In vivo uptake of /sup 67/Ga-citrate by an experimental abscess and the mechanism of /sup 67/Ga uptake

Energy Technology Data Exchange (ETDEWEB)

Nitta, Kazuo; Ogawa, Hiroshi [Daiichi Radioisotope Labs. Ltd., Tokyo (Japan); Ando, Atsushi; Ando, Itsuko; Hiraki, Tatsunosuke

1983-10-01

This study was undertaken to investigate the accumulation of /sup 67/Ga in an experimental abscess and to elucidate the mechanism of /sup 67/Ga uptake in the abscess. Two, three, five, seven and ten days after subcutaneous injection of 0.2 ml turpentine to the rats, /sup 67/Ga-citrate was injected to the rats. Twenty-four hours after injection of /sup 67/Ga, abscess and organs were excised and uptake rates of /sup 67/Ga were assayed. Furthermore, five days after subcutaneous injection of 0.2 ml turpentine to the rats, /sup 67/Ga-citrate was injected to the rats, at various time intervals from 10 minutes to 6 days, abscess and organs were excised and uptake rates of /sup 67/Ga were assayed. And subcellular distribution of /sup 67/Ga in abscess was determined at various time intervals after administration of /sup 67/Ga-citrate. On the other hand, to elucidate /sup 67/Ga binding substances in abscess, /sup 67/Ga-citrate and sodium sulfate-/sup 35/S were injected to the above rats, respectively. Twenty-four hours after injection, abscess was excised and homogenized. The homogenate was digested with proteinase. After digestion, the reaction mixture was gelfiltered on Sephadex G-100. Eluate samples were assayed for radioactivity, uronic acid and protein. Uptake rates of /sup 67/Ga in abscess increased with time after injection of turpentine and reached a plateau 5--7 days later./sup 67/Ga was eluted with acid mucopolysaccharides with molecular weights of 9400--40000, and with molecular weight larger than 40000. It was concluded that /sup 67/Ga was bound to the acid mucopolysaccharides (heparan sulfate, etc) in the abscess.

Three-phase bone scan and indium white blood cell scintigraphy following porous coated hip arthroplasty: A prospective study of the prosthetic tip

International Nuclear Information System (INIS)

Oswald, S.G.; Van Nostrand, D.; Savory, C.G.; Callaghan, J.J.

1989-01-01

Although few reports address the use of three-phase bone scanning (TPBS) and 111 In-labeled white blood cell (In-WBC) scintigraphy in hip arthroplasty utilizing a porous coated prosthesis, the literature suggests that scintigraphic patterns in the uncomplicated patient may differ from that seen in the cemented prosthesis. In an attempt to determine the scintigraphic natural history, 25 uncomplicated porous coated hip arthroplasties in 21 patients were prospectively studied with serial TPBS and In-WBC at approximately 7 days, and at 3, 6, 12, 18, and 24 mo postoperatively. This report deals with findings related to the prosthetic tip. Only one of 136 flow studies were abnormal and only two of 136 blood-pool images demonstrated focally increased activity. All 25 prostheses (120 of 143 scans) demonstrated increased uptake on the bone phase images. The area about the tip was divided into three segments; increased uptake at 24 mo was noted in the medial, distal, and lateral segments in 16%, 72%, and 56% of prostheses, respectively. Twenty of 25 prostheses (82 of 142 scans) showed uptake on In-WBC scintigraphy, being noted in 48% of prostheses at 24 mo. We conclude that scintigraphic patterns in the uncomplicated patient with a porous coated prosthesis appear to differ from patterns described in cemented prostheses

An accurate test for acute appendicitis: In-111 WBC imaging

International Nuclear Information System (INIS)

Navarro, D.A.; Weber, P.M.; Kang, I.Y.; dosRemedios, L.V.; Jasko, I.A.

1985-01-01

The decision to operate when acute appendicitis (APPY) is suspected is often difficult. Surgeons accept up to a 20% false positive rate to avoid any delay that may result in appendiceal rupture and peritonitis. The authors have successfully improved early diagnostic accuracy by using abdominal imaging beginning 2 hours after injecting In-111 labeled WBC. Patients with clear-cut (APPY) had laparotomy and were not studied. Those who were to be observed in the ER for possible (APPY) had their leukocytes harvested, labeled with In-111 oxine, and reinjected. Abnormal localized activity in the right lower quadrant (RLQ) imaged at 2 hours was graded relative to bone marrow activity (8M): 0, 1+ BM. When available the surgical specimen was imaged for In-111 activity. Of 31 patients studied there were 13 with positive scans for (APPY) all surgically confirmed. There were 4 additional abnormal studies all demonstrating known diagnostic patterns, 2 of pertonitis and 2 of colitis. There were 14 negative studies in 8 of whom the clinical course was benign; the remaining 6 had laparotomy with 3 having (APPY) and 3 not. Thus there were no false positives and 3 false negatives. One case negative at 2 hours had appendiceal activity later. The 3 cases with 3+ activity all had apendiceal abscesses. This new application of In-111 oxine WBC imaging is safe, simple, sensitive and specific. It shortens the time to surgical intervention and should reduce the surgical false positive rate

Low transient storage and uptake efficiencies in seven agricultural streams: implications for nutrient demand.

Science.gov (United States)

Sheibley, Richard W; Duff, John H; Tesoriero, Anthony J

2014-11-01

We used mass load budgets, transient storage modeling, and nutrient spiraling metrics to characterize nitrate (NO), ammonium (NH), and inorganic phosphorus (SRP) demand in seven agricultural streams across the United States and to identify in-stream services that may control these conditions. Retention of one or all nutrients was observed in all but one stream, but demand for all nutrients was low relative to the mass in transport. Transient storage metrics (/, , , and ) correlated with NO retention but not NH or SRP retention, suggesting in-stream services associated with transient storage and stream water residence time could influence reach-scale NO demand. However, because the fraction of median reach-scale travel time due to transient storage () was ≤1.2% across the sites, only a relatively small demand for NO could be generated by transient storage. In contrast, net uptake of nutrients from the water column calculated from nutrient spiraling metrics were not significant at any site because uptake lengths calculated from background nutrient concentrations were statistically insignificant and therefore much longer than the study reaches. These results suggest that low transient storage coupled with high surface water NO inputs have resulted in uptake efficiencies that are not sufficient to offset groundwater inputs of N. Nutrient retention has been linked to physical and hydrogeologic elements that drive flow through transient storage areas where residence time and biotic contact are maximized; however, our findings indicate that similar mechanisms are unable to generate a significant nutrient demand in these streams relative to the loads. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.

Comparison of simultaneous 99mTc-HMPAO and 111In oxine labelled white cell scans in the assessment of inflammatory bowel disease

International Nuclear Information System (INIS)

Allan, R.A.; Bassingham, S.; Lazarus, C.; Clarke, S.E.M.; Fogelman, I.; Sladen, G.E.

1993-01-01

Forty-seven patients, 29 with chronic inflammatory bowel disease (IBD) and 18 with presumed irritable bowel syndrome, including one with uncomplicated diverticular disease, were studied with simultaneous technetium-99m hexamethylpropylene amine oxime and indium-III oxine labelled leucocyte scans performed at 1, 3 and 24 h. Twenty-seven patients with IBD had active disease as judged by clinical and laboratory criteria and all of these had positive scans with both agents. No false positive studies were obtained. The 1-h 99m Tc-HMPAO WBC scans showed the same distribution to disease as the 3-h 111 -In WBC scans, with no difference in intensity (P 111 -In scans. The 3-h 99m Tc-HMPAO WBC scans showed more extensive disease (P 111 In WBC scans. Physiological bowel activity on 3-h 99m Tc-HMPAO WBC scans was present in 12 patients but was faint and did not interfere with assessment of disease extent and activity. It is concluded that in terms of isotope availability, radiation dosimetry and image quality, 99m Tc-HMPAO is the agent of choice in detecting active IBD, with localization of disease possible at 1-h after re-injection and optimal resolution and definition of disease extent at 3 h. A negative scan reliably excludes active disease. (orig.)

A new method for evaluating worst- and best-case (WBC) economic consequences of technological development

DEFF Research Database (Denmark)

Schjær-Jacobsen, Hans

1996-01-01

This paper is addressing the problem of evaluating economic worst- and best-care (WBC) consequences of technological development in industrial companies faking into account uncertainties and lack of exact cost and market information. In the theoretical part of the paper, the mathematical concepts...

99mTc-HMPAO WBC-scintigraphy: Are all positive findings in traumatology mandatory for surgical invention?

International Nuclear Information System (INIS)

Winker, K.H.; Weller, S.; Reuland, P.; Feine, U.

1989-01-01

In 5 case reports of traumatology patients the authors describe a subgroup of patients (IYON = infection yes, operation no) with positive WBC scan and proven infection, which do not need surgical intervention and can be treated by conservative means. (orig.) [de

{sup 18}F-FDG uptake at the surgical margin after hepatic resection: Patterns of uptake and differential diagnosis

Energy Technology Data Exchange (ETDEWEB)

Peungjesada, Silanath [University New Mexico, Department of Radiology, Albuquerque, NM (United States); Aloia, Thomas A. [University of Texas MD Anderson Cancer Center, Department of Surgical Oncology, Unit 444, Houston, TX (United States); Fox, Patricia [University of Texas MD Anderson Cancer Center, Department of Biostatistics, Unit 1411, Houston, TX (United States); Chasen, Beth [University of Texas MD Anderson Cancer Center, Department of Nuclear Medicine, Unit 1483, Houston, TX (United States); Shin, Sooyoung; Loyer, Evelyne M. [University of Texas MD Anderson Cancer Center, Department of Diagnostic Radiology, Unit 1473, Houston, TX (United States); Baiomy, Ali [Cairo University, National Cancer Center, Cairo (Egypt)

2015-08-15

To evaluate the patterns of {sup 18}F-FDG uptake at the surgical margin after hepatectomy to identify features that may differentiate benign and malignant uptake. Patients who had undergone a PET/CT after hepatectomy were identified. Delay between resection and PET/CT, presence of uptake at the surgical margin, pattern of uptake, and maximal standardized value were recorded. The PET/CT findings were correlated with contrast-enhanced CT or MRI. There were 26 patients with increased 18F-FDG uptake; uptake was diffuse in seven and focal in 19. Diffuse uptake was due to inflammation in all cases. Focal uptake was due to recurrence in 12 and inflammation in seven cases. Defining a focal pattern only as a positive for malignancy yielded 100 % sensitivity, 87 % specificity, 37 % false positive rate. As expected, SUV{sub max} was significantly higher for recurrence than inflammation, but did overlap. Contrast-enhanced CT allowed differentiation between malignant and benign uptake in all cases. F-FDG uptake after hepatectomy does not equate to recurrence and yields a high false positive rate. Diffuse uptake did not require additional evaluation in our sample. Focal uptake, however, may be due to recurrence; differentiating benign and malignant nodular uptake relies on optimal contrast-enhanced CT or MRI. (orig.)

Comparative Evaluation of C-Reactive Protein and WBC Count in Fascial Space Infections of Odontogenic Origin.

Science.gov (United States)

Bagul, Ravikiran; Chandan, Sanjay; Sane, Vikrant Dilip; Patil, Sujay; Yadav, Dinesh

2017-06-01

To assess efficacy of C-reactive protein levels as monitoring tools for patients with fascial space infections of odontogenic origin. A randomized prospective study was conducted on 20 patients suffering from fascial space infection of odontogenic origin, in the department of Oral and Maxillofacial Surgery Bharati Vidyapeeth dental college and hospital, Pune, Patients between 18 and 60 years of age of both the sexes were selected. All patients were treated and observed by the same surgeon. Patient's venous blood sample was collected pre-operatively and on 2nd and 5th post-operative days for evaluation of WBC count and C-reactive protein (CRP). All patients were encouraged for strict follow-up protocol. Where the results of WBC count and CRP when compared it was seen that the mean values of WBC were normal in 15 cases and abnormal in 5 cases on day 0, day 2 and day 5; whereas the mean values of CRP were abnormal on day 0 and day 2 and were within normal limit on day 5 in all cases. The findings of this prospective analysis indicate that White blood cells and C-reactive protein are effective markers for determining severity of infection, efficacy of treatment regime for patients with fascial space infections of odontogenic origin. Thus the markers also help in making treatment of patients with fascial space infections of odontogenic origin more cost effective and they also help protecting patients from side effects of excess drugs usage. Thus we conclude that CRP should be incorporated as monitoring tools for managing patients with fascial space infections of odontogenic origin.

Radio-active iodine uptake in vitiligo

Energy Technology Data Exchange (ETDEWEB)

Kumar, V.; Shankar, V.; Chaudhary, S.; Bhatia, K.K.; Mehta, L.K.; Arora, D.R. (Medical College and Hospital, Rohtak-124001 (India))

1990-01-01

Vitiligo and thyroid disease are commonly associated disorders. Twenty-two clinically euthyroid vitiligo patients were studied for functional assessment of thyroid by radioactive iodine uptake assay. Half of them showed abnormal uptake values at 24 hours. Of these patients, 90% had lower values indicating a tendency towards developing hypothyroid state. Subclinical thyroid dysfunction in vitiligo appears to be an adaptive change. (author).

Radio-active iodine uptake in vitiligo

International Nuclear Information System (INIS)

Kumar, V.; Shankar, V.; Chaudhary, S.; Bhatia, K.K.; Mehta, L.K.; Arora, D.R.

1990-01-01

Vitiligo and thyroid disease are commonly associated disorders. Twenty-two clinically euthyroid vitiligo patients were studied for functional assessment of thyroid by radioactive iodine uptake assay. Half of them showed abnormal uptake values at 24 hours. Of these patients, 90% had lower values indicating a tendency towards developing hypothyroid state. Subclinical thyroid dysfunction in vitiligo appears to be an adaptive change. (author)

Determination of maximum physiologic thyroid uptake and correlation with 24-hour RAI uptake value

International Nuclear Information System (INIS)

Duldulao, M.; Obaldo, J.

2007-01-01

Full text: In hyperthyroid patients, thyroid uptake values are overestimated, sometimes approaching or exceeding 100%. This is physiologically and mathematically impossible. This study was undertaken to determine the maximum physiologic thyroid uptake value through a proposed simple method using a gamma camera. Methodology: Twenty-two patients (17 females and 5 males), with ages ranging from 19-61 y/o (mean age ± SD; 41 ± 12), with 24-hour uptake value of >50%, clinically hyperthyroid and referred for subsequent radioactive iodine therapy were studied. The computed maximum physiologic thyroid uptake was compared with the 24-hour uptake using the paired Student t-test and evaluated using linear regression analysis. Results: The computed physiologic uptake correlated poorly with the 24-hour uptake value. However, in the male subgroup, there was no statistically significant difference between the two (p=0.77). Linear regression analysis gives the following relationship: physiologic uptake (%) = 77.76 - 0.284 (24-hour RAI uptake value). Conclusion: Provided that proper regions of interest are applied with correct attenuation and background subtraction, determination of physiologic thyroid uptake may be obtained using the proposed method. This simple method may be useful prior to I-131 therapy for hyperthyroidism especially when a single uptake determination is performed. (author)

Predicting pathologic tumor response to chemoradiotherapy with histogram distances characterizing longitudinal changes in 18F-FDG uptake patterns

Science.gov (United States)

Tan, Shan; Zhang, Hao; Zhang, Yongxue; Chen, Wengen; D’Souza, Warren D.; Lu, Wei

2013-01-01

Purpose: A family of fluorine-18 (18F)-fluorodeoxyglucose (18F-FDG) positron-emission tomography (PET) features based on histogram distances is proposed for predicting pathologic tumor response to neoadjuvant chemoradiotherapy (CRT). These features describe the longitudinal change of FDG uptake distribution within a tumor. Methods: Twenty patients with esophageal cancer treated with CRT plus surgery were included in this study. All patients underwent PET/CT scans before (pre-) and after (post-) CRT. The two scans were first rigidly registered, and the original tumor sites were then manually delineated on the pre-PET/CT by an experienced nuclear medicine physician. Two histograms representing the FDG uptake distribution were extracted from the pre- and the registered post-PET images, respectively, both within the delineated tumor. Distances between the two histograms quantify longitudinal changes in FDG uptake distribution resulting from CRT, and thus are potential predictors of tumor response. A total of 19 histogram distances were examined and compared to both traditional PET response measures and Haralick texture features. Receiver operating characteristic analyses and Mann-Whitney U test were performed to assess their predictive ability. Results: Among all tested histogram distances, seven bin-to-bin and seven crossbin distances outperformed traditional PET response measures using maximum standardized uptake value (AUC = 0.70) or total lesion glycolysis (AUC = 0.80). The seven bin-to-bin distances were: L2 distance (AUC = 0.84), χ2 distance (AUC = 0.83), intersection distance (AUC = 0.82), cosine distance (AUC = 0.83), squared Euclidean distance (AUC = 0.83), L1 distance (AUC = 0.82), and Jeffrey distance (AUC = 0.82). The seven crossbin distances were: quadratic-chi distance (AUC = 0.89), earth mover distance (AUC = 0.86), fast earth mover distance (AUC = 0.86), diffusion distance (AUC = 0.88), Kolmogorov-Smirnov distance (AUC = 0.88), quadratic form distance

Variation for N Uptake System in Maize: Genotypic Response to N Supply

KAUST Repository

Garnett, Trevor; Plett, Darren; Conn, Vanessa; Conn, Simon; Rabie, Huwaida; Rafalski, J. Antoni; Dhugga, Kanwarpal; Tester, Mark A.; Kaiser, Brent N.

2015-01-01

An understanding of the adaptations made by plants in their nitrogen (N) uptake systems in response to reduced N supply is important to the development of cereals with enhanced N uptake efficiency (NUpE). Twenty seven diverse genotypes of maize (Zea mays, L.) were grown in hydroponics for 3 weeks with limiting or adequate N supply. Genotypic response to N was assessed on the basis of biomass characteristics and the activities of the nitrate (NO−3) and ammonium (NH+4) high-affinity transport systems. Genotypes differed greatly for the ability to maintain biomass with reduced N. Although, the N response in underlying biomass and N transport related characteristics was less than that for biomass, there were clear relationships, most importantly, lines that maintained biomass at reduced N maintained net N uptake with no change in size of the root relative to the shoot. The root uptake capacity for both NO−3 and NH+4 increased with reduced N. Transcript levels of putative NO−3 and NH+4 transporter genes in the root tissue of a subset of the genotypes revealed that predominately ZmNRT2 transcript levels responded to N treatments. The correlation between the ratio of transcripts of ZmNRT2.2 between the two N levels and a genotype's ability to maintain biomass with reduced N suggests a role for these transporters in enhancing NUpE. The observed variation in the ability to capture N at low N provides scope for both improving NUpE in maize and also to better understand the N uptake system in cereals.

Variation for N Uptake System in Maize: Genotypic Response to N Supply

KAUST Repository

Garnett, Trevor

2015-11-09

An understanding of the adaptations made by plants in their nitrogen (N) uptake systems in response to reduced N supply is important to the development of cereals with enhanced N uptake efficiency (NUpE). Twenty seven diverse genotypes of maize (Zea mays, L.) were grown in hydroponics for 3 weeks with limiting or adequate N supply. Genotypic response to N was assessed on the basis of biomass characteristics and the activities of the nitrate (NO−3) and ammonium (NH+4) high-affinity transport systems. Genotypes differed greatly for the ability to maintain biomass with reduced N. Although, the N response in underlying biomass and N transport related characteristics was less than that for biomass, there were clear relationships, most importantly, lines that maintained biomass at reduced N maintained net N uptake with no change in size of the root relative to the shoot. The root uptake capacity for both NO−3 and NH+4 increased with reduced N. Transcript levels of putative NO−3 and NH+4 transporter genes in the root tissue of a subset of the genotypes revealed that predominately ZmNRT2 transcript levels responded to N treatments. The correlation between the ratio of transcripts of ZmNRT2.2 between the two N levels and a genotype\\'s ability to maintain biomass with reduced N suggests a role for these transporters in enhancing NUpE. The observed variation in the ability to capture N at low N provides scope for both improving NUpE in maize and also to better understand the N uptake system in cereals.

Precise fusion of MRI and dual energy 111In WBC/99mTc HDP SPECT/CT in the diabetic foot using companion CT: an example of SPECT/MRI imaging

International Nuclear Information System (INIS)

Knešaurek, K.; Heiba, S.; Kolker, D.; Vatti, S.

2015-01-01

The purpose of our study was to correctly fuse MRI and SPECT 111 In WBC and 99m Tc HDP images using companion CT images. The fused images could be used to assess proper surgical approach in treatment of the diabetic foot. Nine patients who had dual energy 111 In WBC/ 99 m Tc HDP SPECT/CT and MRI studies within a week were investigated in an ongoing project. A GE Infinia SPECT/CT camera and Siemens MAGNETOM 1.5T MR system were used in this study. First, the MRI and corresponding CT images were coregistrated using a transformation based on normalized mutual information. The transformation was saved and used for MRI and 111 In WBC/ 99 m Tc HDP SPECT fusion. A Jaszczak phantom study was also performed in order to estimate accuracy of MRI/ SPECT fusion. The Jaszczak phantom study with 3.7 MBq 111 In hot sphere showed that MRI/SPECT alignment using the approach described above produced registration with 0.7±0.4 mm accuracy in all three dimensions (3D). The nine clinical cases were visually evaluated and showed 1-2 mm 3D fusion accuracy. MRI provides almost perfect anatomy of soft tissue and bony structures but it may exaggerate the extent of infection. 111 In WBC/ 99 m Tc HDP SPECT imaging is more accurate for infection detection but lacks anatomical reference. Combination of these images proved an essential adjunct to diagnosis. A clinical utility of the approach is illustrated in two clinical examples. In conclusion, the CT in dual energy 111 In WBC/ 99 m Tc HDP SPECT/CT studies can be used to accurately fuse and compare 111 In WBC/ 99 m Tc HDP SPECT and MRI images of the diabetic foot. This can significantly help in conservative treatment planning and limb salvage procedures in treatment of diabetic foot infections.

Exploring the influence of culture on hearing help-seeking and hearing-aid uptake.

Science.gov (United States)

Zhao, Fei; Manchaiah, Vinaya; St Claire, Lindsay; Danermark, Berth; Jones, Lesley; Brandreth, Marian; Krishna, Rajalakshmi; Goodwin, Robin

2015-07-01

The purpose of this paper was to highlight the importance of cultural influence in understanding hearing-help seeking and hearing-aid uptake. Information on audiological services in different countries and 'theories related to cross-culture' is presented, followed by a general discussion. Twenty-seven relevant literature reviews on hearing impairment, cross-cultural studies, and the health psychology model and others as secondary resources. Despite the adverse consequences of hearing impairment and the significant potential benefits of audiological rehabilitation, only a small number of those with hearing impairment seek professional help and take up appropriate rehabilitation. Therefore, hearing help-seeking and hearing-aid uptake has recently become the hot topic for clinicians and researchers. Previous research has identified many contributing factors for hearing help-seeking with self-reported hearing disability being one of the main factors. Although significant differences in help-seeking and hearing-aid adoption rates have been reported across countries in population studies, limited literature on the influence of cross-cultural factors in this area calls for an immediate need for research. This paper highlights the importance of psychological models and cross-cultural research in the area of hearing help-seeking and hearing-aid uptake, and consequently some directions for future research are proposed.

Chapter Twenty Seven

African Journals Online (AJOL)

User

to arrest customers comprised unfair and discriminatory practices”. ... Even in French feminist theatre of 1870 -1914, Doestoevsky's fiction and Malaysian and ..... called “sex workers”) are compelled to pay tax to the government on their income. .... When a politician sells out his principles, or simply throws them to the wind to.

The effect of hydro-ethanolic extract of Curcuma longa rhizome and curcumin on total and differential WBC and serum oxidant, antioxidant biomarkers in rat model of asthma.

Science.gov (United States)

Shakeri, Farzaneh; Soukhtanloo, Mohammad; Boskabady, Mohammad Hossein

2017-02-01

The effects of Curcuma longa ( C. longa ) and curcumin on total and differential WBC count and oxidant, antioxidant biomarkers, in rat model of asthma were evaluated. Total and differential WBC count in the blood, NO 2 , NO 3 , MDA, SOD, CAT and thiol levels in serum were examined in control, asthma, Asthmatic rats treated with C. longa (0.75, 1.50, and 3.00 mg/ml), curcumin (0.15, 0.30, and 0.60 mg/ml), and dexamethasone (1.25 μg/ml) rats. Total and most differential WBC count, NO 2 , NO 3 and MDA were increased but lymphocytes, SOD, CAT and thiol were decreased in asthmatic animals compared to controls ( P longa and curcumin compared to asthmatic group ( P longa and curcumin ( P longa extract and its constituent curcumin in animal model of asthma was observed which suggest a therapeutic potential for the plant and its constituent on asthma.

In-111 WBC imaging in musculoskeletal sepsis

International Nuclear Information System (INIS)

Thompson, L.; Ouzounian, T.J.; Webber, M.M.; Amstutz, H.C.

1984-01-01

This study evaluated the accuracy and utility of the In-111 labeled WBC imaging in a series of patients who were suspected of having musculoskeletal sepsis. The labeling of the WBCs was patterned after a method previously described, in which the WBCs are labeled with In-111 oxine in plasma. The WBCs from 100 ml of blood are separated and incubated with In-111 oxine complex, and then 500 μCi. of the labeled cells were reinjected into the patient. Images of the areas in question were obtained at 24 hrs. In some instances, 48 hour images were also obtained. Images were interpreted using consistent criteria. Forty imaging procedures were done on 39 patients. These included 39 total joint protheses, and 17 other images to evaluate possible osteomyelitis, septic arthritis or deep abscesses. Of these studies, 15 were positive, and 42 negative. The findings were then correlated with operative culture and pathology in 21, aspiration cultures and gram stains in 14, and with clinical findings in the remaining 21. This correlation showed 41 true negatives, 12 true positives, 1 false negative, and 2 false positives. The sensitivity was 92.9% and the specificity was 95.2%l. The false negative occurred in a patient on chronic suppressive antibiotic therapy for an infected total hip replacement. The false positive images occurred in a patient with active rheumatoid arthritis and in a patient imaged one month post operative placement of the prosthesis. These images were very useful in several septic patients who had many possible sites of infection. The authors conclude that In-III imaging is an accurate and useful non-invasive method of evaluating musculoskeletal sepsis

The effect of hydro-ethanolic extract of Curcuma longa rhizome and curcumin on total and differential WBC and serum oxidant, antioxidant biomarkers in rat model of asthma

OpenAIRE

Farzaneh Shakeri; Mohammad Soukhtanloo; Mohammad Hossein Boskabady

2017-01-01

Objective(s): The effects of Curcuma longa (C. longa) and curcumin on total and differential WBC count and oxidant, antioxidant biomarkers, in rat model of asthma were evaluated. Materials and Methods: Total and differential WBC count in the blood, NO2, NO3, MDA, SOD, CAT and thiol levels in serum were examined in control, asthma, Asthmatic rats treated with C. longa (0.75, 1.50, and 3.00 mg/ml), curcumin (0.15, 0.30, and 0.60 mg/ml), and dexamethasone (1.25 ?g/ml) rats. Results: Total and mo...

Uranium uptake by hydroponically cultivated crop plants

Energy Technology Data Exchange (ETDEWEB)

Soudek, Petr; Petrova, Sarka [Laboratory of Plant Biotechnologies, Joint Laboratory of Institute of Experimental Botany AS CR, v.v.i. and Crop Research Institute, v.v.i., Rozvojova 263, 162 05 Prague 6 (Czech Republic); Benesova, Dagmar [Laboratory of Plant Biotechnologies, Joint Laboratory of Institute of Experimental Botany AS CR, v.v.i. and Crop Research Institute, v.v.i., Rozvojova 263, 162 05 Prague 6 (Czech Republic); Faculty of Environment Technology, Institute of Chemical Technology, Technicka 5, 166 28 Prague 6 (Czech Republic); Dvorakova, Marcela [Laboratory of Plant Biotechnologies, Joint Laboratory of Institute of Experimental Botany AS CR, v.v.i. and Crop Research Institute, v.v.i., Rozvojova 263, 162 05 Prague 6 (Czech Republic); Vanek, Tomas, E-mail: vanek@ueb.cas.cz [Laboratory of Plant Biotechnologies, Joint Laboratory of Institute of Experimental Botany AS CR, v.v.i. and Crop Research Institute, v.v.i., Rozvojova 263, 162 05 Prague 6 (Czech Republic)

2011-06-15

Hydroponicaly cultivated plants were grown on medium containing uranium. The appropriate concentrations of uranium for the experiments were selected on the basis of a standard ecotoxicity test. The most sensitive plant species was determined to be Lactuca sativa with an EC{sub 50} value about 0.1 mM. Cucumis sativa represented the most resistant plant to uranium (EC{sub 50} = 0.71 mM). Therefore, we used the uranium in a concentration range from 0.1 to 1 mM. Twenty different plant species were tested in hydroponic solution supplemented by 0.1 mM or 0.5 mM uranium concentration. The uranium accumulation of these plants varied from 0.16 mg/g DW to 0.011 mg/g DW. The highest uranium uptake was determined for Zea mays and the lowest for Arabidopsis thaliana. The amount of accumulated uranium was strongly influenced by uranium concentration in the cultivation medium. Autoradiography showed that uranium is mainly localized in the root system of the plants tested. Additional experiments demonstrated the possibility of influencing the uranium uptake from the cultivation medium by amendments. Tartaric acid was able to increase uranium uptake by Brassica oleracea and Sinapis alba up to 2.8 times or 1.9 times, respectively. Phosphate deficiency increased uranium uptake up to 4.5 times or 3.9 times, respectively, by Brassica oleracea and S. alba. In the case of deficiency of iron or presence of cadmium ions we did not find any increase in uranium accumulation. - Highlights: > The uranium accumulation in twenty different plant species varied from 0.160 to 0.011 mg/g DW. > Uranium is mainly localized in the root system. > Tartaric acid was able to increase uranium uptake by Brassica oleracea and Sinapis alba. > The phosphates deficiency increase the uranium uptake.

Uranium uptake by hydroponically cultivated crop plants

International Nuclear Information System (INIS)

Soudek, Petr; Petrova, Sarka; Benesova, Dagmar; Dvorakova, Marcela; Vanek, Tomas

2011-01-01

Hydroponicaly cultivated plants were grown on medium containing uranium. The appropriate concentrations of uranium for the experiments were selected on the basis of a standard ecotoxicity test. The most sensitive plant species was determined to be Lactuca sativa with an EC 50 value about 0.1 mM. Cucumis sativa represented the most resistant plant to uranium (EC 50 = 0.71 mM). Therefore, we used the uranium in a concentration range from 0.1 to 1 mM. Twenty different plant species were tested in hydroponic solution supplemented by 0.1 mM or 0.5 mM uranium concentration. The uranium accumulation of these plants varied from 0.16 mg/g DW to 0.011 mg/g DW. The highest uranium uptake was determined for Zea mays and the lowest for Arabidopsis thaliana. The amount of accumulated uranium was strongly influenced by uranium concentration in the cultivation medium. Autoradiography showed that uranium is mainly localized in the root system of the plants tested. Additional experiments demonstrated the possibility of influencing the uranium uptake from the cultivation medium by amendments. Tartaric acid was able to increase uranium uptake by Brassica oleracea and Sinapis alba up to 2.8 times or 1.9 times, respectively. Phosphate deficiency increased uranium uptake up to 4.5 times or 3.9 times, respectively, by Brassica oleracea and S. alba. In the case of deficiency of iron or presence of cadmium ions we did not find any increase in uranium accumulation. - Highlights: → The uranium accumulation in twenty different plant species varied from 0.160 to 0.011 mg/g DW. → Uranium is mainly localized in the root system. → Tartaric acid was able to increase uranium uptake by Brassica oleracea and Sinapis alba. → The phosphates deficiency increase the uranium uptake.

Evolution of structure and mechanical properties of hard yet fracture resistant W-B-C coatings with varying C/W ratio

Czech Academy of Sciences Publication Activity Database

Alishahi, M.; Mirzaei, S.; Souček, P.; Zábranský, L.; Buršíková, V.; Stupavska, M.; Peřina, Vratislav; Balázsi, K.; Czigany, Z.; Vašina, P.

2018-01-01

Roč. 340, č. 4 (2018), s. 103-111 ISSN 0257-8972 R&D Projects: GA MŠk LM2015056 Institutional support: RVO:61389005 Keywords : magnetron sputtering * W-B-C * microstructure * hardness * fracture resistance Subject RIV: JK - Corrosion ; Surface Treatment of Materials OBOR OECD: Coating and films Impact factor: 2.589, year: 2016

Physiological FDG uptake in the ovaries after hysterectomy

International Nuclear Information System (INIS)

Nishizawa, Sadahiko; Inubushi, Masayuki; Ozawa, Fukujiro; Kido, Aki; Okada, Hiroyuki

2007-01-01

It is known that focal 18 F-fluorodeoxyglucose (FDG) uptake is physiologically seen in the ovaries and uterus of premenopausal women in correlation with the menstrual cycle, which may cause false-positive diagnoses on the images of FDG positron emission tomography (PET). The objective of this study was to clarify whether women of reproductive age after hysterectomy whose ovaries were preserved, also showed physiological ovarian FDG uptake. We reviewed 26 women after hysterectomy (age 51.1±5.0 years), who underwent annual cancer screening, including FDG-PET and pelvic magnetic resonance (MR) imaging, three times. Seven women (age 45.9±5.8 years, range 34-52 years) had at least one ovary, showing changes in its appearance including the size and number of follicles on MR images each year, which suggested that the ovary was functioning. Four of the seven women showed focal FDG uptake (standardized uptake value 4.2±1.1) that corresponded to the normal ovaries on five PET examinations. Another group of 19 women (age 53.1±3.1 years, range 47-59 years) who had small ovaries without changes on MR images each year did not show FDG uptake in the ovaries. Physiological FDG uptake observed in the ovaries of women of reproductive age even after hysterectomy is reasonably common. As it is not easy to determine the hormonal cycle in these women, it is essential to correlate focal FDG uptake in the pelvis with anatomical and morphological findings on MR images to avoid false-positive diagnoses. (author)

Both semiquantitative degree of rest Tl-201 uptake and reversibility at 24 hour-delay were needed to predict wall motion improvement after bypass surgery

International Nuclear Information System (INIS)

Lee, D. S.; Yoon, S. N.; Kim, K. B.; Jeong, Z. K.; Lee, M. C.; Ko, C. S.

1997-01-01

Controversy still exists about how to use the uptake at rest and 24 hour delay in rest redistribution Tl-201 SPECT to predict improvement of wall motion abnormality after bypass surgery. To find the best way to combine diagnostic efficacy of Tl-201 SPECT to predict myocardial viability, we studied the predictive values (positive: PPV, negative: NPV) of rest and 24 hour-delay Tl-201 SPECT in 21 patients. Wall motion was assessed comparing preoperative post-stress gated Tc-99m-MIBI SPECT with that of 3 months after surgery. Four point scoring system was used for 17 myocardial segments to asses uptakes ( 0 to 3 for normal to defect) at rest and 24 hour-delay and wall motion ( 0 to 3 for normal to dyskinesia). Ejection fraction improved after surgery (5011% vs 4313%). Intra-observer and inter-observer reproducibility of EF was 7 and 9% respectively when we used 3D Perfusion-Motion Map. Sixty seven segments showed wall motion abnormality before surgery. Predictive values of rest Tl-201 uptake decrease were as follows: 0: 15/15(100%), 1: 30/34(88%), 2: 6/11 (55%), 3: 3/7(43%). So PPV of mild decrease was 88%, and NPV of severe decrease was 50%. Delayed reversibility was evaluated in 37 segments (15 patients). Twenty seven segment had persistence or aggravation, but the other 10 segments improved at 24 hour delay. PPV of reversible 10 segments was 80%, and NPV of reversibility was only 46%. PPV of combination of rest Tl-201 uptake of mild degree and 24 hour reversibility was 86% (38/44) and NPV of neither one was 88%. We concluded that both semi-quantitative degree of Tl-201 uptake at rest and reversibility at 24 hour delay was the best to warrant or abandon postoperative improvement of abnormal wall motion found at preoperative post-stress gated myocardial SPECT

Acceptability and Barriers to Uptake of Voluntary Counselling and Testing for HIV amongst Pregnant Women in Nigeria

Directory of Open Access Journals (Sweden)

Bukola Olateju Omolase

2010-08-01

Full Text Available AIM: This study was designed to determine the acceptability of voluntary counselling and testing (VCT for HIV and identify possible barriers to it’s uptake amongst pregnant women in a Nigerian community. METHODS: One hundred and twenty seven consenting pregnant women attending antenatal clinic at Federal Medical Centre, Owo were randomly selected and interviewed by the authors and two trained assistants. The study was conducted between August and October, 2007. The information obtained with the aid of semi –structured questionnaire included their bio data, awareness about VCT and vertical transmission of HIV-AIDS. Other information obtained included acceptability of VCT and barriers to its uptake. RESULT: Majority (85% were aware about vertical transmission of HIV, most (83.5% knew of VCT. They were predominantly willing to accept VCT (77.2% and were ready to recommend VCT to others(76.2%. The main identified barriers to uptake of voluntary counseling were fear of possible outcome (82.7% and risk of divorce (70.9%. CONCLUSION: Most respondents were aware of voluntary counselling and testing for HIV as well as the vertical transmission of HIV. Majority were willing to accept HIV test and recommend same to others. Barriers to uptake of HIV test included fear of possible outcome, lack of felt need, stigmatization and financial constraint. There is need to extend voluntary counselling and testing for HIV to all antenatal patients. [TAF Prev Med Bull 2010; 9(4.000: 309-314

Parieto-occipital encephalomalacia in children; clinical and electrophysiological features of twenty-seven cases.

Science.gov (United States)

Karaoğlu, Pakize; Polat, Ayşe İpek; Yiş, Uluç; Hız, Semra

2015-01-01

Brain injuries occurring at a particular time may cause damages in well-defined regions of brain. Perinatal hypoxic ischemic encephalopathy and hypoglycemia are some of the most common types of brain injuries. Neonatal hypoglycemia can cause abnormal myelination in parietal and occipital lobes resulting in parieto-occipital encephalomalacia. There is a small number of studies about clinical and electroencephalographic (EEG) features of children with parieto-occipital encephalomalacia. They might have important neurologic sequelae such as cortical visual loss, seizures, and psychomotor retardation. We aimed to evaluate the causes of parieto-occipital encephalomalacia and evaluate the clinical and electrophysiological features of children with parieto-occipital encephalomalacia. We evaluated clinical features and EEGs of 27 children with parieto-occipital encephalomalacia. Descriptive statistics were used. Hospitalization during the neonatal period was the most common cause (88.9%) of parieto-occipital brain injury. Eleven patients (40.7%) had a history of neonatal hypoglycemia. Twenty-three patients (85.2%) had epilepsy and nine of the epileptic patients (39%) had refractory seizures. Most of the patients had bilateral (50%) epileptic discharges originating from temporal, parietal, and occipital lobes (56.2%). However, some patients had frontal sharp waves and some had continuous spike and wave discharges during sleep. Visual abnormalities were evident in 15 (55.6%) patients. Twenty-two (81.5%) had psychomotor retardation. Fine motor skills, social contact and language development were impaired more than gross motor skills. In our study, most of the patients with parieto-occipital encephalomalacia had an eventful perinatal history. Epilepsy, psychomotor retardation, and visual problems were common neurologic complications.

