5,274 - 3.31 Variable Housing 0-3 134 = 1,608 = 1.00 Allowance (WD) W-3 174 = 2,087 = 1.31 Tax Advantages

  6. The plant decapeptide OSIP108 prevents copper-induced toxicity in various models for Wilson disease

    Energy Technology Data Exchange (ETDEWEB)

    Spincemaille, Pieter [Centre of Microbial and Plant Genetics (CMPG), KU Leuven, Kasteelpark Arenberg 20, 3001 Heverlee (Belgium); Pham, Duc-Hung [Laboratory for Molecular Biodiscovery, KU Leuven, Campus Gasthuisberg, Herestraat 49, O and N2, 3000 Leuven (Belgium); Chandhok, Gursimran [Clinic for Transplantation Medicine, Münster University Hospital, Albert-Schweitzer-Campus 1, Building A14, D-48149 Münster (Germany); Verbeek, Jef [Department of Hepatology and Metabolic Center, University Hospital Gasthuisberg, Herestraat 49, 3000 Leuven (Belgium); Zibert, Andree [Clinic for Transplantation Medicine, Münster University Hospital, Albert-Schweitzer-Campus 1, Building A14, D-48149 Münster (Germany); Libbrecht, Louis [Department of Hepatology and Metabolic Center, University Hospital Gasthuisberg, Herestraat 49, 3000 Leuven (Belgium); Department of Pathology, University Hospital Ghent, De Pintelaan 185, 9000 Ghent (Belgium); Schmidt, Hartmut [Clinic for Transplantation Medicine, Münster University Hospital, Albert-Schweitzer-Campus 1, Building A14, D-48149 Münster (Germany); Esguerra, Camila V.; Witte, Peter A.M. de [Laboratory for Molecular Biodiscovery, KU Leuven, Campus Gasthuisberg, Herestraat 49, O and N2, 3000 Leuven (Belgium); Cammue, Bruno P.A., E-mail: bruno.cammue@biw.kuleuven.be [Centre of Microbial and Plant Genetics (CMPG), KU Leuven, Kasteelpark Arenberg 20, 3001 Heverlee (Belgium); Department of Plant Systems Biology, VIB, Technologiepark 927, 9052 Ghent (Belgium); Cassiman, David [Department of Hepatology and Metabolic Center, University Hospital Gasthuisberg, Herestraat 49, 3000 Leuven (Belgium); Thevissen, Karin [Centre of Microbial and Plant Genetics (CMPG), KU Leuven, Kasteelpark Arenberg 20, 3001 Heverlee (Belgium)

    2014-10-15

    Background: Wilson disease (WD) is caused by accumulation of excess copper (Cu) due to a mutation in the gene encoding the liver Cu transporter ATP7B, and is characterized by acute liver failure or cirrhosis and neuronal cell death. We investigated the effect of OSIP108, a plant derived decapeptide that prevents Cu-induced apoptosis in yeast and human cells, on Cu-induced toxicity in various mammalian in vitro models relevant for WD and in a Cu-toxicity zebrafish larvae model applicable to WD. Methods: The effect of OSIP108 was evaluated on viability of various cell lines in the presence of excess Cu, on liver morphology of a Cu-treated zebrafish larvae strain that expresses a fluorescent reporter in hepatocytes, and on oxidative stress levels in wild type AB zebrafish larvae. Results: OSIP108 increased not only viability of Cu-treated CHO cells transgenically expressing ATP7B and the common WD-causing mutant ATP7B{sup H1069Q}, but also viability of Cu-treated human glioblastoma U87 cells. Aberrancies in liver morphology of Cu-treated zebrafish larvae were observed, which were further confirmed as Cu-induced hepatotoxicity by liver histology. Injections of OSIP108 into Cu-treated zebrafish larvae significantly increased the amount of larvae with normal liver morphology and decreased Cu-induced production of reactive oxygen species. Conclusions: OSIP108 prevents Cu-induced toxicity in in vitro models and in a Cu-toxicity zebrafish larvae model applicable to WD. General significance: All the above data indicate the potential of OSIP108 as a drug lead for further development as a novel WD treatment. - Highlights: • Wilson disease (WD) is characterized by accumulation of toxic copper (Cu). • OSIP108 increases viability of Cu-treated cellular models applicable to WD. • OSIP108 injections preserve liver morphology of Cu-treated zebrafish larvae. • OSIP108 injections into zebrafish larvae abrogates Cu-induced oxidative stress.

  7. Modeling the Buoyancy System of a Wave Energy Power Plant

    DEFF Research Database (Denmark)

    Pedersen, Tom S.; Nielsen, Kirsten M.

    2009-01-01

    A nonlinear dynamic model of the buoyancy system in a wave energy power plant is presented. The plant ("Wave Dragon") is a floating device using the potential energy in overtopping waves to produce power. A water reservoir is placed on top of the WD, and hydro turbines lead the water to the sea...... producing electrical power. Through air chambers it is possible to control the level of the WD. It is important to control the level in order to maximize the power production in proportion to the wave height, here the amount of overtopping water and the amount of potential energy is conflicting...

  8. Liquid and chemical fluxes in precipitation, throughfall and stemflow

    DEFF Research Database (Denmark)

    Pryor, S.C.; Barthelmie, R.J.

    2005-01-01

    Wet deposition (WD), throughfall (TF) and stemflow (SF) measurements undertaken in a deciduous forest show 85% of the WD liquid flux is observed as TF and approximately 2% as SF. TF and SF were observed to be enriched in base cations and accordingly had an average pH of 6.1 and 5.9, respectively...... composition below sugar maples. The total atmospheric flux of inorganic nitrogen to the forest is approximately 14-18 kg-N ha(-1) yr(-1) supercript stop with approximately half taken up by the canopy. Associated experiments designed to quantify uncertainties in the nutrient fluxes included laboratory tests...

  9. Time-frequency representation of a highly nonstationary signal via the modified Wigner distribution

    Science.gov (United States)

    Zoladz, T. F.; Jones, J. H.; Jong, J.

    1992-01-01

    A new signal analysis technique called the modified Wigner distribution (MWD) is presented. The new signal processing tool has been very successful in determining time frequency representations of highly non-stationary multicomponent signals in both simulations and trials involving actual Space Shuttle Main Engine (SSME) high frequency data. The MWD departs from the classic Wigner distribution (WD) in that it effectively eliminates the cross coupling among positive frequency components in a multiple component signal. This attribute of the MWD, which prevents the generation of 'phantom' spectral peaks, will undoubtedly increase the utility of the WD for real world signal analysis applications which more often than not involve multicomponent signals.

  10. Energy of charged states in the acetanilide crystal: Trapping of charge-transfer states at vacancies as a possible mechanism for optical damage

    Science.gov (United States)

    Tsiaousis, D.; Munn, R. W.

    2004-04-01

    Calculations for the acetanilide crystal yield the effective polarizability (16.6 Å3), local electric field tensor, effective dipole moment (5.41 D), and dipole-dipole energy (-12.8 kJ/mol). Fourier-transform techniques are used to calculate the polarization energy P for a single charge in the perfect crystal (-1.16 eV); the charge-dipole energy WD is zero if the crystal carries no bulk dipole moment. Polarization energies for charge-transfer (CT) pairs combine with the Coulomb energy EC to give the screened Coulomb energy Escr; screening is nearly isotropic, with Escr≈EC/2.7. For CT pairs WD reduces to a term δWD arising from the interaction of the charge on each ion with the change in dipole moment on the other ion relative to the neutral molecule. The dipole moments calculated by density-functional theory methods with the B3LYP functional at the 6-311++G** level are 3.62 D for the neutral molecule, changing to 7.13 D and 4.38 D for the anion and cation, relative to the center of mass. Because of the large change in the anion, δWD reaches -0.9 eV and modifies the sequence of CT energies markedly from that of Escr, giving the lowest two CT pairs at -1.98 eV and -1.41 eV. The changes in P and WD near a vacancy are calculated; WD changes for the individual charges because the vacancy removes a dipole moment and modifies the crystal dielectric response, but δWD and EC do not change. A vacancy yields a positive change ΔP that scatters a charge or CT pair, but the change ΔWD can be negative and large enough to outweigh ΔP, yielding traps with depths that can exceed 150 meV for single charges and for CT pairs. Divacancies yield traps with depths nearly equal to the sum of those produced by the separate vacancies and so they can exceed 300 meV. These results are consistent with a mechanism of optical damage in which vacancies trap optically generated CT pairs that recombine and release energy; this can disrupt the lattice around the vacancy, thereby favoring

  11. Early host responses of seasonal and pandemic influenza A viruses in primary well-differentiated human lung epithelial cells.