Comparative analysis of {sup 99m}Tc-MDP three-phase bone scan with SPECT/CT and {sup 99m}Tc-HMPAO-labeled WBC SPECT/CT in the differential diagnosis of clinically suspicious post-traumatic osteomyelitis

Energy Technology Data Exchange (ETDEWEB)

KIm, Chan Woo; Lee, Soo Jin; Kim, Ji Young; Hwang, Kyu Tae; Choi, Yun Young [Hanyang University Medical CenterSeoul (Korea, Republic of)

2017-03-15

To identify differences between three-phase bone scan and SPECT/CT (TBS) and WBC SPECT/CT (WS) and compare diagnostic accuracies of each modality in patients with suspicious post-traumatic osteomyelitis (OM). Twenty-one patients with suspicious post-traumatic OM were enrolled. All patients performed TBS and WS within 1 week. Foci of MDP and WBC accumulation were divided into three categories: bone (OM), soft tissue (soft tissue inflammation; STI), negative for inflammation (NI). Confirmative diagnosis was made upon operative pathology or long-term clinical follow-up. Of 21 patients, four OM, eight STI, nine NI were finally diagnosed. TBS diagnosis was correct in three of four positive cases and nine of 17 negative cases. Sensitivity, specificity, accuracy, positive predictive value (PPV), negative predictive value (NPV) of TBS were 75 %, 52.9 %, 57.1 %, 27.3 %, 90 %. WS diagnosis was correct in two of four positive cases and 17 of 17 negative cases. Sensitivity, specificity, accuracy, PPV, NPV were 50 %, 100 %, 81.0 %, 100 %, 89.5 %. Twelve of 21 cases showed agreement between TBS and WS. TBS misdiagnosed nine cases (six STI and two NI as eight OM; one OM as one STI), while WS misdiagnosed four cases (two OM as two STI; two STI as two NI). Combining results from TBS and WS led to better diagnostic accuracy (91.7 %) than either TBS or WS alone. TBS and WS showed moderate agreement in assessment of clinically suspected post-traumatic OM. WS better evaluated inflammation than TBS. WS tended to underestimate inflammation whereas TBS tended to overestimate inflammation. Combining TBS and WS enhanced diagnostic accuracy.

Physiological and tumoral uptake of 68Ga-DOTATATE. Standardized uptake values and challenges in interpretation

International Nuclear Information System (INIS)

Kuyumcu, Serkan; Oezkan, Zeynep Goezde; Sanli, Yasemin; Yilmaz, Ebru; Mudun, Ayse; Adalet, Isik; Unal, Seher

2013-01-01

The objective of this study is to determine the range of standardized uptake value (SUV) max of 68Ga-DOTA-tyr3-octreotate (DOTATATE) in normal organs and tumoral lesions and establish uptake unrelated to neuroendocrine tumors (NET). One hundred and twenty patients (57 men, 63 women), who underwent 68 Ga-DOTATATE positron emission tomography (PET)/CT imaging in our institution were analyzed. Patients were indicated for 68 Ga-DOTATATE PET/CT imaging to detect primary tumor or metastasis of suspected or previously known NET, to determine somatostatin receptor (SSTR) positivity and to detect occult source of ectopic Cushing syndrome. Normal range of uptake was calculated for the organs that were proven to have no pathology by either conventional radiological imaging or clinical follow-up, using SUV max as a semiquantitative measure. Uptake and tumor to background (T/B) ratios of tumoral lesions in liver, pancreas, bone, brain and lymph nodes were calculated. Uptakes due to lesions unrelated to NET were also documented. Significant uptake was found in spleen, kidneys, adrenal glands, liver and pituitary gland with mean SUV max of 24.67, 14.30, 13.73, 9.12 and 9.74 respectively. Uptake was measured separately for the pancreatic head and body separately, however, besides a slightly heterogeneous uptake; the difference was not statistically significant. Uptake in the tumoral lesions had high (T/B) ratios with mean SUV max of 28.72, 25.21, 18.28, 34.73 and 12.59 for liver, pancreas, bone, brain and lymph nodes, respectively. Incidental benign tumoral lesions were detected in 3 patients (2.5%) which were meningioma and fibrous dysplasia demonstrating significant and breast fibroadenoma demonstrating mild 68 Ga-DOTATATE uptake. Non-neoplastic processes were detected in 4 patients (14.1%), including postsurgical inflammation, reactive lymph nodes, arthritis and demonstrated faint to mild 68 Ga-DOTATATE uptake, with the exception of significant uptake in accessory spleen. 68 Ga

Dermal Uptake of Organic Vapors Commonly Found in Indoor Air

DEFF Research Database (Denmark)

Weschler, Charles J.; Nazaroff, William W

2014-01-01

Transdermal uptake directly from air is a potentially important yet largely overlooked pathway for human exposure to organic vapors indoors. We recently reported (Indoor Air 2012, 22, 356) that transdermal uptake directly from air could be comparable to or larger than intake via inhalation for many......, formaldehyde, and acrolein. Analysis of published experimental data for human subjects for twenty different organic compounds substantiates these model predictions. However, transdermal uptake rates from air have not been measured for the indoor organics that have the largest modeled ratios of dermal......-to-inhalation uptake; for such compounds, the estimates reported here require experimental verification. In accounting for total exposure to indoor organic pollutants and in assessing potential health consequences of such exposures, it is important to consider direct transdermal absorption from air....

Elevated sacroilac joint uptake ratios in systemic lupus erythematosus

International Nuclear Information System (INIS)

De Smet, A.A.; Mahmood, T.; Robinson, R.G.; Lindsley, H.B.

1984-01-01

Sacroiliac joint radiographs and radionuclide sacroiliac joint uptake ratios were obtained on 14 patients with active systemic lupus erythematosus. Elevated joint ratios were found unilaterally in two patients and bilaterally in seven patients when their lupus was active. In patients whose disease became quiescent, the uptake ratios returned to normal. Two patients had persistently elevated ratios with continued clinical and laboratory evidence of active lupus. Mild sacroiliac joint sclerosis and erosions were detected on pelvic radiographs in these same two patients. Elevated quantitative sacroiliac joint uptake ratios may occur as a manifestation of active systemic lupus erythematosus

Ontogeny of methionine utilization and splanchnic uptake in critically ill children

Science.gov (United States)

To determine the rates of methionine splanchnic uptake and utilization in critically ill pediatric patients, we used two kinetic models: the plasma methionine enrichment,and the "intracellular" homocysteine enrichment. Twenty-four patients, eight infants, eight children, and eight adolescents, were ...

Gallium uptake in myositis ossificans. Potential pitfalls in diagnosis

International Nuclear Information System (INIS)

Salzman, L.; Lee, V.W.; Grant, P.

1987-01-01

Seven cases of gallium uptake in myositis ossificans are described. Gallium scans are done frequently in paraplegics, quadriplegics, and comatose patients to look for occult infection. It is important to be aware of possible gallium uptake in myositis ossificans, particularly in the extremities, which is frequent in these patients. Gallium uptake may be present prior to any abnormalities seen on plain films or CT scans. It is important to correlate roentgenograms with abnormal gallium scans, particularly in the extremities, to avoid potential pitfalls in diagnosis and prevent unnecessary antibiotic treatment. A bone scan should be obtained whenever possible, particularly when roentgenograms are negative, to confirm the diagnosis

Variability of insulin-stimulated myocardial glucose uptake in healthy elderly subjects

DEFF Research Database (Denmark)

Kofoed, Klaus F; Hove, Jens D; Freiberg, Jacob

2002-01-01

The aim of this study was to assess regional and global variability of insulin-stimulated myocardial glucose uptake in healthy elderly subjects and to evaluate potentially responsible factors. Twenty men with a mean age of 64 years, no history of cardiovascular disease, and normal blood pressure...... rest and hyperaemic blood flow during dipyridamole infusion were measured with nitrogen-13 ammonia and positron emission tomography in 16 left ventricular myocardial segments. Intra-individual and inter-individual variability of insulin-stimulated myocardial glucose uptake [relative dispersion...... = (standard deviation/mean)] was 13% and 29% respectively. Although inter-individual variability of glucose uptake and blood flow at rest was of the same magnitude, no correlation was found between these measures. Regional and global insulin-stimulated myocardial glucose uptake correlated linearly with whole...

Methionine Uptake and Required Radiation Dose to Control Glioblastoma

Energy Technology Data Exchange (ETDEWEB)

Iuchi, Toshihiko, E-mail: tiuchi@chiba-cc.jp [Division of Neurological Surgery, Chiba Cancer Center, Chiba (Japan); Hatano, Kazuo [Division of Radiation Oncology, Tokyo Bay Advanced Imaging and Radiation Oncology Clinic, Makuhari, Chiba (Japan); Uchino, Yoshio [Division of Nuclear Medicine, Chiba Ryogo Center, Chiba (Japan); Itami, Makiko [Division of Surgical Pathology, Chiba Cancer Center, Chiba (Japan); Hasegawa, Yuzo; Kawasaki, Koichiro; Sakaida, Tsukasa [Division of Neurological Surgery, Chiba Cancer Center, Chiba (Japan); Hara, Ryusuke [Division of Radiation Oncology, Chiba Cancer Center, Chiba (Japan)

2015-09-01

Purpose: The purpose of this study was to retrospectively assess the feasibility of radiation therapy planning for glioblastoma multiforme (GBM) based on the use of methionine (MET) positron emission tomography (PET), and the correlation among MET uptake, radiation dose, and tumor control. Methods and Materials: Twenty-two patients with GBM who underwent MET-PET prior to radiation therapy were enrolled. MET uptake in 30 regions of interest (ROIs) from 22 GBMs, biologically effective doses (BEDs) for the ROIs and their ratios (MET uptake:BED) were compared in terms of whether the ROIs were controlled for >12 months. Results: MET uptake was significantly correlated with tumor control (odds ratio [OR], 10.0; P=.005); however, there was a higher level of correlation between MET uptake:BED ratio and tumor control (OR, 40.0; P<.0001). These data indicated that the required BEDs for controlling the ROIs could be predicted in terms of MET uptake; BED could be calculated as [34.0 × MET uptake] Gy from the optimal threshold of the MET uptake:BED ratio for tumor control. Conclusions: Target delineation based on MET-PET was demonstrated to be feasible for radiation therapy treatment planning. MET-PET could not only provide precise visualization of infiltrating tumor cells but also predict the required radiation doses to control target regions.

Metaiodobenzylguanidine (MIBG) uptake in Parkinson's disease also decreases at thyroid

International Nuclear Information System (INIS)

Matsui, Hideaki; Udaka, Fukashi; Oda, Masaya; Tamura, Akiko; Kubori, Tamotsu; Nishinaka, Kazuto; Kameyama, Masakuni

2005-01-01

Decreased cardiac metaiodobenzylguanidine (MIBG) uptake was reported in Parkinson's disease and this contributes to the differential diagnosis between Parkinson's disease and other forms of parkinsonism such as multiple system atrophy. However, decreased MIBG uptake of the thyroid has not been demonstrated. The objective of this study was to compare MIBG uptake of the thyroid among Parkinson's disease, multiple system atrophy and controls. Twenty-six patients with Parkinson's disease, 11 patients with multiple system atrophy and 14 controls were examined in this study. Planar images were taken 15 minutes (early images) and 3 hours (late images) after intravenous injection of 111 MBq 123 I-MIBG. MIBG uptake of the thyroid on early images decreased significantly in Parkinson's disease compared to controls (p<0.0001) and multiple system atrophy (p=0.018). MIBG uptake of the thyroid on early images decreased significantly also in multiple system atrophy compared to controls (p=0.027). On late images, thyroid uptake differed significantly only between Parkinson's disease and controls (p=0.010). Our study is the first to demonstrate decreased MIBG uptake of the thyroid in Parkinson's disease. Sympathetic nervous denervation of Parkinson's disease occurred not only in the heart but also in the thyroid. (author)

Synovial aspiration and serological testing in two-stage revision arthroplasty for prosthetic joint infection: evaluation before reconstruction with a mean follow-up of twenty seven months.

Science.gov (United States)

Mühlhofer, Heinrich M L; Knebel, C; Pohlig, Florian; Feihl, Susanne; Harrasser, Norbert; Schauwecker, Johannes; von Eisenhart-Rothe, Rüdiger

2018-02-01

The two-stage revision protocol is the gold standard for controlling and treating low-grade prosthetic joint infections of total hip and total knee arthroplasty. The antibiotic pause for diagnostic reasons before reconstruction (stage two) is discussed in relation to the persistence of the infection and the development of resistant bacterial strains. Serological markers and a synovial analysis are commonly used to exclude the persistence of infection. Therefore, we asked (1) is the serological testing of C-reactive protein and leucocytes a valuable tool to predict a persistence of infection? and (2) what is the role of synovial aspiration of Plymethylmethacrylat (PMMA) spacers in hip and knee joints? One hundred twelve patients who were MSIS criteria-positive for a prosthetic joint infection were studied, including 45 total hip arthroplasties (THA) and 67 total knee artrhoplasties (TKA) patients. All patients were treated with a two-stage-protocol using a mobile PMMA spacer after a 14-day antibiotic-free interval, during which we measured serological markers (C-reactive protein and leucocytes) and performed synovial aspiration (white blood cell count, polymorphonuclear cell percentage, and microbiological culture) in these patients and compared the results with those of their long-term-follow-up (mean follow-up 27 months, range 24-36 months). Of the 112 patients, 89 patients (79.5%; 95% CI 72-86.9) exhibited infection control after a two-stage exchange, and we detected most methicillin-resistant, coagulase-negative Staphylococci (CoNS) in cases of a persistent infection. The mean sensitivity of serum C-reactive protein in the patients was 0.43 (range 0.23-0.64), and the mean specificity was 0.73 (range 0.64-0.82). For serum leucocytes, the mean sensitivity was 0.09 (range 0-0.29), and the mean specificity was 0.81 (range 0.7-0.92). The mean sensitivity for the WBC count in the synovial fluid (PMMA spacer aspiration) was 0.1 (range 0-0.29), and the mean

Hyperleucocytosis in paediatric acute myeloid leukaemia - the challenge of white blood cell counts above 200 × 10(9) /l. The NOPHO experience 1984-2014

DEFF Research Database (Denmark)

Zeller, Bernward; Glosli, Heidi; Forestier, Erik

2017-01-01

on very high white blood cell counts (WBC >200 × 10/l). Eighty-six patients (10%) had WBC 100-199 × 109 /l and 57 (6%) had WBC ≥200 × 109 /l. Patients with WBC ≥200 × 109 /l had a high frequency of t(9;11) and a paucity of trisomy 8. Due to the high frequency of deaths within the first 2 weeks (30% vs. 1......% for all others), overall survival in this group was inferior to patients with WBC vs. 61%). Main cause of early death was intracranial haemorrhage and leucostasis. Twenty-six per cent of these patients never started antileukaemic protocol therapy. Leukapheresis or exchange transfusion...... was used in 24% of patients with hyperleucocytosis without impact on survival. Patients with hyperleucocytosis surviving the first week had identical survival as patients with lower WBC. We conclude that death within the first days after diagnosis is the major challenge in patients with high WBC...

A twenty-seven kilometre film

CERN Multimedia

2009-01-01

For the past two weeks, Bram Conjaerts, a Belgian filmmaker, has been touring the CERN sites and surrounding countryside conducting research for his new documentary. The film will follow the entire 27 Km length of the LHC ring, but unlike most documentaries about the LHC, it will take place mostly above ground! Bram Conjaerts during his visit to CERN.While working towards his film degree in 2008, Bram Conjaerts won an award at the International Documentary Festival for his documentary "Henri and the Islands", an anthropological documentary about the smallest village in Belgium. In an unlikely change of subject matter he decided to use the prize money to make a film about the LHC. "With the money granted by the Flemish government, I wanted to create a documentary about something adventurous and something that I did not know about, " explains Conjaerts. "I started doing research about the LHC and CERN and I came across the fantasy of...

FDG uptake in cervical lymph nodes in children without head and neck cancer.

Science.gov (United States)

Vali, Reza; Bakari, Alaa A; Marie, Eman; Kousha, Mahnaz; Charron, Martin; Shammas, Amer

2017-06-01

Reactive cervical lymphadenopathy is common in children and may demonstrate increased 18 F-fluoro-deoxyglucose ( 18 F-FDG) uptake on positron emission tomography/computed tomography (PET/CT). We sought to evaluate the frequency and significance of 18 F-FDG uptake by neck lymph nodes in children with no history of head and neck cancer. The charts of 244 patients (114 female, mean age: 10.4 years) with a variety of tumors such as lymphoma and post-transplant lymphoproliferative diseases (PTLD), but no head and neck cancers, who had undergone 18 F-FDG PET/CT were reviewed retrospectively. Using the maximum standardized uptake value (SUVmax), increased 18 F-FDG uptake by neck lymph nodes was recorded and compared with the final diagnosis based on follow-up studies or biopsy results. Neck lymph node uptake was identified in 70/244 (28.6%) of the patients. In 38 patients, the lymph nodes were benign. In eight patients, the lymph nodes were malignant (seven PTLD and one lymphoma). In 24 patients, we were not able to confirm the final diagnosis. Seven out of the eight malignant lymph nodes were positive for PTLD. The mean SUVmax was significantly higher in malignant lesions (4.2) compared with benign lesions (2.1) (P = 0.00049). 18 F-FDG uptake in neck lymph nodes is common in children and is frequently due to reactive lymph nodes, especially when the SUVmax is cervical lymph nodes is higher in PTLD patients compared with other groups.

Tracking uptake of innovations from the European Union Public Health Programme.

Science.gov (United States)

Voss, Margaretha; Alexanderson, Kristina; McCarthy, Mark

2013-11-01

The European Commission developed the Public Health Programme to enable cross-national innovation and transfer in fields of health information, health threats and health promotion. PHIRE (Public Health Innovation and Research in Europe), a collaboration of the European Public Health Association (EUPHA) with seven partners, addressed the uptake of these public health innovation projects at country level. EUPHA thematic sections lead on areas of public health practice and research and experts can choose to be section members. The section presidents of seven sections chose eight European public health projects, starting in the EU Public Health Programme in 2003-05, that provided new knowledge for practice and covered a majority of the EU countries. A web-based questionnaire recorded country informants' (CIs) perceptions of uptake, assessed as relevance and dissemination to a range of public and non-governmental organizations. 108 CIs individually described the eight innovations in an average of 14 (46%) of the 30 European countries. Three of the eight innovations were considered of high relevance by >60% of respondents and at least 70% of informants considered seven of the eight innovation projects as of high or moderate relevance. Dissemination was noted across governmental, professional and academic settings, with high impact on knowledge/awareness for at least 30% of CIs. Some projects had uptake within the policy cycle in particular countries and connected strongly with academics and professionals. Projects working at local level had less visibility nationally and some projects were unknown to national respondents. European Union funding for public health can contribute to cross-national knowledge transfer and uptake of innovations. More attention is needed to classify, characterize and identify public health innovations and to demonstrate their direct contribution to European health and well-being.

Multiple loci are associated with white blood cell phenotypes.

Directory of Open Access Journals (Sweden)

Michael A Nalls

2011-06-01

Full Text Available White blood cell (WBC count is a common clinical measure from complete blood count assays, and it varies widely among healthy individuals. Total WBC count and its constituent subtypes have been shown to be moderately heritable, with the heritability estimates varying across cell types. We studied 19,509 subjects from seven cohorts in a discovery analysis, and 11,823 subjects from ten cohorts for replication analyses, to determine genetic factors influencing variability within the normal hematological range for total WBC count and five WBC subtype measures. Cohort specific data was supplied by the CHARGE, HeamGen, and INGI consortia, as well as independent collaborative studies. We identified and replicated ten associations with total WBC count and five WBC subtypes at seven different genomic loci (total WBC count-6p21 in the HLA region, 17q21 near ORMDL3, and CSF3; neutrophil count-17q21; basophil count- 3p21 near RPN1 and C3orf27; lymphocyte count-6p21, 19p13 at EPS15L1; monocyte count-2q31 at ITGA4, 3q21, 8q24 an intergenic region, 9q31 near EDG2, including three previously reported associations and seven novel associations. To investigate functional relationships among variants contributing to variability in the six WBC traits, we utilized gene expression- and pathways-based analyses. We implemented gene-clustering algorithms to evaluate functional connectivity among implicated loci and showed functional relationships across cell types. Gene expression data from whole blood was utilized to show that significant biological consequences can be extracted from our genome-wide analyses, with effect estimates for significant loci from the meta-analyses being highly corellated with the proximal gene expression. In addition, collaborative efforts between the groups contributing to this study and related studies conducted by the COGENT and RIKEN groups allowed for the examination of effect homogeneity for genome-wide significant associations across

Diffusion-Weighted Magnetic Resonance Diagnosis of Local Recurrences of Prostate Cancer after Radical Prostatectomy: Preliminary Evaluation on Twenty-Seven Cases

Directory of Open Access Journals (Sweden)

Salvatore Francesco Carbone

2014-01-01

Full Text Available Objectives. To assess the diagnostic performance of diffusion-weighted MR imaging (DWI in patients affected by prostatic fossa (PF relapse after radical prostatectomy (RP for prostatic carcinoma (PC. Methods. Twenty-seven patients showing a nodular lesion in the PF at T2-weighted MR imaging after RP, with diagnosis of PC relapse established by biopsy or PSA determinations, were investigated by DWI. Two readers evaluated the DWI results in consensus and the apparent diffusion coefficient (ADC of the nodules, separately; a mean value was obtained (ADCm. Results. Relapses did not significantly differ in size in respect of postsurgical benign nodules. The DWI qualitative evaluation showed sensitivity, specificity, accuracy, ppv, and npv values, respectively, of 83.3%, 88.9%, 85.2%, 93.7%, and 72.7% (100%, 87.5%, 95.6%, 93.7%, and 100%, for nodules >6 mm. The intraclass correlation coefficient (ICC for ADC evaluation between the two readers was 0.852 (95% CI 0.661–0.935; P=0.0001. The ADCm values for relapses and benign nodules were, respectively, 0.98±0.21×10−3 mm2/sec and 1.24±0.32×10−3 mm2/sec (P=0.006. Sensitivity, specificity, accuracy, ppv and npv of ADCm were, respectively, 77.8%, 88.9%, 81.8%, 93.3%, and 66.7% (93.3%, 87.5%, 85.4%, 93.3%, and 87.5% for nodules >6 mm. Conclusions. Diffusion-weighted MR imaging is a promising tool in the management of a hyperintense nodule detected by T2-weighted sequences. This might have a relevant importance in contouring radiotherapy treatment volumes.

FDG uptake in cervical lymph nodes in children without head and neck cancer

Energy Technology Data Exchange (ETDEWEB)

Vali, Reza; Bakari, Alaa A.; Marie, Eman; Kousha, Mahnaz; Shammas, Amer [University of Toronto, Department of Diagnostic Imaging, The Hospital for Sick Children, Toronto, ON (Canada); Charron, Martin [Brampton Nuclear Services, Toronto, ON (Canada)

2017-06-15

Reactive cervical lymphadenopathy is common in children and may demonstrate increased {sup 18}F-fluoro-deoxyglucose ({sup 18}F-FDG) uptake on positron emission tomography/computed tomography (PET/CT). We sought to evaluate the frequency and significance of {sup 18}F-FDG uptake by neck lymph nodes in children with no history of head and neck cancer. The charts of 244 patients (114 female, mean age: 10.4 years) with a variety of tumors such as lymphoma and post-transplant lymphoproliferative diseases (PTLD), but no head and neck cancers, who had undergone {sup 18}F-FDG PET/CT were reviewed retrospectively. Using the maximum standardized uptake value (SUVmax), increased {sup 18}F-FDG uptake by neck lymph nodes was recorded and compared with the final diagnosis based on follow-up studies or biopsy results. Neck lymph node uptake was identified in 70/244 (28.6%) of the patients. In 38 patients, the lymph nodes were benign. In eight patients, the lymph nodes were malignant (seven PTLD and one lymphoma). In 24 patients, we were not able to confirm the final diagnosis. Seven out of the eight malignant lymph nodes were positive for PTLD. The mean SUVmax was significantly higher in malignant lesions (4.2) compared with benign lesions (2.1) (P = 0.00049). {sup 18}F-FDG uptake in neck lymph nodes is common in children and is frequently due to reactive lymph nodes, especially when the SUVmax is <3.2. The frequency of malignant cervical lymph nodes is higher in PTLD patients compared with other groups. (orig.)

Tumor grade-related thallium-201 uptake in chondrosarcomas

International Nuclear Information System (INIS)

Kaya, G.C.; Demir, Y.; Ozkal, S.

2010-01-01

Diagnosis of low-grade chondrosarcoma, especially discrimination between enchondroma and low-grade chondrosarcoma, may be difficult pathologically. The aim of this study was to evaluate the value of thallium-201 (Tl-201) scintigraphy in the diagnosis of chondrosarcoma and to investigate whether there was a correlation between Tl-201 uptake and tumor grade. We retrospectively evaluated 121 patients with pathologically proven bone and soft tissue tumors diagnosed between the years 1999 and 2007. All patients were followed by the Bone and Soft Tissue Tumor Working Group in our hospital. Twenty-three patients, mean age 44±15 (range 17-72) years, with a diagnosis of cartilaginous tumors were included. Increased Tl-201 uptake at the lesion sites greater than background was evaluated as malignant tumor. For the pathologic classification, a grading system (grade 1-3) based on the histopathologic findings was used. Pearson correlation coefficient was used to determine whether there was any correlation between Tl-201 uptake and tumor grade in chondrosarcoma. There were 7 enchondromas and 16 chondrosarcomas. Four of 16 patients with chondrosarcoma had lesions pathologically classified as grade 3, 5 as grade 2, and 7 had grade 1 chondrosarcoma. Increased Tl-201 uptake was observed in all patients with grade 3 chondrosarcoma and 2 patients with grade 2 chondrosarcoma. Of 10 patients with chondrosarcoma, 3 grade 2 chondrosarcomas and 7 grade 1 chondrosarcomas, there was no Tl-201 uptake in the tumor region. A significant correlation was found between Tl-201 uptake and tumor grade in chondrosarcoma (p=0.002, r=0.71). Only a few reports in literature have demonstrated false negative results in low-grade chondrosarcoma. Tl-201 uptake was related to tumor grade in chondrosarcoma. If there is a possibility of chondrosarcoma, Tl-201 scintigraphy should be reported with caution. (author)

Capabilities of Seven Species of Aquatic Macrophytes for Phytoremediation of Pentachlorophenol Contaminated Sediment

Science.gov (United States)

Zhao, Liangyuan; Guo, Weijie; Li, Qingyun; Li, Huan; Zhao, Weihua; Cao, Xiaohuan

2017-01-01

Sediments are regarded as the ultimate sink of pentachlorophenol(PCP) in aquatic environment, and capabilities of seven species of aquatic macrophytes for remediating PCP contaminated sediment were investigated. Seven species of aquatic macrophytes could significantly accelerate the degradation of PCP in sediments. Among all, canna indica L., Acorus calamus L. and Iris tectorum Maxim. can be used as efficient alternative plants for remediation of PCP contaminated sediment, which attained 98%, 92% and 88% of PCP removal in sediments, respectively. PCP was detected only in root tissues and the uptake was closely related to the root lipid contents of seven plants. The presence of seven aquatic macrophytes significantly increased microbial populations and the activities of dehydrogenase compared with control sediments, indicating that rhizosphere microorganism played important role in the remediation process. In conclusion, seven species of aquatic macrophytes may act as promising tools for the PCP phytoremediation in aquatic environment, especially Canna indica L., Acorus calamus L. and Iris tectorum Maxim.

Factors affecting gastric uptake in whole body FDG-PET imaging

International Nuclear Information System (INIS)

Tomemori, Takashi; Kitagawa, Mami; Nakahara, Tadaki; Wu, Jin; Nakagawa, Keiichi; Uno, Kimiichi; Abe, Kinji; Tomiyoshi, Katsumi

2001-01-01

Positron emission tomography (PET) using 2-deoxy-2-[ 18 F]-fluoro-D-glucose (FDG) is very useful for the detection and staging of tumors. However, FDG is also accumulated in the normal tissues in various degrees. This physiological FDG uptake is often seen in intestine, making confusion with malignant tumor. The aim of this study was to identify factors influencing physiological FDG uptake in the stomach. A total of 136 people who underwent cancer screening or staging of tumors except for gastric cancer using FDG whole-body PET was examined (mean age: 55.6 yrs). All subjects fasted for at least 4 hours before the PET study and were administrated with FDG intravenously (mean FDG dose: 308.9 MBq). Emission images were acquired on a whole-body PET scanner and images were reconstructed without attenuation correction. The intensity of gastric uptake of FDG whole-body PET image was visually classified into 3 grades; grade 2 = the intensity of gastric uptake more than pulmonary uptake, grade 1 = the intensity of gastric uptake equal to or less than pulmonary uptake, grade 0 = no contrast between gastric uptake and background. Twenty-eight subjects (20.6%) were classified into grade 2, 42 subjects (30.9%) were grade 1 and 66 subjects (48.5%) were grade 0. Subjects' age, fasting time, FDG dose, serum glucose level, free fatty acid level and insulin level were not significantly correlated with the intensity of gastric uptake. But the subjects with higher gastric uptake tended to have anti-Helicobactor pylori (H. pylori) antibodies. The rate of having anti-H.pylori antibodies in the grade 2 group is significantly higher than the grade 1 group (85.7% vs. 72.5%, p<0.05), and that of the grade 1 group is significantly higher than the grade 0 group (72.5% vs. 42.2%, p<0.01). Gastric uptake was observed in about half of subjects. Especially, approximately 20% of all showed high gastric uptake, which was associated with H.pylori infection. Therefore, most of the subjects with high

Factors affecting gastric uptake in whole body FDG-PET imaging

Energy Technology Data Exchange (ETDEWEB)

Tomemori, Takashi; Kitagawa, Mami; Nakahara, Tadaki; Wu, Jin; Nakagawa, Keiichi; Uno, Kimiichi; Abe, Kinji; Tomiyoshi, Katsumi [Nishidai Clinic Diagnostic Imaging Center, Tokyo (Japan)

2001-06-01

Positron emission tomography (PET) using 2-deoxy-2-[{sup 18}F]-fluoro-D-glucose (FDG) is very useful for the detection and staging of tumors. However, FDG is also accumulated in the normal tissues in various degrees. This physiological FDG uptake is often seen in intestine, making confusion with malignant tumor. The aim of this study was to identify factors influencing physiological FDG uptake in the stomach. A total of 136 people who underwent cancer screening or staging of tumors except for gastric cancer using FDG whole-body PET was examined (mean age: 55.6 yrs). All subjects fasted for at least 4 hours before the PET study and were administrated with FDG intravenously (mean FDG dose: 308.9 MBq). Emission images were acquired on a whole-body PET scanner and images were reconstructed without attenuation correction. The intensity of gastric uptake of FDG whole-body PET image was visually classified into 3 grades; grade 2 = the intensity of gastric uptake more than pulmonary uptake, grade 1 = the intensity of gastric uptake equal to or less than pulmonary uptake, grade 0 = no contrast between gastric uptake and background. Twenty-eight subjects (20.6%) were classified into grade 2, 42 subjects (30.9%) were grade 1 and 66 subjects (48.5%) were grade 0. Subjects' age, fasting time, FDG dose, serum glucose level, free fatty acid level and insulin level were not significantly correlated with the intensity of gastric uptake. But the subjects with higher gastric uptake tended to have anti-Helicobactor pylori (H. pylori) antibodies. The rate of having anti-H.pylori antibodies in the grade 2 group is significantly higher than the grade 1 group (85.7% vs. 72.5%, p<0.05), and that of the grade 1 group is significantly higher than the grade 0 group (72.5% vs. 42.2%, p<0.01). Gastric uptake was observed in about half of subjects. Especially, approximately 20% of all showed high gastric uptake, which was associated with H.pylori infection. Therefore, most of the subjects

Scalene muscle uptake: a potential pitfall in head and neck PET/CT

International Nuclear Information System (INIS)

Jacene, Heather A.; Goudarzi, Behnaz; Wahl, Richard L.

2008-01-01

To describe increased 2-deoxy-2-[ 18 F] fluoro-D-glucose (FDG) uptake in the scalene muscles in a large population of patients referred for evaluation with FDG positron emission tomography/computed tomography (PET/CT) imaging. The study met criteria for institutional review board exemption. FDG PET/CT images from 410 patients (179 males; mean age 56.8 years, range 6-88) were retrospectively reviewed for the presence or absence of FDG uptake in the neck that corresponded to the scalene muscles on the concurrent CT scan. Medical records were reviewed and data including age, sex, smoking history, reason for referral, and history of obstructive airways disease, thoracotomy, and thoracic radiation were recorded and evaluated. One hundred and forty-seven of the 410 scans (36%) demonstrated increased FDG uptake on PET that corresponded to the scalene muscles on the CT scan. The uptake was most often bilateral, symmetrical, and linear (n = 117). Other patterns of scalene muscle uptake included unilateral and linear uptake (n = 27) and unilateral and focal uptake (n = 3). Scalene muscle uptake was more common in patients referred for evaluation of lung carcinomas compared to other types of tumors (52% vs. 32%, p = 0.05). Linear FDG uptake in scalene muscles is a commonly seen pattern on PET/CT. This finding should be recognized as a distinct entity and not misinterpreted on transverse images as metastatic disease. (orig.)

Variation in calculated human exposure. Comparison of calculations with seven European human exposure models

NARCIS (Netherlands)

Swartjes F; ECO

2003-01-01

Twenty scenarios, differing with respect to land use, soil type and contaminant, formed the basis for calculating human exposure from soil contaminants with the use of models contributed by seven European countries (one model per country). Here, the human exposures to children and children

Therapeutic implications of thymic uptake of radioiodine in thyroid carcinoma

International Nuclear Information System (INIS)

Wilson, L.M.; Barrington, S.F.; Kettle, A.G.; O'Doherty, M.J.; Coakley, A.J.; Morrison, I.D.

1998-01-01

The management of 38 consecutive patients with differentiated thyroid carcinoma in the period 1991-1996, who each received at least one therapy dose of iodine-131, was reviewed, looking in particular at those in whom anterior mediastinal uptake was demonstrated on scans taken 3 and 7 days post-therapy. Such activity was noted in ten patients. On the basis of clinical follow-up, thyroglobulin measurement and radiological and other scintigraphic imaging, in nine of the ten patients the anterior mediastinal activity was attributed to physiological thymic uptake. Of those nine, all were under 50 years of age; seven were considered disease free, one had residual disease in the neck and one had distant metastases. Physiological uptake by the thymus was more prominent on the 7-day scans and in patients with low tumour volumes. For appropriate patient management it is essential to recognise that physiological uptake of 131 I by the thymus in patients under 50 years of age is a potential cause of false-positive therapy scans. (orig.)

The value of FDG-PET in patients with painful total knee arthroplasty

Energy Technology Data Exchange (ETDEWEB)

Stumpe, Katrin D.M.; Schulthess, Gustav K. von; Strobel, Klaus [University Hospital, Department of Medical Radiology, Division of Nuclear Medicine, Zurich (Switzerland); Romero, Jose [Orthopaedic University Hospital Balgrist, Orthopaedic Surgery, Zurich (Switzerland); Center for Joint Diseases at Hirslanden Clinic, EndoClinic Zurich, Zurich (Switzerland); Ziegler, Oliver [Orthopaedic University Hospital Balgrist, Orthopaedic Surgery, Zurich (Switzerland); Ortho Zentrum Rosenheim, Rosenheim (Germany); Kamel, Ehab M. [University Hospital, Department of Medical Radiology, Division of Nuclear Medicine, Zurich (Switzerland); Centre Hospitalier Universitaire Vaudois (CHUV), Division of Nuclear Medicine, Lausanne (Switzerland); Hodler, Juerg [Orthopaedic University Hospital Balgrist, Department of Radiology, Zurich (Switzerland)

2006-10-15

The purpose of this study was to evaluate{sup 18}F-fluorodeoxyglucose (FDG) uptake in patients with painful total knee arthroplasty and to relate FDG uptake to the location of soft tissue pain. Twenty-eight patients with painful total knee arthroplasty had a clinical examination, standard radiographs, CT measurement of rotation of the femoral component and FDG-PET (18 PET/CT, 10 PET). The diagnosis of infection was based on microbiological examinations of surgical specimens (n=12) or clinical follow-up for at least 6 months (n=16),{sup 99m}Tc-labelled monoclonal antibody scintigraphy and joint aspiration. Twenty-seven of 28 patients presented with diffuse synovial FDG uptake. Additional focal extrasynovial FDG uptake was observed in 19 knees. Twenty-four of the 28 patients had a diagnosis of internal femoral malrotation. The remaining four patients showed no rotation (0 ) and 3 , 4 and 7 of external rotation, respectively. Three patients presented with the additional diagnosis of an infected total knee replacement. Pain was described as diffuse (n=10) or focal (n=18). In two knees a relationship between pain location and FDG uptake was observed. Of ten patients with a severe internal femoral component rotation (>6 ), seven had focal uptake, four in the femoral periosteum and three in the tibial periosteum. The difference between knees with severe malrotation and the remaining knees was not significant (p=1.000, Fisher's Exact Test). Diffuse synovial and focal extrasynovial FDG-PET uptake is commonly found in patients with malrotation of the femoral component and is not related to pain location. The information provided by FDG-PET does not contribute to the diagnosis and management of individual patients with persistent pain after total knee replacement. (orig.)

The value of FDG-PET in patients with painful total knee arthroplasty

International Nuclear Information System (INIS)

Stumpe, Katrin D.M.; Schulthess, Gustav K. von; Strobel, Klaus; Romero, Jose; Ziegler, Oliver; Kamel, Ehab M.; Hodler, Juerg

2006-01-01

The purpose of this study was to evaluate 18 F-fluorodeoxyglucose (FDG) uptake in patients with painful total knee arthroplasty and to relate FDG uptake to the location of soft tissue pain. Twenty-eight patients with painful total knee arthroplasty had a clinical examination, standard radiographs, CT measurement of rotation of the femoral component and FDG-PET (18 PET/CT, 10 PET). The diagnosis of infection was based on microbiological examinations of surgical specimens (n=12) or clinical follow-up for at least 6 months (n=16), 99m Tc-labelled monoclonal antibody scintigraphy and joint aspiration. Twenty-seven of 28 patients presented with diffuse synovial FDG uptake. Additional focal extrasynovial FDG uptake was observed in 19 knees. Twenty-four of the 28 patients had a diagnosis of internal femoral malrotation. The remaining four patients showed no rotation (0 ) and 3 , 4 and 7 of external rotation, respectively. Three patients presented with the additional diagnosis of an infected total knee replacement. Pain was described as diffuse (n=10) or focal (n=18). In two knees a relationship between pain location and FDG uptake was observed. Of ten patients with a severe internal femoral component rotation (>6 ), seven had focal uptake, four in the femoral periosteum and three in the tibial periosteum. The difference between knees with severe malrotation and the remaining knees was not significant (p=1.000, Fisher's Exact Test). Diffuse synovial and focal extrasynovial FDG-PET uptake is commonly found in patients with malrotation of the femoral component and is not related to pain location. The information provided by FDG-PET does not contribute to the diagnosis and management of individual patients with persistent pain after total knee replacement. (orig.)

In vivo hypertensive arterial wall uptake of radiolabeled liposomes

International Nuclear Information System (INIS)

Hodis, H.N.; Amartey, J.K.; Crawford, D.W.; Wickham, E.; Blankenhorn, D.H.

1990-01-01

Using five sham-operated and seven aortic coarctation-induced hypertensive New Zealand White rabbits intravenously injected with neutral small unilamellar vesicles loaded with [111In]nitrilotriacetic acid, we demonstrated in vivo that the normal aortic arterial wall participates in liposome uptake and that this uptake is increased in the hypertensive aortic wall by approximately threefold (p less than or equal to 0.0001). Among the three regions examined, aortic arch, thoracic aorta, and lower abdominal aorta, the difference in uptake between the normotensive and hypertensive arterial walls was significantly different, p less than or equal to 0.05, p less than or equal to 0.0001, and p less than 0.05, respectively. The uptake by the different regions of the hypertensive arterial wall is consistent with the pathological changes present in these areas. Furthermore, the extent of liposome uptake by the aortic wall is strongly correlated with the height of the blood pressure (r = 0.85, p = 0.001, n = 11). We conclude that neutral small unilamellar liposomes can be used to carry agents into the arterial wall in vivo in the study of hypertensive vascular disease and could be especially useful for the delivery of pharmacologically or biologically active agents that would otherwise be inactivated within the circulation or are impermeable to the arterial wall

New Korean Record of Twenty Eight Species of the Family Ichneumonidae (Hymenoptera

Directory of Open Access Journals (Sweden)

Choi, Jin-Kyung

2014-04-01

Full Text Available We report twenty eight ichneumonid species new to Korea. These species belong to seven subfamilies. Among them five subfamilies, Diacritinae Townes, 1965, Microleptinae Townes, 1958, Orthocentrinae F$\\ddot{o} $ 수식 이미지rster, 1869, Orthopelmatinae Schmiedeknecht, 1910, Phrudinae Townes and Townes, 1949, are newly introduced to Korean fauna. All specimens are based on the insect collection of animal systematic laboratory at the Yeungnam University Gyeongsan Campus. Photographs of habitus of newly recorded subfamilies, diagnosis of 28 species and host information are provided.

Patchy uptake of gallium in the lungs of AIDS patients with atypical mycobacterial infection

International Nuclear Information System (INIS)

Skarzynski, J.J.; Sherman, W.; Lee, H.K.; Berger, H.

1987-01-01

The gallium scans of seven AIDS patients who cultured positive for atypical mycobacterium were reviewed. Six cultured positive for Mycobacterium avium intracellulare, while one for Mycobacterium xenopi. A patchy uptake pattern of gallium in the lungs of these patients was identified

Nike Twins Seven Seven: Nigerian Batik Artist.

Science.gov (United States)

LaDuke, Betty

1987-01-01

Chronicles the personal and professional life of Nike Twins Seven Seven (born 1951), a Nigerian batik artist, and her husband, Twins Seven Seven, a musician-artist, both of whom have received international acclaim. (BJV)

Quantitative clinical uptake measurements using conjugate counting

International Nuclear Information System (INIS)

Lathrop, K.A.; Bartlett, R.D.; Chen, C.T.; Chou, J.S.; Faulhaber, P.F.; Harper, P.V.; Stark, V.J.

1986-01-01

While the use of conjugate counting for determination of organ uptake in human subjects has been extensively described, in the present study the determination of the organ uptake of ortho-iodohippurate presented several opportunities for validation of the in vivo counting data. Ortho-iodohippurate is distributed in the extracellular space, is largely extracted on each pass through the kidneys, and is not significantly deiodinated in vivo. Thus, the kidney uptake rate should be proportional to the blood level, the appearance rate of activity in the bladder is equal to the disappearance rate from the kidneys, and direct measurement of activity in the urine after voiding provides an internal standard for imaging measurements of bladder activity. Since the activity levels in the kidneys, bladder, and remainder of the body changed fairly rapidly, especially in the first 20 to 30 minutes following injection, posterior images of the trunk including kidneys and bladder were obtained continuously using a gamma camera fitted with a diverging collimator for 30 minutes and then at intervals for several hours. Simultaneous conjugate counting determinations were made using a whole body scanning system previously described at these meetings. Imaging data corrected for decay and adjacent background were fitted by least squares methods to curves representing a sum of exponentials, and the curves were normalized to the conjugate uptake measurements. The uptake curves of the kidneys and bladder matched well with the direct measurements of the urinary excretion. Data were collected in 16 normal subjects, and the estimated absorbed dose was calculated for the kidneys, the bladder and the remainder of the body for seven radioisotopes of iodine. 4 references, 6 figures, 2 tables

Enhancement of radioiodine uptake in hyperthyroidism with hydrochlorothiazide: a prospective randomised control study

Energy Technology Data Exchange (ETDEWEB)

Tepmongkol, Supatporn [Division of Nuclear Medicine, Department of Radiology, Faculty of Medicine, Chulalongkorn University, Bangkok 10330 (Thailand)

2002-10-01

The aim of this study was to determine whether hydrochlorothiazide (HCTZ) could improve radioiodine uptake in low-uptake hyperthyroid patients. Eighteen hyperthyroid patients with low 3-h and 24-h iodine-131 uptake were recruited to the study. Eleven patients were assigned to the HCTZ group, and seven to the control group. Two weeks after the first, baseline uptake study, a second uptake study was performed. Patients in both groups had a low-iodine diet after the first uptake study. In the HCTZ group, 50 mg of HCTZ was administered twice a day for 5 days prior to the second uptake study. Improvement in uptake at 3 and 24 h in the second uptake study, as compared with the baseline study, was assessed within and between groups. In the control group, compared with the baseline study there was a significant improvement in uptake at 3 h (P=0.03) but a non-significant improvement at 24 h (P=0.07). In the HCTZ group, significant improvements were observed at both 3 h (P=0.0005) and 24 h (P=2.28 x 10{sup -5}). Patients in the HCTZ group had statistically greater improvement in uptake at both 3 h and 24 h compared with the control group (P=0.003 and 0.0008, respectively). There was a 7.18-fold average improvement in uptake in the HCTZ group at 24 h, compared with only a 1.33-fold improvement in the control group. Administration of HCTZ significantly improves 24-h radioiodine uptake in high-iodide pool, low-uptake hyperthyroid patients compared with patients who have received a low-iodine diet alone. (orig.)

Deuterium oxide normalizes blood pressure and vascular calcium uptake in Dahl salt-sensitive hypertensive rats

International Nuclear Information System (INIS)

Vasdev, S.; Prabhakaran, V.; Sampson, C.A.

1990-01-01

This study examined the effect of 25% deuterium oxide in drinking water on systolic blood pressure, uptakes of calcium, and rubidium 86 by aortas of Dahl salt-sensitive rats on 0.4% (low) and 8% (high) sodium chloride (salt) diet. Twenty-four rats were divided into four groups. Groups I and II were on the low salt diet and groups III and IV on the high salt diet from 6 weeks of age. Additionally, at 10 weeks of age groups I and III were placed on 100% water and groups II and IV on 25% deuterium oxide. At 14 weeks, systolic blood pressure, uptakes of calcium, and rubidium 86 by aortas were significantly higher (p less than 0.01) in rats on the high salt diet as compared with those on the low salt diet. Deuterium oxide intake normalized systolic blood pressure and aortic calcium uptake but not aortic rubidium 86 uptake in hypertensive rats on the high salt diet. Deuterium oxide had no effect on blood pressure or aortic calcium uptake in rats on the low salt diet. The parallel increase in systolic blood pressure and vascular calcium uptake suggests that increased calcium uptake mechanisms are associated with hypertension in salt-sensitive Dahl rats. Furthermore, deuterium oxide appears to normalize elevated blood pressure in salt-sensitive hypertensive rats by normalizing elevated vascular (aortic) calcium uptake

Concentration of radionuclides in uranium tailings and its uptake by plants at Jaduguda, Jharkhand, India

International Nuclear Information System (INIS)

Singh, Lal; Soni, Prafulla

2010-01-01

Mining and processing of uranium ore was started in several parts of eastern Singhbhum, viz. Jaduguda, Bhatin and Narwapahar (Jharkhand) in 1968. Radioactivity in the mine tailings has to be consolidated so that it does not emanate in the atmosphere or enter the food chain. Hence, the area has been covered with 30 cm thick soil cover followed by development of plant species that do not have any socioeconomic relevance in the area. Seven native plant species of forestry origin, viz. Colebrookea oppositifolia, Dodonaea viscosa, Furcraea foetida, Imperata cylindrica, Jatropha gossypifolia, Pogostemon benghalense and Saccharum spontaneum have been selected for experimental trials. Distribution and concentration of radionuclides have been evaluated in a tailing pond at different depths in soil and tailings. Radionuclide uptake in each of the selected plant species has been evaluated and discussed in this article. The highest concentration of radionuclides has been found in tailings > soil cover on tailings > roots of selected plant species > shoots of all the selected species. These results show that among the seven species tried, J. gossypifolia and F. foetida have the lowest uptake (below detectable limits), while S. spontaneum and P. benghalense have comparatively higher uptake. However, radionuclide concentration in all the tried species is significantly low compared to species of natural occurrence which have higher radionuclides uptake and accumulation. (author)

Concentration of radionuclides in uranium tailings and its uptake by plants at Jaduguda, Jharkhand, India

Energy Technology Data Exchange (ETDEWEB)

Singh, Lal; Soni, Prafulla [Ecology and Environment Div., Forest Research Institute, Dehradun (India)

2010-01-10

Mining and processing of uranium ore was started in several parts of eastern Singhbhum, viz. Jaduguda, Bhatin and Narwapahar (Jharkhand) in 1968. Radioactivity in the mine tailings has to be consolidated so that it does not emanate in the atmosphere or enter the food chain. Hence, the area has been covered with 30 cm thick soil cover followed by development of plant species that do not have any socioeconomic relevance in the area. Seven native plant species of forestry origin, viz. Colebrookea oppositifolia, Dodonaea viscosa, Furcraea foetida, Imperata cylindrica, Jatropha gossypifolia, Pogostemon benghalense and Saccharum spontaneum have been selected for experimental trials. Distribution and concentration of radionuclides have been evaluated in a tailing pond at different depths in soil and tailings. Radionuclide uptake in each of the selected plant species has been evaluated and discussed in this article. The highest concentration of radionuclides has been found in tailings > soil cover on tailings > roots of selected plant species > shoots of all the selected species. These results show that among the seven species tried, J. gossypifolia and F. foetida have the lowest uptake (below detectable limits), while S. spontaneum and P. benghalense have comparatively higher uptake. However, radionuclide concentration in all the tried species is significantly low compared to species of natural occurrence which have higher radionuclides uptake and accumulation. (author)

Influence of salinity on uptake rate and bioaccumulation of /sup 137/Cs in the oyster crassostrea glomerata

International Nuclear Information System (INIS)

Mashiatullah, A.; Qureshi, R.M.; Khan, S.; Chaghtai, F.; Akhter, P.; Jabbar, A.

2008-01-01

This paper describes results of experiment on bioaccumulation and uptake rate of radiocesium /sup 137/Cs from dissolved phase in the flesh of the Oysters (Crassostrea glomerata) collected off Karachi coast. A radiotracer experiment was conducted under laboratory conditions to determine the uptake rate and bioaccumulation of /sup 137/Cs from dissolved phase in the flesh of the Oyster. Oysters (size: 6-7 cm) were subjected to radiocesium activity of 24 Kilobecquerel per liter (kBq L/sup -1/) under three salinity Ievels (25, 30 and 35 ppt). The uptake of /sup 137/Cs was monitored for a period of seven days. The results showed that bioaccumulation and uptake of /sup 137/Cs in oysters were considerably dependent of salinity levels. Higher bioaccumulation factors and uptake rates were found at low salinity levels. (author)

Age-related normal uptake of 99mTc-MDP in the lower spine

International Nuclear Information System (INIS)

Sundkvist, G.M.G.; Lilja, B.; Mattsson, S.

1997-01-01

Aim: The uptake of 99m Tc-MDP in the lower spine was quantified in connection with ordinary bone scintigraphy. Methods: Fifty-seven women and seventy-two men (aged 20-69 y), with no signs of metabolic or malignant disease and no history of back pain or atraumatic fractures, were included in the study. Results: The women showed an increase in 99m Tc-MDP uptake from the age of 20 y to about 45 y with a decrease from the time of menopause. In contrast to women, the uptake in men showed a slight decrease from the age of 20 y to about 50 y and thereafter a more marked decrease was seen. The major difference between men and women is the high premenopausal uptake in the female skeleton. Conclusion: An understanding of age-related changes in 99m Tc-MDP uptake, which are indices of the skeletal metabolism, is of importance especially in prevention and treatment of osteoporosis, a common disorder in postmenopausal women. (orig.) [de

Muscle, skin and core temperature after -110°c cold air and 8°c water treatment.

Science.gov (United States)

Costello, Joseph Thomas; Culligan, Kevin; Selfe, James; Donnelly, Alan Edward

2012-01-01

The aim of this investigation was to elucidate the reductions in muscle, skin and core temperature following exposure to -110°C whole body cryotherapy (WBC), and compare these to 8°C cold water immersion (CWI). Twenty active male subjects were randomly assigned to a 4-min exposure of WBC or CWI. A minimum of 7 days later subjects were exposed to the other treatment. Muscle temperature in the right vastus lateralis (n=10); thigh skin (average, maximum and minimum) and rectal temperature (n=10) were recorded before and 60 min after treatment. The greatest reduction (P<0.05) in muscle (mean ± SD; 1 cm: WBC, 1.6 ± 1.2°C; CWI, 2.0 ± 1.0°C; 2 cm: WBC, 1.2 ± 0.7°C; CWI, 1.7 ± 0.9°C; 3 cm: WBC, 1.6 ± 0.6°C; CWI, 1.7 ± 0.5°C) and rectal temperature (WBC, 0.3 ± 0.2°C; CWI, 0.4 ± 0.2°C) were observed 60 min after treatment. The largest reductions in average (WBC, 12.1 ± 1.0°C; CWI, 8.4 ± 0.7°C), minimum (WBC, 13.2 ± 1.4°C; CWI, 8.7 ± 0.7°C) and maximum (WBC, 8.8 ± 2.0°C; CWI, 7.2 ± 1.9°C) skin temperature occurred immediately after both CWI and WBC (P<0.05). Skin temperature was significantly lower (P<0.05) immediately after WBC compared to CWI. The present study demonstrates that a single WBC exposure decreases muscle and core temperature to a similar level of those experienced after CWI. Although both treatments significantly reduced skin temperature, WBC elicited a greater decrease compared to CWI. These data may provide information to clinicians and researchers attempting to optimise WBC and CWI protocols in a clinical or sporting setting.

Muscle, skin and core temperature after -110°c cold air and 8°c water treatment.

Directory of Open Access Journals (Sweden)

Joseph Thomas Costello

Full Text Available The aim of this investigation was to elucidate the reductions in muscle, skin and core temperature following exposure to -110°C whole body cryotherapy (WBC, and compare these to 8°C cold water immersion (CWI. Twenty active male subjects were randomly assigned to a 4-min exposure of WBC or CWI. A minimum of 7 days later subjects were exposed to the other treatment. Muscle temperature in the right vastus lateralis (n=10; thigh skin (average, maximum and minimum and rectal temperature (n=10 were recorded before and 60 min after treatment. The greatest reduction (P<0.05 in muscle (mean ± SD; 1 cm: WBC, 1.6 ± 1.2°C; CWI, 2.0 ± 1.0°C; 2 cm: WBC, 1.2 ± 0.7°C; CWI, 1.7 ± 0.9°C; 3 cm: WBC, 1.6 ± 0.6°C; CWI, 1.7 ± 0.5°C and rectal temperature (WBC, 0.3 ± 0.2°C; CWI, 0.4 ± 0.2°C were observed 60 min after treatment. The largest reductions in average (WBC, 12.1 ± 1.0°C; CWI, 8.4 ± 0.7°C, minimum (WBC, 13.2 ± 1.4°C; CWI, 8.7 ± 0.7°C and maximum (WBC, 8.8 ± 2.0°C; CWI, 7.2 ± 1.9°C skin temperature occurred immediately after both CWI and WBC (P<0.05. Skin temperature was significantly lower (P<0.05 immediately after WBC compared to CWI. The present study demonstrates that a single WBC exposure decreases muscle and core temperature to a similar level of those experienced after CWI. Although both treatments significantly reduced skin temperature, WBC elicited a greater decrease compared to CWI. These data may provide information to clinicians and researchers attempting to optimise WBC and CWI protocols in a clinical or sporting setting.

RT-PCR for detection of all seven genotypes of Lyssavirus genus.

Science.gov (United States)

Vázquez-Morón, S; Avellón, A; Echevarría, J E

2006-08-01

The Lyssavirus genus includes seven species or genotypes named 1-7. Rabies genotypes correlate with geographical distribution and specific hosts. Co-circulation of different lyssaviruses, imported cases, and the presence of unknown viruses, such as Aravan, Khujand, Irkut and West Caucasian Bat Virus, make it necessary to use generic methods able to detect all lyssaviruses. Primer sequences were chosen from conserved regions in all genotypes in order to optimise a generic RT-PCR. Serial dilutions of 12 RNA extracts from all seven Lyssavirus genotypes were examined to compare the sensitivity of the RT-PCR standardised in this study with a published RT-PCR optimised for EBLV1 detection and capable of amplifying RNA from all seven lyssaviruses. All seven genotypes were detected by both RT-PCRs, however, the sensitivity was higher with the new version of the test. Twenty samples submitted for rabies diagnosis were tested by the new RT-PCR. Eight out of 20 samples from six dogs, one horse and one bat were found positive, in agreement with immunofluorescence results. Seven samples from terrestrial mammals were genotype 1 and one from a bat was genotype 5. In conclusion, this method can be used to complement immunofluorescence for the diagnosis of rabies, enabling the detection of unexpected lyssaviruses during rabies surveillance.

An Empirical Comparison of Seven Iterative and Evolutionary Function Optimization Heuristics

Science.gov (United States)

Baluja, Shumeet

1995-01-01

This report is a repository of the results obtained from a large scale empirical comparison of seven iterative and evolution-based optimization heuristics. Twenty-seven static optimization problems, spanning six sets of problem classes which are commonly explored in genetic algorithm literature, are examined. The problem sets include job-shop scheduling, traveling salesman, knapsack, binpacking, neural network weight optimization, and standard numerical optimization. The search spaces in these problems range from 2368 to 22040. The results indicate that using genetic algorithms for the optimization of static functions does not yield a benefit, in terms of the final answer obtained, over simpler optimization heuristics. Descriptions of the algorithms tested and the encodings of the problems are described in detail for reproducibility.

The effect of newer water-soluble contrast media on I-131 uptake by the thyroid gland

International Nuclear Information System (INIS)

Starinsky, R.; Horne, T.; Barr, J.; Ramot, Y.

2006-01-01

The aim of this study was to evaluate the effect of two water-soluble contrast media (nonionic and Dimer) on iodine uptake by the thyroid gland. Twenty-eight euthyroid patients (16 females and 12 males) were subjected to 24hrs radioiodine uptake (RAIU) studies following brain CT examinations using the above cited two water-soluble contrast media. Radioiodine uptake studies were done at one (Group-1), two (Group-2) and four (Group-3) weeks following performance of contrast enhanced CT scans. The effect of both contrast media on the thyroid uptake was found to be identical. The radio active iodine uptake (RAIU) was observed to be suppressed in 30% of patients in Group-1, 33% of patients in Group-2 and in none of the patients belonging to Group-3. On the basis of this pilot study on a limited number of patients it was concluded that dimer and non-ionic water soluble contrast media cause suppression of radio iodine uptake by the thyroid gland in a significant proportion of patients. It has also been observed that both contrast media have similar suppressive effects on radio iodine uptake by the thyroid gland. This effect is transient and does not persist beyond a period of four weeks following the administration of the contrast media. (author)

Utility of bone SPECT in temporomandibular joint pain

International Nuclear Information System (INIS)

Yang, Dong Hunn; Sung, Mi Sook; Lee, Jung Whee; Chung, Soo Kyo; Shinn, Kyung Sub

1997-01-01

Temporomandibular (TM) joint pain results from many etiologic factors. The aim of this study was to evaluate the utility of Bone SPECT in patients with TM joint pain. The subjects were 34 patients with TM joint pain. All patients underwent plain radiography, planar bone scan, and Bone SPECT. The intensity of radioisotope uptake at TM joint was graded into three; no increased uptake above the background activity as grade 0, uptake similar to occipital bone as grade I, and uptake similar to maxillary sinus as grade II. Clinical findings and therapeutic methods were reviewed. Twenty-seven patients (80%) out of 34 patients with TM joint pain had increased uptake in bone SPECT. Twenty-one (78%) out of 27 patients had increased uptake in the mandibular condyle and remaining six patients (22%) had uptake in the mandibular and maxillary arch, which proved to be dental problem. Seven patients (21%) out of 34 were grade as 0, four (12%) were grade I, 23 (68%) were grade. II. Four patients with grade I had clicking sound and symptoms which were subsided with medication in all cases. Among 23 patients with grade II, 7 patients had clicking sound and 14 patients underwent medication and decompression therapy. With Planar bone scan, 11 cases (32%) had increased uptake in TM joint area. Plain radiography revealed narrowing, distension, erosion and limitation of TM joint in 16 cases (47%). Bone SPECT can be valuable for screening and managing the patients with TM joint pain. Patients with grade II needed intensive treatment such as joint aspiration. However degree of the radioisotope uptake did not well correlated with clinical symptoms

Effect of tonicity on 22NaCl solution uptake by rabbit eye in vivo and in vitro

International Nuclear Information System (INIS)

Obenberger, J.; Bartosova, D.; Babicky, A.

1979-01-01

Solutions of 22 NaCl in saline or distilled water differ with respect to their ocular uptake. Studies were performed on eyes of living rabbits as well on the enucleated rabbit eyes. Chromatographic paper strips (15x2 mm) were soaked in both solutions, stretched over the cornea and left in contact for 1 min. Radioactivities of paper strips and rabbit eyes were measured and the ocular uptake of 22 Na was expressed as percentual values of the total radioactivities contained in the paper strips before their application to the corneal surface. Values of the ocular uptake of 22 NaCl solved in distilled water exceeded more than twice the values found in experiments where 22 Na solution in saline was used. The use of carrier-free 22 NaCl solutions in distilled water is recommended for the method measuring the ocular uptake hydrodynamics on basis of ocular 22 Na clearance. Uptake of 22 Na in enucleated eyes was twenty-five per cent higher in comparison with the eyes of living rabitts. (author)

/sup 86/Rb uptake of various organs of the spontaneously hypertensive rats

Energy Technology Data Exchange (ETDEWEB)

Nakamura, M; Kuroiwa, A; Nakagaki, O; Tomoike, H; Nose, Y [Kyushu Univ., Fukuoka (Japan). Faculty of Medicine

1975-03-01

Twenty spontaneously hypertensive rats (SHR) and 20 control rats were used for the measurement of Rb/sup 86/ uptake by various organs. Hemodynamic measurements, and the heart weight to body weight ratio showed a significant and sustained hypertension with an increased heart rate in SHR. The ratio of the Rb/sup 86/ uptake in the kidney, brain, liver, adrenal gland, pancreas, and spleen to that in the right ventricle (RV) was smaller in SHR than it was in the control rats. The ratio of the Rb/sup 86/ uptake of the inner layer to the outer layer of the left ventricle (LV), which represents distribution of blood flow to the endocardial layer and epicardial layer, showed no difference between SHR and the control rats. The regional flow fraction in the outer and inner cortex, juxtamedulla, and medulla of the kidney showed no difference between SHR and the control. The present preliminary study suggests that the myocardial blood flow in SHR is greater than that in the control rats. The relationship between cardiac hypertrophy and myocardial flow was discussed.

Frequency and severity of transfusion-related acute lung injury--German haemovigilance data (2006-2007).

Science.gov (United States)

Keller-Stanislawski, B; Reil, A; Günay, S; Funk, M B

2010-01-01

In an observational cohort study (2006-2007) the Paul-Ehrlich-Institut collected epidemiological data to investigate the frequency and causes of TRALI. Diagnosis of TRALI was confirmed according to criteria of the European Haemovigilance Network. Subsequent testing of white blood cell antibodies (WBC-Ab) against HLA or human neutrophil alloantigens was performed. Of a total of 187 reported TRALI cases, 44 could be confirmed consisting of 35 cases of antibody-mediated TRALI and nine cases of non-immune-mediated TRALI. Eight of 44 affected patients (18%) had a fatal outcome, seven cases with WBC-Ab positive plasma donors and one case with red blood cell donors. WBC antibodies were found in one male and 39 female donors. In 34 female donors, a history of pregnancy was confirmed. WBC-Ab positive donors presented four HLA class I antibodies, 15 HLA class II antibodies, 13 HLA class I and class II antibodies, one HNA-2a, and seven HNA-3a antibodies. WBC antibodies matching with recipient antigens were found exclusively in 28 female donors; 26 FFP donors, one platelet donor and one red blood cell donor. Reporting frequency of immune-mediated TRALI was 1:66,000 for fresh frozen plasma, 1:2.86 million for red blood cell concentrates and 1:420,000 for platelet concentrates. Reporting frequency of TRALI-related fatalities was 1:285,000 for FFP. Haemovigilance data show the significance of female donors with a history of pregnancy for the development of antibody-mediated TRALI. Manufacturing of FFP from male plasma and female donor screening for WBC-Ab could represent preventive measures.

A new prognostic index - leucocyte infiltration - in human cerebral infarcts by 99Tcm-HMPAO-labelled white blood cell brain SPECT

International Nuclear Information System (INIS)

Kao, C.H.; Wang, P.Y.; Wang, Y.L.; Chang, L.; Wang, S.J.; Yeh, S.H.

1991-01-01

Twenty-six patients with acute cerebral infarction were imaged by 99 Tc m -hexamethylpropylene-amine oxime (HMPAO)-labelled white blood cell brain (Tc-WBC) single photon emission computed tomography (SPECT). The regions of interest were equally placed in the whole hemispheres of both sides with summation of all transaxial slices in the Tc-WBC SPECT. The asymmetric indices (AI) were calculated as 200 [|(right -left)|/(right + left)]. Grouping of patients with cerebral infarction was based on activities of daily living (ADL) at outcome. The results showed that the poor outcome patient group had a higher AI of Tc-WBC than that of the other patients (13.0 ± 3.0 S.E.M. versus 5.4 ± 1.0 S.E.M., and P < 0.05 by Wilcoxon rank sum test). In conclusion, the Tc-WBC SPECT may be considered as a new prognostic index to predict patient outcome in human cerebral ischaemic infarctions consistent with newly established ischaemic injury theories. (author)

Salivary steroid hormone response to whole-body cryotherapy in elite rugby players.

Science.gov (United States)

Grasso, D; Lanteri, P; Di Bernardo, C; Mauri, C; Porcelli, S; Colombini, A; Zani, V; Bonomi, F G; Melegati, G; Banfi, G; Lombardi, G

2014-01-01

Saliva represents a low stress, not-invasively collected matrix that allows steroid hormone monitoring in athletes by reflecting type, intensity and duration of exercise. Whole body cryotherapy (WBC) consists of short whole-body exposures to extremely cold air (-110° to -140°C) which, despite being initially used to treat inflammatory diseases, is currently acquiring increasing popularity in sports medicine. Cryostimulation practice is now widely accepted as an effective treatment to accelerate muscle recovery in rugby players. The aim of this work was to study the changes of steroid hormones in saliva of rugby players after both 2 and 14 consecutive WBC sessions, in order to investigate the effects of the treatment on their salivary steroid hormonal profile. Twenty-five professional rugby players, belonging to the Italian National Team, underwent a 7-day cryotherapy protocol consisting of 2 daily sessions. Saliva samples were taken in the morning prior to the start of the WBC, in the evening after the end of the second WBC, and in the morning of the day after the last WBC session. The samples were analyzed for cortisol, DHEA, testosterone and estradiol using competitive enzyme-linked immunosorbent assays. Cortisol and DHEA showed a reduction already after the 2 WBC sessions of the first day; after 14 consecutive WBC sessions cortisol, DHEA, and estradiol levels decreased, while testosterone increased as did the testosterone to cortisol ratio. These results were confirmed by the fact that the majority of subjects showed variations exceeding the critical difference (CD). In conclusion, we found that WBC acutely affects the salivary steroid hormone profile, and the results are evident already after only one twice-daily session. Most significantly, after one-week of consecutive twice-daily WBC sessions, all the hormones were modified. This is the first experimental report that links changes in the hormonal asset to WBC.

Assessment of relative individual renal function based on DMSA uptake corrected for renal size

International Nuclear Information System (INIS)

Estorch, M.; Camacho, V.; Tembl, A.; Mena, I.; Hernandez, A.; Flotats, A.; Carrio, I.; Torres, G.; Prat, L.

2002-01-01

Decreased relative renal DMSA uptake can be a consequence of abnormal kidney size, associated with normal or impaired renal function. The quantification of relative renal function based on DMSA uptake in both kidneys is an established method for the assessment of individual renal function. Aim: To assess relative renal function by means of quantification of renal DMSA uptake corrected for kidney size. Results were compared with relative renal DMSA uptake without size correction, and were validated against the absolute renal DMSA uptake. Material and Methods: Four-hundred-forty-four consecutive patients (147 adults, mean age 14 years) underwent a DMSA study for several renal diseases. The relative renal function, based on the relative DMSA uptake uncorrected and corrected for renal size, and the absolute renal DMSA uptake were calculated. In order to relate the relative DMSA uptake uncorrected and corrected for renal size with the absolute DMSA uptake, subtraction of uncorrected (SU) and corrected (SC) relative uptake percentages of each pair of kidneys was obtained, and these values were correlated to the matched subtraction percentages of absolute uptake (SA). If the individual relative renal function is normal (45%-55%), the subtraction value is less or equal to 10%. Results: In 227 patients (51%) the relative renal DMSA uptake value was normal either uncorrected or corrected for renal size (A), and in 149 patients (34%) it was abnormal by both quantification methods (B). Seventy-seven patients (15%) had the relative renal DMSA uptake abnormal only by the uncorrected method (C). Subtraction value of absolute DMSA uptake percentages was not significantly different of subtraction value of relative DMSA uptake percentages corrected for renal size when relative uncorrected uptake was abnormal and corrected normal. where * p<0.0001, and p=NS. Conclusion: When uncorrected and corrected relative DMSA uptake are abnormal, the absolute uptake is also impaired, while when

FDG uptake on PET and enhancement on CT or MRI in hepatocellular carcinoma (HCC)

International Nuclear Information System (INIS)

Ko, K. H.; Yun, M.; Kim, M. J.; Ryu, Y. H.; Lee, J. D.

2002-01-01

To correlate between FDG PET and enhancement pattern on CT and MRI and assess the factors affecting FDG uptake in HCC. Thirty seven nontreated HCC from 34 pts (M:F=30:4, mean age 53) were enrolled. All cases were histologically diagnosed and classified according to Edmonson and Steiner's grading. Tumor FDG uptake was visually assessed on a scale of 0 to 3 compared to the adjacent liver. (0 liver and 3>>liver) and was semi-quantitatively analyzed using SUV. Enhancement pattern on CT and MRI was classified into 3 groups according to signal intensity or density in arterial and portal phase (GroupI: hyperintense-hypointense, GroupII: isointense-hypointense, GroupIII: hypointense-hypointense). Tumor FDG uptake was correlated with enhancement pattern, grade, size and serum aFP level. The tumor ranged from 1.5cm to 20cm. Of the 37 cases, 19(51%) had positive FDG uptake (2 or 3), while 18(49%) were negative (0 or 1). The correlation between FDG uptake and enhancement pattern was statistically insignificant. Lower FDG uptake was associated with lower tumor grade and/or smaller tumor size (P<0.005). FDG uptake of HCC seems to be useful in predicting the differentiation of the tumor and may be prognostic. Although the significance of dynamic enhancement pattern on CT or MRI is yet controversial, it has no specific correlation with FDG uptake and grade on the tumor in this study

Value of scintigraphy in the diagnosis of infections related to continuous ambulatory peritoneal dialysis (CAPD)

International Nuclear Information System (INIS)

Soriano, A.; G-Vicence, A.M.; Torre, M. de la; Rodado, S.; Poblete, V.M.; Alcazar, R.

2002-01-01

Full text: Complications related to CAPD result in temporary or permanent discontinuation of CAPD. Approximately a 20 % of the patients on peritoneal dialysis are transferred to hemodialysis due to different complications, chief among these is peritonitis. Other complications are exit-site infections, catheter-related problems, hernias, poor ultrafiltration or clearance, etc. Although peritonitis remains the major cause of transfer to hemodialysis the accurate identification and localization the other infectious complications is necessary for their appropriate treatment. The aim of this study is to assess prospectively the value of scintigraphic with 99mTc-HMPAO labeled white blood cells (WBC) in-patients on CAPD with suspicious of infectious complications. From 1997 to 2000, 27 scintigraphies with 99mTc HMPAO labeled WBC were performed in 17 patients with suspicious of catheter related abdominal wall infection, assessed by Twardowski scale, or peritonitis. In five patients we carried out study of control after the onset of therapy to assess response. The procedure for radiolabeling WBC with 99mTc-HMPAO in our department is similar to the ISORBE consensus protocol. Planar images were obtained 30 minutes, 2 hours, and in some cases at 24 hours, after administration of 740-925 MBq of labeled WBC. Four patients with clinical evidence of peritonitis showed a diffuse uptake, in two of them we carried out scintigraphy after antibiotic therapy and we did not find abnormalities. From 18 scintigraphies with catheter-related local infection 6 showed focal uptake in patients with positive culture and pericatheter exudate. All patients with negative culture had normal scintigraphies. In 3 of them after antibiotic therapy and negative culture did not find pathologic abnormalities. Peritoneal and wall abdominal scintigraphy with WBC radiolabeling with 99mTc-HMPAO is useful method for evaluation of several CAPD-related infectious complications. (author)

Reduction of FDG uptake in brown adipose tissue in clinical patients by a single dose of propranolol

Energy Technology Data Exchange (ETDEWEB)

Soederlund, Veli [Karolinska University Hospital, Department of Radiology, Stockholm (Sweden); Larsson, Stig A. [Karolinska University Hospital, Department of Nuclear Medicine, Stockholm (Sweden); Jacobsson, Hans [Karolinska University Hospital, Department of Radiology, Stockholm (Sweden); Karolinska University Hospital, Department of Nuclear Medicine, Stockholm (Sweden)

2007-07-15

Uptake in brown adipose tissue (hibernating fat) is sometimes seen at FDG-PET examinations. Despite a characteristic appearance, this may hide clinically relevant uptake. Stimulation of the sympathetic nervous system increases glucose uptake of brown fat. We now re-examine patients with brown fat activity that could disguise tumour uptake after pre-treatment with propranolol (a non-selective {beta}-blocker) in order to reduce the uptake. Our first examinations of this kind are reported. Eleven patients with strong brown fat uptake were studied. There was a mean of 5 days (range 2-8) between the examinations. At the second examination, 80 mg of propranolol was given orally 2 h before FDG administration. In addition to visual evaluation of the brown fat uptake, SUV assessments of the uptake in brown fat, lung, heart, liver, spleen and bone marrow were made. All patients showed complete or almost complete disappearance of the brown fat activity at the second examination (p < 0.001) both upon visual evaluation and when comparing SUVs. In seven patients there was also uptake in a known or strongly suspected malignancy, which remained unchanged between the examinations. Beyond an insignificant decrease in the myocardial uptake, there was no redistribution to the various examined organs at the second examination. Pre-treatment with a single dose of propranolol blocks the FDG uptake in brown adipose tissue, thereby increasing the specificity of the examination. The tumour uptake seems not to be impaired. (orig.)

Identification and characterization of twenty-seven short ...

Indian Academy of Sciences (India)

They have been successfully applied to resolve phylo- genetic relationships among various groups at different tax- onomic ranks (Nikaido et al. 2003; Chen et al. .... nizable flanking direct repeats (DRs) that are diagnostic of amplification via RNA intermediates during retrotransposi- tion (Weiner et al. 1986; Deininger 1989) ...

Trace metal uptake by tropical vegetables grown on soil amended with urban sewage sludge

Energy Technology Data Exchange (ETDEWEB)

Nabulo, G.; Black, C.R. [School of Biosciences, University of Nottingham, University Park, Nottingham, NG7 2RD (United Kingdom); Young, S.D., E-mail: scott.young@nottingham.ac.u [School of Biosciences, University of Nottingham, University Park, Nottingham, NG7 2RD (United Kingdom)

2011-02-15

Trace metal uptake was measured for tropical and temperate leafy vegetables grown on soil from an urban sewage disposal farm in the UK. Twenty-four leafy vegetables from East Africa and the UK were assessed and the five vegetable types that showed the greatest Cd concentrations were grown on eight soils differing in the severity of contamination, pH and other physico-chemical properties. The range of Cd concentrations in the edible shoots was greater for tropical vegetables than for temperate types. Metal uptake was modelled as a function of (i) total soil metal concentration, (ii) CaCl{sub 2}-soluble metal, (iii) soil solution concentration and (iv) the activity of metal ions in soil pore water. Tropical vegetables were not satisfactorily modelled as a single generic 'green vegetable', suggesting that more sophisticated approaches to risk assessment may be required to assess hazard from peri-urban agriculture in developing countries. - Research highlights: Cadmium uptake by tropical green vegetables varies greatly between types. Modelling metal uptake works best for Ni, Cd and Zn but is poor for Cu, Ba and Pb. Modelling with dilute CaCl{sub 2} extraction is as good as metal ion activity in pore water. - Trace metal uptake by tropical leaf vegetables can be predicted from dilute CaCl{sub 2} extraction of soil but model parameters are genotype-specific.

Trace metal uptake by tropical vegetables grown on soil amended with urban sewage sludge

International Nuclear Information System (INIS)

Nabulo, G.; Black, C.R.; Young, S.D.

2011-01-01

Trace metal uptake was measured for tropical and temperate leafy vegetables grown on soil from an urban sewage disposal farm in the UK. Twenty-four leafy vegetables from East Africa and the UK were assessed and the five vegetable types that showed the greatest Cd concentrations were grown on eight soils differing in the severity of contamination, pH and other physico-chemical properties. The range of Cd concentrations in the edible shoots was greater for tropical vegetables than for temperate types. Metal uptake was modelled as a function of (i) total soil metal concentration, (ii) CaCl 2 -soluble metal, (iii) soil solution concentration and (iv) the activity of metal ions in soil pore water. Tropical vegetables were not satisfactorily modelled as a single generic 'green vegetable', suggesting that more sophisticated approaches to risk assessment may be required to assess hazard from peri-urban agriculture in developing countries. - Research highlights: → Cadmium uptake by tropical green vegetables varies greatly between types. → Modelling metal uptake works best for Ni, Cd and Zn but is poor for Cu, Ba and Pb. → Modelling with dilute CaCl 2 extraction is as good as metal ion activity in pore water. - Trace metal uptake by tropical leaf vegetables can be predicted from dilute CaCl 2 extraction of soil but model parameters are genotype-specific.

In-111 platelet scintigraphy for detection of lower-extremity deep venous thrombophlebitis: Are 4-hour delayed images sufficient

International Nuclear Information System (INIS)

Seabold, J.E.; Conrad, G.R.; Ponto, J.A.; Kimball, D.A.; Frey, E.E.; Coughlan, J.D.; Ahmed, F.; Jensen, K.C.