    Directory of Open Access Journals (Sweden)

    Rachael L Gerlach

    Full Text Available Replication, cell tropism and the magnitude of the host's antiviral immune response each contribute to the resulting pathogenicity of influenza A viruses (IAV in humans. In contrast to seasonal IAV in human cases, the 2009 H1N1 pandemic IAV (H1N1pdm shows a greater tropism for infection of the lung similar to H5N1. We hypothesized that host responses during infection of well-differentiated, primary human bronchial epithelial cells (wd-NHBE may differ between seasonal (H1N1 A/BN/59/07 and H1N1pdm isolates from a fatal (A/KY/180/10 and nonfatal (A/KY/136/09 case. For each virus, the level of infectious virus and host response to infection (gene expression and apical/basal cytokine/chemokine profiles were measured in wd-NHBE at 8, 24, 36, 48 and 72 hours post-infection (hpi. At 24 and 36 hpi, KY/180 showed a significant, ten-fold higher titer as compared to the other two isolates. Apical cytokine/chemokine levels of IL-6, IL-8 and GRO were similar in wd-NHBE cells infected by each of these viruses. At 24 and 36 hpi, NHBE cells had greater levels of pro-inflammatory cytokines including IFN-α, CCL2, TNF-α, and CCL5, when infected by pandemic viruses as compared with seasonal. Polarization of IL-6 in wd-NHBE cells was greatest at 36 hpi for all isolates. Differential polarized secretion was suggested for CCL5 across isolates. Despite differences in viral titer across isolates, no significant differences were observed in KY/180 and KY/136 gene expression intensity profiles. Microarray profiles of wd-NHBE cells diverged at 36 hpi with 1647 genes commonly shared by wd-NHBE cells infected by pandemic, but not seasonal isolates. Significant differences were observed in cytokine signaling, apoptosis, and cytoskeletal arrangement pathways. Our studies revealed differences in temporal dynamics and basal levels of cytokine/chemokine responses of wd-NHBE cells infected with each isolate; however, wd-NHBE cell gene intensity profiles were not significantly

  12. Structure/Property Relationships of Siloxane-Based Liquid Crystalline Materials

    Science.gov (United States)

    1992-05-01

    1974). (6) Goossens , N.J.,., Mol. Cryst. Liq. Cryst., 12,237-244(1971). (7) Gray, G.W. and Goodby, J.W.G., Smectic Liquid Crystals- Textures and...pp 30-105, (1989). 42 (59) Richards , R.D.C., Hawthorne, W.D., Hill, J.S., White, M.S., Lacey, D., Semlyen, J.A., Gray, G.W., and Kendrick, T.C., J...946(1985). (30) Davidson, P. and Levelut, A.M., J. Phys., 49, 689-695(1988). (31) Richards , R.D.C., Hawthorne, W.D., Hill, J.S., White, M.S., Lacey

  13. Problems getting from the laboratory to the field: Reclamation of an AML site

    International Nuclear Information System (INIS)

    Dick, W.A.; Stehouwer, R.C.

    1994-01-01

    Acid and toxic abandoned mineland sites provide an opportunity whereby flue gas desulfurization (FGD) by-product can be beneficially used as a reclamation amendment material. Studies are needed to compare the effectiveness of FGD by-product, as compared with resoil, for reclamation purposes. Initial studies provided information about the chemical and physical properties of the FGD by-product and how to transport and blend the FGD by-product with yard waste compost. Greenhouse studies indicated that rates of 125 dry tons/acre of FGD and 50 dry tons/acre of yard waste compost would provide optimum results for reclamation of acid and toxic spoil contained at the Fleming abandoned mineland (AML) site. Their results showed that heavy metal loading rates were much lower using the FGD/compost mixture than using resoil material. Dioxin in the mixture was also less than the 5 ppt level considered as normal background. The technical problems of using FGD by-product for reclamation of an AML site were solved. However, considerable efforts to educate the public about the merits of reclaiming the Fleming AML site using this FGD/compost mixture were required before initiating field reclamation activities. Education efforts must continue if FGD by-products are to achieve general acceptance as a reclamation alternative to resoil in cases where resoil is of scarce supply

  14. The Structure of Prejudice and Its Relation to Party Preferences in Belgium: Flanders and Wallonia Compared

    Directory of Open Access Journals (Sweden)

    Cecil Meeusen

    2017-11-01

    Full Text Available We test two assumptions of the generalized prejudice literature. First, that the structure of generalized prejudice (i.e. how prejudices are interrelated is dependent on the intergroup context. Second, that different types of prejudice have similar political consequences and run via the generalized prejudice component. We perform these tests in the two main regions of Belgium − Flanders and Wallonia − and investigate the influence of differences in the history of immigration, experience of the linguistic and autonomy conflict, and the separate party system and political discourse (i.e. the societal and intergroup context on these premises. We make use of the Belgian Election Panel (BEP data that included measures of prejudice toward multiple target groups (immigrants, Flemings, Walloons, homosexuals, and Jews and voting propensities for the main political parties. Our results show that, regardless of the differences in intergroup experiences, the structure of prejudice is identical in Flanders and Wallonia. Flemings are, however, more tolerant toward homosexuals and immigrants than Walloons. The political context and the set of potential political outlets does play an important moderating role in the translation of prejudices to party preferences: While negative attitudes toward the other regional group seem to divide the electorate in Flanders, it does not affect voting intentions in Wallonia. Anti-immigrant prejudice is crucial in both regions, but affects voters in different ways at the right-side of the political spectrum.

  15. Mr. Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, United Kingdom

    CERN Multimedia

    Maximilien Brice

    2002-01-01

    Photos 01,02: Mr Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, UK (third from left, front) in front of the ATLAS End-Cap Toroid vacuum vessel in the ATLAS assembly hall with, from left to right, Fred Wickens, Chris Jones, Peter Fletcher, Ray Browne, Neil Geddes, Jim Fleming, Anne Trefethen, Jim Wilson, Edwin Towndrow, Sharon Bonfield, Guy Rickett, Ken Smith, Peter Jenni. Photo 03: Mr Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, UK (fifth from left) visiting ATLAS assembly hall with, from left to right, Jim Wilson, Peter Jenni, Ken Smith, Edwin Towndrow, Ray Brown, Chris Jones, Neil Geddes, Sharon Bonfield, Anne Trefethen, Jim Fleming, Fred Wickens. Photo 04: Mr Pat McDonald, Director of "Key Business Technologies", Department of Trade and Industry, UK (fourth from right) in front of the ATLAS Barrel Toroid coil casing in the ATLAS assembly hall with, from left to right, Peter Jenni, Jim Wilson, Guy Rickett, Anne Trefethen, ...

  16. Expectations from ethics

    International Nuclear Information System (INIS)

    Fleming, P.

    2008-01-01

    Prof. Patricia Fleming, centred her presentation on ethical expectations in regulating safety for future generations. The challenge is to find a just solution, one that provides for a defensible approach to inter-generational equity. The question on equity is about whether we are permitted to treat generations differently and to still meet the demands of justice. And the question must be asked regarding these differences: 'in what ways do they make a moral difference?' She asked the question regarding the exact meaning of the ethical principle 'Radioactive waste shall be managed in such a way that predicted impacts on the health of future generations will not be greater than relevant levels of impact that are acceptable today'. Some countries have proposed different standards for different time periods, either implicitly or explicitly. In doing so, have they preserved our standards of justice or have they abandoned them? Prof. Fleming identified six points to provide with some moral maps which might be used to negotiate our way to a just solution to the disposal of nuclear waste. (author)

  17. A new species of Voria Robineau-Desvoidy (Diptera: Tachinidae) from Area de Conservación Guanacaste in northwestern Costa Rica.

    Science.gov (United States)

    Fleming, A J; Wood, D Monty; Smith, M Alex; Dapkey, Tanya; Hallwachs, Winnie; Janzen, Daniel

    2017-01-01

    We describe a new species in the genus Voria Robineau-Desvoidy, 1830 (Diptera: Tachinidae: Voriini) from Area de Conservación Guanacaste (ACG) in northwestern Costa Rica. It was reared as part of an ongoing inventory of wild-caught caterpillars spanning a variety of moth and butterfly families (Lepidoptera). Our study provides a concise description of the new species using morphology, life history, molecular data, and photographic documentation. In addition to the new species, we provide a diagnosis of the genus as well as new data relating to host use. The following new species of Voria is described: Voria erasmocoronadoi Fleming & Wood sp. n. The following are proposed by Fleming & Wood as new synonyms of Voria : Xenoplagia Townsend, 1914 syn. n. , Hystricovoria Townsend, 1928 syn. n. , Afrovoria Curran, 1938 syn. n. , and Anavoria Mesnil, 1953 syn. n. , and Itavoria Townsend, 1931 syn. n. The following new combinations are proposed as a result of the new synonymies: Voria bakeri (Townsend, 1928), comb. n. and Voria setosa (Townsend, 1914), comb. n. The authors also propose Voria pollyclari (Rocha-e-Silva, Lopes & Della Lucia, 1999), comb. n. based on the morphology of the holotype.

  18. Aggiustamento regionale, integrazione dei mercati finanziari e redistribuzione fiscale in un'unione monetaria

    Directory of Open Access Journals (Sweden)

    A. RICCI

    2013-10-01

    Full Text Available The work extends the Mundell-Fleming model to a regional context in conditions of uncertainty and imbalance, thus making necessary changes to the basic structure of the original model. The necessity of such an expansion stems from several reasons. First, the new model allows to analyse the static and dynamic effects of asymmetric shocks of a stochastic or systematic character that affect a small region of a currency area. Second, at the level of regional economics there is still a lack of a theoretical model capable of synthesising the effects of monetary and fiscal policies in a context of tight interdependence between the financial sector, public sector and the real sector. Finally, within the sphere of regional economics there is a clear dividing line between short-term and long-term analysis. Aggregate demand policies can generate radically different effects in the long run as opposed to the short-run, regardless of the changes induced by the supply side. The author illustrates the main features that differentiate the model presented with the traditional Mundell-Fleming model. Then, the structure of the model is presented in formal terms and an analysis is performed of stochastic asymmetric shocks of a monetary and real nature that affect a small regional economy. Finally, the impact effects and the long-term dynamic effects of permanent shocks are analysed.  JEL Codes: F36 

  19. Hydrogeochemical and stream sediment reconnaissance basic data for Seguin NTMS quadrangle, Texas

    International Nuclear Information System (INIS)

    1978-01-01

    Results of a reconnaissance geochemical survey of the Sequin Quadrangle, Texas are reported. Field and laboratory data are presented for 848 groundwater, 950 stream sediment, and 406 stream water samples. Statistical and areal distributions of uranium and other possible uranium-related variables are displayed. A generalized geologic map of the survey area is provided, and pertinent geologic factors which may be of significance in evaluating the potential for uranium mineralization are briefly discussed. Groundwater data indicate that uranium concentrations above the 85th percentile occur along several northeast-southwest trends paralleling the regional strike of the major formations located within the survey area. The stream sediment data indicate that uranium is associated with heavy and/or resistate minerals in the Carrizo Sand and certain members of the Claiborne Group. Soluble uranium is primarily associated with the Cretaceous Formations, the Whitsett and Catahoula Formations, and sections of the Oakville and Fleming Formations. Stream water data corroborate well with both groundwater and stream sediment data. Anomalous values for uranium and associated pathfinder elements indicate that the Whitsett and Catahoula Formations and sections of the Oakville and Fleming Formations are potentially favorable for uranium mineralization. Anomalous values for certain pathfinder elements also occur in basins draining from the Beaumont Formation and may warrant further investigation

  20. Investing in nursing education: some evidence of immediate private monetary benefits.

    Science.gov (United States)

    Siedenberg, J M

    1989-05-01

    Sir Alexander Fleming's discovery of penicillin and Wilhelm Roentgen's detection of X rays are two of the more famous illustrations of research findings coming about accidentally. Fleming and Roentgen each was working in the general field of his major breakthrough when a significant disclosure occurred quite fortuitously. Results presented in this article also came about somewhat unintentionally. While studying the benefits of investment in cooperative education, positive outcomes in completing a baccalaureate degree with a specialization in nursing, turned up. A study of Lehman College alumni (1980-1985) revealed that nursing students fared better in the labor market upon graduation than did their nonnursing counterparts. This article examines several of the employment variables, such as wage rate and search costs, in light of factors including background differences of graduates, and market conditions such as the nursing shortage. Evidence suggests that the relative advantage enjoyed by the nursing group is associated with the additional human capital obtained through pursuing an academic concentration in nursing.

  1. Tubin: Sinfonie nr. 11 (ergänzt von Kaljo Raid) / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Tubin: Sinfonie nr. 11 (ergänzt von Kaljo Raid); Pärt: Nekrolog op. 5, Sinfonie nr. 1; Tüür: Searching for Roots, Insula deserta, Zeitraum. Königliches Philharmonisches Orchester Stockholm, Paavo Järvi". Virgin/EMI CD 5 45212 2 (WD:71'34") DDD

  2. Optimizing Hemodynamic Support of Acute Spinal Cord Injury Based on Injury Mechanism

    Science.gov (United States)

    2016-10-01

    t raining, SX ~ ~ D LD, MD, pressure monitoring . ll SO; no MAP s upport - I _J .& • functional assesssment > SCI; MAP support d1.1ring... Manley , G.T., Patel, N. and Whetstone, W.D. (2014). Medical and surgical management after spinal cord injury: vasopressor usage, early surgerys

  3. Commentary: From the Rockies to the Andes — How to Manage ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Despite the optimism, promotion, and engineering achievements, the CPR scheme floundered from the beginning. By the 1920s, farmers had organized and were blaming the CPR, saying that the high expenses for land and water were unacceptable. Many abandoned their farms. A farmer named W.D. Trego led some of ...

  4. The membrane attack complex of the complement system is essential for rapid wallerian degeneration

    NARCIS (Netherlands)

    Ramaglia, Valeria; King, Rosalind Helen Mary; Nourallah, Michelle; Wolterman, Ruud; de Jonge, Rosalein; Ramkema, Marja; Vigar, Miriam Ann; van der Wetering, Sandra; Morgan, Brian Paul; Troost, Dirk; Baas, Frank

    2007-01-01

    The complement (C) system plays an important role in myelin breakdown during Wallerian degeneration (WD). The pathway and mechanism involved are, however, not clear. In a crush injury model of the sciatic nerve, we show that C6, necessary for the assembly of the membrane attack complex (MAC), is

  5. BJUT at TREC 2015 Microblog Track: Real-Time Filtering Using Non-negative Matrix Factorization

    Science.gov (United States)

    2015-11-20

    query accurate ambiguity intergration Tweets Vector Preprocessing W-d matrix Feature vector Similarity ranking Recommended twittres Get...recommendation tech- nique based on product category attributes[J]. Expert Systems with Applications, 2009, 36(9): 11480-11488. [5] Sobecki J, Babiak E,Sanina M

  6. From Orthodoxy to Pluralism: New Views of School Administration.

    Science.gov (United States)

    Clark, David L.; McKibbin, Sue

    1982-01-01

    Presents a reader quiz on attitudes about school administration. Analyzes likely responses to the quiz and concludes that the assumption that schools are rational, bureaucratic organizations leads to rigidity and confusion because it does not accurately describe schools as they exist. Argues for pluralism in organizational views. (WD)

  7. EX-111 thermal emission from hot white dwarfs: the suggested He abundance-temperature correlation. EX-112: the unique emission line white dwarf star GD 356. Semiannnual status report, 1 December 1985-1 June 1986

    International Nuclear Information System (INIS)

    Shipman, H.L.

    1986-08-01

    Progress in the EXOSAT data analysis program is reported. EXOSAT observations for four white dwarfs (WD1031-115, WD0004+330, WD1615-154, and WD0109-264) were obtained. Counting rates were unexpectedly low, indicating that these objects have a substantial amount of x-ray absorbing matter in their photosheres. In addition, soft x-ray pulsations characterized by a 9.25 minute cycle were discovered in the DA white dwarf V471 Tauri. A residual x-ray flux from the K dwarf companion can be seen during the white dwarf eclipse at orbital phase 0.0. Pronounced dips in the soft x-ray light curve occur at orbital phases 0.15, 0.18, and 0.85. The dips may be correlated with the triangular Lagrangian points of the binary orbit. Smaller dips at phases near the eclipse may be associated with cool loops in the K star corona. Data for the white dwarf H1504+65 was also analyzed. This object is particularly unusual in that its photoshere is devoid of hydrogen and helium. Finally, existing data on the white dwarf Sirius B were analyzed to see what constraints from other data can be placed on the properties of this star. Interrelationships between radius, rotational velocity, and effective temperature were derived

  8. THE PUZZLING EARLY DETECTION OF LOW VELOCITY 56Ni DECAY LINES IN SN 2014J: HINTS OF A COMPACT REMNANT

    International Nuclear Information System (INIS)

    Ouyed, Rachid; Leahy, Denis; Koning, Nico; Staff, Jan

    2015-01-01

    We show that the low-velocity 56 Ni decay lines detected earlier than expected in the type Ia SN 2014J find an explanation in the quark-nova Ia model, which involves the thermonuclear explosion of a tidally disrupted sub-Chandrasekhar white dwarf (WD) in a tight neutron-star-WD binary system. The explosion is triggered by impact from the quark-nova (QN) ejecta on the WD material; the QN is the explosive transition of the neutron star to a quark star (QS) triggered by accretion from a CO torus (the circularized WD material). The presence of a compact remnant (the QS) provides: (1) an additional energy source (spin-down power) which allows us to fit the observed light-curve including the steep early rise; (2) a central gravitational potential which slows down some of the 56 Ni produced to velocities of a few 10 3 km s –1 . In our model, the 56 Ni decay lines become optically visible at ∼20 days from explosion time in agreement with observations. We list predictions that can provide important tests for our model

  9. A Neutron Star-White Dwarf Binary Model for Repeating Fast Radio Burst 121102

    Science.gov (United States)

    Gu, Wei-Min; Dong, Yi-Ze; Liu, Tong; Ma, Renyi; Wang, Junfeng

    2016-06-01

    We propose a compact binary model for the fast radio burst (FRB) repeaters, where the system consists of a magnetic white dwarf (WD) and a neutron star (NS) with strong bipolar magnetic fields. When the WD fills its Roche lobe, mass transfer will occur from the WD to the NS through the inner Lagrange point. The accreted magnetized materials may trigger magnetic reconnection when they approach the NS surface, and therefore the electrons can be accelerated to an ultra-relativistic speed. In this scenario, the curvature radiation of the electrons moving along the NS magnetic field lines can account for the characteristic frequency and the timescale of an FRB. Owing to the conservation of angular momentum, the WD may be kicked away after a burst, and the next burst may appear when the system becomes semi-detached again through the gravitational radiation. By comparing our analyses with the observations, we show that such an intermittent Roche-lobe overflow mechanism can be responsible for the observed repeating behavior of FRB 121102.