1986-01-01

Twenty-one nonheparinized patients suspected of having lower-extremity deep venous thrombosis underwent 4- and 24-hour In-111-labeled platelet scintigraphy (PS) and lower-extremity contrast venography (CV). Eleven of the 21 patients (52%) had one or more intraluminal filling defects on CV, indicating active thrombophlebitis. In seven of these 11 patients (64%) In-PS was abnormal at 4 hours, and in ten (91%) at 24 hours. All patients with abnormal studies at 4 hours showed greater uptake of more abnormal sites at 24 hours. Of the ten patients with CV-negative studies, two had abnormal bilateral lower pelvis/upper thigh uptake in In-PS at 24 hours. These two In-PS studies were considered to be false positive. Twenty-four-hour In-PS images are necessary if 4-hour images show faint focal uptake of asymmetric blood pool activity, or are normal

Can tumor uptake Tc-99m MDP

International Nuclear Information System (INIS)

Yang, Y.S.F.; Zeng, Z.J.; Yao, Y.M.; Shi, S.M.P.; Shi, S.Z.Y.

2002-01-01

Aim: To study a distribution of Tc-99m MDP in mice bearing tumor cell lines. Methods: The uptake of Tc-99m MDP was analyzed in seven human tumor cell lines (SPC-A1 adenocarcinoma of lung cancer, P37 Breast cancer, T24 Bladder cancer, SKOV2 Ovary carcinoma, Hela-229 Cervical carcinoma, Osteosarcoma, A375 Melanoma) and one mouse lung cancer cell line (Lewis). They were transplanted into 13, 4, 5, 5, 4, 5 athymic mice, 6 SCID nude mice and 4 C57 black mice, respectively. Approximately 10(7) cells of each cell line were injected subcutaneously into a right chest of mouse. After 5∼6 weeks, the Tc-99m MDP scintigraphy were determined 5-6 hours after i.v. injection of 74MBq in 0.05ml every mouse. Result: Biodistribution and tumor uptake MDP was different in the various cell types investigated. Region of interests (RIOs) placed on a small part of the tumor and horizontal copied to left chest or spine of mice in Tc-99m MDP imaging and the average count ratio (tumor to background ratio: T/B, tumor to spine ratio: T/NT) in each ROI was calculated. 13 nude mice bearing the adenocarcinoma (SPC-A1) were sacrificed and biodistribution was determined after Tc-99m MDP scintigraphy. Results were expressed as % injected dose/gram (%ID/g), mean±SD. T-ulcer=ulcer of tumor, T-round=surrounding of tumor, T-center=the center of tumor, Thor-sp=thoracic spine, Lum-ver=lumbar vertebra, LN=lymph node. Conclusions: Tumor can uptake Tc-99m MDP including adenocarcinoma. Higher uptake rate in the center tissue of tumor is than other part of tumor. It maybe connected with necrosis or fibrosis of tumor

Bone marrow uptake of 99mTc-MIBI in patients with multiple myeloma

International Nuclear Information System (INIS)

Fonti, R.; Del Vecchio, S.; Zannetti, A.; Di Gennaro, F.; Pace, L.; Salvatore, M.; De Renzo, A.; Catalano, L.; Califano, C.; Rotoli, B.

2001-01-01

In a previous study, we showed the ability of technetium-99m methoxyisobutylisonitrile ( 99m Tc-MIBI) scan to identify active disease in patients with multiple myeloma (Eur J Nucl Med 1998; 25: 714-720). In particular, a semiquantitative score of the extension and intensity of bone marrow uptake was derived and correlated with both the clinical status of the disease and plasma cell bone marrow infiltration. In order to estimate quantitatively 99m Tc-MIBI bone marrow uptake and to verify the intracellular localization of the tracer, bone marrow samples obtained from 24 multiple myeloma patients, three patients with monoclonal gammopathy of undetermined significance (MGUS) and two healthy donors were studied for in vitro uptake. After centrifugation over Ficoll-Hypaque gradient, cell suspensions were incubated with 99m Tc-MIBI and the uptake was expressed as the percentage of radioactivity specifically retained within the cells. The cellular localization of the tracer was assessed by micro-autoradiography. Twenty-two out of 27 patients underwent 99m Tc-MIBI scan within a week of bone marrow sampling. Whole-body images were obtained 10 min after intravenous injection of 555 MBq of the tracer; the extension and intensity of 99m Tc-MIBI uptake were graded using the semiquantitative score. A statistically significant correlation was found between in vitro uptake of 99m Tc-MIBI and both plasma cell infiltration (Pearson's coefficient of correlation r=0.69, P 99m Tc-MIBI inside the plasma cells infiltrating the bone marrow. Therefore, our findings show that the degree of tracer uptake both in vitro and in vivo is related to the percentage of infiltrating plasma cells which accumulate the tracer in their inner compartments. (orig.)

Incidental Focal 18F FDG Uptake in the Prostate: Clinical Significance and Differential Diagnostic Criteria

International Nuclear Information System (INIS)

Cho, Suk Kyong; Choi, Joon Young; Yoo, Jang; Cheon, Miju; Lee, Ji Young; Hyun, Seung Hyup; Lee, Eun Jeong; Lee, Kyung Han; Kim, Byung Tae

2011-01-01

The extent and intensity of 18F FDG uptake in prostate cancer patients are known to be variable, and the clinical significance of focal 18F fluorodeoxyglucose ( 18F FDG) uptake that is incidentally found on positron emission tomography (PET) has not been established. We investigated the clinical significance of incidental focal prostate uptake of 18F FDG on PET/computed tomography (CT) and analyzed differential findings on PET/CT Between malignant and benign uptake. A total of 14,854 whole body 18F FDG PET/CT scans (4,806 that were conducted during cancer screening and 10,048 that were conducted to evaluate suspected of alleged cancer outside of the prostate) were retrospectively reviewed to determine the presence, location, multiplicity reviewed to determine the presence, location, multiplicity and maximum standardized uptake value (SUVmax) of focal prostate uptake and combined calcification. The final diagnosis determined by serum prostate specific antigen (PSA) level and biopsy was compared with PET findings. Incidental focal prostate uptake was observed in 148 of 14,854 scans (1.0%). Sixty seven of these 148 subjects who had diagnostic confirmation were selected for further analysis. Prostate cancer was diagnosed in nine of 67 subjects (13.4%). The remaining 58 subjects had no malignancy in the prostate based on normal serum PSA level (n=53), or elevated serum PSA level with a negative biopsy result (n=5). While 84.6% (11/13) of malignant uptake was peripherally located in the prostate glands, 60.2% (50/83) of benign uptake was centrally located (p 18F FDG uptake un the prostate is not common, the incidence of cancer with focal uptake is not low. Therefore, these findings deserve further evaluation. The location of the focal prostate uptake may help with the selection of high risk prostate cancer patients.

Comparison of phosphate uptake rates by the smallest plastidic and aplastidic protists in the North Atlantic subtropical gyre.

Science.gov (United States)

Hartmann, Manuela; Grob, Carolina; Scanlan, David J; Martin, Adrian P; Burkill, Peter H; Zubkov, Mikhail V

2011-11-01

The smallest phototrophic protists (protists meet their inorganic nutrient requirements, we compared the phosphate uptake rates of plastidic and aplastidic protists in the phosphate-depleted subtropical and tropical North Atlantic (4-29°N) using a combination of radiotracers and flow cytometric sorting on two Atlantic Meridional Transect cruises. Plastidic protists were divided into two groups according to their size (protists showed higher phosphate uptake rates per cell than the aplastidic protists. Although the phosphate uptake rates of protist cells were on average seven times (Pprotists were one fourth to one twentieth of an average bacterioplankton cell. The unsustainably low biomass-specific phosphate uptake by both plastidic and aplastidic protists suggests the existence of a common alternative means of phosphorus acquisition - predation on phosphorus-rich bacterioplankton cells. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

Low blood flow at onset of moderate-intensity exercise does not limit muscle oxygen uptake

DEFF Research Database (Denmark)

Nyberg, Michael Permin; Mortensen, Stefan P; Saltin, Bengt

2010-01-01

The effect of low blood flow at onset of moderate-intensity exercise on the rate of rise in muscle oxygen uptake was examined. Seven male subjects performed a 3.5-min one-legged knee-extensor exercise bout (24 +/- 1 W, mean +/- SD) without (Con) and with (double blockade; DB) arterial infusion...... of inhibitors of nitric oxide synthase (N(G)-monomethyl-l-arginine) and cyclooxygenase (indomethacin) to inhibit the synthesis of nitric oxide and prostanoids, respectively. Leg blood flow and leg oxygen delivery throughout exercise was 25-50% lower (P ... +/- 12 vs. 262 +/- 39 ml/min). The present data demonstrate that muscle blood flow and oxygen delivery can be markedly reduced without affecting muscle oxygen uptake in the initial phase of moderate-intensity exercise, suggesting that blood flow does not limit muscle oxygen uptake at the onset...

Partitioning of oxygen uptake between the gills and skin in fish larvae: a novel method for estimating cutaneous oxygen uptake.

Science.gov (United States)

Rombough, P J

1998-06-01

The goal of this study was to develop an alternative to the traditional rubber dam method for measuring cutaneous oxygen uptake in bimodally respiring (skin + gills) fish larvae. The method tested involved using microelectrodes to measure the PO2 gradient in the diffusive boundary layer adjacent to seven positions on the skin surface (one on the head, two on the yolk sac, two on the trunk, one at the base of the dorsal fin-fold and one on the proximal portion of the caudal fin-fold) of rainbow trout (Oncorhynchus mykiss) larvae in still water. The PO2 gradient (deltaPO2/delta x, where x is the distance from the skin surface) was then used to calculate area-specific rate of O2 uptake (.MO2/A) according to the Fick equation, .MO2/A=Dbeta(deltaPO2/deltax), where A is the cross-sectional area of the boundary layer, D is the diffusion coefficient and beta is the capacitance coefficient for O2 in water. The accuracy of the method was assessed by comparing it with the rubber dam method. After correcting for differences in body mass, the two methods gave essentially identical results. According to the boundary layer method, the mean (+/-95 % CI) rate of O2 uptake across the skin of newly hatched rainbow trout at 10 degrees C is 3.13+/-0.18 microg O2 cm-2h-1 (N=265). The corresponding value obtained using the rubber dam method was 3. 36+/-0.35 microg O2 cm-2 h-1 (N=27). The advantages of the boundary layer method are that it can be used with smaller, more delicate larvae and that variables, such as flow rate, that can affect the efficiency of gas exchange can be regulated more precisely. The boundary layer method also permits examination of regional differences in exchange efficiency, although in still water such differences do not appear to be significant in trout larvae. The mean steepness of the PO2 gradient in the boundary layer and, hence, the mean rate of area-specific O2 uptake were essentially the same (P>0.05) at all seven locations tested in this study. The

Low blood flow at onset of moderate intensity exercise does not limit muscle oxygen uptake

DEFF Research Database (Denmark)

Nyberg, Michael Permin; Mortensen, Stefan Peter; Saltin, Bengt

2010-01-01

The effect of low blood flow at onset of moderate intensity exercise on the rate of rise in muscle oxygen uptake was examined. Seven male subjects performed a 3.5 minute one-legged knee-extensor exercise bout (24+/-1 (+/-S.D.) W) without (CON) and with (double blockade; DB) arterial infusion of i....... Additionally, prostanoids and/or NO appear to play important roles in elevating skeletal muscle blood flow in the initial phase of exercise. Key words: Oxygen delivery, oxygen extraction, nitric oxide, prostanoids.......The effect of low blood flow at onset of moderate intensity exercise on the rate of rise in muscle oxygen uptake was examined. Seven male subjects performed a 3.5 minute one-legged knee-extensor exercise bout (24+/-1 (+/-S.D.) W) without (CON) and with (double blockade; DB) arterial infusion...... of inhibitors of nitric oxide synthase (NOS; L-NMMA) and cyclooxygenase (COX; indomethacin) in order to inhibit the synthesis of nitric oxide (NO) and prostanoids, respectively.. Leg blood flow and leg oxygen delivery throughout exercise was 25-50 % lower (P

Can tumor uptake Tc-99m MDP ?

International Nuclear Information System (INIS)

Yand Shun, Fang; Yao, Ming; Zeng, Jun; Shi Zhen, Yu; Zhao Lan, Xiang; Dong Qiang, Gang

2003-01-01

To explore the mechanism of technetium-99m-methylene diphosphonate (MDP) uptake within tumor through analyze a distribution of Tc-99m MDP in mice bearing tumor cell lines. Methods: The uptake of Tc-99m MDP was analyzed in seven human tumor cell lines ( SPC-A1 adenocarcinoma of lung cancer, Bcap-37 Breast cancer, T-24 Bladder cancer, SKOV3 Ovary carcinoma, Hela-229 Cervical carcinoma, SCI-OS Osteosarcoma, SCI-375 Melanoma) and mouse Lewis lung cancer cell line. They were transplanted into athymic mice, SCID nude mice and C57BL/6 mice, respectively. Approximately 10(6) cells of each cell line were injected subcutaneously into a right chest of mouse. After 4 and 5 weeks, the Tc-99m MDP scintigraphy were determined 6 hours after tail vein injection of 74MBq in 0.05ml every mouse. Result: Biodistribution and tumor uptake MDP was different in the various cell types investigated. According to the Region Ratio program of Siemens Power Macintosh 9500 Computer System, region of interests (RIOs) placed on a small part of the tumor and horizontal copied to left background (T/B) and thoracic spine (T/N) of mice in Tc-99m MDP imaging. The average cpm/pixel ratios were calculated by standardized uptake measure (SUM) and determined the tumor-positive value (T/B) greater than or equal to 1.2. T/B of cell lines were sorted from higher to lower as follows: SCI-OS, Lewis, SKOV3, SCI-375, T-24, SPC-A1, Bcap-37, Hela-229. T/N: SCI-OS, SKOV3, T-24, SCI-375, Lewis, SPC-A1, Bcap-37, Hela-229. The biodistribution data of 99Tcm-MDP in SPC-A1 tumor-bearing BALB/c nude mice were given as ID/g and represent the means D (n=13) in 30 hours after injection of Tc-99m MDP. ID/g of major tissue were sorted from higher to lower as follows: thoracic spine, lumbar, ribs, kidneys, the center of tumor, the ulcer of tumor, the surrounding of tumor, lymph node, blood, lungs, heart, liver. Conclusions: Most of tumor can uptake Tc-99m MDP including human adenocarcinoma. The uptake rate in the center tissue of

Measurement of renal function by calculation of fractional uptake of technetium-99m dimercaptosuccinic acid

International Nuclear Information System (INIS)

Beatovic, S.Lj.; Jaksic, E. D.; Hari, R. S.

2004-01-01

The purpose of this study was to set up normal values of the fractional uptake (FU) of technetium-99m dimercaptosuccinic acid in adults and in the pediatric population, as well as to evaluate the validity of this parameter at different levels of renal function. A total of 86 subjects was divided into seven groups. In group A there were 23 potential kidney donors and in group B, 18 children in remission after a first urinary tract infection. Another three groups consisted of patients with diabetes i.e. group C, seven patients with normal values of albuminuria, group D, 16 patients with microalbuminuria and group E, five patients with macroalbuminuria. In group F, there were ten patients with a well-functioning transplanted kidney and in group G, seven patients with suspected acute rejection. The procedure began with the quantification of the doses of 99m Tc-DMSA to be injected and the measurement of the empty syringe lying on the gamma camera collimator. Thereafter, four planar views of the kidneys were acquired three hours after the injection. The counts from the posterior and anterior views were subtracted for background and corrected for radioactive decay time and patient thickness. The FU was calculated by the geometric mean of counts per second from the posterior and anterior view. It was expressed as a fraction of the injected dose. The mean values of FU in healthy adults were 0.227 ± 0.077 for one kidney and 0.454 ± 0.146 for both kidneys. The mean values of FU for the left and right kidney were 0.225± 0.071 and 0.229 ± 0.079, respectively. In children, the mean values were 0.220 ± 0.092 for one kidney and 0.432 ± 0.094 for both kidneys. The highest values of FU of 0.322 ± 0.078 (0.644 ± 0.138 for both kidneys) were measured in group C. In group D, FU was 0.185 ± 0.065 (0.361 ± 0.125 for both kidneys) and in group E 0.082 ± 0.040 (0.163 ± 0.080 total). In patients with a transplanted kidney, fractional uptake was 0.162 ± 0.039 in group F and 0

Plant uptake of 134Cs in relation to soil properties and time

International Nuclear Information System (INIS)

Massas, I.; Skarlou, V.; Haidouti, C.

2002-01-01

134 Cs uptake by sunflower and soybean plants grown on seven different soils and its relation to soil properties were studied in a greenhouse pot experiment. Soil in each pot was contaminated by dripping the 134 Cs in layers, and sunflower and soybean plants were grown for three and two successive periods, respectively. 134 Cs plant uptake was expressed as the transfer factor (TF) (Bq kg -1 plant/Bq kg -1 soil) and as the daily plant uptake (flux) (Bq pot -1 day -1 ) taking into account biomass production and growth time. For the studied soils and for both plants, no consistent trend of TFs with time was observed. The use of fluxes, in general, provided less variable results than TFs and stronger functional relationships. A negative power functional relationship between exchangeable potassium plus ammonium cations expressed as a percentage of cation exchange capacity of each soil and 134 Cs fluxes was found for the sunflower plants. A similar but weaker relationship was observed for soybean plants. The significant correlation between sunflower and soybean TFs and fluxes, as well as the almost identical highest/lowest 134 Cs flux ratios, in the studied soils, indicated a similar effect of soil characteristics on 134 Cs uptake by both plants. In all the studied soils, sunflower 134 Cs TFs and fluxes were significantly higher than the respective soybean values, while no significant difference was observed in potassium content and daily potassium plant uptake (flux) of the two plants

The Value of PCT, WBC and hs-CRP Tests in the Diagnosis and Prognosis of Children with Pneumonia%小儿肺炎中PCT、WBC、hs-CRP检测对疾病诊断及预后判断价值分析

Institute of Scientific and Technical Information of China (English)

夏兰兰; 李敬

2017-01-01

目的 分析小儿肺炎中PCT、WBC、hs-CRP检测对疾病诊断及预后的判断价值.方法 选取2015年5月至2016年4月在本院住院治疗的肺炎患儿120例作为观察组,健康儿童65例作为对照组.检测治疗前后患儿及健康儿童血清PCT、WBC、hs-CRP的变化.结果 治疗前,细菌感染组WBC数量(15.5±3.4)×109/L、hs-CRP水平(19.8±2.6) mg/L和PCT水平(21.9±2.1)ng/mL均明显高于非细菌感染组(6.8 ±2.3)×109/L、(4.5±2.3)mg/L、(4.7±1.8) ng/mL和健康对照组(8.1 ±1.4)×109/L、(3.5±1.2) mg/L、(1.8±0.5) ng/mL,且差异具有统计学意义(P＜0.05).而非细菌感染组和健康对照组的WBC、hs-CRP和PCT结果差异无统计学意义(P＞0.05);治疗后,细菌感染组WBC数量(7.3±1.4)×109/L、hs-CRP水平(5.1 ± 1.2) mg/L和PCT水平(2.3 ± 1.2) ng/mL均明显低于治疗前,差异具有统计学意义(P＜0.05);WBC、hs-CRP、PCT联合检测的灵敏性95.2％、特异性93.0％、准确度93.3％显著高于WBC、hs-CRP、PCT单独检测,差异具有统计学意义(P＜0.05).结论 在小儿肺炎治疗过程中,动态监测患儿血清的WBC、hs-CRP、PCT的变化,并结合临床,有助于诊疗和判断患儿疾病愈后的情况,具有显著的临床意义,值得推广应用.%Objective To estimate the value of PCT,WBC and hs-CRP tests in the diagnosis and prognosis of children with pneumonia.Methods 120 cases with pneumonia in children were selected from May 2015 to April 2016 in our hospital as the observation group,65 cases of healthy children as the control group.Changes of serum PCT,WBC and hs-CRP tests in children and healthy children before and after treatment were mearued.Results Before treatment,bacterial infection group have WBC count (15.5 ± 3.4) × 109/L,hs-CRP levels (19.8±2.6) mg/L and PCT level (21.9 ±2.1) ng/mL,which were significantly higher than those in non bacterial infection group (6.8 ±2.3) × 109/L,(4.5 ±2.3) mg/L,(4.7 ± 1.8) ng/mL and healthy control group (+ 8.1 �

Thyroid uptake test

International Nuclear Information System (INIS)

Ganatra, R.D.

1992-01-01

The uptake of radioiodine by the thyroid gland is altered by the iodine content of diet or drugs. American diet has a high iodine content because each slice of the white bread contains nearly 150μg of iodine due to the bleaching process employed in the production of the bread. This carrier content of iodine reduces the uptake so much, that the normal American uptakes are usually three to four times lower than the uptakes in the developing countries. The other drawback of the thyroid uptake test is that it is affected by the iodine containing drugs. Anti-diarrhoea medications are quire common in the developing countries and many of them contain iodine moiety. Without a reliable drug history, a low thyroid uptake value may lead to a misleading conclusion

Cold Water Mediates Greater Reductions in Limb Blood Flow than Whole Body Cryotherapy.

Science.gov (United States)

Mawhinney, Chris; Low, David A; Jones, Helen; Green, Daniel J; Costello, Joseph T; Gregson, Warren

2017-06-01

Cold-water immersion (CWI) and whole body cryotherapy (WBC) are widely used recovery methods in an attempt to limit exercise-induced muscle damage, soreness, and functional deficits after strenuous exercise. The aim of this study was to compare the effects of ecologically valid CWI and WBC protocols on postexercise lower limb thermoregulatory, femoral artery, and cutaneous blood flow responses. Ten males completed a continuous cycle exercise protocol at 70% maximal oxygen uptake until a rectal temperature of 38°C was attained. Participants were then exposed to lower-body CWI (8°C) for 10 min, or WBC (-110°C) for 2 min, in a randomized crossover design. Rectal and thigh skin, deep, and superficial muscle temperatures, thigh, and calf skin blood flow (laser Doppler flowmetry), superficial femoral artery blood flow (duplex ultrasound), and arterial blood pressure were measured before, and for 40 min post, cooling interventions. Greater reductions in thigh skin (CWI, -5.9°C ± 1.8°C; WBC, 0.2°C ± 0.5°C; P < 0.001) and superficial (CWI, -4.4°C ± 1.3°C; WBC, -1.8°C ± 1.1°C; P < 0.001) and deep (CWI, -2.9°C ± 0.8°C; WBC, -1.3°C ± 0.6°C; P < 0.001) muscle temperatures occurred immediately after CWI. Decreases in femoral artery conductance were greater after CWI (CWI, -84% ± 11%; WBC, -59% ± 21%, P < 0.02) and thigh (CWI, -80% ± 5%; WBC, -59% ± 14%, P < 0.001), and calf (CWI, -73% ± 13%; WBC, -45% ± 17%, P < 0.001) cutaneous vasoconstriction was greater after CWI. Reductions in rectal temperature were similar between conditions after cooling (CWI, -0.6°C ± 0.4°C; WBC, -0.6°C ± 0.3°C; P = 0.98). Greater reductions in blood flow and tissue temperature were observed after CWI in comparison with WBC. These novel findings have practical and clinical implications for the use of cooling in the recovery from exercise and injury.

Diffuse and diffuse-plus-focal uptake in the thyroid gland identified by using FDG-PET. Prevalence of thyroid cancer and Hashimoto's thyroiditis

International Nuclear Information System (INIS)

Kurata, Seiji; Ishibashi, Masatoshi; Hiromatsu, Yuji; Kaida, Hayato; Miyake, Ikuyo; Uchida, Masafumi; Hayabuchi, Naofumi

2007-01-01

The objective of this study was to investigate and evaluate the prevalence of incidental thyroid diffuse and diffuse-plus-focal fluorine-18 fluorodeoxyglucose (FDG) uptake in healthy subjects who underwent cancer screening on positron emission tomography (PET) scan, and also to evaluate the prevalence of thyroid cancer and Hashimoto's thyroiditis. We carried out a retrospective review of 1626 subjects who underwent PET scanning at our institution. Diffuse uptake was defined as FDG uptake in the whole thyroid gland, whereas diffuse-plus-focal uptake was defined as a thyroid lesion with both diffuse uptake and focal FDG uptake. The maximum standardized uptake value of the thyroid lesions was recorded and reviewed. In each selected subject with positive thyroid FDG uptake, serum thyroid-stimulating hormone, thyroid hormone, and thyroid antibodies were measured. Fine needle aspiration cytology was performed on patients with a definite nodule using ultrasonography. Twenty-nine subjects (1.78%) were identified as having either diffuse FDG uptake (n=25, 1.53%) or diffuse-plus-focal FDG uptake (n=4, 0.24%). All subjects with diffuse FDG uptake were diagnosed as having Hashimoto's thyroiditis. In 1 of the 25 subjects with diffuse FDG uptake and two of the four with diffuse-plus-focal FDG uptake, histopathologic diagnosis showed papillary thyroid carcinoma associated with Hashimoto's thyroiditis. However, PET scan did not detect papillary carcinoma associated with Hashimoto's thyroiditis in one of the three subjects. Our results suggest that although diffuse FDG uptake usually indicates Hashimoto's thyroiditis, the risk of thyroid cancer must be recognized in both diffuse FDG uptake and diffuse-plus-focal FDG uptake on PET scan. (author)

Plant uptake of dual-labeled organic N biased by inorganic C uptake

DEFF Research Database (Denmark)

Rasmussen, Jim; Sauheitl, Leopold; Eriksen, Jørgen

2010-01-01

glycine or CO2-3 , but found no differences in uptake rates between these C-sources. The uptake of inorganic C to the shoot tissue was higher for maize grown in full light compared to shading, which indicates a passive uptake of inorganic C with water. We conclude that uptake of inorganic C produced...

Outlook: The Next Twenty Years

Energy Technology Data Exchange (ETDEWEB)

Murayama, Hitoshi

2003-12-07

I present an outlook for the next twenty years in particle physics. I start with the big questions in our field, broken down into four categories: horizontal, vertical, heaven, and hell. Then I discuss how we attack the bigquestions in each category during the next twenty years. I argue for a synergy between many different approaches taken in our field.

Effectiveness of 131I nor-cholesterol uptake per unit volume of adrenal adenoma in the diagnosis of aldosteronoma

International Nuclear Information System (INIS)

Kita, Tamotsu; Tomita, Hiroko; Sakaguchi, Chiharu

2010-01-01

Diagnosis of adrenal adenomas for patients with primary aldosteronism is sometimes difficult only by referring to the visualization pattern in adrenocortical scintigraphy without regards to standard scintigraphy or suppression scintigraphy with dexamethasone. We studied if quantitative evaluation of the standard scintigraphy without dexamethasone suppression can be useful to diagnose aldosteronomas. Twenty-nine patients who had undergone adrenalectomy with different clinical manifestations (16 patients with primary aldosteronism, 6 patients with Cushing's syndrome and 7 patients without hormonal abnormality) were included in the study. Volume of the adrenocortical adenomas, 131 I nor-cholesterol uptake of the adrenocortical adenomas, and 131 I nor-cholesterol uptake per unit volume of the adrenocortical adenomas were compared between the 3 groups. The volume of adrenocortical adenomas in the patients with primary aldosteronism was significantly lower than those in the other two groups (Cushing's syndrome p 131 I nor-cholesterol uptake of adrenocortical adenoma. The 131 I nor-cholesterol uptake per unit volume of adrenocortical adenomas was significantly higher in the patients with primary aldosteronism than those in the other two groups (Cushing's syndrome p 131 I nor-cholesterol uptake per unit volume of adenoma obtained from adrenocortical scintigraphy without dexamethasone suppression can be useful in the diagnosis of aldosteronoma. (author)

Temporal relation between temperature change and FDG uptake in brown adipose tissue

International Nuclear Information System (INIS)

Kim, SunHee; Krynyckyi, Borys R.; Machac, Josef; Kim, Chun K.

2008-01-01

It has been reported that the prevalence of 18 F fluorodeoxyglucose (FDG) uptake in brown adipose tissue (BAT) is related to outdoor temperature, i.e., more frequent during the colder periods of the year. The purpose of this study was to assess the temporal relationship between BAT FDG uptake and temperature. We correlated the prevalence of BAT with average temperatures (divided into five temperature ranges) of seven different durations. One thousand four hundred ninety-five consecutive FDG Positron emission tomography (PET) studies in 1,159 patients (566 male and 593 female, mean age = 60.4 years) were retrospectively reviewed. FDG uptake with distinct patterns compatible with BAT was identified by a consensus of two readers. The local daily average temperature from January 2000 to November 2003 (beginning 60 days before the date of first PET scan) were obtained, and 2-, 3-, 7-, 14-, 30-, and 60-day average temperatures before the date of a PET study were calculated. The prevalence of BAT FDG uptake was correlated with these various average temperatures. The daily, 2-day, 3-day, and 7-day average temperature had an inverse relation with the prevalence of BAT, i.e., the lower the temperature, the higher prevalence of BAT. When the temperature was averaged over 14 days or longer, this inverse relationship between the temperature and the prevalence of BAT was no longer preserved. Our data suggest that increased FDG uptake in BAT occurs more often as an acute response to cold weather (1-7 days) rather than to prolonged periods of average cold weather. (orig.)

Tau Antibody Targeting Pathological Species Blocks Neuronal Uptake and Interneuron Propagation of Tau in Vitro.

Science.gov (United States)

Nobuhara, Chloe K; DeVos, Sarah L; Commins, Caitlin; Wegmann, Susanne; Moore, Benjamin D; Roe, Allyson D; Costantino, Isabel; Frosch, Matthew P; Pitstick, Rose; Carlson, George A; Hock, Christoph; Nitsch, Roger M; Montrasio, Fabio; Grimm, Jan; Cheung, Anne E; Dunah, Anthone W; Wittmann, Marion; Bussiere, Thierry; Weinreb, Paul H; Hyman, Bradley T; Takeda, Shuko

2017-06-01

The clinical progression of Alzheimer disease (AD) is associated with the accumulation of tau neurofibrillary tangles, which may spread throughout the cortex by interneuronal tau transfer. If so, targeting extracellular tau species may slow the spreading of tau pathology and possibly cognitive decline. To identify suitable target epitopes, we tested the effects of a panel of tau antibodies on neuronal uptake and aggregation in vitro. Immunodepletion was performed on brain extract from tau-transgenic mice and postmortem AD brain and added to a sensitive fluorescence resonance energy transfer-based tau uptake assay to assess blocking efficacy. The antibodies reduced tau uptake in an epitope-dependent manner: N-terminal (Tau13) and middomain (6C5 and HT7) antibodies successfully prevented uptake of tau species, whereas the distal C-terminal-specific antibody (Tau46) had little effect. Phosphorylation-dependent (40E8 and p396) and C-terminal half (4E4) tau antibodies also reduced tau uptake despite removing less total tau by immunodepletion, suggesting specific interactions with species involved in uptake. Among the seven antibodies evaluated, 6C5 most efficiently blocked uptake and subsequent aggregation. More important, 6C5 also blocked neuron-to-neuron spreading of tau in a unique three-chamber microfluidic device. Furthermore, 6C5 slowed down the progression of tau aggregation even after uptake had begun. Our results imply that not all antibodies/epitopes are equally robust in terms of blocking tau uptake of human AD-derived tau species. Copyright © 2017 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

Uptake, localization and clearance of quantum dots in ciliated protozoa Tetrahymena thermophila

International Nuclear Information System (INIS)

Mortimer, Monika; Kahru, Anne; Slaveykova, Vera I.

2014-01-01

Protozoa as phagocytizing cells have been shown to integrate engineered nanoparticles (NPs), while the mechanism, dynamics and extent of such uptake are unclear. Here our fluorescence microscopy data showed that CdSe/ZnS quantum dots (QDs) with primary size of 12 nm were readily phagocytized into the food vacuoles of Tetrahymena thermophila in a time- and dose-dependent manner. Twenty hours after the exposure to QDs in sublethal concentration the clearance of the QDs from the cells was incomplete suggesting that phagocytosis of QDs into food vacuoles was not the only pathway of uptake by T. thermophila. This was further proven by the results that the inhibition of phagocytosis did not block the internalization of QDs into protozoans. This study provides a new insight into uptake and cellular trafficking of subtoxic concentrations of nanoparticles that may, due to prolonged retention times in the cells, pose risks by potentially becoming available to higher trophic levels. - Highlights: • Tetrahymena thermophila internalized QDs in a dose- and time-dependent manner. • The egested QDs were not significantly biodegraded in the food vacuoles. • In addition to phagocytosis QDs entered protozoa by alternative uptake pathways. • The clearance of the QDs from the cells was incomplete after 20 h in fresh medium. • The prolonged retention time of nontoxic NPs in protozoa could increase their transfer in food chain. - In addition to phagocytosis, quantum dots (QDs) entered protozoans by alternative pathways which did not lead to complete clearance of the QDs from the cells

Twenty Practices of an Entrepreneurial University

DEFF Research Database (Denmark)

Gjerding, Allan Næs; Wilderom, Celeste P.M.; Cameron, Shona P.B.

2006-01-01

studies twenty organisational practices against which a University's entrepreneurship can be measured. These twenty practices or factors in effect formed the basis for an entrepreneurship audit. During a series of interviews, the extent to which the universities are seen as entrepreneurial...

Synthesis and evaluation of iodide uptake inhibitors in thyroid gland

International Nuclear Information System (INIS)

Lacotte, Pierre

2012-01-01

This work was intended to discover small organic molecules acting as iodide uptake inhibitors in thyroid cells. These compounds can indeed be derivatized into biochemical probes for further characterization of proteins involved in iodide transport mechanisms. On the long term, these inhibitors also appear as attractive drug candidates for treatment of thyroid pathologies or radioprotection against iodine isotopes. A similar strategy was adopted for both of the two inhibitor families. First, we synthesized a chemical library of around 100 analogues; we measured their IC50 against iodide uptake in FRTL-5 cells to get structure-activity relationships. Absolute configuration of stereo-genic centers was also investigated, and a preferential stereochemistry was found to be responsible for activity. From this basis, around twenty 'second-generation' analogues were synthesized by combining fragments contributing to biological activity. Biological evaluation indicated that nine were very potent inhibitors, with IC50 ≤ 6 nM and satisfying physicochemical properties required for drug candidates. Finally, one photoactivatable biotinylated probe was developed in each family and used for photoaffinity labeling. Several specifically labeled proteins are still under identification and constitute new potential therapeutic targets. (author)

Percutaneous gastrostomy -a report of twenty-seven cases-

International Nuclear Information System (INIS)

Kim, Tae Ho; Lee, Ho Suk; Kim, Yong Joo; Kim, Tae Hun; Suh, Kyung Jin; Kang, Duk Sik

1991-01-01

Nutritional support by gastrostomy feeding is an important treatment adjunct when major swallowing difficulty or debilitating diseases is present. This technique for percutaneous placement of a gastric feeding tube now provides many patients with a simple, safe, and well-tolerated alternative to surgical feeding gastrostomy. We experienced 27 cases of percutaneous gastrostomy from January 1989 to February 1991 at Kyungpook National University Hospital. The underlying diseases of the patients were esophageal cancer (11), pyriform sinus cancer (4), laryngeal cancer (3), tongue cancer (2), lye stricture (1), lung cancer (1), chordoma (1), lethal midline granuloma (1), malignant lymphoma (1), maxillary cancer (1), and tonsil cancer (1). Selding method was used in all cases. In five patients it was difficult to insert the nasogastric tube for air insufflation, and one patient had subtotal gastrectomy with gastrojejunostomy, but gastrostomy was performed in all cases. The general condition improved in all patients. We experienced one case of mild peritonitis, but no other significant complications were observed. Gastrostomy tubes were patient in all patients during their survival period, except two patients who experienced obstruction 2 and 6 months after the procedure. Percutaneous gastrostomy can be used safely and effectively in such patients who have pharyngoesophageal or CNS lesions precluding oral intake

Muscle, Skin and Core Temperature after −110°C Cold Air and 8°C Water Treatment

Science.gov (United States)

Costello, Joseph Thomas; Culligan, Kevin; Selfe, James; Donnelly, Alan Edward

2012-01-01

The aim of this investigation was to elucidate the reductions in muscle, skin and core temperature following exposure to −110°C whole body cryotherapy (WBC), and compare these to 8°C cold water immersion (CWI). Twenty active male subjects were randomly assigned to a 4-min exposure of WBC or CWI. A minimum of 7 days later subjects were exposed to the other treatment. Muscle temperature in the right vastus lateralis (n = 10); thigh skin (average, maximum and minimum) and rectal temperature (n = 10) were recorded before and 60 min after treatment. The greatest reduction (Psporting setting. PMID:23139763

Reasons for low uptake of referrals to ear and hearing services for children in Malawi.

Directory of Open Access Journals (Sweden)

Tess Bright

Full Text Available Early detection and appropriate intervention for children with hearing impairment is important for maximizing functioning and quality of life. The lack of ear and hearing services in low income countries is a significant challenge, however, evidence suggests that even where such services are available, and children are referred to them, uptake is low. The aim of this study was to assess uptake of and barriers to referrals to ear and hearing services for children in Thyolo District, Malawi.This was a mixed methods study. A survey was conducted with 170 caregivers of children who were referred for ear and hearing services during community-based screening camps to assess whether they had attended their referral and reasons for non-attendance. Semi-structured interviews were conducted with 23 caregivers of children who did not take up their referral to explore in-depth the reasons for non-uptake. In addition, 15 stakeholders were interviewed. Thematic analysis of the interview data was conducted and emerging trends were analysed.Referral uptake was very low with only 5 out of 150 (3% children attending. Seven main interacting themes for non-uptake of referral were identified in the semi-structured interviews: location of the hospital, lack of transport, other indirect costs of seeking care, fear and uncertainty about the referral hospital, procedural problems within the camps, awareness and understanding of hearing loss, and lack of visibility and availability of services.This study has highlighted a range of interacting challenges faced by families in accessing ear and hearing services in this setting. Understanding these context specific barriers to non-uptake of ear and hearing services is important for designing appropriate interventions to increase uptake.

Dependence of intestinal amino acid uptake on dietary protein or amino acid levels

International Nuclear Information System (INIS)

Karasov, W.H.; Solberg, D.H.; Diamond, J.M.

1987-01-01

To understand how intestinal amino acid (AA) transport is regulated by dietary substrate levels, the authors measured uptake of seven radioactively-labelled AAs and glucose across the jejunal brush-border membrane of mice kept on one of three isocaloric rations differing in nitrogen content. In the high-protein ration, uptake increased by 77-81% for the nonessential, less toxic AAs, proline, and aspartate but only by 32-61% for the more toxic essential AAs tested. In the nitrogen-deficient ration, uptake decreased for the nonessential aspartate and proline but stayed constant or increased for essential AAs and for the nonessential alanine. These patterns imply independent regulation of the intestine's various AA transporters. With decreasing dietary AA (or protein), the imino acid and acidic AA private transporters are repressed, while activities of the basic AA transporter and the neutral AA public transporter decrease to an asymptote or else go through a minimum. These regulatory patterns can be understood as a compromise among conflicting constraints imposed by protein's multiple roles as a source of calories, nitrogen, and essential AAs and by the toxicity of essential AAs at high concentrations

Does the intensity of diffuse thyroid gland uptake on F-18 fluorodeoxyglucose positron emission tomography/computed tomography scan predict the severity of hypothyroidism? Correlation between maximal standardized uptake value and serum thyroid stimulating hormone levels

International Nuclear Information System (INIS)

Pruthi, Ankur; Choudhury, Partha Sarathi; Gupta, Manoj; Taywade, Sameer

2015-01-01

F-18 fluorodeoxyglucose (F-18 FDG) positron emission tomography/computed tomography (PET/CT) scan and hypothyroidism. The aim was to determine whether the intensity of diffuse thyroid gland uptake on F-18 FDG PET/CT scans predicts the severity of hypothyroidism. A retrospective analysis of 3868 patients who underwent F-18 FDG PET/CT scans, between October 2012 and June 2013 in our institution for various oncological indications was done. Out of them, 106 (2.7%) patients (79 females, 27 males) presented with bilateral diffuse thyroid gland uptake as an incidental finding. These patients were investigated retrospectively and various parameters such as age, sex, primary cancer site, maximal standardized uptake value (SUVmax), results of thyroid function tests (TFTs) and fine-needle aspiration cytology results were noted. The SUVmax values were correlated with serum thyroid stimulating hormone (S. TSH) levels using Pearson's correlation analysis. Pearson's correlation analysis. Clinical information and TFT (serum FT3, FT4 and TSH levels) results were available for 31 of the 106 patients (27 females, 4 males; mean age 51.5 years). Twenty-six out of 31 patients (84%) were having abnormal TFTs with abnormal TSH levels in 24/31 patients (mean S. TSH: 22.35 μIU/ml, median: 7.37 μIU/ml, range: 0.074-211 μIU/ml). Among 7 patients with normal TSH levels, 2 patients demonstrated low FT3 and FT4 levels. No significant correlation was found between maximum standardized uptake value and TSH levels (r = 0.115, P > 0.05). Incidentally detected diffuse thyroid gland uptake on F-18 FDG PET/CT scan was usually associated with hypothyroidism probably caused by autoimmune thyroiditis. Patients should be investigated promptly irrespective of the intensity of FDG uptake with TFTs to initiate replacement therapy and a USG examination to look for any suspicious nodules

Capital in the Twenty-First Century

DEFF Research Database (Denmark)

Hansen, Per H.