  10. Site Selection, Acquisition, and Planning for Aquaculture in Dredged Material Containment Areas

    Science.gov (United States)

    1993-08-01

    LCUIRSETTIWVIN Figure ACUAT 6. Fowhr o ei gnpoeuefrstln n nta trg RAEQUREDt S RACErmadWd 98 18~RE FORte 2- SiteA Selej) Site characteristics Table 1 lists...seeds, spores, organisms, etc.) (5) Effects on preserves, etc. Imvact f Attraction of vectors ( insects or rodents) due to creation of favorable

  11. Schostakowitsch. Orchesterlieder (Vol. 2), Neeme Järvi / Werner Pfister

    Index Scriptorium Estoniae

    Pfister, Werner

    1996-01-01

    Uuest heliplaadist "Schostakowitsch. Orchesterlieder (Vol. 2): Sechs Romanzen op. 21, Sechs Gedichte op. 143a, Suite auf Verse von Michelangelo Buonarroti op. 145a. Göteborger Sinfoniker, Neeme Järvi". DG CD 447 085-2 (WD: 71'06") DDD

  12. Fiscal 1997 verification and survey of geothermal prospecting technology etc. 1/2. Survey report on deep-seated geothermal resources; 1997 nendo chinetsu tansa gijutsu nado kensho chosa hokokusho. 1/2. Shinbu chinetsu shigen chosa

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-02-01

    For the purpose of reducing the risk to accompany the exploitation of deep-seated geothermal resources, investigations are conducted into the three factors that govern the formation of geothermal resources at deep levels, that is, the supply of heat from heat sources, the supply of geothermal fluids, and the development of fracture systems contributing to the constitution of reservoir structures. In fiscal 1997, a fumarolic gas test is conducted at the deep-seated geothermal well WD-1b which was drilled in the preceding fiscal year. In the test, chemical and isotopic characteristics are compared between the fluids of the WD-1b and the other existing deep-seated wells, and it is found that the fluids from the WD1b originates in surface water just like the fluids from the others and that the constitution of its gas is not greatly affected by magmatic fluids. A PTS (Pressure, Temperature, Spinner flowmeter) logging is performed to observe conditions in the well with the fluids being discharged and to know the inflow point and rate the fumarolic fluids, and the result is utilized to presume the 3-dimensional stress in the vicinity of the WD-1. An isotopic measurement of water included in the fluids is conducted to examine the origin of the geothermal fluids, constant observation and analysis of micro-earthquakes are carried out, and the fluid flow and fluid hydraulic characteristics are also studied. (NEDO)

  13. Sibelius. Lemminkäinen-Legenden op. 22 Nr. 1-4 / Christoph Schlüren

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1997-01-01

    Uuest heliplaadist "Sibelius: Lemminkäinen-Legenden op. 22 Nr. 1-4, Nächtlicher Ritt und Sonnenaufgang op. 55, Luonnotar op. 70. Stockholm Philharmoniker / Paavo Järvi. Virgin/EMI CD 545213 2 (WD:70'22")DDD

  14. THE DYNAMICAL EFFECTS OF WHITE DWARF BIRTH KICKS IN GLOBULAR STAR CLUSTERS

    International Nuclear Information System (INIS)

    Fregeau, John M.; Richer, Harvey B.; Rasio, Frederic A.; Hurley, Jarrod R.

    2009-01-01

    Recent observations of the white dwarf (WD) populations in the Galactic globular cluster NGC 6397 suggest that WDs receive a kick of a few km s -1 shortly before they are born. Using our Monte Carlo cluster evolution code, which includes accurate treatments of all relevant physical processes operating in globular clusters, we study the effects of the kicks on their host cluster and on the WD population itself. We find that in clusters whose velocity dispersion is comparable to the kick speed, WD kicks are a significant energy source for the cluster, prolonging the initial cluster core contraction phase significantly so that at late times the cluster core-to-half-mass radius ratio is a factor of up to ∼10 larger than in the no-kick case. WD kicks thus represent a possible resolution of the large discrepancy between observed and theoretically predicted values of this key structural parameter. Our modeling also reproduces the observed trend for younger WDs to be more extended in their radial distribution in the cluster than older WDs.

  15. Breast Cancer in Three Dimensions: Revealing Telomere Dysfunction in Breast Cancer

    Science.gov (United States)

    2006-09-01

    Wang Q, Puisieux, A, Foulkes WD and Trifiro M. Polymorphisms and HNPCC: PMS2 -MLH1 protein interactions diminished by ‘single nucleotide polymorphisms...characterization of the spectrum of genomic deletions in the mismatch repair genes MSH2, MLH1, MSH6, and PMS2 responsible for hereditary nonpolyposis colorectal

  16. Locating a Prostate Cancer Susceptibility Gene on the X Chromosome by Linkage Disequilibrium Mapping Using Three Founder Populations in Quebec and Switzerland

    Science.gov (United States)

    2006-09-01

    Gordon PH, Wang Q, Puisieux, A, Foulkes WD and Trifiro M. Polymorphisms and HNPCC: PMS2 -MLH1 protein interactions diminished by ‘single nucleotide...and PMS2 responsible for hereditary nonpolyposis colorectal cancer (HNPCC). Genes Chromosomes Cancer, 44 (2): 123-38, 2005. 120. Soravia C

  17. Browse Title Index

    African Journals Online (AJOL)

    Items 101 - 127 of 127 ... Vol 29, No 1 (2014), Short Term Comparative Analysis of Serum Electrolytes and Performance Characteristics of Castrated and Intact Red Sokoto Bucks, Abstract. MO Mamman, LO Aka, ... OB Balemba, LSB Mellau, RJ Assey, A Hay-Schmidt, WD Semuguruka, V Danyzer. Vol 25, No 2 (2008), The ...

  18. The Ecological Impact of Beach Nourishment with Dredged Materials on the Intertidal Zone at Bogue Banks, North Carolina.

    Science.gov (United States)

    1983-03-01

    ronmental advisability of beach nourishment with dredged materials. The high-energy sandy teach environment is harsh, characterized by great variations in...34 Botanica Marina, No. 20, 1977, pp. 227-232. ANDERSON, W.D., et al., "The Macro-Fauna of the Surf Zone off Folly Beach, South Carolina," Technical Report

  19. Functionally Similar WRKY Proteins Regulate Vacuolar Acidification in Petunia and Hair Development in Arabidopsis

    NARCIS (Netherlands)

    Verweij, W.; Spelt, C.E.; Bliek, M.; de Vries, M.; Wit, N.; Faraco, M.; Koes, R.; Quattrocchio, F.

    2016-01-01

    The WD40 proteins ANTHOCYANIN11 (AN11) from petunia (Petunia hybrida) and TRANSPARENT TESTA GLABRA1 (TTG1) fromArabidopsis thalianaand associated basic helix-loop-helix (bHLH) and MYB transcription factors activate a variety of differentiation processes. In petunia petals, AN11 and the bHLH protein

  20. Teacher Stress: A Descriptive Study of the Concerns.

    Science.gov (United States)

    Dedrick, Charles V.; And Others

    1981-01-01

    A recent survey of K-12 teachers in a middle-sized midwestern school system sought to identify the stressful conditions of the teaching profession as perceived by teachers. Women ranked lack of time as the greatest source of stress while men ranked disruptive students as the most stressful condition. (Author/WD)

  1. Mezi-krajské a vnitro-krajské rozdíly v dostupnosti tržního nájemního bydlení

    Czech Academy of Sciences Publication Activity Database

    Lux, Martin; Mikeszová, Martina

    2009-01-01

    Roč. 12, č. 4 (2009), s. 46-48 ISSN 1212-0855 R&D Projects: GA MMR WD-05-07-3 Institutional research plan: CEZ:AV0Z70280505 Keywords : regional differences * housing affordability * rental housing Subject RIV: AO - Sociology, Demography

  2. Pärt, Arvo. Fratres / Rainer Wagner

    Index Scriptorium Estoniae

    Wagner, Rainer

    1995-01-01

    Uuest heliplaadist "Pärt, Arvo. Fratres, Cantus (in Memory of Benjamin Britten), summa, Festina Lente; Peter Manning, France Springuel, Mireille Gleizes, Huub Righarts, I Fiamminghi, Rudolf Werthen" (AD: 1994) Telarc/in-akustik CD 80 387 (WD: 79'00")

  3. Far Ultraviolet Spectroscopic Explorer Spectroscopy of the Nova-Like Cataclysmic Variable BB Doradus

    National Research Council Canada - National Science Library

    Godon, Patrick; Sion, Edward M; Barrett, Paul E; Szkody, Paula; Schlegel, Eric M

    2008-01-01

    ... (possibly lower than 10 ). Assuming an average white dwarf (WD) mass of 0.8 M leads to a mass accretion rate of 10 9 M yr 1 and a distance on the order of 650 pc, consistent with the extremely low Galactic reddening in the direction of BB Dor...

  4. SYNTHESIS AND CHARACTERISATION OF Ni0.25Co0.75Fe2O4 ...

    African Journals Online (AJOL)

    characterised for their size and structure using X-ray diffraction (XRD), high .... the sample shows broad peaks, indicating the fine crystalline nature of the particles. ... Zhao, L.J.; Zhang, H.J.; Xing,Y.; Song, S.Y.; Yu, S.Y.; Shi, W.D.; Guo, X.M.; ...

  5. Intraspecific trait variation and covariation in a widespread tree species (Nothofagus pumilio) in southern Chile.

    Science.gov (United States)

    Fajardo, Alex; Piper, Frida I

    2011-01-01

    • The focus of the trait-based approach to study community ecology has mostly been on trait comparisons at the interspecific level. Here we quantified intraspecific variation and covariation of leaf mass per area (LMA) and wood density (WD) in monospecific forests of the widespread tree species Nothofagus pumilio to determine its magnitude and whether it is related to environmental conditions and ontogeny. We also discuss probable mechanisms controlling the trait variation found. • We collected leaf and stem woody tissues from 30-50 trees of different ages (ontogeny) from each of four populations at differing elevations (i.e. temperatures) and placed at each of three locations differing in soil moisture. • The total variation in LMA (coefficient of variation (CV) = 21.14%) was twice that of WD (CV = 10.52%). The total variation in traits was never less than 23% when compared with interspecific studies. Differences in elevation (temperature) for the most part explained variation in LMA, while differences in soil moisture and ontogeny explained the variation in WD. Traits covaried similarly in the altitudinal gradient only. • Functional traits of N. pumilio exhibited nonnegligible variation; LMA varied for the most part with temperature, while WD mostly varied with moisture and ontogeny. We demonstrate that environmental variation can cause important trait variation without species turnover. © The Authors (2010). Journal compilation © New Phytologist Trust (2010).

  6. Optimization of the alcoholic fermentation of blueberry juice by AS ...

    African Journals Online (AJOL)

    AJL

    2012-02-21

    Feb 21, 2012 ... Kraft TFB, Schmidt BM, Yousef GG, Knight CTG, Cuendet M, Kang YH,. Pezzuto JM, Seigler D, ... Su MS, Silva JL (2006). Antioxidant activity ... 104: 182-187. Tian RR, Pan QH, Zhan JC, Li JM, Wan SB, Zhang QH, Huang WD.

  7. Dicty_cDB: Contig-U14349-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 36 0.10 2 ( FE846078 ) CAFI539.rev CAFI Pichia stipitis aerobic dextrose... 38 0.11 2 ( FE846079 ) CAFI539.f...wd CAFI Pichia stipitis aerobic dextrose... 38 0.11 2 ( AC176598 ) Strongylocentrotus purpuratus clone R3-30

  8. Identification and functional characterization of a novel MYOC mutation in two primary open angle glaucoma families from The Netherlands.

    NARCIS (Netherlands)

    Hogewind, B.F.T.; Gaplovska-Kysela, K.; Theelen, T.; Cremers, F.P.M.; Yam, G.H.; Hoyng, C.B.; Mukhopadhyay, A.

    2007-01-01

    PURPOSE: Glaucoma is the second most prevalent cause of blindness worldwide, projected to affect more than 60 million people by 2010, 75% of which represents primary open angle glaucoma (POAG). Of the three genes, namely, Myocilin (MYOC), Optineurin (OPTN), and WD repeat-containing protein 36

  9. Ligeti: Ricercare per organo / M. K.

    Index Scriptorium Estoniae

    M. K.

    1991-01-01

    Uuest heliplaadist "Ligeti: Ricercare per organo, Vivier, Les Communiantes, Cavana, Jodl; Scelsi: In nomine Lucis; Lennot: Livre d'Orgue-extrait; Richer: Orgue 88; Pärt: Pari intervallo, Pierre Bousseau (Orgel)" (AD:1990). Adda/TIS CD 581 240 (WD:59'45") DDD

  10. Analysis of aroma compounds of Roselle by Dynamic Headspace Sampling using different preparation methods

    DEFF Research Database (Denmark)

    Juhari, Nurul Hanisah Binti; Varming, Camilla; Petersen, Mikael Agerlin

    2015-01-01

    The influence of different methods of sample preparation on the aroma profiles of dried Roselle (Hibiscus sabdariffa) was studied. Least amounts of aroma compounds were recovered by analysis of whole dry calyxes (WD) followed by ground dry (GD), blended together with water (BTW), and ground...

  11. Cryptosporidium infections in children in Durban

    African Journals Online (AJOL)

    1991-03-16

    Mar 16, 1991 ... Ann Trap Paediarr 1986; 6: 155-156. 20. Pape JW, Levine E, Beaulieu ME, Marshal! F, Verdier R, Johnson WD jun. Cryptosporidiosis in Haitian children. Am ] Trap Med Hyg 1987; 36: 333-337. 21. Hamoudi AC, Qualman SJ, Marcon MJ er al. Do regional variations in prevalence of cryptosporidiosis occur?

  12. Medtner: Konzert für Klavier und Orchester Nr. 1 c-Moll op. 33 / Volkmar Fischer

    Index Scriptorium Estoniae

    Fischer, Volkmar

    1992-01-01

    Uuest heliplaadist "Medtner: Konzert für Klavier und Orchester Nr. 1 c-Moll op. 33, Sonaten-Ballade für Klavier Fis-Dur op. 27. London Philharmonic Orchestra / Neeme Järvi". Chandos/Koch CD9039 (WD:54'28")

  13. EST Table: DC572689 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC572689 E_FL_wd--_27G20_R_0 10/09/28 53 %/126 aa ref|XP_002400269.1| DNA mismatch repair protein mlh1..., putative [Ixodes scapularis] gb|EEC09245.1| DNA mismatch repair protein mlh1, putative

  14. EST Table: DC572641 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC572641 E_FL_wd--_27E09_R_0 10/09/28 52 %/145 aa ref|XP_002400269.1| DNA mismatch repair protein mlh1..., putative [Ixodes scapularis] gb|EEC09245.1| DNA mismatch repair protein mlh1, putative

  15. EST Table: DC563666 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC563666 E_FL_wd--_01A16_R_0 10/09/28 53 %/141 aa ref|XP_002400269.1| DNA mismatch repair protein mlh1..., putative [Ixodes scapularis] gb|EEC09245.1| DNA mismatch repair protein mlh1, putative

  16. EST Table: DC566703 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available DC566703 E_FL_wd--_09O22_R_0 10/09/28 52 %/145 aa ref|XP_002400269.1| DNA mismatch repair protein mlh1..., putative [Ixodes scapularis] gb|EEC09245.1| DNA mismatch repair protein mlh1, putative

  17. Journal of Endocrinology, Metabolism and Diabetes of South Africa ...

    African Journals Online (AJOL)

    Adrenocortical function in hospitalised patients with active pulmonary tuberculosis receiving a rifampicin-based regimen - a pilot study · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. WD Francois Venter, Vanessa R Panz, Charles Feldman, Barry I Joffe, 16-21.

  18. Credentialism: Why We Have Diploma Mills.

    Science.gov (United States)

    Arnstein, George

    1982-01-01

    The demand for credentials and college degrees in the United States has spawned the establishment of many degree-granting institutions that are nothing more than diploma mills. Despite some indicators of institutional quality, such as accreditation and state licensing, the identification of substandard colleges is not always an easy task. (WD)

  19. Genetic enrichment of cardiomyocytes derived from mouse ...

    African Journals Online (AJOL)

    Genetic enrichment of cardiomyocytes derived from mouse embryonic stem cells. WJ He, SC Li, LL Ye, H Liu, QW Wang, WD Han, XB Fu, ZL Chen. Abstract. Pluripotent embryonic stem cells (ESC) have the ability to differentiate into a variety of cell lineages in vitro, including cardiomyocytes. Successful applications of ...

  20. Estnische Klaviermusik / Andreas K. W. Meyer

    Index Scriptorium Estoniae

    Meyer, Andreas K. W.

    1995-01-01

    Uuest heliplaadist "Estnische Klaviermusik. Mägi: Die alte Kannel; Kangro: Suite op. 1; Rääts: Toccata; Sumera: Stück aus dem Jahre 1981; Tüür: Sonate; Vähi: Fata Morgana; Pärt: Partita. Lauri Väinmaa (Klavier)" (AD: 1993). Finlandia/East West Records CD 4509-95704-2 (WD:57'08")

  1. Alfven, Hugo. Die drei Schwedischen Rhapsodien op. 19, 24 und 47 / Andreas Meyer

    Index Scriptorium Estoniae

    Meyer, Andreas

    1995-01-01

    Uuest heliplaadist "Alfven, Hugo. Die drei Schwedischen Rhapsodien op. 19, 24 und 47, En skärgardssägen op. 20, Suite aus Der Berkönig. Königliche Stockholmer Philharmoniker, Neeme Järvi". AD: 1987-1992. BIS?Disco-Center CD 725 (WD: 77'00")

  2. X-ray fluorescence spectrometry applied to soil analysis

    International Nuclear Information System (INIS)

    Salvador, Vera Lucia Ribeiro; Sato, Ivone Mulako; Scapin Junior, Wilson Santo; Scapin, Marcos Antonio; Imakima, Kengo

    1997-01-01

    This paper studies the X-ray fluorescence spectrometry applied to the soil analysis. A comparative study of the WD-XRFS and ED-XRFS techniques was carried out by using the following soil samples: SL-1, SOIL-7 and marine sediment SD-M-2/TM, from IAEA, and clay, JG-1a from Geological Survey of Japan (GSJ)

  3. African Journal of Biotechnology - Vol 9, No 34 (2010)

    African Journals Online (AJOL)

    Isolation and characterization of a novel Bacillus subtilis WD23 exhibiting laccase activity from forest soil · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT ... Detection of genetically modified maize (Zea mays L.) in seed samples from Nepal · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  4. The Professional-Bureaucratic Conflict: Origins, Implications, Resolution.

    Science.gov (United States)

    Angona, Judith; Williams, Leonard B.

    1981-01-01

    Examines the literature on the inevitable conflict in modern organizations between the professional's training for self-administration and bureaucratic denial of individual initiative and draws implications for administrative techniques that can help win the loyalty of a professional staff. (Author/WD)

  5. Double-detonation model of type Ia supernovae with a variable helium layer ignition mass

    International Nuclear Information System (INIS)

    Zhou Wei-Hong; Zhao Gang; Wang Bo

    2014-01-01

    Although Type Ia supernovae (SNe Ia) play an important role in the study of cosmology, their progenitors are still poorly understood. Thermonuclear explosions from the helium double-detonation sub-Chandrasekhar mass model have been considered as an alternative method for producing SNe Ia. By adopting the assumption that a double detonation occurs when a He layer with a critical ignition mass accumulates on the surface of a carbon—oxygen white dwarf (CO WD), we perform detailed binary evolution calculations for the He double-detonation model, in which a He layer from a He star accumulates on a CO WD. According to these calculations, we obtain the initial parameter spaces for SNe Ia in the orbital period and secondary mass plane for various initial WD masses. We implement these results into a detailed binary population synthesis approach to calculate SN Ia birthrates and delay times. From this model, the SN Ia birthrate in our Galaxy is ∼0.4 − 1.6 × 10 −3 yr −1 . This indicates that the double-detonation model only produces part of the SNe Ia. The delay times from this model are ∼ 70 – 710 Myr, which contribute to the young population of SNe Ia in the observations. We found that the CO WD + sdB star system CD–30 11223 could produce an SN Ia via the double-detonation model in its future evolution. (research papers)

  6. Structure-Activity Relationships in the Cytoprotective Effect of Caffeic Acid Phenethyl Ester (CAPE) and Fluorinated Derivatives: Effects on Heme Oxygenase-1 Induction and Antioxidant Activities

    Science.gov (United States)

    2010-03-09

    Hishikawa, K., Nakaki, T., Fujita, T., 2005. Oral flavonoid supplementation attenuates atherosclerosis development in apolipoprotein E-deficient mice... flavonoids . Free Radical Biology & Medicine 20, 331–342. Wakabayashi, N., Dinkova-Kostova, A.T., Holtzclaw, W.D., Kang, M.I., Kobayashi, A., Yamamoto, M

  7. Do Academically Able Teachers Leave Education? The North Carolina Case.

    Science.gov (United States)

    Schlechty, Phillip C.; Vance, Victor S.