2014-01-01

Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp......Review essay on: Capital in the Twenty-First Century. By Thomas Piketty . Translated by Arthur Goldhammer . Cambridge, Mass.: The Belknap Press of Harvard University Press, 2014. viii + 685 pp...

The influence of sex on the haematological values of apparently ...

African Journals Online (AJOL)

Blood samples were collected from fifty apparently healthy adult Sahel goats, twenty five each of male and female in Maiduguri to assess the influence of sex on their haematology. The red blood cell (RBC) counts, white blood cell (WBC) counts, haemoglobin (Hb) concentration, packed cell volume (PCV), platelet counts, ...

High-Intensity Focused Ultrasound for the Treatment of Wrinkles and Skin Laxity in Seven Different Facial Areas

OpenAIRE

Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon

2015-01-01

Background High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. Objective This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Methods Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two inde...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... for a thyroid scan is 30 minutes or less. Thyroid Uptake You will be given radioactive iodine (I-123 or I-131) in liquid or capsule form to swallow. The thyroid uptake will begin several hours to 24 hours later. Often, two separate uptake ...

Effect of zinc source and picolinic acid on 65Zn uptake in an in vitro continuous-flow perfusion system for pig and poultry intestinal segments

International Nuclear Information System (INIS)

Hill, D.A.; Peo, E.R. Jr.; Lewis, A.J.

1987-01-01

Twenty weanling pigs and fourteen 9-wk-old broiler chickens were used in three continuous-flow in vitro perfusion experiments using noneverted intestinal sacs to 1) determine differences in 65 Zn absorption due to location within the intestinal tract, 2) evaluate 65 Zn uptake from ZnCl 2 and Zn-methionine (ZnMet) with or without added picolinic acid (PA) in pig intestinal sacs and 3) evaluate 65 Zn uptake from ZnCl 2 and ZnMet in chicken intestinal sacs. No differences in 65 Zn uptake due to gut segment position were observed in the pigs. A Zn source x PA interaction was observed for 65 Zn uptake into the pig gut tissue and for 65 Zn uptake to the serosal side of the gut sacs. Total 65 Zn absorption in the pig gut sacs from the two Zn sources was not different, but the addition of a 5 M ratio of PA to Zn depressed 65 Zn absorption. No differences were observed in total 65 Zn absorption or 65 Zn uptake in poultry gut sac tissue. There was, however, greater uptake of 65 Zn from ZnCl 2 to the serosal side of the sacs than from ZnMet. The data indicate that 65 Zn from ZnCl 2 and ZnMet is similar in total absorption and that the addition of PA depresses Zn uptake

Uptake of nuclides by plants

International Nuclear Information System (INIS)

Greger, Maria

2004-04-01

This review on plant uptake of elements has been prepared to demonstrate how plants take up different elements. The work discusses the nutrient elements, as well as the general uptake and translocation in plants, both via roots and by foliar absorption. Knowledge of the uptake by the various elements within the periodic system is then reviewed. The work also discusses transfer factors (TF) as well as difficulties using TF to understand the uptake by plants. The review also focuses on species differences. Knowledge necessary to understand and calculate plant influence on radionuclide recirculation in the environment is discussed, in which the plant uptake of a specific nuclide and the fate of that nuclide in the plant must be understood. Plants themselves determine the uptake, the soil/sediment determines the availability of the nuclides and the nuclides themselves can interact with each other, which also influences the uptake. Consequently, it is not possible to predict the nuclide uptake in plants by only analysing the nuclide concentration of the soil/substrate

Uptake of nuclides by plants

Energy Technology Data Exchange (ETDEWEB)

Greger, Maria [Stockholm Univ. (Sweden). Dept. of Botany

2004-04-01

This review on plant uptake of elements has been prepared to demonstrate how plants take up different elements. The work discusses the nutrient elements, as well as the general uptake and translocation in plants, both via roots and by foliar absorption. Knowledge of the uptake by the various elements within the periodic system is then reviewed. The work also discusses transfer factors (TF) as well as difficulties using TF to understand the uptake by plants. The review also focuses on species differences. Knowledge necessary to understand and calculate plant influence on radionuclide recirculation in the environment is discussed, in which the plant uptake of a specific nuclide and the fate of that nuclide in the plant must be understood. Plants themselves determine the uptake, the soil/sediment determines the availability of the nuclides and the nuclides themselves can interact with each other, which also influences the uptake. Consequently, it is not possible to predict the nuclide uptake in plants by only analysing the nuclide concentration of the soil/substrate.

Factors associated with influenza and pneumococcal vaccine uptake among rheumatoid arthritis patients in Denmark invited to participate in a pneumococcal vaccine trial (Immunovax_RA)

DEFF Research Database (Denmark)

Nguyen, MTT; Lindegaard, H.; Hendricks, O.

2017-01-01

the survey during scheduled follow-up visits. The questionnaire included questions concerning previous influenza and pneumococcal vaccine uptake, attitudes about vaccination, and socio-demographic factors. Factors associated with recalled vaccine uptake were assessed by multivariate logistic regression....... Results: A total of 192 RA patients completed the survey, 134 (70%) of whom were women and 90 (47%) were aged ≥ 65 years. Sixty-seven patients (35%) received conventional disease-modifying anti-rheumatic drugs (cDMARDs) and 125 (65%) combination therapy with biological disease-modifying anti...

The FAA's postmortem forensic toxicology self-evaluated proficiency test program: the second seven years.

Science.gov (United States)

Chaturvedi, Arvind K; Craft, Kristi J; Cardona, Patrick S; Rogers, Paul B; Canfield, Dennis V

2009-05-01

During toxicological evaluations of samples from fatally injured pilots involved in civil aviation accidents, a high degree of quality control/quality assurance (QC/QA) is maintained. Under this philosophy, the Federal Aviation Administration (FAA) started a forensic toxicology proficiency-testing (PT) program in July 1991. In continuation of the first seven years of the PT findings reported earlier, PT findings of the next seven years are summarized herein. Twenty-eight survey samples (12 urine, 9 blood, and 7 tissue homogenate) with/without alcohols/volatiles, drugs, and/or putrefactive amine(s) were submitted to an average of 31 laboratories, of which an average of 25 participants returned their results. Analytes in survey samples were correctly identified and quantitated by a large number of participants, but some false positives of concern were reported. It is anticipated that the FAA's PT program will continue to serve the forensic toxicology community through this important part of the QC/QA for laboratory accreditations.

An analysis of true- and false-positive results of vocal fold uptake in positron emission tomography-computed tomography imaging.

Science.gov (United States)

Seymour, N; Burkill, G; Harries, M

2018-03-01

Positron emission tomography-computed tomography with fluorine-18 fluorodeoxy-D-glucose has a major role in the investigation of head and neck cancers. Fluorine-18 fluorodeoxy-D-glucose is not a tumour-specific tracer and can also accumulate in benign pathology. Therefore, positron emission tomography-computed tomography scan interpretation difficulties are common in the head and neck, which can produce false-positive results. This study aimed to investigate patients detected as having abnormal vocal fold uptake on fluorine-18 fluorodeoxy-D-glucose positron emission tomography-computed tomography. Positron emission tomography-computed tomography scans were identified over a 15-month period where reports contained evidence of unilateral vocal fold uptake or vocal fold pathology. Patients' notes and laryngoscopy results were analysed. Forty-six patients were identified as having abnormal vocal fold uptake on positron emission tomography-computed tomography. Twenty-three patients underwent positron emission tomography-computed tomography and flexible laryngoscopy: 61 per cent of patients had true-positive positron emission tomography-computed tomography scans and 39 per cent had false-positive scan results. Most patients referred to ENT for abnormal findings on positron emission tomography-computed tomography scans had true-positive findings. Asymmetrical fluorine-18 fluorodeoxy-D-glucose uptake should raise suspicion of vocal fold pathology, accepting a false-positive rate of approximately 40 per cent.

Tracer studies on the effect of different methods of phosphorus application on fertilizer P uptake by Sunnhemp (Crotolaria juncea L.)

International Nuclear Information System (INIS)

Chaudhury, J.; Ray, P.K.

1994-01-01

The relative efficacy of seven methods of phosphorus application on dry matter yield, and fertilizer phosphorus uptake and its utilization by Sunnhemp (var. K-12 yellow) was studied under field conditions using 32 P tagged superphosphate (SSP). Fertilizer was least utilized by the traditional method of application of fertilizer i.e. broadcasting, whereas placement below the seed was significantly superior to all other methods in relation to dry matter yield, total and fertilizer P uptake by Sunnhemp. The per cent utilization of fertilizer P added and per cent Pdff followed the similar pattern as that of the dry matter yield. (author). 7 refs., 1 tab

Space power technology for the twenty-first century (SPT21)

International Nuclear Information System (INIS)

Borger, W.U.; Massie, L.D.

1988-01-01

During the spring and summer months of 1987, the Aero Propulsion Laboratory of the Air Force Wright Aeronautical Laboratories, Wright-Patterson AFB, Ohio in cooperation with the Air Force Space Technology Center at Kirtland AFB, New Mexico, undertook an initiative to develop a Strategic Plan for Space Power Technology Development. The initiative was called SPT21, Space Power Technology for the Twenty-First Century. The planning process involved the participation of other Government organizations (U.S. Army, Navy, DOE and NASA) along with major aerospace companies and universities. Following an SPT21 kickoff meeting on 28 May 1987, detailed strategic planning was accomplished through seven (7) Space Power Technology Discipline Workshops commencing in June 1987 and concluding in August 1987. Technology Discipline Workshops were conducted in the following areas: (1) Solar Thermal Dynamic Power Systems (2) Solar Photovoltaic Cells and Arrays (3) Thermal Management Technology (4) Energy Storage Technology (5) Nuclear Power Systems Technology (6) Power Conditioning, Distribution and Control and (7) Systems Technology/Advanced Concepts. This technical paper summarizes the planning process and describes the salient findings and conclusions of the workshops

Diselenolane-mediated cellular uptake.

Science.gov (United States)

Chuard, Nicolas; Poblador-Bahamonde, Amalia I; Zong, Lili; Bartolami, Eline; Hildebrandt, Jana; Weigand, Wolfgang; Sakai, Naomi; Matile, Stefan

2018-02-21

The emerging power of thiol-mediated uptake with strained disulfides called for a move from sulfur to selenium. We report that according to results with fluorescent model substrates, cellular uptake with 1,2-diselenolanes exceeds uptake with 1,2-dithiolanes and epidithiodiketopiperazines with regard to efficiency as well as intracellular localization. The diselenide analog of lipoic acid performs best. This 1,2-diselenolane delivers fluorophores efficiently to the cytosol of HeLa Kyoto cells, without detectable endosomal capture as with 1,2-dithiolanes or dominant escape into the nucleus as with epidithiodiketopiperazines. Diselenolane-mediated cytosolic delivery is non-toxic (MTT assay), sensitive to temperature but insensitive to inhibitors of endocytosis (chlorpromazine, methyl-β-cyclodextrin, wortmannin, cytochalasin B) and conventional thiol-mediated uptake (Ellman's reagent), and to serum. Selenophilicity, the extreme CSeSeC dihedral angle of 0° and the high but different acidity of primary and secondary selenols might all contribute to uptake. Thiol-exchange affinity chromatography is introduced as operational mimic of thiol-mediated uptake that provides, in combination with rate enhancement of DTT oxidation, direct experimental evidence for existence and nature of the involved selenosulfides.

99mTc-HMPAO Labelled WBC Scan in Experimental Abscess by Labelling Autologous Leukocytes with In-House-Synthesized HMPAO

International Nuclear Information System (INIS)

Lee, Dong Soo; Shin, Hyung Sik; Ahn, Curie; Chung, June Key; Lee, Myung Chul; Choi, Kang Won; Koh, Chang Soon; Jung, Jae Min; Chung, Eun Ju

1991-01-01

With HMPAO we have synthesized in our laboratory, we labelled 99m Tc to canine leukocytes. Experimental abscess made by subcutaneous injection with Staphylococcus aureus was imaged with these 99m Tc labelled leukocytes. Labelling efficiency of HMPAO with 99m Tc was 66.2% ± 14.6% (N=9). Labelling efficiency of leukocytes with 99m Tc-HMPAO was 54% ± 7.79 (N=7). Cell bound radio activity in 99m Tc-HMPAO labelled leukocytes was around 80%. when these cells were incubated in plasma in vitro at 37 .deg. C for 5 hours. In vivo cell bound activity was over 80% at 24 hours after injection. One day and four days after inoculation, uptake at the inflammatory focus was found with 99m Tc labelled leukocytes. Uptake showed up in 4 hour image, and the uptake at the lesion was most prominent in 24 hour image. These findings show that in-house-synthesized HMPAO could be used for labelling leukocytes with 99m Tc, and that 99m Tc-HMPAO-labelled leukocytes were so stable and viable that inflammatory focus could be visualized with these 99m Tc-labelled leukocytes.

Myocardial uptake of iodinated free fatty acids and 201Tl in experimental ischemia

International Nuclear Information System (INIS)

Westera, G.; Wall, E.E. van der; Visser, F.C.; Scholtalbers, A.S.; Eenige, M.J. van; Roos, J.P.

1984-01-01

In an experimental study, we evaluated the uptake of ( 131 I)-17-iodo heptadecanoic acid ( 131 I-HDA), ( 125 I)-15-4 (4-iodophenyl) pentadecanoic acid ( 125 I-PPA) and thallium-201 ( 201 Tl) in the dog heart. Twenty dogs were studied and divided into 3 groups: in group A, 10 dogs (4 normal, 6 with coronary artery occlusion) were studied with 131 I-HDA and 201 Tl; in group B, 5 dogs (with occlusion) received 125 I-PPA and 201 Tl; and in group C, 5 dogs (with occlusion) were studied with 125 I-PPA and 131 I-HDA. Two min after administration of the compounds the hearts were excised and stored in formaldehyde. After sectioning of the left ventricle, total uptake was counted and expressed in percentage of injected dose. Uptake in the normal myocardium (group A) was 4.2+-0.6% for 131 I-HDA and 4.6+-0.7% for 201 Tl; in the occluded dog hearts (group A) we measured values of 2.6+-0.4% for 131 I-HDA (p 201 Tl (p 131 I-HDA, 125 I-PPA and 201 Tl in groups B and C was not significantly different: group B, 125 I-PPA 2.8+-0.8% and 201 Tl 2.5+-0.5%; group C, 125 I-PPA 1.9+-0.7% and 131 I-HDA 1.6+-0.6%. Moreover, regional distribution of both iodinated fatty acids was quite comparable with the distribution of 201 Tl. We conclude that 131 I-HDA and 125 I-PPA show similar uptake as 201 Tl and are distributed according to coronary artery perfusion, which underscores their value as myocardial imaging agents. (orig.) [de

Factors Influencing Household Uptake of Improved Solid Fuel Stoves in Low- and Middle-Income Countries: A Qualitative Systematic Review

Directory of Open Access Journals (Sweden)

Stanistreet Debbi

2014-08-01

Full Text Available Household burning of solid fuels in traditional stoves is detrimental to health, the environment and development. A range of improved solid fuel stoves (IS are available but little is known about successful approaches to dissemination. This qualitative systematic review aimed to identify factors that influence household uptake of IS in low- and middle-income countries. Extensive searches were carried out and studies were screened and extracted using established systematic review methods. Fourteen qualitative studies from Asia, Africa and Latin-America met the inclusion criteria. Thematic synthesis was used to synthesise data and findings are presented under seven framework domains. Findings relate to user and stakeholder perceptions and highlight the importance of cost, good stove design, fuel and time savings, health benefits, being able to cook traditional dishes and cleanliness in relation to uptake. Creating demand, appropriate approaches to business, and community involvement, are also discussed. Achieving and sustaining uptake is complex and requires consideration of a broad range of factors, which operate at household, community, regional and national levels. Initiatives aimed at IS scale up should include quantitative evaluations of effectiveness, supplemented with qualitative studies to assess factors affecting uptake, with an equity focus.

On the uptake of flexible working arrangements and the association with human resource and organisational performance outcomes

OpenAIRE

Berkery, Elaine; Morley, Michael J.; Tiernan, Siobhan; Purtill, Helen; Parry, Emma

2017-01-01

The aim of this study was to identify bundles of flexible working arrangements (FWAs) from data provided by 1,064 organizations in seven EU countries, and to relate bundle membership to demographic variables and human resource (HR) and organizational performance outcomes. Using Ward's hierarchical clustering algorithm we identified four distinct bundles of FWAs based on the uptake of twelve individual FWAs across the sample of organizations. Bundle 1 represents organizations engaging in a hig...

Population pharmacokinetics of cytarabine, etoposide and daunorubicin in the treatment of acute myeloid leukaemia

DEFF Research Database (Denmark)

Krogh-Madsen, Mikkel; Bender, B.; Jensen, M. K.

2012-01-01

PURPOSE: Interpatient variability in the pharmacokinetics (PK) of cytarabine, etoposide, and daunorubicin following body surface area-adjusted doses calls for studies that point to other covariates to explain this variability. The purpose of this study was to investigate such relationships and gi...... and the relationship between kidney function and etoposide clearance to clinical end points would support dose individualization. Patients with above-normal creatinine clearances and high bWBC may receive sub-optimal treatment due to elevated etoposide clearances....... insights into the PK of this combination treatment. METHODS: A prospective population PK study of twenty-three patients with acute myeloid leukemia was undertaken. Plasma concentrations of patients were determined by high-pressure liquid chromatography. PK models were developed with NONMEM...... in creatinine clearance of 60 mL/min resulted in a decrease in etoposide clearance of 32%. CONCLUSIONS: Population-based models characterized the PK for all three drugs. bWBC was a significant covariate for etoposide and cytarabine and showed a trend for daunorubicin. Linking the significant bWBC relationships...

Nitric oxide and prostaglandins influence local skeletal muscle blood flow during exercise in humans: coupling between local substrate uptake and blood flow

DEFF Research Database (Denmark)

Kalliokoski, Kari K; Langberg, Henning; Ryberg, Ann Kathrine

2006-01-01

-legged dynamic knee-extension exercise. Local blockade was produced by infusing nitro-L-arginine methyl ester and indomethacin directly in the muscle via a microdialysis catheter. Blood flow and glucose uptake were measured in the region of blockade and in two additional regions of vastus lateralis muscle 1......Synergic action of nitric oxide (NO) and prostaglandins (PG) in the regulation of muscle blood flow during exercise has been demonstrated. In the present study, we investigated whether these vasodilators also regulate local blood flow, flow heterogeneity, and glucose uptake within the exercising...... skeletal muscle. Skeletal muscle blood flow was measured in seven healthy young men using near-infrared spectroscopy and indocyanine green and muscle glucose uptake using positron emission tomography and 2-fluoro-2-deoxy-D-[(18)F]glucose without and with local blockade of NO and PG at rest and during one...

Effect of EHDP on calcium accumulation and technetium-99m pyrophosphate uptake in experimental myocardial infarction

International Nuclear Information System (INIS)

Buja, L.M.; Tofe, A.J.; Parkey, R.W.; Francis, M.D.; Lewis, S.E.; Kulkarni, P.V.; Bonte, F.J.; Willerson, J.T.

1981-01-01

Ethane-l-hydroxy-1,1-diphosphonate (EHDP) inhibits bone mineral growth. This study was performed to test the hypothesis that EHDP would interfere with the process of calcium uptake and deposition in evolving myocardial infarction and thereby influence other parameters, including technetium-99m pyrophosphate (Tc-99m PYP) uptake and scintigraphic visualization of the infarcts. Permanent occlusion of the left anterior descending coronary artery (LAD) was produced in beagles. In seven dogs, serum EHDP was maintained at 10-15 μg/ml for 24 hours by continuous i.v. infusion, and seven control dogs were infused with saline. The Tc-99m PYP was infected 2 hours before sacrifice. EHDP-treated dogs showed a mild decrease (20%) in mean calcium content of infarcted myocardium (102.4 +/- 6.4 μg [+/- SEM] per gram wet weight [n = 51] vs 126.7 +/- 9.5 [n = 49] [p -3 ] [n = 46] vs 28.9 +/- 4.3 [n = 46] [p < 0.005]) and a marked decrease (65%) in infarct-to-normal ratio (6.1 +/- 0.9 [n = 6] vs 15.9 +/- 3.7 [n = 6] [p < 0.05]). Positive relationships were demonstrated between myocardial Tc-99m PYP and calcium levels in the EHDP-treated dogs (r = 0.69) and the control dogs (r = 0.77). Infarct size and regional myocardial blood flow changes were similar in the EHDP-treated and control dogs. The average grade (0-4+) of the Tc-99m PYP myocardial scintigrams for infarcts greater than 3.5 g was 2.4 +/- 0.2 for control dogs and 1.1 +/- 0.4 for EHDP-treated dogs (p < 0.05). Thus, EHDP infusion at the dose tested produced a mild decrease in calcium accumulation in canine infarcts; however, it produced a greater reduction in Tc-99m PYP uptake in the infarcts

Introduction and uptake of new medical technologies in the Australian health care system: a qualitative study.

Science.gov (United States)

Gallego, Gisselle; Casey, Robert; Norman, Richard; Goodall, Stephen

2011-10-01

The aim of this study was to explore the views and perceptions of stakeholders about the current national health technology assessment process conducted by the Medical Services Advisory Committee (MSAC) and its role in the uptake and diffusion of new medical technologies in Australia. Data collection occurred over a nine month period (August 2008-April 2009). Twenty in-depth, semi-structured interviews were conducted with individuals from four stakeholders groups: (i) MSAC members and evaluators, (ii) academic and health technology assessment experts, (iii) medical industry representatives and (iv) medical specialists. Interviews were digitally recorded, transcribed verbatim and coded using a constant comparative method. Respondents expressed a consensus opinion that the MSAC process is generally fair and transparent, and has been increasingly so over time. The process was described as "flexible" and "intuitive" yet also "idiosyncratic" due to the nature of the technologies being appraised. Approval by MSAC was generally reported to be increasingly important once a technology becomes more widely used. While successful MSAC approval was felt to be important for widespread distribution of a new technology, it was viewed more as a "facilitator of the uptake of new technologies" as opposed to a primary "driver" of technology uptake. Instead, other factors were identified as providing the actual impetus for the uptake of new technologies, with MSAC approval and reimbursement eventually helping facilitate more widespread diffusion. MSAC's decision making process is perceived as fair but with room for improvement. Its role in the uptake and diffusion of new medical technologies in Australia is limited. MSAC does not act as a barrier to significant market penetration of new procedures and medical technologies. However reimbursement is a trigger for increased use. Copyright © 2011 Elsevier Ireland Ltd. All rights reserved.

Improvement of the WBC calibration of the Internal Dosimetry Laboratory of the CDTN/CNEN using MCNPX code

Energy Technology Data Exchange (ETDEWEB)

Guerra P, F.; Heeren de O, A. [Universidade Federal de Minas Gerais, Departamento de Engenharia Nuclear, Programa de Pos Graduacao em Ciencias e Tecnicas Nucleares, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil); Melo, B. M.; Lacerda, M. A. S.; Da Silva, T. A.; Ferreira F, T. C., E-mail: tcff01@gmail.com [Centro de Desenvolvimento da Tecnologia Nuclear, Programa de Pos Graduacao / CNEN, Av. Pte. Antonio Carlos 6627, 31270-901 Belo Horizonte, Minas Gerais (Brazil)

2015-10-15

The Plan of Radiological Protection licensed by the National Nuclear Energy Commission - CNEN in Brazil includes the risks of assessment of internal and external exposure by implementing a program of individual monitoring which is responsible of controlling exposures and ensuring the maintenance of radiation safety. The Laboratory of Internal Dosimetry of the Center for Development of Nuclear Technology - LID/CDTN is responsible for routine monitoring of internal contamination of the Individuals Occupationally Exposed (IOEs). These are, the IOEs involved in handling {sup 18}F produced by the Unit for Research and Production of Radiopharmaceuticals sources; as well a monitoring of the entire body of workers from the Research Reactor TRIGA IPR-R1/CDTN or whenever there is any risk of accidental incorporation. The determination of photon emitting radionuclides from the human body requires calibration techniques of the counting geometries, in order to obtain a curve of efficiency. The calibration process normally makes use of physical phantoms containing certified activities of the radionuclides of interest. The objective of this project is the calibration of the WBC facility of the LID/CDTN using the BOMAB physical phantom and Monte Carlo simulations. Three steps were needed to complete the calibration process. First, the BOMAB was filled with a KCl solution and several measurements of the gamma ray energy (1.46 MeV) emitted by {sup 40}K were done. Second, simulations using MCNPX code were performed to calculate the counting efficiency (Ce) for the BOMAB model phantom and compared with the measurements Ce results. Third and last step, the modeled BOMAB phantom was used to calculate the Ce covering the energy range of interest. The results showed a good agreement and are within the expected ratio between the measured and simulated results. (Author)

Improvement of the WBC calibration of the Internal Dosimetry Laboratory of the CDTN/CNEN using MCNPX code

International Nuclear Information System (INIS)

Guerra P, F.; Heeren de O, A.; Melo, B. M.; Lacerda, M. A. S.; Da Silva, T. A.; Ferreira F, T. C.

2015-10-01

The Plan of Radiological Protection licensed by the National Nuclear Energy Commission - CNEN in Brazil includes the risks of assessment of internal and external exposure by implementing a program of individual monitoring which is responsible of controlling exposures and ensuring the maintenance of radiation safety. The Laboratory of Internal Dosimetry of the Center for Development of Nuclear Technology - LID/CDTN is responsible for routine monitoring of internal contamination of the Individuals Occupationally Exposed (IOEs). These are, the IOEs involved in handling 18 F produced by the Unit for Research and Production of Radiopharmaceuticals sources; as well a monitoring of the entire body of workers from the Research Reactor TRIGA IPR-R1/CDTN or whenever there is any risk of accidental incorporation. The determination of photon emitting radionuclides from the human body requires calibration techniques of the counting geometries, in order to obtain a curve of efficiency. The calibration process normally makes use of physical phantoms containing certified activities of the radionuclides of interest. The objective of this project is the calibration of the WBC facility of the LID/CDTN using the BOMAB physical phantom and Monte Carlo simulations. Three steps were needed to complete the calibration process. First, the BOMAB was filled with a KCl solution and several measurements of the gamma ray energy (1.46 MeV) emitted by 40 K were done. Second, simulations using MCNPX code were performed to calculate the counting efficiency (Ce) for the BOMAB model phantom and compared with the measurements Ce results. Third and last step, the modeled BOMAB phantom was used to calculate the Ce covering the energy range of interest. The results showed a good agreement and are within the expected ratio between the measured and simulated results. (Author)

Age-related normal uptake of {sup 99m}Tc-MDP in the lower spine

Energy Technology Data Exchange (ETDEWEB)

Sundkvist, G.M.G. [Dept. of Clinical Physiology, Centralsjukhuset, Kristianstad (Sweden); Lilja, B. [Dept. of Clinical Physiology, Universitetssjukhuset MAS, Malmoe (Sweden); Mattsson, S. [Dept. of Radiation Physics, Universitetssjukhuset MAS, Malmoe (Sweden)

1997-03-01

Aim: The uptake of {sup 99m}Tc-MDP in the lower spine was quantified in connection with ordinary bone scintigraphy. Methods: Fifty-seven women and seventy-two men (aged 20-69 y), with no signs of metabolic or malignant disease and no history of back pain or atraumatic fractures, were included in the study. Results: The women showed an increase in {sup 99m}Tc-MDP uptake from the age of 20 y to about 45 y with a decrease from the time of menopause. In contrast to women, the uptake in men showed a slight decrease from the age of 20 y to about 50 y and thereafter a more marked decrease was seen. The major difference between men and women is the high premenopausal uptake in the female skeleton. Conclusion: An understanding of age-related changes in {sup 99m}Tc-MDP uptake, which are indices of the skeletal metabolism, is of importance especially in prevention and treatment of osteoporosis, a common disorder in postmenopausal women. (orig.) [Deutsch] Ziel: In Verbindung mit einer routinemaessigen Skelettszintigraphie wurde die Speicherung von {sup 99m}Tc-MDP in der unteren Wirbelsaeule quantifiziert. Methoden: 57 Frauen und 22 Maenner (Alter von 20-69 Jahren) ohne metabolische oder boesartige Erkrankungen sowie ohne Rueckenschmerzen oder Wirbelsinterungen wurden in die Studien aufgenommen. Ergebnisse: Bei Frauen zeigte sich ein Anstieg der {sup 99m}Tc-MDP-Speicherung zwischen den Altersabschnitten 20 bis 45 Jahre und dann ein Abfall waehrend der Menopause. Im Gegensatz hierzu zeigte sich bei Maennern ein leichter Abfall der Speicherung vom 20. bis 50. Lebensjahr und danach eine noch staerkere Abnahme. Der Hauptunterschied zwischen den Geschlechtern ist die relativ hohe Speicherung im weiblichen Skelett praemenopausal. Schlussfolgerung: Das Verstaendnis der Altersbeziehungen der {sup 99m}Tc-MDP-Speicherung als Indikator des Knochenstoffwechsels ist fuer Praevention und Behandlung der postmenopausalen Osteoporose wichtig. (orig.)

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... for a thyroid scan is 30 minutes or less. Thyroid Uptake You will be given radioactive iodine ( ... for each thyroid uptake is five minutes or less. top of page What will I experience during ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... Scan and Uptake Thyroid scan and uptake uses small amounts of radioactive materials called radiotracers, a special ... is a branch of medical imaging that uses small amounts of radioactive material to diagnose and determine ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... uptake measurements are obtained at different times. For example, you may have uptake measurements at four to ... medicine procedures can be time consuming. It can take several hours to days for the radiotracer to ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... known as a thyroid uptake. It is a measurement of thyroid function, but does not involve imaging. ... eating can affect the accuracy of the uptake measurement. Jewelry and other metallic accessories should be left ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... Uptake? A thyroid scan is a type of nuclear medicine imaging. The radioactive iodine uptake test (RAIU) ... of thyroid function, but does not involve imaging. Nuclear medicine is a branch of medical imaging that ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... radioactive iodine uptake test (RAIU) is also known as a thyroid uptake. It is a measurement of ... potential to identify disease in its earliest stages as well as a patient’s immediate response to therapeutic ...

Effects of Increased Respiratory Resistance on Maximal O2 Uptake and Anaerobic Threshold during Incremental Exercise Tests

OpenAIRE

ÖZÇELİK, Oğuz

2014-01-01

This study was undertaken to assess whether maximal O2 uptake (VO2max) can be used as an index of measuring aerobic capacity under the condition of increased respiratory resistance. Seven male subjects performed two incremental exercise tests on a cycle ergometer on different days: one control (C) and one breathing through an 8 mm bore diameter respiratory resistance (R). Ventilatory and gas exchange responses were measured with a turbine volume transducer and mass spectrometry, and processed...

Thyroid Scan and Uptake

Medline Plus

Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Thyroid Scan and Uptake Thyroid scan and uptake uses ...

The clinical characteristics of twenty-eight idiopathic pulmonary fibrosis cases

International Nuclear Information System (INIS)

Yu Yong; Shi Minhua; Hu Huacheng

2007-01-01

Objective: To summarize the clinical characteristics of idiopathic pulmonary fibrosis (IPF). Methods: The clinical characteristics of twenty-eight cases diagnosed as IPF between 1991 and 2006 were studied retrospectively. Results: Most IPF patients had an insidious onset of progressive dyspnea and non-productive cough. Inspiratory crackles and finger clubbing were also noted in most patients. The most impressive appearance of their radiography was peripheral reticular and nodular opacities, distributed largely at the lung bases. Pulmonary function test showed restrictive impairment and impaired oxygen diffusion. The arterial blood gas analysis revealed type I respiratory failure. One IPF case was complicated with lung cancer. The symptoms of fifteen cases(71.4%) were relieved under the therapy with glucocorticoid. Seven patients died as yet in our group and the middle duration was 24 months. Conclusions: The diagnosis of IPF relies mostly on the clinical characteristics, radiography, pulmonary function test, blood gas analysis and exclusion of other ILD. Atypical cases need lung biopsy to do further the diagnosis. Therapy with glucocorticoid may be effective in some cases. Prognosis in IPF cases complicated with lung cancer is poor. (authors)

Normal cerebral FDG uptake during childhood

International Nuclear Information System (INIS)

London, Kevin; Howman-Giles, Robert

2014-01-01

Current understanding of cerebral FDG uptake during childhood originates from a small number of studies in patients with neurological abnormalities. Our aim was to describe cerebral FDG uptake in a dataset of FDG PET scans in children more likely to represent a normal population. We reviewed cerebral FDG PET scans in children up to 16 years of age with suspected/proven extracranial malignancies and the following exclusions: central nervous system metastases, previous malignancies, previous chemotherapy or radiotherapy, development of cerebral metastases during therapy, neurological conditions, taking antiepileptic medication or medications likely to interfere with cerebral metabolism, and general anaesthesia within 24 h. White matter, basal ganglia, thalamus and the cerebellar cortex were analysed using regional SUV max , and the cerebral cortex, basal ganglia, thalamus and cerebellum were analysed using a regional relative uptake analysis in comparison to maximal cortical uptake. Scans from 30 patients (age range 11 months to 16 years, mean age 10 years 5 months) were included. All regions showed increasing SUV max with age. The parietal, occipital, lateral temporal and medial temporal lobes showed lower rates of increasing FDG uptake causing changing patterns of regional FDG uptake during childhood. The cortical regions showing the most intense uptake in early childhood were the parietal and occipital lobes. At approximately 7 years of age these regions had relatively less uptake than the frontal lobes and at approximately 10 years of age these regions had relatively less uptake than the thalamus. Relative FDG uptake in the brain has not reached an adult pattern by 1 year of age, but continues to change up to 16 years of age. The changing pattern is due to different regional rates of increasing cortical FDG uptake, which is less rapid in the parietal, occipital and temporal lobes than in the frontal lobes. (orig.)

Normal cerebral FDG uptake during childhood

Energy Technology Data Exchange (ETDEWEB)

London, Kevin [The Children' s Hospital at Westmead, Department of Nuclear Medicine, Sydney, NSW (Australia); University of Sydney, Discipline of Paediatrics and Child Health, Sydney Medical School, Sydney, NSW (Australia); Howman-Giles, Robert [The Children' s Hospital at Westmead, Department of Nuclear Medicine, Sydney, NSW (Australia); University of Sydney, Disciplines of Imaging and Paediatrics and Child Health, Sydney Medical School, Sydney, NSW (Australia)

2014-04-15

Current understanding of cerebral FDG uptake during childhood originates from a small number of studies in patients with neurological abnormalities. Our aim was to describe cerebral FDG uptake in a dataset of FDG PET scans in children more likely to represent a normal population. We reviewed cerebral FDG PET scans in children up to 16 years of age with suspected/proven extracranial malignancies and the following exclusions: central nervous system metastases, previous malignancies, previous chemotherapy or radiotherapy, development of cerebral metastases during therapy, neurological conditions, taking antiepileptic medication or medications likely to interfere with cerebral metabolism, and general anaesthesia within 24 h. White matter, basal ganglia, thalamus and the cerebellar cortex were analysed using regional SUV{sub max}, and the cerebral cortex, basal ganglia, thalamus and cerebellum were analysed using a regional relative uptake analysis in comparison to maximal cortical uptake. Scans from 30 patients (age range 11 months to 16 years, mean age 10 years 5 months) were included. All regions showed increasing SUV{sub max} with age. The parietal, occipital, lateral temporal and medial temporal lobes showed lower rates of increasing FDG uptake causing changing patterns of regional FDG uptake during childhood. The cortical regions showing the most intense uptake in early childhood were the parietal and occipital lobes. At approximately 7 years of age these regions had relatively less uptake than the frontal lobes and at approximately 10 years of age these regions had relatively less uptake than the thalamus. Relative FDG uptake in the brain has not reached an adult pattern by 1 year of age, but continues to change up to 16 years of age. The changing pattern is due to different regional rates of increasing cortical FDG uptake, which is less rapid in the parietal, occipital and temporal lobes than in the frontal lobes. (orig.)

Increased muscle glucose uptake during contractions

DEFF Research Database (Denmark)

Ploug, Thorkil; Galbo, Henrik; Richter, Erik

1984-01-01

We reinvestigated the prevailing concept that muscle contractions only elicit increased muscle glucose uptake in the presence of a so-called "permissive" concentration of insulin (Berger et al., Biochem. J. 146: 231-238, 1975; Vranic and Berger, Diabetes 28: 147-163, 1979). Hindquarters from rats...... in severe ketoacidosis were perfused with a perfusate containing insulin antiserum. After 60 min perfusion, electrical stimulation increased glucose uptake of the contracting muscles fivefold. Also, subsequent contractions increased glucose uptake in hindquarters from nondiabetic rats perfused for 1.5 h......-methylglucose uptake increased during contractions and glucose uptake was negative at rest and zero during contractions. An increase in muscle transport and uptake of glucose during contractions does not require the presence of insulin. Furthermore, glucose transport in contracting muscle may only increase if glycogen...

Thyroid Scan and Uptake

Medline Plus

Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician ... of nuclear medicine imaging. The radioactive iodine uptake test (RAIU) is also known as a thyroid uptake. ...

Standardization of a method to calculate absolute renal uptake of 99m Tc-DMSA in children

International Nuclear Information System (INIS)

Ono, Carla Rachel; Sapienza, Marcelo Tatit; Watanabe, Tomoco; Costa, Paulo Luiz Aguirre; Okamoto, Miriam Roseli Yoshie; Garcez, Alexandre Teles; Buchpiguel, Carlos Alberto; Machado, Beatriz Marcondes; Machado, Marcia Melo Campos; Liberato Junior, Waldyr de Paula

2006-01-01

Objective:To standardize a method and determine normal values for absolute renal uptake of 99m Tc-DMSA in children with normal creatinine clearance. Materials and methods: Twenty-two children (between 7 months and 10 years of age; mean 4.5 years) without clinical evidence of renal disease were studied using 99m Tc-DMSA scintigraphy. Eighteen had normal renal ultrasonography, micturating urethrocystography, creatinine clearance and visual interpretation of the scintigraphy with 99m Tc-DMSA. Four children were excluded, one with incomplete creatinine clearance and three due to reduction in the creatinine clearance. Absolute renal uptake of 99m Tc-DMSA (DMSA-Abs) was expressed as the fraction of the administered dose retained by each kidney six hours after administration of the radiopharmaceutical. Results: DMSA-Abs was 21.8 +- 3.2% for the right kidney and 23.1 +-3.3% for the left kidney. There was no correlation between renal uptake and the age groups studied, although there was a tendency to an increase in the creatinine clearance with age. Conclusion: Normal values of DMSA-Abs can be used as an additional parameter for the initial diagnostic evaluation and during follow-up of renal diseases, mainly when bilateral impairment of renal function is suspected or in a patient with a single functioning kidney (in which renal differential function is of limited value). (author)

Barriers and facilitators to uptake of the school-based HPV vaccination programme in an ethnically diverse group of young women.