    1981-01-01

    To determine whether academically able teachers are more likely than others to leave the classroom, a study was conducted of the data file of all certified regular classroom teachers who entered teaching in North Carolina from 1973 to 1980 and had no prior teaching experience. (Author/WD)

  8. Flow around turbulence promoters in parallel channel, (2)

    International Nuclear Information System (INIS)

    Shiina, Yasuaki

    1983-01-01

    Effects of walls on shedding vortex in developed channel flow were investigated putting a cylinder at the center of channels or on a wall for the value of w/d from 2 to 4. Results were compared with the uniform flow result. When a cylinder was put at the center of the channels, non-dimensional frequency plotted against Reynolds number agreed with the uniform flow result at low Reynolds number. However, it increased rapidly with Reynolds number, then it lay considerably above the uniform flow results at high Reynolds number. When a cylinder was put on a wall, non-dimensional frequency was considerably lower than the uniform flow result in the cases of w/d = 3 and 4. In the case of w/d = 2, however, frequency was higher than the uniform flow result at high Reynolds number. In all cases in the present study, the transition Reynolds number increased with decrease in the value of w/d. These results indicate that the increase in shedding frequency was due to the shift in velocity distribution from Poiseuille parabora in the wake region, which obviously increased with Reynolds number and with decrease in channel width. (author)

  9. Stenhammer, Wilhelm. sinfonien Nr. 1 F-Dur und Nr. 2 g-Moll op. 34, Excelsior! op. 13, Serenade F-Dur op. 31. Sinfonieorchester Göteborg, Neeme Järvi / Andreas K. W. Meyer

    Index Scriptorium Estoniae

    Meyer, Andreas K. W.

    1995-01-01

    Uuest heliplaadist "Stenhammer, Wilhelm. sinfonien Nr. 1 F-Dur und Nr. 2 g-Moll op. 34, Excelsior! op. 13, Serenade F-Dur op. 31. Sinfonieorchester Göteborg, Neeme Järvi". DG 2 CD 445857-2 (WD: 138'37")

  10. Wilson's Disease in Children : A Position Paper by the Hepatology Committee of the European Society for Paediatric Gastroenterology, Hepatology and Nutrition

    NARCIS (Netherlands)

    Socha, Piotr; Janczyk, Wojciech; Dhawan, Anil; Baumann, Ulrich; D'Antiga, Lorenzo; Tanner, Stuart; Iorio, Raffaele; Vajro, Pietro; Houwen, Roderick; Fischler, Björn; Dezsofi, Antal; Hadzic, Nedim; Hierro, Loreto; Jahnel, Jörg; McLin, Valérie; Nobili, Valerio; Smets, Francoise; Verkade, Henkjan J; Debray, Dominique

    Background:Clinical presentations of Wilson's disease (WD) in childhood ranges from asymptomatic liver disease to cirrhosis or acute liver failure, whereas neurological and psychiatric symptoms are rare. The basic diagnostic approach includes serum ceruloplasmin and 24-hour urinary copper excretion.

  11. The National Surgical Quality Improvement Program 30-Day Challenge: Microsurgical Breast Reconstruction Outcomes Reporting Reliability

    Directory of Open Access Journals (Sweden)

    Austin D. Chen

    2018-03-01

    Conclusion:. For immediate, free-tissue breast reconstruction, the ACS-NSQIP may be reliable for monitoring and comparing SSI, WD, URO, and URA rates. However, clinicians may find it useful to understand limitations of the ACS-NSQIP for complications and risk factors, as it may underreport complications occurring beyond 30 days.

  12. Polymorphism in TNP-1 gene of Murrah buffalo bulls

    African Journals Online (AJOL)

    hope&shola

    different types of anomalies (Yadav et al., 1990), how- ever as ... processes of modification in mammals (Lewis et al,. 2003). ... (Dadoune et al., 1988, Hofmann et al., 1990). ..... Cho C, Jung-Ha H, Willis WD, Goulding EH, Stein P, Xu Z, Schultz.

  13. Effects of the use of assisted reproductive technologies and an obesogenic environment on resistance artery function and diabetes biomarkers in mice offspring.

    Directory of Open Access Journals (Sweden)

    Francisco I Ramirez-Perez

    Full Text Available Maternal obesity affects the incidence of cardiovascular disease and diabetes in offspring. Also the use of assisted reproductive technologies (ART has been associated with cardiovascular deficiencies in offspring. Obese women often suffer from infertility and use ART to achieve a pregnancy, but the combined effects of maternal obesity and ART on cardiovascular health and incidence of diabetes in the offspring is not known. Here, we report the effects of the use of ART within an obesogenic environment, consisting of feeding a western diet (WD to dams and offspring, on resistance artery function and presence of diabetes biomarkers in juvenile mice offspring. Our results indicate that WD and ART interacted to induce endothelial dysfunction in mesenteric resistance arteries isolated from 7-week-old mice offspring. This was determined by presence of a reduced acetylcholine-induced dilation compared to controls. The arteries from these WD-ART mice also had greater wall cross-sectional areas and wall to lumen ratios indicative of vascular hypertrophic remodeling. Of the diabetes biomarkers measured, only resistin was affected by a WD×ART interaction. Serum resistin was significantly greater in WD-ART offspring compared to controls. Diet and sex effects were observed in other diabetes biomarkers. Our conclusion is that in mice the use of ART within an obesogenic environment interacts to favor the development of endothelial dysfunction in the resistance arteries of juvenile offspring, while having marginal effects on diabetes biomarkers.

  14. Tube suction test for evaluating durability of cementitiously stabilized soils.

    Science.gov (United States)

    2011-06-01

    In a comprehensive laboratory study, different tests namely, unconfined compressive strength (UCS) at the end of freeze-thaw/wet-dry (FT/ : W-D) cycles, resilient modulus (Mr) at the end of F-T/W-D cycles, vacuum saturation, tube suction, and moistur...

  15. Frequency-dependent changes in the amplitude of low-frequency fluctuations in patients with Wilson's disease: a resting-state fMRI study.

    Science.gov (United States)

    Hu, Xiaopeng; Chen, Siyi; Huang, Chang-Bing; Qian, Yinfeng; Yu, Yongqiang

    2017-06-01

    To investigate the frequency-dependent changes in the amplitude of low-frequency fluctuations (ALFF) in patients with Wilson's disease (WD). Resting-state function magnetic resonance imaging (R-fMRI) were employed to measure the amplitude of ALFF in 28 patients with WD and 27 matched normal controls. Slow-5 (0.01-0.027 Hz) and slow-4 (0.027-0.073 Hz) frequency bands were analyzed. Apart from the observation of atrophy in the cerebellum, basal ganglia, occipital gyrus, frontal gyrus, precentral gyrus, and paracentral lobule, we also found widespread differences in ALFF of the two bands in the medial frontal gyrus, inferior temporal gyrus, insula, basal ganglia, hippocampus/parahippocampal gyrus, and thalamus bilaterally. Compared to normal controls, WD patients had increased ALFF in the posterior lobe of the cerebellum, inferior temporal gyrus, brain stem, basal ganglia, and decreased ALFF in the anterior lobe of the cerebellum and medial frontal gyrus. Specifically, we observed that the ALFF abnormalities in the cerebellum and middle frontal gyrus were greater in the slow-5 than in the slow-4 band. Correlation analysis showed consistently positive correlations between urinary copper excretion (Cu), serum ceruloplasmin (CP) and ALFFs in the cerebellum. Our study suggests the accumulation of copper profoundly impaired intrinsic brain activity and the impairments seem to be frequency-dependent. These results provide further insights into the understanding of the pathophysiology of WD.

  16. Schostakowitsch: Sinfonie Nr. 12 op. 112 (Das Jahr 1917) / Hans-Christian Dadelsen

    Index Scriptorium Estoniae

    Dadelsen, Hans-Christian

    1991-01-01

    Uuest heliplaadist "Schostakowitsch: Sinfonie Nr. 12 op. 112 (Das Jahr 1917). Hamlet-Suite op. 32a. Das goldene Zeitalter [The Age of Gold] (Suite) op. 22a. Göteborger Symphoniker, Neeme Järvi". DG CD 431 688-2 (WD:77'21") DDD

  17. Western disturbances seen with AMSU-B and infrared sensors

    Indian Academy of Sciences (India)

    e-mail: dileepmp@unipune.ernet.in. Western .... optic environment of two cases of WD (17 April. 2001, 19 February ... brings out the advantage of AMSU-B (and the scale analysis of ..... KLM users' guide; NOAA US Department of Commerce.

  18. Genetic analysis of 55 northern Vietnamese patients with Wilson ...

    Indian Academy of Sciences (India)

    Le Anh Tuan Pham

    2017-12-19

    Dec 19, 2017 ... et al. 1993). The ATP7B gene consists of 21 exons and 20 introns. It is ∼7.5 kb in size and ... tal in Hanoi from 2010 to 2015. Diagnosis of WD ..... 6, 616–623. Figus A., Angius A., Loudianos G., Bertini C., Dessi V., Loi. A. et al ...