Science.gov (United States)

Batista Ferrer, Harriet; Trotter, Caroline L; Hickman, Matthew; Audrey, Suzanne

2016-09-01

To identify the barriers and facilitators to uptake of the HPV vaccine in an ethnically diverse group of young women in the south west of England. Three school-based vaccination sessions were observed. Twenty-three young women aged 12 to 13 years, and six key informants, were interviewed between October 2012 and July 2013. Data were analysed using thematic analysis and the Framework method for data management. The priority given to preventing cervical cancer in this age group influenced whether young women received the HPV vaccine. Access could be affected by differing levels of commitment by school staff, school nurses, parents and young women to ensure parental consent forms were returned. Beliefs and values, particularly relevant to minority ethnic groups, in relation to adolescent sexual activity may affect uptake. Literacy and language difficulties undermine informed consent and may prevent vaccination. The school-based HPV vaccination programme successfully reaches the majority of young women. However, responsibility for key aspects remain unresolved which can affect delivery and prevent uptake for some groups. A multi-faceted approach, targeting appropriate levels of the socio-ecological model, is required to address procedures for consent and cultural and literacy barriers faced by minority ethnic groups, increase uptake and reduce inequalities. © The Author 2015. Published by Oxford University Press on behalf of Faculty of Public Health.

Rhizobia symbiosis of seven leguminous species growing along Xindian riverbank of Northern Taiwan

Directory of Open Access Journals (Sweden)

Cheng-Tai Huang

2018-01-01

Full Text Available Legume-rhizobia symbioses of seven leguminous species growing along Xindian riverbank of Northern Taiwan were investigated in this study. These legumes form either determinate or indeterminate types of root nodules. The determinate nodules of Alysicarpus vaginalis, Desmodium. triflorum, D. heterophyllum, Sesbania cannabina and the indeterminate nodules of Mimosa pudica harbored bacteroids of morphological uniformity (length of 1-3 μm, while the indeterminate nodules of Crotalaria zanzibarica and Trifolium repens contained bacteroids of highly pleomorphism (size varying from 1 to 5 μm. The enclosed bacteria were isolated from respective nodules, and twenty slow-growing and nine fast-growing rhizobial isolates were recovered. The slow-growing isolates were classified to the genus Bradyrhizobium based on the 16S rRNA sequences, whereas the fast-growing rhizobia comprise four genera, Neorhizobium, Rhizobium, Cupriavidus and Paraburkholderia. Results of stable isotope analyses revealed that the seven leguminous species had similar and consistently negative δ15N values in leaves (mean of -1.2 ‰, whereas the values were positive (varying from 3.7 to 7.3 ‰ in the nodules. These values were significantly higher in the indeterminate nodules than those in the determinate ones. In addition, variations in the values of leaf δ13C (varying from -29 to -34‰ among the seven legumes were measured, indicating their photosynthetic water use efficiencies were different. This is the first field survey to report the rhizobial diversity and the nutrient relationships of sympatric legume in Taiwan.

Chronic effects of dietary carbohydrate variation on [18F]-2-fluoro-2-deoxyglucose uptake in rodent heart.

Science.gov (United States)

Fine, Eugene J; Miao, Weibing; Koba, Wade; Volek, Jeff S; Blaufox, M Donald

2009-09-01

Measured cardiac [F]-2-fluoro-2-deoxyglucose (FDG) activity in human PET scans is variable despite efforts to standardize patient preparation. Heart uptake can obscure chest disease, and is of physiologic interest. Short-term carbohydrate (CHO) restriction can reduce FDG uptake, although unreliably, whereas long-term restriction of CHO has not been systematically studied. It would be valuable to understand FDG hearts' chronic dietary dependence. Fifteen Wistar rats (age 4 weeks) were randomized to three diet groups (n = 5) of low (0.1% of total energy), intermediate (52%), and high (78%) CHO content (LC, IC, and HC, respectively). After 4 weeks, blood for ketone bodies (KB), glucose, insulin, and glucagon was obtained, followed in 2 days by whole-body PET with 37 MBq FDG. Diet groups were switched every 4 weeks to control for the effects of dietary order. Heart maximal standardized uptake value was compared among animals. Heart mean maximal standardized uptake value was dramatically reduced for LC (3.4+/-0.4; P<0.001) compared with either IC (10.9+/-0.7) or HC (11.0+/-0.7) (P=NS, IC vs. HC). KB (mumol/l) differed widely (P<0.001) in LC (718.6+/-40.0) versus IC (120.3+/-34.0) and HC (99.2+/-32.1) (P=NS, IC vs. HC), whereas glucose, insulin, and glucagon did not differ among the groups. Sustained CHO-restriction results in marked, reproducibly reduced cardiac FDG uptake. Six-fold to seven-fold increased KB concentrations provide alternative substrate to glucose.

Bone marrow uptake of {sup 18}F-fluorodeoxyglucose in Hodgkin lymphoma without bone involvement: comparison between patients with and without B symptoms

Energy Technology Data Exchange (ETDEWEB)

Vale, Rômulo Hermeto Bueno do; Ferraro, Daniela Andrade; Duarte, Paulo Schiavom; Carvalho, Giovana; Lima, Marcos Santos; Coura Filho, George Barbério; Sapienza, Marcelo Tatit; Buchpiguel, Carlos Alberto, E-mail: daniela.ferraro@hc.fm.usp.br [Instituto do Câncer do Estado de São Paulo (ICESP), SP (Brazil)

2018-03-15

Objective: To compare the degree of benign bone marrow uptake of {sup 18}F-fluorodeoxyglucose ({sup 18}F-FDG) between Hodgkin lymphoma patients with and without B symptoms. Materials and Methods: We analyzed the medical charts of 74 Hodgkin lymphoma patients who underwent {sup 18}F-FDG positron emission tomography/computed tomography (PET/CT) prior to the initiation of therapy between October 2010 and September 2013. In all of the patients, the bone marrow biopsy was negative and the {sup 18}F-FDG PET/CT images did not suggest bone marrow involvement. Of the 74 patients evaluated, 54 presented inflammatory (B) symptoms and 20 did not. Regions of interest (ROIs) were drawn on the sternum, the proximal thirds of the humeri, the proximal thirds of the femora, and both iliac wings (totaling seven ROIs per patient). To compare the patients with and without B symptoms, in terms of standardized uptake values (SUVs) for the seven ROIs, we used the Mann-Whitney U test. Results: For six of the ROIs, the SUVs were higher in the patients with B symptoms than in those without, and the difference was statistically significant (p < 0.05). There was also a tendency toward a statistically significant difference between the two groups in terms of the SUV for the right iliac wing ROI (p = 0.06). Conclusion: In our sample, the presence of B symptoms was associated with increased {sup 18}F-FDG uptake in bone marrow. (author)

Radioiodine uptake in inactive pulmonary tuberculosis

International Nuclear Information System (INIS)

Bakheet, S.M.; Powe, J.; Al Suhaibani, H.; Hammami, M.M.; Bazarbashi, M.

1999-01-01

Radioiodine may accumulate at sites of inflammation or infection. We have seen such accumulation in six thyroid cancer patients with a history of previously treated pulmonary tuberculosis. We also review the causes of false-positive radioiodine uptake in lung infection/inflammation. Eight foci of radioiodine uptake were seen on six iodine-123 diagnostic scans. In three foci, the uptake was focal and indistinguishable from thyroid cancer pulmonary metastases from thyroid cancer. In the remaining foci, the uptake appeared nonsegmental, linear or lobar, suggesting a false-positive finding. The uptake was unchanged, variable in appearance or non-persistent on follow-up scans and less extensive than the fibrocystic changes seen on chest radiographs. In the two patients studied, thyroid hormone level did not affect the radioiodine lung uptake and there was congruent gallium-67 uptake. None of the patients had any evidence of thyroid cancer recurrence or of reactivation of tuberculosis and only two patients had chronic intermittent chest symptoms. Severe bronchiectasis, active tuberculosis, acute bronchitis, respiratory bronchiolitis, rheumatoid arthritis-associated lung disease and fungal infection such as Allescheria boydii and aspergillosis can lead to different patterns of radioiodine chest uptake mimicking pulmonary metastases. Pulmonary scarring secondary to tuberculosis may predispose to localized radioiodine accumulation even in the absence of clinically evident active infection. False-positive radioiodine uptake due to pulmonary infection/inflammation should be considered in thyroid cancer patients prior to the diagnosis of pulmonary metastases. (orig.)

Root uptake of transuranic elements

International Nuclear Information System (INIS)

Schulz, R.K.

1977-01-01

The uptake of elements by plant roots is one of the important pathways of entry of many elements into the food chain of man. Data are cited showing plutonium concentration ratios, plant/soil, ranging from 10 -10 to 10 -3 . Concentration ratios for americium range from 10 -7 to 10 +1 . Limited experiments with curium and neptunium indicate that root uptake of curium is similar to that of americium and that plant uptake of neptunium is substantially larger than that of curium and americium. The extreme ranges of concentration ratios cited for plutonium and americium are due to a number of causes. Experimental conditions such as very intensive cropping will lead to abnormally high concentration ratios. In some experiments, addition of chelating agents markedly increased plant root uptake of transuranic elements. Particle size and composition of the source material influenced uptake of the transuranics by plants. Translocation within the plant, and soil factors such as pH and organic matter content, all affect concentration ratios

Significance of retardation of abnormal uptake of iodine-123-beta-methyl-p-iodophenyl-pentadecanoic acid myocardial scintigraphy in patients with vasospastic angina

International Nuclear Information System (INIS)

Inoue, Fumitaka; Hashimoto, Toshio; Uemura, Shiro; Kawamoto, Atsuhiko; Dohi, Kazuhiro; Matsushima, Akihiko

2001-01-01

This study investigated retardation of abnormal uptake of iodine-123-beta-methyl-p-iodophenyl-pentadecanoic acid (BMIPP) scintigraphy in patients with vasospastic angina. Twenty-three patients with vasospastic angina showed abnormal uptake of BMIPP before medical treatment and had coronary vasospasm induced by acetylcholine. The patients were divided into two groups according to uptake of BMIPP after medical treatment: retardation of abnormal uptake of BMIPP (Group R, n=4) and normal uptake of BMIPP (Group N, n=19). Frequency of chest pain, medical treatment and autonomic nervous activity were compared between the two groups. Furthermore, the frequency of chest pain and uptake of BMIPP in group R were obtained after intensive medical treatment. Autonomic nervous activity was evaluated by heart rate variability on Holter electrocardiography. Heart rate variability contained high-frequency elements (HF; 0.15-0.4 Hz) and low-frequency elements (LF; 0.04-0.15 Hz). LF/HF was estimated for sympathetic nervous activity and HF was estimated for parasympathetic nervous activity. Daytime and nighttime autonomic nervous activity were compared between the two groups. The frequency of chest pain was higher in Group R than in Group N (p<0.05). Medical treatment was not different between the two groups. Circadian variation of sympathetic and parasympathetic nervous activity were absent in Group R. During the nighttime, Group R showed higher sympathetic nervous activity (p<0.05) and lower parasympathetic nervous activity (p<0.01) than Group N. The frequency of chest pain was significantly lower after intensive medical treatment (p<0.05), and uptake of BMIPP returned to normal in Group R. We suspected that the disorder in autonomic nervous activity was more severe in Group R, and thus induced coronary vasospasm. Retardation of abnormal uptake of BMIPP in patients with vasospastic angina indicates poor control of coronary vasospasm. Uptake of BMIPP is useful in the evaluation of

Seven steps to curb global warming

International Nuclear Information System (INIS)

Mathews, John

2007-01-01

Based on best current estimates that the world needs to reduce global carbon dioxide emissions by 70% by 2050, and that there is at best a 10-year window of opportunity available to initiate the enormous changes needed, this paper proposes a set of seven self-contained steps that can be taken at a global level to tackle the problem with some prospect of success. The steps are self-financing and practicable, in that they are based on existing technologies. They involve agreement to create a new international agency charged with formulating and policing a global carbon pricing regime; a complementary step involving global monitoring of greenhouse gas emissions utilizing satellite resources; taking steps to compensate developing countries for preserving rainforest as carbon sinks; the dismantling of newly created trade barriers holding back global trade in biofuels; global promotion of a transition to renewable sources of electricity through facilitation of grid interconnections with independent power producers; a global moratorium on the building of new coal-fired power stations; and recycling of carbon revenues to promote uptake of renewable energy sources in developing countries, particularly Brazil, India and China. Taken as a group, it is argued that these steps are both necessary and sufficient. They call for institutional innovations at a global level that are politically difficult but feasible, given the magnitude of the problems addressed

Characterization of cadmium uptake in Lactobacillus plantarum and isolation of cadmium and manganese uptake mutants

Energy Technology Data Exchange (ETDEWEB)

Hao, Z.; Reiske, H.R.; Wilson, D.B.

1999-11-01

Two different Cd{sup 2+} uptake systems were identified in Lactobacillus plantarum. One is a high-affinity, high-velocity Mn{sup 2+} uptake system which also takes up Cd{sup 2+} and is induced by Mn{sup 2+} starvation. The calculated K{sub m} and V{sub max} are 0.26 {mu}M and 3.6 {mu}mol g of dry cell{sup {minus}1} min{sup {minus}1}, respectively. Unlike Mn{sup 2+} uptake, which is facilitated by citrate and related tricarboxylic acids, Cd{sup 2+} uptake is weakly inhibited by citrate. Cd{sup 2+} and Mn{sup 2+} are competitive inhibitors of each other, and the affinity of the system for Cd{sup 2+} is higher than that for Mn{sup 2+}. The other Cd{sup 2+} uptake system is expressed in Mn{sup 2+}-sufficient cells, and no K{sub m} can be calculated for it because uptake is nonsaturable. Mn{sup 2+} does not compete for transport through this system, nor does any other tested cation, i.e., Zn{sup 2+}, Cu{sup 2+}, Co{sup 2+}, Mg{sup 2+}, Ca{sup 2+}, Fe{sup 2+}, or Ni{sup 2+}. Both systems require energy, since uncouplers completely inhibit their activities. Two Mn{sup 2+}-dependent L. plantarum mutants were isolated by chemical mutagenesis and ampicillin enrichment. They required more than 5,000 times as much Mn{sup 2+} for growth as the parental strain. Mn{sup 2+} starvation-induced Cd{sup 2+} uptake in both mutants was less than 5% the wild-type rate. The low level of long-term Mn{sup 2+} or Cd{sup 2+} accumulation by the mutant strains also shows that the mutations eliminate the high-affinity Mn{sup 2+} and Cd{sup 2+} uptake system.

Can Spatiotemporal Fluoride (18F-) Uptake be Used to Assess Bone Formation in the Tibia? A Longitudinal Study Using PET/CT.

Science.gov (United States)

Lundblad, Henrik; Karlsson-Thur, Charlotte; Maguire, Gerald Q; Jonsson, Cathrine; Noz, Marilyn E; Zeleznik, Michael P; Weidenhielm, Lars

2017-05-01

spherical volume of interest drawn on the registered volumes. To make the semiquantitative data comparable for all patients with multiple examinations, the SUVmean and SUVmax difference per day (SUVmeanDPD and SUVmaxDPD) between the first PET/CT scan and each subsequent one was calculated. Indicators of poor healing progress were (1) uneven distribution of the radionuclide uptake between ends of the bones that were supposed to heal as seen in the video or, (2) low absolute magnitude of the SUV difference data. Twenty-four patients treated between October 2013 and April 2015 with a TSF gave informed consent to be examined with 18 F - PET/CT bone scans. Twenty-two patients successfully completed treatment, one of whom had only one PET/CT scan. Observation of 18 F - uptake was able to identify three patients whose healing progress was poor, indicated by uneven distribution of radionuclide uptake across the ends of the bones that were supposed to heal. An absolute magnitude of the SUVmaxDPD of 0.18 or greater indicated good bone formation progress. This was verified in 10 patients by the days between the operation to attach and to remove the TSF being less than 250 days, whereas other SUVmaxDPD values were ambiguous, with 11 patients achieving successful completion. Observation of the spatiotemporal uptake of 18 F - appears to be a promising method to enable the clinician to assess the progress of bone formation in different parts of the bone. Bone uptake which is uneven across the ends of bone that were supposed to heal or very low bone uptake might indicate impaired bone healing where early intervention may then be needed. However, semiquantification of 18 F - uptake (SUVmaxDPD), SUVmeanDPD) was ambiguous in showing consistency with the bone-healing progress. Level III, diagnostic study.

Muscle glycogen content and glucose uptake during exercise in humans: influence of prior exercise and dietary manipulation

DEFF Research Database (Denmark)

Steensberg, Adam; van Hall, Gerrit; Keller, Charlotte

2002-01-01

on two occasions: one after 60 min of two-legged cycling (16 h prior to the experimental trial) followed by a high carbohydrate diet (HCHO) and the other after the same exercise followed by a low carbohydrate diet (LCHO) (Series 2). Muscle glycogen was decreased by 40 % when comparing the pre-exercised......There are many factors that can influence glucose uptake by contracting skeletal muscle during exercise and although one may be intramuscular glycogen content, this relationship is at present not fully elucidated. To test the hypothesis that muscle glycogen concentration influences glucose uptake...... during exercise, 13 healthy men were studied during two series of experiments. Seven men completed 4 h of two-legged knee extensor exercise 16 h after reducing of muscle glycogen by completing 60 min of single-legged cycling (Series 1). A further six men completed 3 h of two-legged knee extensor exercise...

Uptake of iodine-123-α-methyl tyrosine by gliomas and non-neoplastic brain lesions

International Nuclear Information System (INIS)

Kuwert, T.; Morgenroth, C.; Woesler, B.; Matheja, P.; Palkovic, S.; Vollet, B.; Samnick, S.; Maasjosthusmann, U.; Lerch, H.; Gildehaus, F.J.; Wassmann, H.; Schober, O.

1996-01-01

Using single-photon emission tomography (SPET), the radiopharmaceutical L-3-iodine-123-α-methyl tyrosine (IMT) has been applied to the imaging of amino acid transport into brain tumours. It was the aim of this study to investigate whether IMT SPET is capable of differentiating between high-grade gliomas, low-grade gliomas and non-neoplastic brain lesions. To this end, IMT uptake was determined in 53 patients using the triple-headed SPET camera MULTISPECT 3. Twenty-eight of these subjects suffered from high-grade gliomas (WHO grade III or IV), 12 from low-grade gliomas (WHO grade II), and 13 from non-neoplastic brain lesions, including lesions after effective therapy of a glioma (five cases), infarctions (four cases), inflammatory lesions (three cases), infarctions (four cases), inflammatory lesions (three cases) and traumatic haematoma (one case). IMT uptake was significantly higher in high-grade gliomas than in low-grade gliomas and non-neoplastic lesions. IMT uptake by low-grade gliomas was not significantly different from that by non-neoplastic lesions. Diagnostic sensitivity and specificity were 71% and 83% for differentiating high-grade from low-grade gliomas, 82% and 100% for distinguishing high-grade gliomas from non-neoplastic lesions, and 50% and 100% for discriminating low-grade gliomas from non-neoplastic lesions. Analogously to positron emission tomography with radioactively labelled amino acids and fluorine-18 deoxyglucose, IMT SPET may aid in differentiating higc-grade gliomas from histologically benign brain tumours and non-neoplastic brain lesions; it is of only limited value in differentiating between non-neoplastic lesions and histologically benign brain tumours. (orig.)

Calculation of hydrogen and oxygen uptake in fuel rod cladding during severe accidents using the integral diffusion method -- Preliminary design report

International Nuclear Information System (INIS)

Siefken, L.J.

1999-01-01

Preliminary designs are described for models of hydrogen and oxygen uptake in fuel rod cladding during severe accidents. Calculation of the uptake involves the modeling of seven processes: (1) diffusion of oxygen from the bulk gas into the boundary layer at the external cladding surface, (2) diffusion from the boundary layer into the oxide layer, (3) diffusion from the inner surface of the oxide layer into the metallic part of the cladding, (4) uptake of hydrogen in the event that the cladding oxide layer is dissolved in a steam-starved region, (5) embrittlement of cladding due to hydrogen uptake, (6) cracking of cladding during quenching due to its embrittlement and (7) release of hydrogen from the cladding after cracking of the cladding. An integral diffusion method is described for calculating the diffusion processes in the cladding. Experimental results are presented that show a rapid uptake of hydrogen in the event of dissolution of the oxide layer and a rapid release of hydrogen in the event of cracking of the oxide layer. These experimental results are used as a basis for calculating the rate of hydrogen uptake and the rate of hydrogen release. The uptake of hydrogen is limited to the equilibrium solubility calculated by applying Sievert's law. The uptake of hydrogen is an exothermic reaction that accelerates the heatup of a fuel rod. An embrittlement criteria is described that accounts for hydrogen and oxygen concentration and the extent of oxidation. A design is described for implementing the models for hydrogen and oxygen uptake and cladding embrittlement into the programming framework of the SCDAP/RELAP5 code. A test matrix is described for assessing the impact of the proposed models on the calculated behavior of fuel rods in severe accident conditions. This report is a revision and reissue of the report entitled; ''Preliminary Design Report for Modeling of Hydrogen Uptake in Fuel Rod Cladding During Severe Accidents.''

Soil ingestion may be an important route for the uptake of contaminants by some reptiles.

Science.gov (United States)

Rich, C Nelson; Talent, Larry G

2009-02-01

Some species of reptiles regularly ingest soil in the wild. Therefore, we evaluated the importance of soil ingestion as a route for the uptake of contaminants in lizards. We used sand as a substitute for soil during the present study. Different groups of leopard geckos (Eublepharis macularius) were provided with a control and five sodium selenite-spiked sand mixtures during a 28-d study. Twenty lizards were assigned to a control group and to each of five selenium-spiked sand mixtures that consisted of nominal selenium (Se) concentrations of 0.05, 0.46, 4.57, 11.41, and 22.83 mg Se/kg dry sand. Leopard geckos readily ingested the Se-spiked sand. We observed concentration-related effects in several endpoints. Overall growth in body mass was the most sensitive endpoint and was significantly (p leopard geckos appear to be as sensitive to sodium selenite as birds and mammals. The present study suggests that ingestion of soil could be an important potential route for the uptake of soil contaminants in some reptiles and should be evaluated in ecotoxicological studies and risk analyses of reptiles.

Radioiodine uptake by plants from soils

International Nuclear Information System (INIS)

Sabova, T.

1976-01-01

The uptake and accumulation of radioiodine by wheat, maize and peas from various types of soil have been studied. The uptake depends on the type of soil, on its content of organic matter and on the amount of fertilizer. Radioiodine is mainly accumulated in the roots. Accumulation in above-ground plant parts decreases in the following order: wheat, maize, peas. Uptake was highest from humus and clay soils and lowest from black and meadow soils. Application of chloride fertilizer or carrier iodine lead to an increase of radioiodine uptake in the whole plant. (author)

Kinetics of 3H-serotonin uptake by platelets in infantile autism and developmental language disorder (including five pairs of twins)

International Nuclear Information System (INIS)

Katsui, T.; Okuda, M.; Usuda, S.; Koizumi, T.

1986-01-01

The kinetics of 5-HT uptake by platelets was studied in cases of infantile autism and developmental language disorder (DLD) and normal subjects. Two patients of the autism group were twins, and the seven patients of the DLD group were members of four pairs of twins. The Vmax values (means +/- SD) for autism and DLD were 6.46 +/- .90 pmol 5-HT/10(7) cells/min and 4.85 +/- 1.50 pmol 5-HT/10(7) cells/min, respectively. These values were both significantly higher than that of 2.25 +/- .97 pmole 5-HT/10(7) cells/min for normal children. The Km values of the three groups were not significantly different. Data on the five pairs of twins examined suggested that the elevated Vmax of 5-HT uptake by platelets was determined genetically

Kinetics of 3H-serotonin uptake by platelets in infantile autism and developmental language disorder (including five pairs of twins)

Energy Technology Data Exchange (ETDEWEB)

Katsui, T.; Okuda, M.; Usuda, S.; Koizumi, T.

1986-03-01

The kinetics of 5-HT uptake by platelets was studied in cases of infantile autism and developmental language disorder (DLD) and normal subjects. Two patients of the autism group were twins, and the seven patients of the DLD group were members of four pairs of twins. The Vmax values (means +/- SD) for autism and DLD were 6.46 +/- .90 pmol 5-HT/10(7) cells/min and 4.85 +/- 1.50 pmol 5-HT/10(7) cells/min, respectively. These values were both significantly higher than that of 2.25 +/- .97 pmole 5-HT/10(7) cells/min for normal children. The Km values of the three groups were not significantly different. Data on the five pairs of twins examined suggested that the elevated Vmax of 5-HT uptake by platelets was determined genetically.

Insulin resistance and maximal oxygen uptake

DEFF Research Database (Denmark)

Seibaek, Marie; Vestergaard, Henrik; Burchardt, Hans

2003-01-01

BACKGROUND: Type 2 diabetes, coronary atherosclerosis, and physical fitness all correlate with insulin resistance, but the relative importance of each component is unknown. HYPOTHESIS: This study was undertaken to determine the relationship between insulin resistance, maximal oxygen uptake......, and the presence of either diabetes or ischemic heart disease. METHODS: The study population comprised 33 patients with and without diabetes and ischemic heart disease. Insulin resistance was measured by a hyperinsulinemic euglycemic clamp; maximal oxygen uptake was measured during a bicycle exercise test. RESULTS......: There was a strong correlation between maximal oxygen uptake and insulin-stimulated glucose uptake (r = 0.7, p = 0.001), and maximal oxygen uptake was the only factor of importance for determining insulin sensitivity in a model, which also included the presence of diabetes and ischemic heart disease. CONCLUSION...

Isolation of Borrelia burgdorferi from the blood of seven patients with Lyme disease.

Science.gov (United States)

Nadelman, R B; Pavia, C S; Magnarelli, L A; Wormser, G P

1990-01-01

Borrelia burgdorferi, the etiologic agent of Lyme disease, has rarely been successfully cultured from blood. We report on seven patients from Westchester County, New York, with B. burgdorferi bacteremia diagnosed between April 1987 and August 1987. One hundred thirty-two attempts to isolate spirochetes were made on blood specimens obtained from 104 patients. Twenty-two of these specimens were obtained from nine patients who had recently been bitten by Ixodes ticks but who were asymptomatic. Heparinized blood or serum specimens (0.2 to 0.4 mL) were inoculated onto 6 mL of modified Barbour-Stoenner-Kelly medium. Lyme serology was performed by enzyme-linked immunosorbent polyvalent, IgM, and IgG assays, fluorescent immunoassay, and microhemagglutination. Four of the seven patients had erythema migrans, two had facial nerve palsy, and one had a flu-like syndrome without rash. These patients represented 21% (four of 19) of all patients with the characteristic skin lesion who had blood cultures for B. burgdorferi, and 40% (two of five) of all those with facial nerve palsy. Serologic testing was frequently nonreactive; two patients had no detectable antibody on multiple sera by five different assays. All patients improved with antibiotic treatment, and had negative subsequent blood cultures, but five of seven had persistent complaints after completion of therapy. Culturing blood for B. burgdorferi may be useful in confirming the diagnosis of Lyme disease in selected patients. Use of spirochete blood cultures may facilitate a better understanding of the pathogenesis and natural history of Lyme disease.

Use of rice seedlings to estimate uptake of radiocesium from soil to plants in Fukushima Prefecture

International Nuclear Information System (INIS)

Fujimura, Shigeto; Suzuki, Yasukazu; Ohno, Takeshi

2013-01-01

The uptake of radiocesium to plants from the soil is affected by many environmental factors, and it is difficult to determine the contribution of uptake among these factors. In addition, these environmental factors should be investigated independently for each field. The aim of this study was to develop a practical and simple method for the estimate of uptake of radiocesium from soil to plants. Rice seedlings were used to estimate the root uptake of radiocesium from seven different soils. To confirm that the seedlings were the effective indicator, the concentration of "1"3"7Cs in the seedlings was compared with that in brown rice and sunflower. The seedlings were cultivated for a week from germination in a phytotron and the concentrations of "1"3"7Cs in the seedlings above ground were determined. To obtain brown rice and sunflower, rice and sunflower were cultivated either in a pot (1/5000 a Wagner pot, 4000 cm"3) placed in a glasshouse or in a paddy field in Fukushima prefecture for two to four months. The concentration of "1"3"7Cs in the rice seedlings ranged from 150 to 1900 Bq kg"-"1, and that in brown rice and sunflower ranged from 2 to 880 Bq kg"-"1 and from 580 to 3900 Bq kg"-"1, respectively. The Spearman's rank correlation coefficient between the measured concentration of "1"3"7Cs in rice seedlings and the measured concentration of "1"3"7Cs in brown rice and sunflower was 1.0 (p < 0.001 and p = 0.09, respectively). This suggests that the use of rice seedlings in this experiment over a period of two weeks provides an effective indicator for the uptake of "1"3"7Cs from soil to plants over a longer period of time. (author)

Use of rice seedlings to estimate uptake of radiocesium from soil to plants in Fukushima Prefecture

International Nuclear Information System (INIS)

Fujimura, Shigeto; Suzuki, Yasukazu; Ohno, Takeshi

2012-01-01

The uptake of radiocesium to plants from the soil is affected by many environmental factors, and it is difficult to determine the contribution of uptake among these factors. In addition, these environmental factors should be investigated independently for each field. The aim of this study was to develop a practical and simple method for the estimate of uptake of radiocesium from soil to plants. Rice seedlings were used to estimate the root uptake of radiocesium from seven different soils. To confirm that the seedlings were the effective indicator, the concentration of 137 Cs in the seedlings was compared with that in brown rice and sunflower. The seedlings were cultivated for a week from germination in a phytotron and the concentrations of 137 Cs in the seedlings above ground were determined. To obtain brown rice and sunflower, rice and sunflower were cultivated either in a pot (1/5000 a Wagner pot, 4000 cm 3 ) placed in a glasshouse or in a paddy field in Fukushima prefecture for two to four months. The concentration of 137 Cs in the rice seedlings ranged from 150 to 1900 Bq kg -1 , and that in brown rice and sunflower ranged from 2 to 880 Bq kg -1 and from 580 to 3900 Bq kg -1 , respectively. The Spearman's rank correlation coefficient between the measured concentration of 137 Cs in rice seedlings and the measured concentration of 137 Cs in brown rice and sunflower was 1.0 (p < 0.001 and p = 0.09, respectively). This suggests that the use of rice seedlings in this experiment over a period of two weeks provides an effective indicator for the uptake of 137 Cs from soil to plants over a longer period of time. (author)

The effect of three different (-135°C whole body cryotherapy exposure durations on elite rugby league players.

Directory of Open Access Journals (Sweden)

James Selfe

Full Text Available BACKGROUND: Whole body cryotherapy (WBC is the therapeutic application of extreme cold air for a short duration. Minimal evidence is available for determining optimal exposure time. PURPOSE: To explore whether the length of WBC exposure induces differential changes in inflammatory markers, tissue oxygenation, skin and core temperature, thermal sensation and comfort. METHOD: This study was a randomised cross over design with participants acting as their own control. Fourteen male professional first team super league rugby players were exposed to 1, 2, and 3 minutes of WBC at -135°C. Testing took place the day after a competitive league fixture, each exposure separated by seven days. RESULTS: No significant changes were found in the inflammatory cytokine interleukin six. Significant reductions (p<0.05 in deoxyhaemoglobin for gastrocnemius and vastus lateralis were found. In vastus lateralis significant reductions (p<0.05 in oxyhaemoglobin and tissue oxygenation index (p<0.05 were demonstrated. Significant reductions (p<0.05 in skin temperature were recorded. No significant changes were recorded in core temperature. Significant reductions (p<0.05 in thermal sensation and comfort were recorded. CONCLUSION: Three brief exposures to WBC separated by 1 week are not sufficient to induce physiological changes in IL-6 or core temperature. There are however significant changes in tissue oxyhaemoglobin, deoxyhaemoglobin, tissue oxygenation index, skin temperature and thermal sensation. We conclude that a 2 minute WBC exposure was the optimum exposure length at temperatures of -135°C and could be applied as the basis for future studies.

Thyroid uptake software

International Nuclear Information System (INIS)

Alonso, Dolores; Arista, Eduardo

2003-01-01

The DETEC-PC software was developed as a complement to a measurement system (hardware) able to perform Iodine Thyroid Uptake studies. The software was designed according to the principles of Object oriented programming using C++ language. The software automatically fixes spectrometric measurement parameters and besides patient measurement also performs statistical analysis of a batch of samples. It possesses a PARADOX database with all information of measured patients and a help system with the system options and medical concepts related to the thyroid uptake study

Clinical impact of abnormal FDG uptake in pulmonary nodules detected by CT in patients with only history of non-lung cancers

International Nuclear Information System (INIS)

Wong, C.O.; Nunez, R.; Welsh, R.J.; Chmielewski, G.W.; Hill, E.A.; Hill, J.C.; Ravikrishnan, K.P.; Darlene Fink-Bennett; Dworkin, H.J.

2001-01-01

Objective: The aim is to assess the clinical impact of positive FDG uptake in single (SPN) or multiple (MPN) pulmonary nodules detected by CT in patients with known past history of non-lung cancers (but no known lung cancers). Materials and Methods: Twenty-eight sequential patients with non-lung cancers (15 breast, 8 colon, 5 prostate) referred for evaluation of SPN or MPN by PET over a period of two years were included. F-18 FDG PET images, covering chest and upper abdomen, were interpreted blindly and then correlated with CT findings for the precise location of abnormal FDG uptake in the chest. Results: There was a significant number of abnormal FDG uptake in both SPN or MPN. Positive abnormal uptake suggestive of malignancy was found in 25% of patients in the form of SPN and 39% of patients in the form of MPN (p<0.03). Positive cases in the pattern of multiple foci of pulmonary uptake were attributed to metastatic disease. Otherwise positive cases were followed by tissue diagnosis and/or surgical attention. The negative cases were followed clinically. Of the 11 positive cases of MPN, 2 patients (18%) showed only abnormal FDG uptake in just one of the nodules, which was later confirmed at surgery to be a primary cancer of lung in both patients. Conclusion: These results suggest that PET scan would be just as useful in patients with SPN and known non-lung cancers as other patients with no history of any cancers. Not all patients with non-lung cancer and MPN have pulmonary metastasis by PET criteria. PET may single out a primary lung malignancy in patients with non-lung cancer and MPN. PET has thus great clinical impact in these patients with pulmonary nodules and known non-lung cancers as the management would otherwise be completely different in situations revealed by the study

Circulating Docosahexaenoic Acid Associates with Insulin-Dependent Skeletal Muscle and Whole Body Glucose Uptake in Older Women Born from Normal Weight Mothers

Directory of Open Access Journals (Sweden)

Robert M. Badeau

2017-02-01

Full Text Available Background: Obesity among pregnant women is common, and their offspring are predisposed to obesity, insulin resistance, and diabetes. The circulating metabolites that are related to insulin resistance and are associated with this decreased tissue-specific uptake are unknown. Here, we assessed metabolite profiles in elderly women who were either female offspring from obese mothers (OOM or offspring of lean mothers (OLM. Metabolic changes were tested for associations with metrics for insulin resistance. Methods: Thirty-seven elderly women were separated into elderly offspring from obese mothers (OOM; n = 17 and elderly offspring from lean/normal weight mothers (OLM; n = 20 groups. We measured plasma metabolites using proton nuclear magnetic resonance (1H-NMR and insulin-dependent tissue-specific glucose uptake in skeletal muscle was assessed. Associations were made between metabolites and glucose uptake. Results: Compared to the OLM group, we found that the docosahexaenoic acid percentage of the total long-chain n-3 fatty acids (DHA/FA was significantly lower in OOM (p = 0.015. DHA/FA associated significantly with skeletal muscle glucose uptake (GU (p = 0.031 and the metabolizable glucose value derived from hyperinsulinemic-euglycemic clamp technique (M-value in the OLM group only (p = 0.050. Conclusions: DHA/FA is associated with insulin-dependent skeletal muscle glucose uptake and this association is significantly weakened in the offspring of obese mothers.

Physiological FDG uptake in the palatine tonsils

International Nuclear Information System (INIS)

Kawabe, Joji; Okamura, Terue; Shakudo, Miyuki

2001-01-01

In clinical F-18 fluorodeoxyglucose (FDG) positron emission tomography (PET) studies of the head and neck region, remarkable symmetric tonsillar FDG uptake is sometimes observed. We determined the incidence and degree of tonsillar FDG uptake and investigated the significance of tonsillar FDG uptake. Between June 1998 and August 1998, we obtained informed consent from 17 patients who were scheduled to undergo a FDG-PET study for their own disease (11 men and 6 women; aged 22 to 77 yr) and who did not have head and neck disease to perform FDG-PET scanning of the head and neck region in addition to their target organs. The incidence and degree of tonsillar FDG uptake were determined. Remarkable tonsillar FDG uptake was found in 9 patients. The SUVs of these FDG uptakes ranged from 2.48 to 6.75, with a mean of 4.29±1.20 (SD). Tonsillar FDG uptakes in the remaining 8 patients were not remarkable, and their SUVs ranged from 1.93 to 3.31, with a mean of 2.46±0.45. Head and neck disease does not appear to have been responsible for the increase in tonsillar FDG uptake. Differences among tonsillar FDG uptake in these 17 patients without head and neck disease appear to reflect differences in activity of ''physiological'' inflammation of the palatine tonsils. (author)

Effect of duration of fasting and diet on the myocardial uptake of F-18-2-fluoro-2-deoxyglucose (F-18 FDG) at rest

International Nuclear Information System (INIS)

Kumar, Pankaj; Patel, Chetan D; Singla, Suhas; Malhotra, A

2014-01-01

Patterns of myocardial fluoro-2-deoxyglucose (FDG) uptake with respect to duration of fasting and dietary modifications. We observed the effect of duration of fasting and diet on the myocardial uptake pattern of F-18 FDG in patients routinely referred for oncological evaluation and no previous history of Coronary Artery Disease (CAD). Prospective study. A total of 153 patients (M: 81, F: 72; mean age: 47 ± 15 years; mean blood glucose level (mBG) 105 ± 23 mg/dl) were randomly divided in three groups. Group A: 4-6 h fasting; Group B: Overnight fasting (12–14 h); Group C: Low carbohydrate and fat rich diet for 2 days coupled with overnight fasting prior to the positron emission tomography (PET) scan. FDG uptake was classified as following: 1) homogeneous uptake, 2) heterogeneous uptake, and 3) ‘no uptake’ in the left ventricular (LV) myocardium. FDG PET study was performed as standard protocol for oncological conditions. Descriptive statistics, Chi-square test or Fisher's exact test, and Spearman's rank correlation tests were applied. We observed the ‘no uptake’ pattern in five (10%), 28 (55%), and 39 (77%), ‘heterogeneous’ pattern in 20 (39%), 14 (28%), and seven (14%), and ‘homogeneous’ pattern in 26 (51%), nine (18%), and five (10%) patients in Group A, B, and C, respectively. There was statistically significant difference of myocardial uptake pattern between group A and B (P < 0.0001), between group A and C (P < 0.0001), and between Group B and C (P = 0.023). The mBG was 102, 105, and 111 mg/dl in ‘no uptake’, heterogeneous, and homogeneous uptake pattern, respectively, (P = 0.103). Also, within each group the mBG was not related to the uptake pattern. Both restricted diet and duration of fasting play an important role in determining the pattern and suppression of myocardial F-18 FDG uptake. Overnight fasting and restricted diet together suppress myocardial FDG uptake more than overnight fasting alone, which suppresses uptake

Detoxification of mercury pollutant leached from spent fluorescent lamps using bacterial strains.