  19. MID-INFRARED SPECTROSCOPIC OBSERVATIONS OF THE DUST-FORMING CLASSICAL NOVA V2676 OPH

    Energy Technology Data Exchange (ETDEWEB)

    Kawakita, Hideyo; Arai, Akira; Shinnaka, Yoshiharu [Koyama Astronomical Observatory, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan); Ootsubo, Takafumi [Department of Earth Science and Astronomy, Graduate School of Arts and Sciences, The University of Tokyo, 3-8-1 Komaba, Meguro-ku, Tokyo 153-8902 (Japan); Nagashima, Masayoshi, E-mail: kawakthd@cc.kyoto-su.ac.jp [Department of Physics, Faculty of Science, Kyoto Sangyo University, Motoyama, Kamigamo, Kita-ku, Kyoto 603-8555 (Japan)

    2017-02-01

    The dust-forming nova V2676 Oph is unique in that it was the first nova to provide evidence of C{sub 2} and CN molecules during its near-maximum phase and evidence of CO molecules during its early decline phase. Observations of this nova have revealed the slow evolution of its lightcurves and have also shown low isotopic ratios of carbon ({sup 12}C/{sup 13}C) and nitrogen ({sup 14}N/{sup 15}N) in its envelope. These behaviors indicate that the white dwarf (WD) star hosting V2676 Oph is a CO-rich WD rather than an ONe-rich WD (typically larger in mass than the former). We performed mid-infrared spectroscopic and photometric observations of V2676 Oph in 2013 and 2014 (respectively 452 and 782 days after its discovery). No significant [Ne ii] emission at 12.8 μ m was detected at either epoch. These provided evidence for a CO-rich WD star hosting V2676 Oph. Both carbon-rich and oxygen-rich grains were detected in addition to an unidentified infrared feature at 11.4 μ m originating from polycyclic aromatic hydrocarbon molecules or hydrogenated amorphous carbon grains in the envelope of V2676 Oph.

  20. Phytoplankton and some abiotic features of El-Bardawil Lake, Sinai ...

    African Journals Online (AJOL)

    Phytoplankton and some abiotic features of El-Bardawil Lake, Sinai, Egypt. H Touliabah, HM Safik, MM Gab-Allah, WD Taylor. Abstract. El-Bardawil Lake is a large coastal lagoon on the Mediterranean coast of Sinai, Egypt. Although it is shallow and oligotrophic, it is one of the most important lakes in Egypt as a source of ...

  1. High-resolution Hydrodynamic Simulation of Tidal Detonation of a Helium White Dwarf by an Intermediate Mass Black Hole

    Science.gov (United States)

    Tanikawa, Ataru

    2018-05-01

    We demonstrate tidal detonation during a tidal disruption event (TDE) of a helium (He) white dwarf (WD) with 0.45 M ⊙ by an intermediate mass black hole using extremely high-resolution simulations. Tanikawa et al. have shown tidal detonation in results of previous studies from unphysical heating due to low-resolution simulations, and such unphysical heating occurs in three-dimensional (3D) smoothed particle hydrodynamics (SPH) simulations even with 10 million SPH particles. In order to avoid such unphysical heating, we perform 3D SPH simulations up to 300 million SPH particles, and 1D mesh simulations using flow structure in the 3D SPH simulations for 1D initial conditions. The 1D mesh simulations have higher resolutions than the 3D SPH simulations. We show that tidal detonation occurs and confirm that this result is perfectly converged with different space resolution in both 3D SPH and 1D mesh simulations. We find that detonation waves independently arise in leading parts of the WD, and yield large amounts of 56Ni. Although detonation waves are not generated in trailing parts of the WD, the trailing parts would receive detonation waves generated in the leading parts and would leave large amounts of Si group elements. Eventually, this He WD TDE would synthesize 56Ni of 0.30 M ⊙ and Si group elements of 0.08 M ⊙, and could be observed as a luminous thermonuclear transient comparable to SNe Ia.

  2. Depot-Specific Response of Adipose Tissue to Diet-Induced Inflammation: The Retinoid-Related Orphan Receptor α (RORα) Involved?

    Science.gov (United States)

    Kadiri, Sarah; Auclair, Martine; Capeau, Jacqueline; Antoine, Bénédicte

    2017-11-01

    Epididymal adipose tissue (EAT), a visceral fat depot, is more closely associated with metabolic dysfunction than inguinal adipose tissue (IAT), a subcutaneous depot. This study evaluated whether the nuclear receptor RORα, which controls inflammatory processes, could be implicated. EAT and IAT were compared in a RORα loss-of-function mouse (sg/sg) and in wild-type (WT) littermates, fed a standard diet (SD) or a Western diet (WD), to evaluate the impact of RORα expression on inflammatory status and on insulin sensitivity (IS) of each fat depot according to the diet. Sg/sg mice fed the SD exhibited a decreased inflammatory status and a higher IS in their fat depots than WT mice. WD-induced obesity had distinct effects on the two fat depots. In WT mice, EAT exhibited increased inflammation and insulin resistance while IAT showed reduced inflammation and improved IS, together with a depot-specific increase of RORα, and its target gene IκBα, in the stroma vascular fraction (SVF). Conversely, in sg/sg mice, WD increased inflammation and lowered IS of IAT but not of EAT. These findings suggest an anti-inflammatory role for RORα in response to WD, which occurs at the level of SVF of IAT, thus possibly contributing to the "healthy" expansion of IAT. © 2017 The Obesity Society.

  3. Baltische Musik für Streichorchester (Vol. 2) / Hans-Christian Dadelsen

    Index Scriptorium Estoniae

    Dadelsen, Hans-Christian

    1995-01-01

    Uuest heliplaadist "Baltische Musik für Streichorchester (Vol. 2). Ostrobothnian Chamber Orchestra, Juha Kangas". Finlandia/East West Records CD 4509-9789-2 (WD: 64'34") Plaadil ka Erkki-Sven Tüüri teos "Insula Deserta"

  4. Regional analysis of S emission-deposition trends in North America from 1979 through 1988

    International Nuclear Information System (INIS)

    Shannon, J.D.

    1991-01-01

    Variations in SO x emissions weighted by a regional deposition model are shown to account for most of the variance in regionally averaged annual wet deposition (WD) and precipitation-weighted concentrations (PWCs) of sulfate in the United States and Canada during the period 1979--1988. Total emissions decreased about 15% during that time. For all sites combined, weighted emissions accounted for about two-thirds of the variance, with slightly better performance for PWC than for WD. Restricting the emission regions to the states containing the monitoring sites in each region led to very mixed results, with good explanation of WD and PWC variance in the Midwest and in all sites combined but generally poor explanation elsewhere, particularly for WD. In some regions, local emission densities are quite low, and most deposition would be expected to result from outside sources, so no strong relationship between local emission rates and deposition would be expected. Including annual meteorological variability in the emission weighting improved variance explanation in several of the peripheral regions, but reduced variance explanation elsewhere, particularly in the Midwest, the region of the highest emission density. 10 refs., 2 figs., 1 tab

  5. Genetic analysis of 55 northern Vietnamese patients with Wilson ...

    Indian Academy of Sciences (India)

    We used Sanger sequencing to identify mutation hot spots in 55 northern Vietnamese with a clinical diagnosis of WD. Mutations were screened and detected by direct DNA sequencing. A total of 26 different ATP7B gene mutations were identified, including seven novel mutations (five nonsense and two missense mutations).

  6. Case series

    African Journals Online (AJOL)

    abp

    24 juil. 2015 ... work is properly cited. Pan African Medical Journal – ISSN: 1937- 8688 .... Ceci pourrait être expliqué par les variations des habitudes tabagiques et des composants des cigarettes [6-8]. .... Thun MJ, Lally CA, Flannery JT, Calle EE, Flanders WD, Heath. CW JR. Cigarette smoking and changes in the ...

  7. Wood nitrogen concentrations in tropical trees: phylogenetic patterns and ecological correlates.

    Science.gov (United States)

    Martin, Adam R; Erickson, David L; Kress, W John; Thomas, Sean C

    2014-11-01

    In tropical and temperate trees, wood chemical traits are hypothesized to covary with species' life-history strategy along a 'wood economics spectrum' (WES), but evidence supporting these expected patterns remains scarce. Due to its role in nutrient storage, we hypothesize that wood nitrogen (N) concentration will covary along the WES, being higher in slow-growing species with high wood density (WD), and lower in fast-growing species with low WD. In order to test this hypothesis we quantified wood N concentrations in 59 Panamanian hardwood species, and used this dataset to examine ecological correlates and phylogenetic patterns of wood N. Wood N varied > 14-fold among species between 0.04 and 0.59%; closely related species were more similar in wood N than expected by chance. Wood N was positively correlated with WD, and negatively correlated with log-transformed relative growth rates, although these relationships were relatively weak. We found evidence for co-evolution between wood N and both WD and log-transformed mortality rates. Our study provides evidence that wood N covaries with tree life-history parameters, and that these patterns consistently co-evolve in tropical hardwoods. These results provide some support for the hypothesized WES, and suggest that wood is an increasingly important N pool through tropical forest succession. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  8. Journal of Astrophysics and Astronomy | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    This paper reports the first spectroscopic observations in the H α region at different orbital phases and the revised photometric solutions, for the contact binary KP101231 (V1) in the direction of the open cluster Praesepe. The photometric solutions obtained for the data in V and R passbands using the Wilson--Devinney (WD) ...