Science.gov (United States)

Al-Ghouti, Mohammad A; Abuqaoud, Reem H; Abu-Dieyeh, Mohammed H

2016-03-01

The spent fluorescent lamps (SFLs) are being classified as a hazardous waste due to having mercury as one of its main components. Mercury is considered the second most toxic heavy metal (arsenic is the first) with harmful effects on animal nervous system as it causes different neurological disorders. In this research, the mercury from phosphor powder was leached, then bioremediated using bacterial strains isolated from Qatari environment. Leaching of mercury was carried out with nitric and hydrochloric acid solutions using two approaches: leaching at ambient conditions and microwave-assisted leaching. The results obtained from this research showed that microwave-assisted leaching method was significantly better in leaching mercury than the acid leaching where the mercury leaching efficiency reached 76.4%. For mercury bio-uptake, twenty bacterial strains (previously isolated and purified from petroleum oil contaminated soils) were sub-cultured on Luria Bertani (LB) plates with mercury chloride to check the bacterial tolerance to mercury. Seven of these twenty strains showed a degree of tolerance to mercury. The bio-uptake capacities of the promising strains were investigated using the mercury leached from the fluorescent lamps. Three of the strains (Enterobacter helveticus, Citrobacter amalonaticus, and Cronobacter muytjensii) showed bio-uptake efficiency ranged from 28.8% to 63.6%. Copyright © 2015 Elsevier Ltd. All rights reserved.

Nuclear medicine imaging of diabetic foot infection

International Nuclear Information System (INIS)

Capriotti, Gabriela; D'Alessandria, Calogero; Signore, Alberto; Chianelli, Marco; Prandini, Napoleone

2005-01-01

Full text: Osteomyelitis of the foot is the most frequent complication in diabetic patients. Nuclear medicine plays an important role in diagnosis and for therapy follow-up, using different tracers. We reviewed 57 papers on diabetic foot imaging (published from 1982 to 2004, 50 original papers and 7 reviews), for a total of 2889 lesions. Data analysis has been carried out to establish which imaging technique could be used as a 'gold standard' for diagnosis of infection and to evaluate the extent of disease and to monitor the efficacy of therapy. Data analysis revealed that three-phase bone-scan is sensitive but not specific whereas specificity and diagnostic accuracy of 99m Tc-WBC scintigraphy is higher than 111 In- WBC scintigraphy. In the forefoot leukocyte scintigraphy may be useful for diagnosis of osteomyelitis and for monitoring the response to medical treatment. In the mid/hind foot the leukocytes uptake is not related only to the presence of infected region, but it is attributed to inflammation, fractures and reparative processes. Other radiopharmaceuticals such as 99m Tc/ 111 In-HIG, radiolabelled antibody and their fragments, showed high sensibility, but lower specificity than WBC (96.8/66.5, 95.8/70.2, 91.3/62 vs 85.8/84.5). Conclusion: It emerged that in the forefoot when clinical suspicious of osteomyelitis is low and medical treatment is contemplated, three-phase bon scan is the procedure of choice. A positive test is not diagnostic for osteomyelitis, and radiolabelled WBC scintigraphy is necessary. In the mid/hind foot, diagnosis of neuropathic joint with infection is problematic. Radiolabelled WBC imaging is probably the most accurate test for determining the presence of infection. Although a negative study strongly indicate the absence of osteomyelitis, it is important to note that a positive result requires a complementary study with marrow agent. (author)

Hydrogen uptake by Azolla-Anabaena

International Nuclear Information System (INIS)

Ruschel, A.P.; Freitas, J.R. de; Silva, P.M.

1984-01-01

The hydrogen uptake in the Azolla-Anabaena system is studied. Tritium is used as tracer. Plants are incubated under different atmosphere composition: a) Air + 3 H 2 ; b) Air + CO 2 + 3 H 2 + CO; c) Air + 3 H 2 + CO; d) Air + CO 2 + 3 H 2 + CO to study the pathway of absorbed hydrogen in the Azolla - Anabaena system. Azolla-Anabaena showed greater hydrogen uptake under argonium atmosphere than under air. Carbon monoxide decreased hydrogen uptake. There are evidences of recycling of the hydrogen evolved through notrogenease. (Author) [pt

Evolutionary relationships of ATP-Binding Cassette (ABC) uptake porters.

Science.gov (United States)

Zheng, Wei Hao; Västermark, Åke; Shlykov, Maksim A; Reddy, Vamsee; Sun, Eric I; Saier, Milton H

2013-05-06

The ATP-Binding Cassette (ABC) functional superfamily includes integral transmembrane exporters that have evolved three times independently, forming three families termed ABC1, ABC2 and ABC3, upon which monophyletic ATPases have been superimposed for energy-coupling purposes [e.g., J Membr Biol 231(1):1-10, 2009]. The goal of the work reported in this communication was to understand how the integral membrane constituents of ABC uptake transporters with different numbers of predicted or established transmembrane segments (TMSs) evolved. In a few cases, high resolution 3-dimensional structures were available, and in these cases, their structures plus primary sequence analyses allowed us to predict evolutionary pathways of origin. All of the 35 currently recognized families of ABC uptake proteins except for one (family 21) were shown to be homologous using quantitative statistical methods. These methods involved using established programs that compare native protein sequences with each other, after having compared each sequence with thousands of its own shuffled sequences, to gain evidence for homology. Topological analyses suggested that these porters contain numbers of TMSs ranging from four or five to twenty. Intragenic duplication events occurred multiple times during the evolution of these porters. They originated from a simple primordial protein containing 3 TMSs which duplicated to 6 TMSs, and then produced porters of the various topologies via insertions, deletions and further duplications. Except for family 21 which proved to be related to ABC1 exporters, they are all related to members of the previously identified ABC2 exporter family. Duplications that occurred in addition to the primordial 3 → 6 duplication included 5 → 10, 6 → 12 and 10 → 20 TMSs. In one case, protein topologies were uncertain as different programs gave discrepant predictions. It could not be concluded with certainty whether a 4 TMS ancestral protein or a 5 TMS ancestral protein

Comparison of I-123 IMP cerebral uptake and MR spectroscopy following experimental carotid occlusion

International Nuclear Information System (INIS)

Holman, B.L.; Jolesz, F.A.; Polak, J.F.; Kronauge, J.F.; Adams, D.F.

1985-01-01

Both I-123 IMP scintigraphy and MRI have been suggested as sensitive detectors of changes shortly after acute cerebral infarction. We compared the uptake of N-isopropyl I-123 p-iodoamphetamine (IMP) and MR spectroscopy of the brain after internal carotid artery ligation. Thirteen gerbils were lightly anesthetized with ether. After neck dissection, an internal carotid artery was occluded. After 2.8 hours, 100 muCi I-123 IMP was injected intravenously into the 13 experimental animals plus three controls. Seven gerbils remained asymptomatic while six developed hemiparesis. At 3 hours after ligation, the animals were killed. The brains were bisected and T1 and T2 relaxation times were determined for the right and left hemispheres by MR spectroscopy immediately after dissection. I-123 IMP uptake was then determined in the samples. Interhemispheric differences in uptake for I-123 IMP were 0.1 +/- 1.7% (SEM) in the control, 33.5 +/- 10% in the asymptomatic and 54.6 +/- 9.7% in the symptomatic animals. Significant differences were seen with I-123 IMP in 6/7 asymptomatic and 6/6 symptomatic animals. In conclusion, I-123 is more sensitive than T1 or T2 relaxation times for the detection of cerebral perfusion abnormalities. Prolongation in T1 and T2 relaxation times correlates closely with increased brain tissue water content and the development of symptoms, indicators of structural brain damage and probable infarction

Uptake of benzyladenine by excised watermelon cotyledons.

Science.gov (United States)

Lampugnani, M G; Fantelli, R; Longo, G P; Longo, C P; Rossi, G

1981-07-01

The uptake of 8-[(14)C]N(6)-benzyladenine (BA) was studied in excised watermelon (Citrullus vulgaris Schrad.) cotyledons 24 hours after the start of imbibition. The passive nature of this uptake is suggested by the following evidence: (a) no sign of saturation on increasing external concentration of BA; (b) no decrease in uptake under conditions that inhibit ATP synthesis; (c) no change in amount of radioactivity absorbed when cotyledons are frozen and thawed before the uptake test. About two-thirds of the radioactivity taken up is released after 12 hours of washing. If the washing is performed at 2 C very little radioactivity is released.There seems to be a correlation between the level of radioactivity (i.e. of BA + derivatives) present in the cotyledons and the magnitude of hormonal responses that are observed four days after uptake. This relationship holds regardless of whether a given level of radioactivity has been reached after a short period of uptake or after a long period of uptake followed by washing.

Gastric gallium-67 uptake in gastritis

International Nuclear Information System (INIS)

Yeh, E.L.; Tisdale, P.L.; Zielonka, J.S.

1983-01-01

Even though Ga-67 imaging has been used widely in the diagnosis of malignant as well as inflammatory lesions, its uptake in the stomach has been reported in the literature mainly in gastric lymphoma and carcinoma. As shown in this case, intense gastric uptake of the radionuclide may be seen in common gastritis without malignancy. Perhaps the benign gastric uptake of Ga-67 deserves more emphasis

Uptake of breast cancer preventive therapy in the UK: results from a multicentre prospective survey and qualitative interviews.

Science.gov (United States)

Hackett, Julia; Thorneloe, Rachael; Side, Lucy; Wolf, Michael; Horne, Rob; Cuzick, Jack; Smith, Samuel G

2018-04-24

Uptake of preventive therapy for women at increased breast cancer risk in England is unknown following the introduction of UK clinical guidelines in 2013. Preventive therapy could create socioeconomic inequalities in cancer incidence if it is more readily accepted by particular socio-demographic groups. In this multicentre study, we investigated uptake of tamoxifen and evaluated socio-demographic and clinical factors associated with initiation. We explored women's experiences of treatment decision-making using qualitative interview data. Between September 2015 and December 2016, women (n = 732) attending an appointment at one of 20 centres in England to discuss breast cancer risk were approached to complete a survey containing socio-demographic details and nulliparity. Of the baseline survey respondents (n = 408/732, 55.7% response rate), self-reported uptake of tamoxifen at 3-month follow-up was reported in 258 (63.2%). Sixteen women participated in semi-structured interviews. One in seven (38/258 = 14.7%) women initiated tamoxifen. Women who had children were more likely to report use of tamoxifen than those without children (OR = 5.26; 95%CI: 1.13-24.49, p = 0.035). Interview data suggested that women weigh up risks and benefits of tamoxifen within the context of familial commitments, with exposure to significant other's beliefs and experiences of cancer and medication a basis for their decision. Uptake of tamoxifen is low in clinical practice. There were no socio-demographic differences in uptake, suggesting that the introduction of breast cancer preventive therapy is unlikely to create socioeconomic inequalities in cancer incidence. Women's decision-making was influenced by familial priorities, particularly having children.

21 CFR 862.1715 - Triiodothyronine uptake test system.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Triiodothyronine uptake test system. 862.1715... Systems § 862.1715 Triiodothyronine uptake test system. (a) Identification. A triiodothyronine uptake test... plasma. Measurements of triiodothyronine uptake are used in the diagnosis and treatment of thyroid...

Uptake of myocardial imaging agents by rejected hearts

International Nuclear Information System (INIS)

Bergsland, J.; Carr, E.A.; Carroll, M.; Wright, J.W.; Feldman, M.J.; Massucci, J.; Bhayana, J.N.; Gona, J.M.

1985-01-01

Technetium 99 m pyrophosphate, Gallium 67 and Thallium 201 uptakes were measured in heterotopically transplanted rat hearts. Five days after transplantation, Technetium 99 m pyrophosphate, and Gallium 67 uptakes were significantly higher in allogeneic grafts than in syngeneic grafts. At an early stage of rejection (three days after transplantation), only Technetium 99 m pyrophosphate uptake in the left ventricle of allogeneic grafts showed a significant difference (p less than 0.04). At five days, Thallium 201 uptake was significantly lower in allo- than syngeneic grafts. There was a positive correlation between radionuclide uptake and histologic degree of rejection for Technetium 99 m pyrophosphate and Gallium 67 while Thallium 201 uptake correlated negatively. Analysis of variance revealed that hearts with no or minimal rejection had statistically different uptakes than hearts with mild to moderate rejection. These results suggest that uptake of imaging agents might be useful in the diagnosis of rejection of the transplanted heart

Seven challenges for neuroscience.

Science.gov (United States)

Markram, Henry

2013-01-01

Although twenty-first century neuroscience is a major scientific enterprise, advances in basic research have not yet translated into benefits for society. In this paper, I outline seven fundamental challenges that need to be overcome. First, neuroscience has to become "big science" - we need big teams with the resources and competences to tackle the big problems. Second, we need to create interlinked sets of data providing a complete picture of single areas of the brain at their different levels of organization with "rungs" linking the descriptions for humans and other species. Such "data ladders" will help us to meet the third challenge - the development of efficient predictive tools, enabling us to drastically increase the information we can extract from expensive experiments. The fourth challenge goes one step further: we have to develop novel hardware and software sufficiently powerful to simulate the brain. In the future, supercomputer-based brain simulation will enable us to make in silico manipulations and recordings, which are currently completely impossible in the lab. The fifth and sixth challenges are translational. On the one hand we need to develop new ways of classifying and simulating brain disease, leading to better diagnosis and more effective drug discovery. On the other, we have to exploit our knowledge to build new brain-inspired technologies, with potentially huge benefits for industry and for society. This leads to the seventh challenge. Neuroscience can indeed deliver huge benefits but we have to be aware of widespread social concern about our work. We need to recognize the fears that exist, lay them to rest, and actively build public support for neuroscience research. We have to set goals for ourselves that the public can recognize and share. And then we have to deliver on our promises. Only in this way, will we receive the support and funding we need.

Uptake and transport of chromium in plants

International Nuclear Information System (INIS)

Ramachandran, V.; D'souza, T.J.; Mistry, K.B.

1980-01-01

The uptake of chromium, an important soil and water pollutant, by five different plant species was examined in nutrient culture experiments using chromium-51 as a tracer. The concentration in aerial tissues of both trivalent and hexavalent forms of chromium was the greatest in peas followed by beans, tomato and the cereals over identical uptake periods. The uptake of 51 Cr 3+ was, in general, greater than 51 CrO 4 2- . Studies with bean plants indicated that shoot uptake of both forms of chromium decreased with increasing pH and salt concentration of the external solution. Concentrations of 10 -4 M and 10 -5 M DNP inhibited 51 Cr uptake by bean shoots. (author)

Radioiodine uptake measurements in thyroid

International Nuclear Information System (INIS)

Kadireshn, A.; Kapur, S.C.; Samuel, J.R.; Mahajan, M.K.

1988-01-01

Evaluation of thyroid function can be carried out by measuring the uptake of orally administered radioactive iodine. The results of the thyroid uptake measurements for the period 1982-1987 in Christian Medical College, Ludhiana are presented here. About 3000 patients were screened during the analysis period. (author)

Octreotide Uptake in Parathyroid Adenoma

Directory of Open Access Journals (Sweden)

Seyhan Karaçavuş

2012-08-01

Full Text Available The patient with a history of bone pain and muscle weakness, was thought to have oncogenic osteomalacia as a result of biochemical investigations and directed to Nuclear Medicine Department for a whole-body bone scintigraphy and 111In-octreotide scintigraphy. There was no focal pathologic tracer uptake, but generalized marked increase in skeletal uptake on bone scintigraphy. Octreotide scintigraphy showed accumulation of octreotide in the region of the left lobe of the thyroid gland in the neck. Thereafter, parathyroid scintigraphy was performed with technetium-99m labeled metroxy-isobutyl-isonitryl (99mTc-MIB and MIBI scan demonstrated radiotracer uptake at the same location with octreotide scintigraphy. The patient underwent left inferior parathyroidectomy and histopathology confirmed a parathyroid adenoma. Somatostatin receptor positive parathyroid adenoma may show octreotide uptake. Octreotide scintigraphy may be promising and indicate a possibility of using somatostatin analogues for the medical treatment of somatostatin receptor positive parathyroid tumors. (MIRT 2012;21:77-79

Sudden increase in atmospheric concentration reveals strong coupling between shoot carbon uptake and root nutrient uptake in young walnut trees

International Nuclear Information System (INIS)

Delaire, M.; Sigogne, M.; Beaujard, F.; Frak, E.; Adam, B.; Le Roux, X.

2005-01-01

Short-term effects of a sudden increase in carbon dioxide concentration on nutrient uptake by roots during vegetative growth was studied in young walnut trees. Rates of carbon dioxide uptake and water loss by individual trees were determined by a branch bag method from three days before and six days after carbon dioxide concentration was increased. Nutrient uptake rates were measured concurrently by a hydroponic recirculating nutrient solution system. Carbon dioxide uptake rates increased greatly with increasing atmospheric carbon dioxide; nutrient uptake rates were proportional to carbon dioxide uptake rates, except for the phosphorus ion. Daily water loss rates were only slightly affected by elevated carbon dioxide. Overall, it was concluded that in the presence of non-limiting supplies of water and nutrients, root nutrient uptake and shoot carbon assimilation are strongly coupled in the short term in young walnut trees despite the important carbon and nutrient storage capacities od woody species. 45 refs., 7 figs

Aquaporins and root water uptake

Science.gov (United States)

Water is one of the most critical resources limiting plant growth and crop productivity, and root water uptake is an important aspect of plant physiology governing plant water use and stress tolerance. Pathways of root water uptake are complex and are affected by root structure and physiological res...

Cell uptake survey of pegylated nanographene oxide.

Science.gov (United States)

Vila, M; Portolés, M T; Marques, P A A P; Feito, M J; Matesanz, M C; Ramírez-Santillán, C; Gonçalves, G; Cruz, S M A; Nieto, A; Vallet-Regi, M

2012-11-23

Graphene and more specifically, nanographene oxide (GO) has been proposed as a highly efficient antitumoral therapy agent. Nevertheless, its cell uptake kinetics, its influence in different types of cells and the possibility of controlling cellular internalization timing, is still a field that remains unexplored. Herein, different cell types have been cultured in vitro for several incubation periods in the presence of 0.075 mg ml(-1) pegylated GO solutions. GO uptake kinetics revealed differences in the agent's uptake amount and speed as a function of the type of cell involved. Osteoblast-like cells GO uptake is higher and faster without resulting in greater cell membrane damage. Moreover, the dependence on the commonly used PEG nature (number of branches) also influences the viability and cell uptake speed. These facts play an important role in the future definition of timing parameters and selective cell uptake control in order to achieve an effective therapy.

Cell uptake survey of pegylated nanographene oxide

International Nuclear Information System (INIS)

Vila, M; Nieto, A; Vallet-Regi, M; Portolés, M T; Feito, M J; Matesanz, M C; Ramírez-Santillán, C; Marques, P A A P; Gonçalves, G; Cruz, S M A

2012-01-01

Graphene and more specifically, nanographene oxide (GO) has been proposed as a highly efficient antitumoral therapy agent. Nevertheless, its cell uptake kinetics, its influence in different types of cells and the possibility of controlling cellular internalization timing, is still a field that remains unexplored. Herein, different cell types have been cultured in vitro for several incubation periods in the presence of 0.075 mg ml −1 pegylated GO solutions. GO uptake kinetics revealed differences in the agent’s uptake amount and speed as a function of the type of cell involved. Osteoblast-like cells GO uptake is higher and faster without resulting in greater cell membrane damage. Moreover, the dependence on the commonly used PEG nature (number of branches) also influences the viability and cell uptake speed. These facts play an important role in the future definition of timing parameters and selective cell uptake control in order to achieve an effective therapy. (paper)

99mTc-DPD uptake in juvenile arthritis

International Nuclear Information System (INIS)

Stender Hansen, E.; Holm, I.E.; Buenger, C.; Knudsen, V.; Noer, I.; Bach Christensen, S.

1986-01-01

Unilateral arthritis of the knee was induced in mongrel puppies by intraarticular injections of 1% Carragheenan. Bone metabolism was studied by a scintimetric technique on static 99m Tc-diphosphonate bone scans every 2nd week during the induction of arthritis for 3 months and monthly in a postarthritic phase of another 3 months. Changes in uptake of radionuclide were present after 2 weeks. The induction phase was characterized by a decreased uptake in the calcification layer of the juxta-articular growth plates and a moderately increased epiphyseal uptake. The postarthritic phase was characterized by normalization of growth plate uptake and a marked increase in epiphyseal uptake. Using contact autoradiography, the epiphyseal uptake was seen mainly in a narrow subchondral and subsynovial bone layer, around bone cysts and osteophytes, whereas central epiphyseal bone was osteopenic with decreased uptake of tracer. The study suggests that the early scintigraphic appearance of juvenile non-suppurative arthritis may be an overall decrease in uptake of 99m Tc-diphosphonate due to a depression of growth plate metabolism. (author)

The features of HPOA on dynamic bone scintigraphy: A reflection of underlying pathophysiology

International Nuclear Information System (INIS)

Bernard, E.J.; Howman-Giles, R.; Macauley, D.I.; Uren, R.F.

1998-01-01

Full text: Hypertrophic pulmonary osteoarthropathy (HPOA) is the clinical syndrome of clubbing, arthritis and periostitis which may accompany a spectrum of underlying disease processes. Increased blood flow through involved extremities is an invariable accompaniment of the syndrome and it is hypothesised that the chronic increase in peripheral blood flow results in the known pathological changes of periosteal inflammation and proliferation, oedema, synovial congestion and exudation and hyperplasia of the finger pulp. The dynamic and blood pool phases of bone scintigraphy provide a unique tool for examining the vascular changes in bone and soft tissues and we describe the previously unreported features of the dynamic bone scan in HPOA. We performed three-phase bone scans on two adolescent patients with cystic fibrosis with knee discomfort. Both studies showed marked hyperaemia to the knees. On the blood pool phase, hyperaemia was seen to the tissues closely related to the periosteum of the long bones in upper and lower limbs, periarticular tissues and finger pulps. The delayed images showed the classic features of HPOA with linear uptake of tracer in the shafts and metaphyseal regions of the long bones and minor periarticular uptake of tracer. A WBC scan performed in one patient showed WBC accumulation in the periosteum of the metaphyseal regions, extending in the shafts, of the distal femurs and proximal tibias. Negligible WBC accumulation was seen in the synovium of the knees reflecting the non-inflammatory nature of the articular changes as is described in most patients with HPOA. In conclusion, the dynamic phases of the bone scan examination in HPOA reflect the pivotal underlying pathophysiological process of abnormally increased blood flow to the periosteal and periarticular tissues of involved long bones and finger pulps and further expands the known diagnostic features of this disease on bone scintigraphy

21 CFR 868.1730 - Oxygen uptake computer.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Oxygen uptake computer. 868.1730 Section 868.1730...) MEDICAL DEVICES ANESTHESIOLOGY DEVICES Diagnostic Devices § 868.1730 Oxygen uptake computer. (a) Identification. An oxygen uptake computer is a device intended to compute the amount of oxygen consumed by a...

The twenty-eight lodges (xiu 宿)

OpenAIRE

Morgan, Daniel Patrick

2018-01-01

The twenty-eight lodges (xiu 宿). Named and numbered in the central circle, the twenty-eight lodges, represent uneven orange-segment-like divisions of the celestial sphere running from pole to pole through the ‘guide stars’ (juxing 距星) at/near the western extremity of the constellations after which they are named. In the inner circle are the modern identifications of those guide stars. In the outer circle are the equatorial lodge widths in contemporary use in du 度 / days, where the number of d...

Heavy metals and their radionuclides uptake by Bacillus Licheniformis

International Nuclear Information System (INIS)

Ramadan, A.A.; Ahmed, M.M.; Abo-state, M.A.M.; Sarhan, M.; Faroqe, M.

2007-01-01

Bacillus licheniformis is a gram positive spore forming bacterium. Different concentrations of cobalt affected the ability of Co uptake and growth of Bacillus licheniformis. As the concentration increased, both the uptake and growth were decreased. Maximum Co uptake was found at ph 7.0, while for growth was ph 8.0. The optimum temperature for uptake and growth was 40 degree C and 20% inoculum size represents the maximum cobalt uptake by Bacillus licheniformis. Also, maximum uptake was recorded after 72 hours, incubation period. As the concentration of cesium was increased till 400 mg/l, the uptake was also increased. The optimum cesium uptake and growth was at ph 8.0. The optimum growth was at 45 degree C while Cs uptake was found at 35 degree C and 15% inoculum size represented the maximum Cs uptake. After 72 hour incubation period, maximum Cs uptake was recorded. Generally, Bacillus licheniformis removed more than 80% of Co and 50% of Cs from the broth medium. Addition of clay to Bacillus licheniformis increased both Co or Cs uptake. Bacillus licheniformis was gamma resistant and 10 KGy reduced the viability by 5.3 log cycles. The irradiated and non-irradiated cultures can grow on 500 or 700 mg Co or Cs. Bacillus licheniformis removed 99.32% of the Co radionuclides and 99.28% of Cs radionuclides

Correlation between 5-Minute {sup 99m}Tc-Pertechnetate Uptake and 24-Hour {sup 131}I Uptake in Patients with Thyroid Disease

Energy Technology Data Exchange (ETDEWEB)

Lee, Chan Woo; Won, Kyu Chang; Yoon, Hyun Dae; Cho, In Ho; Kim, Tae Nyeun; Shin, Dong Gu; Lee, Hyoung Woo; Shim, Bong Sup; Lee, Hyun Woo [Yeungnam University School of Medicine, Daegu (Korea, Republic of)

1992-07-15

The 20-minute {sup 99m}Tc-pertechnetate uptake became readily available for routine use and it replaced {sup 131}I for thyroid imaging. However measuring thyroid uptake during a 5-minute minimizes pertechnetate uptake by the salivary glands and presence of contaminated saliva from those glands in to the pharynx and esophagus. A study was carried out to determine the suitability of the utility of a 5-minute and 20-minute interval from administration of {sup 99m}Tc-pertechnetate to imaging and uptake measurement as a replacement for the 24 hour standard originally established with {sup 131}I, and to evaluate the relationship between 5-minute {sup 99m}Tc-pertechnetate uptake and other thyroid functions. A 5-minute and 20-minute uptake of {sup 99m}Tc-pertechnetate were measured in 70 patients with thyroid disease at Yeungnam University Hospital from March 1, 1991 to Feb. 29, 1992. The results were as follows. 1) The 5-minute {sup 99m}Tc-pertechnetate uptake in Graves' disease, Hashimoto's thyroiditis, simple goiter non toxic nodular goiter, subacute thyroiditis and euthyroid were 18.2%, 14.6%, 2.8%, 3.2%, 1.2% and 1.1%, respectively. There was a significant difference between the mean of the euthyroid group and the mean of the Graves' disease. So differentiation between them can be easily made. 2) The 5 minute {sup 99m}Tc- pertechnetate thyroid uptake was well correlated with 24 hour {sup 131}I thyroid uptake (r=0.75, p<0.001). These data provided an equation for estimating the 24 hour uptake of iodide given the 5 minute pertechnetate uptake: Estimated 24-hour '1{sup 31}I thyroid Uptake = 7.188{sup *}In (5 minute {sup 99m}Tc-Pertechnetate uptake)+16.94 3) The 20-minute {sup 99m}Tc-pertechnetate thyroid uptake was well correlated with 24-hour {sup 131}I uptake (r=0.72, p<0.001) and 5-minute {sup 99m}Tc-pertechnetate thyroid uptake (r=0.96, p<0.001). 4) In the Graves' disease, The 5-minute {sup 99m}Tc-pertechnetate thyroid uptake was well

Proceedings: Twenty years of energy policy: Looking toward the twenty-first century

International Nuclear Information System (INIS)

1992-01-01

In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy

Proceedings: Twenty years of energy policy: Looking toward the twenty-first century

Energy Technology Data Exchange (ETDEWEB)

1992-12-31

In 1973, immediately following the Arab Oil Embargo, the Energy Resources Center, University of Illinois at Chicago initiated an innovative annual public service program called the Illinois Energy Conference. The objective was to provide a public forum each year to address an energy or environmental issue critical to the state, region and nation. Twenty years have passed since that inaugural program, and during that period we have covered a broad spectrum of issues including energy conservation nuclear power, Illinois coal, energy policy options, natural gas, alternative fuels, new energy technologies, utility deregulation and the National Energy Strategy.

Interventions promoting the acceptance and uptake of generic medicines: a narrative review of the literature.

Science.gov (United States)

Babar, Z U D; Kan, S W; Scahill, S

2014-09-01

The objective of this paper was to undertake a narrative review of the literature regarding strategies and interventions promoting the acceptance and uptake of generic medicines. A literature search was performed between November 2011 and January 2012 to identify published full text original research articles documenting interventions to promote the use of generic medicines. Keywords used were: "generic medicine", "generic drug", "intervention", "promotion", "acceptance", "uptake", "generic/therapeutic substitution" and their related root words. The electronic databases comprised of Embase (1980 - present), Google, Google Scholar, Medline (1948 - present), PubMed, Science Direct, Scopus, Springer Link and The Cochrane Library. An interpretative narrative synthesis was undertaken and emergent themes analysed and reported. Eighteen studies were included in the final analysis. There were seven main themes which including; education, financial incentives, advertising to promote generic medicines, free generic medicine trials, administrative forms and medicines use review (MUR). These themes were further classified into subthemes. Education was subdivided into consumer and physician education. Financial incentives included the influence of financial incentives on both consumers and physicians. The subthemes in the financial incentives category included the changes in co-payment for consumers, reward payment for physicians and fund-holding schemes. Advertising included the sub-themes of print media and the use of anthropomorphic images, while free generic medicines trial was made up of free vouchers for generic medicines and generic medicines sampling system. The studies have mixed results; some interventions in some settings were useful, while others were not. Not all interventions consistently improved the uptake of generic medicines. There was limited literature available and further work is required to develop a range of interventions to support the uptake of generic

Why the American public supports twenty-first century learning.

Science.gov (United States)

Sacconaghi, Michele

2006-01-01

Aware that constituent support is essential to any educational endeavor, the AOL Time Warner Foundation (now the Time Warner Foundation), in conjunction with two respected national research firms, measured Americans' attitudes toward the implementation of twenty-first century skills. The foundation's national research survey was intended to explore public perceptions of the need for changes in the educational system, in school and after school, with respect to the teaching of twenty-first century skills. The author summarizes the findings of the survey, which were released by the foundation in June 2003. One thousand adults were surveyed by telephone, including African Americans, Latinos, teachers, and business executives. In general, the survey found that Americans believe today's students need a "basics-plus" education, meaning communication, technology, and critical thinking skills in addition to the traditional basics of reading, writing, and math. In fact, 92 percent of respondents stated that students today need different skills from those of ten to twenty years ago. Also, after-school programs were found to be an appropriate vehicle to teach these skills. Furthermore, the survey explored how well the public perceives schools to be preparing youth for the workforce and postsecondary education, which twenty-first century skills are seen as being taught effectively, and the level of need for after-school and summer programs. The survey results provide conclusive evidence of national support for basics-plus education. Thus, a clear opportunity exists to build momentum for a new model of education for the twenty-first century.

Uranium uptake of Vetiveria zizanioides (L.) Nash

International Nuclear Information System (INIS)

Luu Viet Hung; Maslov, O.D.; Trinh Thi Thu My; Phung Khac Nam Ho; Dang Duc Nhan

2010-01-01

Uranium uptake of vetiver grass (Vetiveria zizanioides (L.) Nash) from Eutric Fluvisols (AK), Albic Acrisols (BG), Dystric Fluvisols (HP) and Ferralic Acrisols (TC) in northern Vietnam is assessed. The soils were mixed with aqueous solution of uranyl nitrate to make soils contaminated with uranium at 0, 50, 100, 250 mg/kg before planting the grass. The efficiency of uranium uptake by the grass was assessed based on the soil-to-plant transfer factor (TF U , kg·kg -1 ). It was found that the TF U values are dependent upon the soils properties. CEC facilitates the uptake and the increased soil pH could reduce the uptake and translocation of uranium in the plant. Organic matter content, as well as iron and potassium, inhibits the uranium uptake of the grass. It was revealed that the lower fertile soil, the higher uranium uptake. The translocation of uranium in root for all the soil types studied is almost higher than that in its shoot. It seems that vetiver grass could potentially be used for the purpose of phytoremediation of soils contaminated with uranium

Monocyte transferrin-iron uptake in hereditary hemochromatosis

International Nuclear Information System (INIS)

Sizemore, D.J.; Bassett, M.L.

1984-01-01

Transferrin-iron uptake by peripheral blood monocytes was studied in vitro to test the hypothesis that the relative paucity of mononuclear phagocyte iron loading in hereditary hemochromatosis results from a defect in uptake of iron from transferrin. Monocytes from nine control subjects and 17 patients with hemochromatosis were cultured in the presence of 59Fe-labelled human transferrin. There was no difference in 59Fe uptake between monocytes from control subjects and monocytes from patients with hemochromatosis who had been treated by phlebotomy and who had normal body iron stores. However, 59Fe uptake by monocytes from iron-loaded patients with hemochromatosis was significantly reduced compared with either control subjects or treated hemochromatosis patients. It is likely that this was a secondary effect of iron loading since iron uptake by monocytes from treated hemochromatosis patients was normal. Assuming that monocytes in culture reflect mononuclear phagocyte iron metabolism in vivo, this study suggests that the relative paucity of mononuclear phagocyte iron loading in hemochromatosis is not related to an abnormality in transferrin-iron uptake by these cells

Hg uptake in ureteral obstructions

International Nuclear Information System (INIS)

Desgrez, J.P.; Bourguignon, M.; Raynaud, C.; CEA, 91 - Orsay

1976-01-01

In the presence of a total obstruction the results obtained with the Hg uptake test, as indeed with other functional tests, inform on the value of the kidney function at the time but have no prognostic value where repair possibilities are concerned. Some preliminary results seem to show however that very soon after the obstacle is removed, by the 10th or 15th day perhaps, quantitative functional tests may once more be used to evaluate the functional prognosis. This would mean that by waiting about two weeks after the disappearance of a total obstruction the Hg uptake test may again be used in all confidence. In order to check this deduction, which is based on slender evidence but which nevertheless has important practical implications, the measurement of the Hg uptake rate during the days following removal of the obstacle appears essential. In long-standing partial obstructions the Hg uptake rate gives an accurate assessment of the functional balance and helps considerably in the choice of therapy [fr

Siderophore production by pathogenic mucorales and uptake of deferoxamine B.

Science.gov (United States)

Larcher, Gérald; Dias, Marylène; Razafimandimby, Bienvenue; Bomal, Danielle; Bouchara, Jean-Philippe

2013-12-01

Clinical reports have established that mucormycosis, mainly caused by Rhizopus spp., frequently occurs in patients treated with deferoxamine B (DFO, Desferal(®)) which is misappropriated by these fungi. Siderophore production by twenty mucoralean isolates was therefore investigated using a commercial iron-depleted culture medium. Siderophore production was detected for most of the isolates. Our experiments confirmed that feroxamine B (iron chelate of DFO) promoted in vitro growth of Rhizopus arrhizus. Electrophoretic analysis of somatic extracts revealed iron-regulated proteins of 60 and 32 kDa which were lacking in iron-depleted culture conditions. Using a fluorescent derivative of deferoxamine B, we showed by fluorescence microscopy the entry of the siderophore within the fungal cells, thus suggesting a shuttle mechanism encompassing the uptake of the entire siderophore-ion complex into the cell. This useful tool renders possible a better understanding of iron metabolism in Mucorales which could lead to the development of new diagnostic method or new antifungal therapy using siderophores as imaging contrast agents or active drug vectors.

Twenty lectures on thermodynamics

CERN Document Server

Buchdahl, H A

2013-01-01

Twenty Lectures on Thermodynamics is a course of lectures, parts of which the author has given various times over the last few years. The book gives the readers a bird's eye view of phenomenological and statistical thermodynamics. The book covers many areas in thermodynamics such as states and transition; adiabatic isolation; irreversibility; the first, second, third and Zeroth laws of thermodynamics; entropy and entropy law; the idea of the application of thermodynamics; pseudo-states; the quantum-static al canonical and grand canonical ensembles; and semi-classical gaseous systems. The text

Measuring the serotonin uptake site using [3H]paroxetine--a new serotonin uptake inhibitor

International Nuclear Information System (INIS)

Gleiter, C.H.; Nutt, D.J.

1988-01-01

Serotonin is an important neurotransmitter that may be involved in ethanol preference and dependence. It is possible to label the serotonin uptake site in brain using the tricyclic antidepressant imipramine, but this also binds to other sites. We have used the new high-affinity uptake blocker paroxetine to define binding to this site and report it to have advantages over imipramine as a ligand

Ocean carbon uptake and storage

International Nuclear Information System (INIS)

Tilbrook, Bronte

2007-01-01

Full text: The ocean contains about 95% of the carbon in the atmosphere, ocean and land biosphere system, and is of fundamental importance in regulating atmospheric carbon dioxide concentrations. In the 1990s an international research effort involving Australia was established to determine the uptake and storage of anthropogenic C02 for all major ocean basins. The research showed that about 118 of the 244 + 20 billion tons of the anthropogenic carbon emitted through fossil fuel burning and cement production has been stored in the ocean since preindustrial times, thus helping reduce the rate of increase in atmospheric C02. The research also showed the terrestrial biosphere has been a small net source of C02 (39 ± 28 billion tons carbon) to the atmosphere over the same period. About 60% of the total ocean inventory of the anthropogenic C02 was found in the Southern Hemisphere, with most in the 30 0 S to 50 0 S latitude band. This mid-latitude band is where surface waters are subducted as Mode and Intermediate waters, which is a major pathway controlling ocean C02 uptake. High storage (23% of the total) also occurs in the North Atlantic, associated with deep water formation in that basin. The ocean uptake and storage is expected to increase in the coming decades as atmospheric C02 concentrations rise. However, a number of feedback mechanisms associated with surface warming, changes in circulation, and biological effects are likely to impact on the uptake capacity. The accumulation or storage-of the C02 in the ocean is also the major driver of ocean acidification with potential to disrupt marine ecosystems. This talk will describe the current understanding of the ocean C02 uptake and storage and a new international research strategy to detect how the ocean uptake and storage will evolve on interannual through decadal scales. Understanding the ocean response to increasing atmospheric C02 will be a key element in managing future C02 increases and establishing

The Twenty Statement Test in Teacher Development

Directory of Open Access Journals (Sweden)

Ahmet Aypay

2011-10-01

Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed.

The Twenty Statement Test in Teacher Development

Directory of Open Access Journals (Sweden)

Ahmet Aypay

2011-04-01

Full Text Available The purpose of this study is to describe teacher characteristics using Twenty Statements Test (TST. Study group includes a total of thirty-five individuals, including teachers, guidance and counselors and research assistants. The study used a qualitative approach on teacher identity. TST is one of the qualitative methods that were used to determine individual self-conceptualization. Study group were requested to write twenty statements that describe themselves responding to the question “Who I am?” in a free format. The findings indicated that teachers were overwhelmingly in group c (reflective. No differences were found in terms of gender and profession. Only few significant differences have been found based on marital status. The utility of TST in teacher training and development was discussed

P-32 uptake in lentic algae

International Nuclear Information System (INIS)

Strange, J.R.; Williamson, G.D.; Fletcher, D.J.