  9. Kenad ja kõrged / Aimo Niemi, Pekka Aromaa, Olli Laitinen ja Jari Pitkäjärvi

    Index Scriptorium Estoniae

    2016-01-01

    Linnamaasturite võrdlus: Fiat 500X 1,4 Multiair Popstar, Honda HR-V 1,5 i-VTEC Elegance, Mazda CX-3 2,0 Skyactiv-G Premium Plus, Opel Mokka 1,4 Turbo ECOTEC Start/Stop, Ssangyong Tivoli 1,6i 2WD Quartz, Suzuki Vitara 1,6 VVT GLX

  10. INNER EDGES OF COMPACT DEBRIS DISKS AROUND METAL-RICH WHITE DWARFS

    Energy Technology Data Exchange (ETDEWEB)

    Rafikov, Roman R.; Garmilla, Jose A., E-mail: rrr@astro.princeton.edu, E-mail: garmilla@astro.princeton.edu [Department of Astrophysical Sciences, Princeton University, Ivy Lane, Princeton, NJ 08540 (United States)

    2012-12-01

    A number of metal-rich white dwarfs (WDs) are known to host compact, dense particle disks, which are thought to be responsible for metal pollution of these stars. In many such systems, the inner radii of disks inferred from their spectra are so close to the WD that particles directly exposed to starlight must be heated above 1500 K and are expected to be unstable against sublimation. To reconcile this expectation with observations, we explore particle sublimation in H-poor debris disks around WDs. We show that because of the high metal vapor pressure the characteristic sublimation temperature in these disks is 300-400 K higher than in their protoplanetary analogs, allowing particles to survive at higher temperatures. We then look at the structure of the inner edges of debris disks and show that they should generically feature superheated inner rims directly exposed to starlight with temperatures reaching 2500-3500 K. Particles migrating through the rim toward the WD (and rapidly sublimating) shield the disk behind them from strong stellar heating, making the survival of solids possible close to the WD. Our model agrees well with observations of WD+disk systems provided that disk particles are composed of Si-rich material such as olivine, and have sizes in the range {approx}0.03-30 cm.

  11. INNER EDGES OF COMPACT DEBRIS DISKS AROUND METAL-RICH WHITE DWARFS

    International Nuclear Information System (INIS)

    Rafikov, Roman R.; Garmilla, José A.

    2012-01-01

    A number of metal-rich white dwarfs (WDs) are known to host compact, dense particle disks, which are thought to be responsible for metal pollution of these stars. In many such systems, the inner radii of disks inferred from their spectra are so close to the WD that particles directly exposed to starlight must be heated above 1500 K and are expected to be unstable against sublimation. To reconcile this expectation with observations, we explore particle sublimation in H-poor debris disks around WDs. We show that because of the high metal vapor pressure the characteristic sublimation temperature in these disks is 300-400 K higher than in their protoplanetary analogs, allowing particles to survive at higher temperatures. We then look at the structure of the inner edges of debris disks and show that they should generically feature superheated inner rims directly exposed to starlight with temperatures reaching 2500-3500 K. Particles migrating through the rim toward the WD (and rapidly sublimating) shield the disk behind them from strong stellar heating, making the survival of solids possible close to the WD. Our model agrees well with observations of WD+disk systems provided that disk particles are composed of Si-rich material such as olivine, and have sizes in the range ∼0.03-30 cm.

  12. Inner Edges of Compact Debris Disks around Metal-rich White Dwarfs

    Science.gov (United States)

    Rafikov, Roman R.; Garmilla, José A.

    2012-12-01

    A number of metal-rich white dwarfs (WDs) are known to host compact, dense particle disks, which are thought to be responsible for metal pollution of these stars. In many such systems, the inner radii of disks inferred from their spectra are so close to the WD that particles directly exposed to starlight must be heated above 1500 K and are expected to be unstable against sublimation. To reconcile this expectation with observations, we explore particle sublimation in H-poor debris disks around WDs. We show that because of the high metal vapor pressure the characteristic sublimation temperature in these disks is 300-400 K higher than in their protoplanetary analogs, allowing particles to survive at higher temperatures. We then look at the structure of the inner edges of debris disks and show that they should generically feature superheated inner rims directly exposed to starlight with temperatures reaching 2500-3500 K. Particles migrating through the rim toward the WD (and rapidly sublimating) shield the disk behind them from strong stellar heating, making the survival of solids possible close to the WD. Our model agrees well with observations of WD+disk systems provided that disk particles are composed of Si-rich material such as olivine, and have sizes in the range ~0.03-30 cm.

  13. Solution of the Neutron transport equation in hexagonal geometry using strongly discontinuous nodal schemes

    International Nuclear Information System (INIS)

    Mugica R, C.A.; Valle G, E. del

    2005-01-01

    In 2002, E. del Valle and Ernest H. Mund developed a technique to solve numerically the Neutron transport equations in discrete ordinates and hexagonal geometry using two nodal schemes type finite element weakly discontinuous denominated WD 5,3 and WD 12,8 (of their initials in english Weakly Discontinuous). The technique consists on representing each hexagon in the union of three rhombuses each one of which it is transformed in a square in the one that the methods WD 5,3 and WD 12,8 were applied. In this work they are solved the mentioned equations of transport using the same discretization technique by hexagon but using two nodal schemes type finite element strongly discontinuous denominated SD 3 and SD 8 (of their initials in english Strongly Discontinuous). The application in each case as well as a reference problem for those that results are provided for the effective multiplication factor is described. It is carried out a comparison with the obtained results by del Valle and Mund for different discretization meshes so much angular as spatial. (Author)

  14. Wolman disease associated with hemophagocytic lymphohistiocytosis: attempts for an explanation.

    Science.gov (United States)

    Taurisano, Roberta; Maiorana, Arianna; De Benedetti, Fabrizio; Dionisi-Vici, Carlo; Boldrini, Renata; Deodato, Federica

    2014-10-01

    The lysosomal acid lipase (LAL) is the enzyme responsible of the hydrolysis of cholesteryl esters and triglycerides within endo-lysosomes. Loss of enzyme activity leads to accumulation of cholesteryl esters and triglycerides in the lysosome of most tissues. The complete deficiency of LAL is responsible of Wolman disease (WD), a severe systemic disease manifesting in the first days of life with vomiting, diarrhea, failure to thrive, hepatosplenomegaly, jaundice, anemia, and thrombocytopenia. Hemophagocytic lymphohistiocytosis (HLH) is a life-threatening condition which may be genetically determined or secondary to infections, malignancies, immune deficiencies, and rheumatologic disorders. So far, some inborn errors of metabolism have been associated with HLH (e.g., lysinuric protein intolerance, Gaucher's disease), and it has been anecdotally described in three WD patients, without any specific pathogenetic hypothesis. Here, we report on a WD patient, showing clear clinical, biochemical, and histological features indicative of HLH. We discuss the pathophysiological role of cholesteryl ester-induced inflammasome activation in macrophages, leading to a secondary HLH. This case indicates that WD can cause secondary HLH and suggests that a careful metabolic workup should be performed when facing to a pediatric patient with HLH.

  15. Reaganomics and K-12 Education: Some Responses from the Private Sector.

    Science.gov (United States)

    Leonard, Mary

    1982-01-01

    Reductions in personal and corporate income tax rates are expected to have a negative impact on charitable giving to public education. At the same time, grant makers are demanding that grant recipients improve their efficiency and effectiveness and broaden their basis of support. (Author/WD)

  16. Barrier abnormalities and keratinocyte-derived cytokine cascade after cessation of long-term topical glucocorticosteroid on hairless mouse skin

    Directory of Open Access Journals (Sweden)

    Tzu-Kai Lin

    2015-06-01

    Conclusion: An epidermis-derived cytokine cascade was observed following TCS-induced barrier disruption, which is similar to that from permeability barrier insults by acetone or tape stripping. The study suggests that concurrent application of skin care products during TCS treatment improves barrier homeostasis, and should become a standard practice to alleviate TCS-induced WD.

  17. Molecular Effects of 13C/DIM in Prostate Cancer

    Science.gov (United States)

    2007-04-01

    expression, Arch. Biochem. Biophys. 352 (1998) 59–70. [36] M.G. Busby, A.R. Jeffcoat, L.T. Bloedon, M.A. Koch, T. Black, K.J. Dix, W.D. Heizer , B.F. Thomas...the extracellular environment is implicated in the angiogenic switch. They found that MMP-9 could render normal islets angiogenic releasing VEGF

  18. Rachmaninoff. Sonate für Violoncello und Klavier op. 19 / Giselher Schubert

    Index Scriptorium Estoniae

    Schlüren, Christoph

    1995-01-01

    Uuest heliplaadist "Rachmaninoff. Sonate für Violoncello und Klavier op. 19; Schnittke. Sonate für Violoncello und Klavier; Pärt. Fratres für Violoncello und Klavier. Jiri Barta (Violoncello), Marian Lap£ansky (Klavier). Supraphon/Koch CD 11 2156-2 (WD: 73'13")

  19. Mahler: Sinfonie Nr. 8 Es-Dur (Sinfonie der Tausend) / Norbert Rüdell

    Index Scriptorium Estoniae

    Rüdell, Norbert

    1995-01-01

    Uuest heliplaadist "Mahler: Sinfonie Nr. 8 Es-Dur (Sinfonie der Tausend). Estonian Boys' Choir, Brunnsbo Children's Choir, Gothenburg Opera Chorus, Royal Stockholm Philharmonic Choir, Gothenburg Symphony Chorus, Gothenburg Opera Chorus, Gothenburg Symphony Orchestra, Neeme Järvi. BIS/Disco-Center CD 700 (WD:72'18")

  20. The Shock and Vibration Digest. Volume 16, Number 9

    Science.gov (United States)

    1984-09-01

    times greater than was actually observed. Steels R. Pietrowski , W.F. Gasse, and W.D. Kenny . • . Dofasco Inc., SAE Paper No. 830171 Key Words: Steel... Pietrowski , R ............ 2059 Skoczynski, W ........... 1997 Upon, R ............... 2070 ’ Porat, I ................ 1877 Skuta, E.B .............. 1916