1975-01-01

A study of the Flat Creek Embayment of Lake Sidney Lanier near Gainesville, Georgia revealed three genera of algae, Chlorococcum, Fragillaria and Nostoc, to be prominent in this eutrophic region of the lake. The algae was grown in phosphate-rich media and subsequently labelled with P-32. All species incorporated luxury amounts of phosphorus as determined by the uptake of P-32. The results indicate that the P-32 uptake is proportional to the surface-per-volume ratio. The higher surface-per-volume ratio resulted in greater uptake of P-32

Citrate and succinate uptake by potato mitochondria

International Nuclear Information System (INIS)

Jung, D.W.; Laties, G.G.

1979-01-01

Potato mitochondria, in the absence of respiration, have a very low capacity for uptake by exchange with endogenous anions, taking up only 2.4 nanomoles citrate and 2.0 nanomoles succinate per milligram protein. Maximum citrate uptake of over 17 nanomoles per milligram protein occurs in the presence of inorganic phosphate, a dicarboxylic acid, and an external energy source (NADH), conditions where net anion accumulation proceeds, mediated by the interlinking of the inorganic phosphate, dicarboxylate, and tricarboxylate carriers. Maximum succinate uptake in the absence of respiratory inhibitors requires only added inorganic phosphate. Compounds which inhibit respiration (antimycin), the exchange carriers (mersalyl and benzylmalonate), or the establishment of the membrane proton motive force (uncouplers) reduce substrate accumulation. A potent inhibitor of the citrate carrier in animal mitochondria, 1,2,3-benzenetricarboxylic acid, does not inhibit citrate uptake in potato mitochondria. Citrate uptake is reduced by concurrent ADP phosphorylation and this reduction is sensitive to oligomycin. The initiation of state 3 after a 3-minute substrate state results in a reduction of the steady-state of citrate uptake by approximately 50%. Accumulation of succinate initially is inhibited by increasing sucrose concentration in the reaction medium from 50 to 400 millimolar. Limited substrate uptake is one of the factors responsible for the often observed depressed initial state 3 respiration rates in many mitochondrial preparations. Since nonlimiting levels of substrate in the matrix cannot be attained by energy-independent exchange, a dependence on respiration for adequate uptake results. Substrate limitation therefore occurs in the matrix for the period of time needed for energy-dependent accumulation of nonlimiting levels

Plutonium uptake by marine phytoplankton in culture

International Nuclear Information System (INIS)

Fisher, N.S.; Olson, B.L.; Bowen, V.T.

1980-01-01

At environmentally realistic atom concentrations 237 Pu tracer was used to examine Pu uptake by unialgla cultures of Thalassiosira pseudonana (live and dead), Thalassiosira sp., and Platymonas sp., as well as by glass particles. Live or dead cells and glass particles accumulated Pu at similar rates, indicating that initial uptake was a passive phenomenon. Uptake was strongly affected by the nature of particle surfaces, but much less by composition of the media. Cells from rapidly growing cultures took up more Pu, than did those from late log or senescent cultures. Acid-washed glass took up more Pu, faster, than did unwashed glass. Cells accumulated more Pu from uv-treated seawater than from seawater untreated or enriched with f/50-level EDTA or f/50 vitamins; from complete f/50 medium uptake was even less, as with f/50 trace metals + EDTA. After a shot uptake Pu was 25% removable in tracer-free media, but after 3 days of uptake none was removable in seawater or exometabolite media, and only 15% in f/50-level EDTA. The data support the hypothesis that Pu in marine environments associates with suspended particles that could act as vertical vectors for this element

Uptake of 2,4-D in higher plants from artificial rain

International Nuclear Information System (INIS)

Lokke, H.

1984-01-01

Sinapis alba L., Lapsana communis L., Achillea millefolium L., Brassica napus L., Lactuca sativa L., and Lycopersicum esculentum L. were exposed to 2,4-dichlorophenoxy [2- 14 C]acetic acid (2,4-D) at 10 micrograms liter-1 in artificial rain, pH 6.5 and 3.3. The 2,4-D was absorbed in all species tested. Concentrations of parent 2,4-D appeared at the highest level in Achillea (0.1 mg kg-1 dry wt), and at zero level in Lycopersicum. Twenty-one daily treatments at pH 6.5 for 30-min periods increased dry-matter concentrations in the leaves of Achillea and decreased those in Brassica. No change in dry-matter concentration was observed in the leaves of Brassica by seven daily treatments for 30-min periods at pH 3.3

Factors influencing physiological FDG uptake in the intestine

International Nuclear Information System (INIS)

Yasuda, Seiei; Takahashi, Wakoh; Takagi, Shigeharu; Fujii, Hirofumi; Ide, Michiru; Shohtsu, Akira

1998-01-01

The intestine is a well-known site of physiological 18 F-fluorodeoxyglucose (FDG) accumulation in positron emission tomography (PET). To identify factors influencing physiological FDG uptake in the intestine, the intensity of FDG uptake was evaluated in a total of 1,068 healthy adults. Non-attenuation-corrected whole-body PET images were obtained for all subjects and visually evaluated. Subjects were then classified into two groups according to the intensity of intestinal FDG uptake. Sex, age, presence or absence of constipation, and serum glucose, hemoglobin A 1 c, and free fatty acid levels were compared between the two groups. High intestinal FDG uptake was observed at an overall rate of 11.0%. Sex (female), age, and bowel condition (constipation) were found to affect intestinal FDG uptake. The factors we identified lead to further questions the relationship between intestinal motility and glucose uptake that warrant further study. (author)

Distinction of infected and non-infected post-surgical incisions with In-111-WBC scintigraphy

International Nuclear Information System (INIS)

Abdel-Nabi, H.; Hinkle, G.H.; Olsen, J.O.

1985-01-01

To determine if In-111-WBCs scintigraphy can distinguish between healing and infection in post-surgical wounds, a prospective study was performed in patients with 3-14 day old surgical incisions. Eighteen patients (11 males and 7 females) were scanned 24 hrs after injection of 0.5 mCi of In-111 labeled autologous leukocytes. The scan findings were correlated with blood and/wound cultures results and diagnosis at time of discharge. Incisional uptake of In-111-WBCs was noted in 9 patients with infected surgical wounds and was absent in those 9 patients with non-infected surgical wounds. The results of the authors' study show that In-111-WBCs do not accumulate in non-infected surgical incisions. This confirms their previous findings in rats. The high specificity of In-111 leukocytes imaging makes it a valuable study in the evaluation of post-operative patients with suspected surgical wound infections. In-111 WBCs scintigraphy can distinguish between normal healing and infection at the site of recent (3-14 days) surgical incisions

Electron uptake by iron-oxidizing phototrophic bacteria

Energy Technology Data Exchange (ETDEWEB)

Bose, A; Gardel, EJ; Vidoudez, C; Parra, EA; Girguis, PR

2014-02-26

Oxidation-reduction reactions underlie energy generation in nearly all life forms. Although most organisms use soluble oxidants and reductants, some microbes can access solid-phase materials as electron-acceptors or -donors via extracellular electron transfer. Many studies have focused on the reduction of solid-phase oxidants. Far less is known about electron uptake via microbial extracellular electron transfer, and almost nothing is known about the associated mechanisms. Here we show that the iron-oxidizing photoautotroph Rhodopseudomonas palustris TIE-1 accepts electrons from a poised electrode, with carbon dioxide as the sole carbon source/electron acceptor. Both electron uptake and ruBisCo form I expression are stimulated by light. Electron uptake also occurs in the dark, uncoupled from photosynthesis. Notably, the pioABC operon, which encodes a protein system essential for photoautotrophic growth by ferrous iron oxidation, influences electron uptake. These data reveal a previously unknown metabolic versatility of photoferrotrophs to use extracellular electron transfer for electron uptake.

Establishing the R&D Agenda for Twenty-First Century Learning

Science.gov (United States)

Kay, Ken; Honey, Margaret

2006-01-01

Much ink has flowed over the past few years describing the need to incorporate twenty-first century skills into K-12 education. Preparing students to succeed as citizens, thinkers, and workers--the bedrock of any educational system--in this environment means arming them with more than a list of facts and important dates. Infusing twenty-first…

CONSEXPO 3.0, consumer exposure and uptake models

NARCIS (Netherlands)

Veen MP van; LBM

2001-01-01

The report provides a modelling approach to consumer exposure to chemicals, based on mathematical contact, exposure and uptake models. For each route of exposure, a number of exposure and uptake models are included. A general framework joins the exposure and uptake models selected by the user. By

Dependence of FDG uptake on tumor microenvironment

International Nuclear Information System (INIS)

Pugachev, Andrei; Ruan, Shutian; Carlin, Sean; Larson, Steven M.; Campa, Jose; Ling, C. Clifton; Humm, John L.

2005-01-01

Purpose: To investigate the factors affecting the 18 F-fluorodeoxyglucose ( 18 F-FDG) uptake in tumors at a microscopic level, by correlating it with tumor hypoxia, cellular proliferation, and blood perfusion. Methods and Materials: Nude mice bearing Dunning prostate tumors (R3327-AT) were injected with 18 F-FDG and pimonidazole, bromodeoxyuridine, and, 1 min before sacrifice, with Hoechst 33342. Selected tumor sections were imaged by phosphor plate autoradiography, while adjacent sections were used to obtain the images of the spatial distribution of Hoechst 33342, pimonidazole, and bromodeoxyuridine. The images were co-registered and analyzed on a pixel-by-pixel basis. Results: Statistical analysis of the data obtained from these tumors demonstrated that 18 F-FDG uptake was positively correlated with pimonidazole staining intensity in each data set studied. Correlation of FDG uptake with bromodeoxyuridine staining intensity was always negative. In addition, FDG uptake was always negatively correlated with the staining intensity of Hoechst 33342. Conclusions: For the Dunning prostate tumors studied, FDG uptake was always positively correlated with hypoxia and negatively correlated with both cellular proliferation and blood flow. Therefore, for the tumor model studied, higher FDG uptake is indicative of tumor hypoxia, but neither blood flow nor cellular proliferation

Mechanisms of DNA uptake by cells

Energy Technology Data Exchange (ETDEWEB)

Lacks, S.A.

1977-01-01

Three categories of cellular uptake of DNA can be distinguished. First, in the highly transformable bacteria, such as Diplococcus pneumoniae, Haemophilus influenzae and Bacillus subtilis, elaborate mechanisms of DNA transport have evolved, presumably for the purpose of genetic exchange. These mechanisms can introduce substantial amounts of DNA into the cell. Second, methods have been devised for the forced introduction of DNA by manipulation of bacterial cells under nonphysiological conditions. By such means small but significant amounts of DNA have been introduced into various bacteria, including Escherichia coli. Third, mammalian cells are able to take up biologically active DNA. This has been most clearly demonstrated with viral DNA, although the mechanism of uptake is not well understood. The intention, here, is to survey current understanding of the various mechanisms of DNA uptake. A review of experience with the bacterial systems may throw some light on the mammalian system and lead to suggestions for enhancing DNA uptake by mammalian cells.

Short-term uptake of heavy metals by periphyton algae

Energy Technology Data Exchange (ETDEWEB)

Vymazal, J.

1984-12-31

The utilization of periphyton for the removal of heavy metals from enriched small streams has been examined. By means of short-term batch laboratory experiments the courses of metal uptake have been studied. For uptake study naturally growing periphyton community and periphytic filamentous algae Cladophora glomerata and Oedogonium rivulare have been used. Uptakes of nine heavy metals (Pb, Cd, Cu, Co, Cr, Ni, Zn, Fe and Mn) have been determined during four hours exposure. In addition the influence of humic substances on heavy metals uptake has been determined. Uptake of all metals increased during four hours exposure but not in the same way. Some metals were removed continuously (Ni, Cr, Fe and Mn), other metals were removed more rapidly during the first hour or first two hours of exposure and then only slight removal continued (Cu, Pb, Cd, Co). Uptake of Zn was rather unambiguous. Results of these experiments suggest that the course of uptake for individual metals could be similar for most periphyton algae. It was established that humic substances significantly reduce heavy metals uptake. The highest decrease of uptake was observed in Cu, Cr, Co and Cd. The results of model experiments are being tested in a pilot scale with respect to the demands of engineering practice. (J.R.)

Phosphorus deficiency enhances molybdenum uptake by tomato plants

International Nuclear Information System (INIS)

Heuwinkel, H.; Kirkby, E.A.; Le Bot, J.; Marschner, H.

1992-01-01

Water culture experiments are described which provide conclusive evidence that Mo uptake by tomato plants is markedly enhanced by P deficiency. In a longterm experiment, which ran for 11 days, in marked contrast to the uptake of other nutrients, a three fold higher Mo uptake rate was observed after only four days of withdrawal of P from the nutrient medium. In contrast to the gradual increase in pH of the nutrient medium of the plants supplied with P, the pH in the medium of the -P plants fell. Throughout the growth of these plants net H+ efflux could be accounted for by excess cation over anion uptake, indicating that organic acid extrusion plays no major role in the observed fall in pH. Further evidence that Mo uptake is enhanced in P deficient tomato plants is provided in short-term nutrient solution experiments (1h and 4h) using radioactive molybdenum (99Mo). Compared with P sufficient plants, the uptake rates of 99Mo by P deficient plants were three to five times higher after 1h and nine to twelve times higher after 4h. Resupplying P during the uptake periods to deficient plants reduced the uptake rate of 99Mo to values similar to those of P sufficient plants. It is concluded that the uptake of molybdate occurs via phosphate binding/ transporting sites at the plasma membrane of root cells. Further support for this conclusion comes from exchange experiments with non-labelled molybdenum, which show a much larger amount of 99Mo exchangeable from the roots of P deficient plants

Skeletal muscle glucose uptake during dynamic exercise in humans

DEFF Research Database (Denmark)

Richter, Erik; Kiens, Bente; Saltin, Bengt

1988-01-01

uptake was not compensated for by increased uptake of free fatty acids but was accompanied by decreases in plasma insulin and increases in plasma epinephrine and norepinephrine. During work with large muscle masses, arterial lactate increased to approximately 6 mM, and net leg lactate release reverted......To study the role of muscle mass in glucoregulation, six subjects worked with the knee extensors of one leg on a specially constructed cycle ergometer. The knee extensors of one leg worked either alone or in combination with the knee extensors of the other leg and/or with the arms. Substrate usage...... to net lactate uptake. Decreased glucose uptake could not be explained by decreased perfusion. It is concluded that thigh muscle glucose uptake is affected by the size of the total muscle mass engaged in exercise. The decrease in thigh glucose uptake, when arm cranking was added and O2 uptake...

Evaluation of hilar 67Ga-citrate uptake in bronchogenic carcinoma

International Nuclear Information System (INIS)

Matsuno, Noriyo; Kuyama, Junpei; Uchida, Yoshitaka; Hatano, Osamu; Imai, Yasunori; Uno, Kimiichi; Minoshima, Satoshi.

1995-01-01

We evaluated hilar uptake on 67 Ga-citrate scintigraphy and correlated with hilar lymph node metastases in one-hundred seventeen cases (two-hundred thirty four hila) of bronchogenic carcinoma. Hilar uptake was classified into three grades independently on anterior and posterior chest views: no uptake (grade 0), uptake equal to that in the thoracic vertebrae (grade 1), and uptake higher than that in the thoracic vertebrae (grade 2). If a summed grade of anterior and posterior view was larger than 3, hilar uptake was considered as positive. In forty-four cases (forty-nine hila) with hilar lymph node metastases, positive hilar uptake was found in ten cases (eleven hila), resulting in sensitivity of 22% based on cases and 23% based on hila. In seventy-three cases (one-hundred forty-six hila) without hilar lymph node metastases, positive hilar uptake was found in six cases (ten hila), resulting in specificity of 91% based on cases and 93% based on hila. In comparison to scintigraphic findings of unilaterally positive hilar uptake, findings of bilaterally positive hilar uptake showed significantly lower accuracy in determining presence of hilar lymph node metastases. No definite correlation between hilar uptake and histopathology or 67 Ga-citrate uptake in a primary tumor was observed. The results indicate that usefulness of 67 Ga-citrate scintigraphy is limited when evaluating hilar lymph node metastases in bronchogenic carcinoma. (author)

The next twenty years - IAEA's role

International Nuclear Information System (INIS)

Tape, G.F.

1977-01-01

The twentieth anniversary of an institution is an appropriate time to look back and to ask what has been achieved. It is also an appropriate time to look ahead and to ask what should be the mission for the future. How can the strengths of the International Atomic Energy Agency (IAEA) be best utilized, what new opportunities should be seized upon, and what challenges should the IAEA be prepared to meet in the next twenty years? Forward planning is a very necessary activity in today's world. There are so many demands on national or institutional resources that careful analysis of options is necessary to establish priorities and ultimately to provide for implementation. But such planning must be done carefully with full appreciation for the validity and sensitivity of the input assumptions and data. Furthermore, today's plan, while setting goals and directions, cannot be so inflexible that it cannot be responsive to ever-changing political, economic and technical constraints or opportunities. Thus in looking ahead, the plan must contain provisions for flexibility to provide for further modifications in the light of ever-changing knowledge, attitudes, and world conditions. The experience of the past five years in the energy field, and especially in nuclear energy, underscores this need. In looking ahead for the next twenty years, we are attempting to describe the International Atomic Energy Agency and its role through the twentieth century. In doing so, we are automatically laying the base for the Agency's work going into the twenty-first century. In short, we are trying to visualize a programme that can serve the coming generation and, in doing so, creating a base from which the needs of the succeeding generation can be met. This is a large order and the crystal ball is less than clear. (author)

Capturing Individual Uptake: Toward a Disruptive Research Methodology

Science.gov (United States)

Bastian, Heather

2015-01-01

This article presents and illustrates a qualitative research methodology for studies of uptake. It does so by articulating a theoretical framework for qualitative investigations of uptake and detailing a research study designed to invoke and capture students' uptakes in a first-year writing classroom. The research design sought to make uptake…

A PET study of 18FDG uptake in soft tissue masses

International Nuclear Information System (INIS)

Lodge, M.A.; Marsden, P.K.; Cronin, B.F.; O'Doherty, M.J.; Lucas, J.D.; Smith, M.A.

1999-01-01

A study was performed with the aim of investigating some of the methodological factors affecting the ability of quantitative 2-[ 18 F]-fluoro-2-deoxy-d-glucose (FDG) positron emission tomography to assess tumour malignancy. Twenty-nine patients with soft tissue masses were studied using a 6-hour scanning protocol and various indices of glucose metabolism were compared with histological grade. Significant differences were observed in the time-activity response of benign and high-grade tumours. High-grade sarcomas were found to reach a peak activity concentration approximately 4 h after injection whereas benign lesions reached a maximum within 30 min. This translated to improved differentiation between these two tumour types using a standard uptake value (SUV) derived from images acquired at later times. An SUV measured 4 h post-injection was found to be as useful an index of tumour malignancy as the metabolic rate of FDG determined using either Patlak or non-linear regression techniques. Each of these indices had a sensitivity and specificity of 100% and 76% respectively for the discrimination of high-grade sarcomas from benign tumours. (orig.)

Uptake mechanism for iodine species to black carbon.

Science.gov (United States)

Choung, Sungwook; Um, Wooyong; Kim, Minkyung; Kim, Min-Gyu

2013-09-17

Natural organic matter (NOM) plays an important role in determining the fate and transport of iodine species such as iodide (I(-)) and iodate (IO3(-)) in groundwater system. Although NOM exists as diverse forms in environments, prior iodine studies have mainly focused on uptake processes of iodide and iodate to humic materials. This study was conducted to determine the iodide and iodate uptake potential for a particulate NOM (i.e., black carbon [BC]). A laboratory-produced BC and commercial humic acid were used for batch experiments to compare their iodine uptake properties. The BC exhibited >100 times greater uptake capability for iodide than iodate at low pH of ~3, while iodide uptake was negligible for the humic acid. The uptake properties of both solids strongly depend on the initial iodine aqueous concentrations. After uptake reaction of iodide to the BC, X-ray absorption fine structure spectroscopy results indicated that the iodide was converted to electrophilic species, and iodine was covalently bound to carbon atom in polycyclic aromatic hydrocarbons present in the BC. The computed distribution coefficients (i.e., Kd values) suggest that the BC materials retard significantly the transport of iodide at low pH in environmental systems containing even a small amount of BC.

Technetium-99m methylene diphosphonate scintimammography for evaluation of palpable breast masses

International Nuclear Information System (INIS)

Shah, S.; Khan, M.M.; Khan, A.U.; Khan, S.M.; Khan, A.A.

2002-01-01

Objective:To evaluate technetium-99m methylene diphosphonate (/sup 99m/Tc-MDP) as a noninvasive tumor-localizing agent in patients with palpable breast masses and to differentiate malignant from benign breast lesions. Design: It was an observational and experimental study. Place and Duration of Study: the study was conducted at the Institute of Radiotherapy and Nuclear Medicine (IRNUM), Peshawar during a six-month period (June to November, 1995). Subjects and Methods: 99m Tc-MDP scintimammography (SMM) was performed in thirty patients with palpable breast masses (Group A). Ten patients with no palpable breast abnormality (Group B) also underwent /sup 99m/Tc-MDP breast study; they served as controls. Upright anterior, lateral and oblique lateral images of the breasts were acquired 10-30 minutes after intravenous injection of 740 MBq of /sup 99m/Tc-MDP. This was performed during routine bone scanning. SMM was followed by surgical and /or needle biopsy. Results: breast cancer was histologically diagnosed in twenty two (73%), and benign disease found in eight patients (27%). Of the twenty two breast carcinomas, twenty (91%) were detected using /sup 99m/Tc-MDP SMM, while no uptake was seen in two (9%). Of the eight patients with pathologically proven benign breast lesions, seven (88%) either did not show any uptake or showed faint bilateral accumulation. Focal /sup 99m/Tc-MDP uptake was observed in one fibroadenoma. Conclusion: The study showed that SMM with /sup 99m/Tc-MDP is positive in a high percentage of patients with carcinoma of the breast and may differentiate malignant from benign masses. (author)

Platinum uptake from chloride solutions using biosorbents

Directory of Open Access Journals (Sweden)

Mehmet Hakan Morcali

2013-04-01

Full Text Available Present work investigates platinum uptake from synthetically prepared, dilute platinum-bearing solutions using biomass residues, i.e. pistachio nut shell and rice husk, which are abundant in Turkey, and provides a comparison between these two biosorbents. Effects of the different uptake parameters, sorbent dosage, contact time, temperature and pH of solution on platinum uptake (% were studied in detail on a batch sorption. Before the pistachio nut shell was activated, platinum uptake (% was poor compared to the rice husk. However, after the pistachio nut shell was activated at 1000 °C under an argon atmosphere, the platinum uptake (% increased two-fold. The pistachio nut shell (original and activated and rice husk were shown to be better than commercially available activated carbon in terms of adsorption capacity. These two sorbents have also been characterized by FTIR and SEM. Adsorption equilibrium data best complied with the Langmuir isotherm model. Maximum adsorption capacities, Qmax, at 25 °C were found to be 38.31 and 42.02 mg.g- 1for the activated pistachio nut shell and rice husk, respectively. Thermodynamic calculations using the measured ∆H°, ∆S° and ∆G° values indicate that the uptake process was spontaneous and endothermic. The experimental data were shown to be fit the pseudo-second-order kinetic model.

Uptake of SPECT radiopharmaceuticals in neocortical brain cultures

Energy Technology Data Exchange (ETDEWEB)

Jong, B.M. de; Royen, E.A. van

1989-01-01

The uptake, retention and uptake antagonism of /sup 201/Tl-DDC, /sup 201/Tl-Cl, /sup 123/I-IMP, /sup 99m/Tc-HMPAO and /sup 99m/Tc-O4/sup -/ were compared in rat neocortex cultures. /sup 201/Tl-DDC and /sup 123/I-IP revealed the highest uptake of radioactivity in the cultures. /sup 99m/Tc-HMPAO and /sup 123/I-IMP showed the highest retention of radioactivity within the tissue in washout experiments. Blocking of bioelectric activity by tetrodotoxin did not significantly affect the uptake of the radiopharmaceuticals (RPHA). Inhibition of Na K ATPase by ouabain inhibited the uptake of /sup 201/Tl-Cl (77%) and /sup 201/Tl-DDC (27%). Imipramine showed a significantly stronger inhibitory effect on /sup 123/I-IMP uptake in comparison with the effect on other RPHA. /sup 99m/Tc-O4/sup -/ was not concentrated within the cultured tissue. Under the in vitro conditions used in this study, the various RPHA were characterised by distinct differences in their interaction with cortical brain tissue.

Incidence and characteristics of uterine leiomyomas with FDG uptake

International Nuclear Information System (INIS)

Nishizawa, Sadahiko; Inubushi, Masayuki; Kido, Aki; Miyagawa, Masao; Inoue, Takeshi; Shinohara, Katsura; Kajihara, Makoto

2008-01-01

Uterine leiomyomas sometimes show focal 18 F-fluorodeoxyglucose (FDG) uptake on positron emission tomography (PET) images that may result in a false-positive diagnosis for malignant lesions. This study was conducted to investigate the incidence and characteristics of uterine leiomyomas that showed FDG uptake. We reviewed FDG-PET and pelvic magnetic resonance (MR) images of 477 pre-menopausal (pre-MP, age 42.1±7.3 years) and 880 post-MP (age 59.9±6.8 years) healthy women who underwent these tests as parts of cancer screening. Of 1357, 323 underwent annual cancer screening four times, 97 did three times, 191 did twice, and the rest were screened once. Focal FDG uptake (maximal standardized uptake value >3.0) in the pelvis was localized and characterized on co-registered PET/MR images. Uterine leiomyomas were found in 164 pre-MP and 338 post-MP women. FDG uptake was observed in 18 leiomyomas of 17 of the 164 (10.4%) pre-MP women and in 4 leiomyomas of 4 of the 338 (1.2%) post-MP women. The incidence was significantly higher in pre-MP women than in post-MP women (chi-square, P<0.001). Of the 22, 13 showed signal intensity equal to or higher than that of the myometrium on T2-weighted MR images, which suggested abundant cellularity, whereas the majority of leiomyomas without FDG uptake showed low signal intensity. Of the 13 women, 12 examined more than twice showed substantial changes in the level of FDG uptake in leiomyomas each year with FDG uptake disappearing or newly appearing. These changes were observed frequently in relation with menopause or menstrual phases. Leiomyomas with focal FDG uptake were seen in both pre- and post-MP women with a higher incidence in pre-MP women. Abundant cellularity and hormonal dependency may explain a part of the mechanisms of FDG uptake in leiomyomas. It is important to know that the level of FDG uptake in leiomyomas can change and newly appearing FDG uptake does not necessarily mean malignant transformation. (author)

Nitrite uptake by nitrogen-depleted wheat seedlings

Energy Technology Data Exchange (ETDEWEB)

Jackson, W A; Johnson, R E; Volk, R J

1974-01-01

Intact, 14-day-old nitrogen-depleted wheat (Triticum vulgare cv. Blueboy) seedlings were exposed to solutions of 0.5 mM KNO/sub 2/, 0.05 mM CaSO/sub 4/ and 1 mM sodium 2-(N-morpholino)-ethanesulfonate, pH 6.1. Nitrite uptake was determined from depletion of the ambient solution or from incorporation of /sup 15/N in the tissue. An initial nitrite uptake shoulder was followed by a relatively slow uptake rate which subsequently increased to a substantially greater rate. This accelerated phase was maintained through 24 h. Nitrite accumulated to a slight extent in the root tissues during the first few hours but declined to low values when the accelerated rate was fully developed, indicating an increase in nitrite reductase activity paralleling the increase in nitrite uptake capacity. About 50% of the nitrogen absorbed as nitrite was translocated to the shoots by 9 to 12 h. Development of the accelerated nitrite uptake rate was restricted in excised roots, in intact plants kept in darkness, by 400 ..mu..g puromycin ml/sup -1/ and by 1 mM L-ethionine. When puromycin and L-ethionine were added after the accelerated phase had been initiated, their effects were not as detrimental as when they were added at first exposure to KNO/sub 2/. The two inhibitors restricted translocation more than uptake. The data indicate an involvement of protein synthesis and a requirement for movement of a substance from shoots to roots for maximal development of the accelerated nitrite uptake phase. A requirement for protein synthesis in the transport of soluble organic nitrogen from roots to shoots is also suggested.

The location and nature of accumulated phosphorus in seven sludges from activated sludge plants which exhibited enhanced phosphorus removal

International Nuclear Information System (INIS)

Buchan, L.

1981-01-01

Electron microscopy combined with the energy dispersive analysis of X-rays (EDX) has been used to examine the nature of the phosphorus accumulated in sludges from seven activated sludge plants exhibiting enhanced phosphorus removal. Large phosphorus accumulations were located in identical structures in the sludges examined. The phosphorus was located in large electron-dense bodies, within large bacterial cells which were characteristically grouped in clusters. The calcium:phosphorus ratio of these electron-dense bodies precluded them from being any form of calcium phosphate precipitate. Quantitative analysis indicated that the electron-dense bodies contained in excess of 30% phosphorus. The results obtained are supportive of a biological mechanism of enhanced phosphorus uptake in activated sludge

Vitamin B 12 absorption: correction of intestinal retention by whole-body profile activity of vitamin B 12-58 cobalt and by double tracer technique

International Nuclear Information System (INIS)

Goncalves, M.R. Bencke; Gheldof, R.; Paternot, L. van Tricht; Delmotte, E.; Verschaeren, A.; Martin, P.; Verhas, M.; Universidade Federal, Rio de Janeiro, RJ

1997-01-01

Full text. Intestinal retention could give false negative results in determining the whole-body retention of vitamin B 12 absorption (WBC B12-58Co). After having validate the WBC B12-58Co, taking the Schilling test as reference, we have studied the feasibility to evaluate the intestinal contamination by measurement of the profile activity distribution of vitamin B12-58Co and by a double tracer technique (WBC B12-58Co/ WBC 51 Cr Cl3). Methodology: twenty five patients were studied for the setting up of the new methodology. For eleven of them the WBC B12-58 Co retention was measured at the 7th day after the oral administration of 37KBq of B12-58Co using a four detectors whole body counter. One week later, a Schilling test was performed after the oral absorption of 18,5 KBq B12-57Co. Results were expressed as %ID. In these patients, one single peak of hepatic activity was observed on the whole body profile and thus no further intestinal correction was needed. In order to evaluate the intestinal contribution, we made in nine other patients the profile of the whole body distribution of activity at 1 h, 1 week and two weeks after the oral administration of B12-58Co. For five other patients a double tracer technique was used for intestinal correction after the simultaneous oral administration of 37 KBq of B12-58Co and 1,85 MBq of 51 Cr Cl3. The B12-58Co absorption was evaluated after intestinal correction based on subtraction of the 51Cr Cl3 contribution after the formula: B12-58Co(%ID) = WBC B12-58Co - WBC 51 Cr Cl3/1 - WBC 51 Cr Cl3. Results: the correlation with the Schilling test was found excellent: r=0,94 (n=11). The normality for WBC retention (n=7) was define as 53,2 +-12,4% ID (SD). For nine patients studied at the 7th day, the presence of a double peak (hepatic and intestinal peaks) allowed the subtraction by exponential extrapolation; the correction range was 4,4% to 37,2%. With the exception of one observation there was no difference in the measure of vitamin

Twenty-One at TREC-8: using Language Technology for Information Retrieval

NARCIS (Netherlands)

Kraaij, Wessel; Pohlmann, Renée; Hiemstra, Djoerd; Voorhees, E.M; Harman, D.K.

2000-01-01

This paper describes the official runs of the Twenty-One group for TREC-8. The Twenty-One group participated in the Ad-hoc, CLIR, Adaptive Filtering and SDR tracks. The main focus of our experiments is the development and evaluation of retrieval methods that are motivated by natural language

FDG uptake in the stomach

International Nuclear Information System (INIS)

Yun, M. J.; Cho, H. J.; Cho, E. H.; Kim, T. S.; Kang, W. J.; Lee, J. D.

2007-01-01

This study was performed to evaluate histopathologic features of advanced gastric cancer (AGC) to predict FDG uptake on PET. 153 patients(102 men; mean age, 55 y) were diagnosed with AGC by surgery were included in this study. PET images were evaluated by visual and semi-quantitative analysis of FDG uptake in primary tumors. Primary tumors size were measured and divided according to Borrmann classification. Tumor histology was classified under WHO classification, depth of invasion and Iymphovascular invasion. The tumors were also grouped by high cellular(cellularity = 50%) and low cellular group (<50%). Microscopic growth type was based on Lauren classification. Stromal fibrosis degree and inflammatory cell infiltration amount was graded as low(none∼mild), or high(moderate∼severe). Lymph node metastases was assessed in all patients. Statistical analyses were performed to evaluate differences in SUV as to histopathologic factors. Of the 153 patients, 21 patients(14%) had primary tumor invisible on initial whole body images. After water ingestion, the tumors became visible in 15 of the 21 patients due to disappearance of physiologic stomach uptake. Polypoid or ulcerofungating tumors, high cellularity, intestinal growth pattern, and larger tumors significantly predicted increased tumor SUVs. Well or moderately differentiated adenocarcinoma tended to show high cellularity and intestinal growth pattern. Poorly differentiated adenocarcinoma had diverse spectrum of histopathology. Signet ring cell carcinomas were mostly ulceroinfiltrative or diffusely infiltrative in macroscopic type and diffuse in microscopic tumor growth. Mucinous adenocarcinomas were mostly low in cellularity. FDG uptake patterns are useful in representing histopathologic characteristics of the entire tumor in gastric cancers. The degree of FDG uptake depends on tumor size, macroscopic type, cellularity, and microscopic growth pattern and it shows no association with well known important prognostic

Chemical composition and antioxidant activity of seven cultivars of guava (Psidium guajava) fruits.

Science.gov (United States)

Flores, Gema; Wu, Shi-Biao; Negrin, Adam; Kennelly, Edward J

2015-03-01

The antioxidant activity and identification of phenolic compounds of seven edible guava (Psidium guajava) cultivars that varied in colour from white to pink were examined. In the DPPH assay all four pink-pulp guavas (Barbie Pink, Homestead, Sardina 1, Sardina 2) included in the study showed higher activity than the white pulp cultivars (Yen 2 and Sayla) and less than the red pulp guava cultivar (Thai Maroon). In the ABTS(+) assay this trend was the same up to 20 min, but from 20 to 40 min Barbie Pink showed lower activity than the white guavas. Twenty-one compounds were characterised in the cultivars, and ten of them are reported for the first time in this fruit. Principle component analysis was performed to identify differences in chemistry among these cultivars. Our results suggest that the antioxidant activity and phytochemical composition of P. guajava vary significantly according to the cultivar and pulp colour. Copyright © 2014. Published by Elsevier Ltd.

The Association Study between Twenty One Polymorphisms in Seven Candidate Genes and Coronary Heart Diseases in Chinese Han Population.

Directory of Open Access Journals (Sweden)

Barrak F Alobeidy

Full Text Available Previous genome-wide association studies (GWAS in multiple populations identified several genetic loci for coronary heart diseases (CHD. Here we utilized a 2-stage candidate gene association strategy in Chinese Han population to shed light on the putative association between several metabolic-related candidate genes and CHD. At the 1(st stage, 190 patients with CHD and 190 controls were genotyped through the MassARRAY platform. At the 2(nd stage, a larger sample including 400 patients and 392 controls was genotyped by the High Resolution Melt (HRM method to confirm or rule out the associations with CHD. MLXIP expression level was quantified by the real time PCR in 65 peripheral blood samples. From the 21 studied single nucleotide polymorphisms (SNPs of seven candidate genes: MLXIPL, MLXIP, MLX, ADIPOR1, VDR, SREBF1 and NR1H3, only one tag SNP rs4758685 (T→C was found to be statistically associated with CHD (P-value = 0.02, Odds ratio (OR of 0.83. After adjustment for the age, sex, lipid levels and diabetes, the association remained significant (P-value = 0.03. After adjustment for the hypertension, P-value became 0.20 although there was a significant difference in the allele distribution between the CHD patients with hypertension and the controls (P-value = 0.04, 406 vs 582. In conclusion, among the 21 tested SNPs, we identified a novel association between rs4758685 of MLXIP gene and CHD. The C allele of common variant rs4758685 interacted with hypertension, and was found to be protective against CHD in both allelic and genotypic models in Chinese Han population.

Correlation of hepatic 18F-fluorodeoxyglucose uptake with fatty liver

International Nuclear Information System (INIS)

An, Young Sil; Yoon, Joon Kee; Hong, Seon Pyo; Joh, Chul Woo; Yoon, Seok Nam

2006-01-01

Liver demonstrates heterogeneous FDG uptake and sometimes it shows abnormally increased uptake even though there is no malignant tissue. However, there was no previous study to correlate these various pattern of hepatic FDG uptake with benign liver disease. Therefore, we evaluated the significance of hepatic FDG uptake associated with various clinical factors including fatty liver, liver function tests and lipid profiles. We reviewed a total of 188 patients (male/female: 120/68, mean age: 50 ± 9) who underwent PET/CT for screening of malignancy. Patients with DM, impaired glucose tolerance, previous severe hepatic disease or long-term medication history were excluded. The FDG uptake in liver was analyzed semi-quantitatively using ROI on transaxial images (segment 8) and we compared mean standardized uptake value (SUV) between fatty liver and non-fatty liver group. We also evaluated the correlation between hepatic FDG uptake and various clinical factors including serum liver function test (ALT, AST), γ -GT, total cholesterol and triglyceride concentration. The effect of alcoholic history and body mass index on hepatic FDG uptake was analyzed within the fatty liver patients. The hepatic FDG uptake of fatty liver group was significantly higher than that of non-fatty liver group. Serum total cholesterol and triglyceride concentration showed significant correlation with hepatic FDG uptake. However, there was no significant correlation between other factors (ALT, AST, and γ -GT) and FDG uptake. Also there was no difference of mean SUV between normal and abnormal groups on the basis of alcoholic history and body mass index within fatty liver patients. Fatty liver and high serum triglyceride concentration were the independent factors affecting hepatic FDG uptake according to multivariate analysis. In conclusion, hepatic FDG uptake was strongly correlated with fatty liver and serum triglyceride concentration

Results of about a seven years lysimeter study to the quantification of the mobility of radionuclides into the system soil-water-plant

International Nuclear Information System (INIS)

Gerzabek, M.H.; Strebl, F.; Temmel, B.

1999-04-01

The result of seven years lysimeter experiments (twelve soil monoliths, four soil types) to determine the uptake of 60 Co, 137 Cs and 226 Ra into agricultural crops and the leaching behaviour are presented. The mobility of the artificial radionuclides in soil profiles decreased in the following order: 60 Co ≥ 22 6Ra > 137 Cs. Total median values of soil-plant transfer factors (dry matter basis) for the three radionuclides decreased from 226 Ra (0.068 kg kg -1 ) to 137 Cs (0.043 kg kg -1 ) and 60 Co (0.018 kg kg -1 ). The physical and chemical properties of the experimental soils resulted in significant differences in transfer factors or fluxes between the investigated soils for 137 Cs and 226 Ra, but not for 60 Co. Differences in transfer between plant species and plant parts are distinct, with graminaceous species showing 5.8 and 15 times lower values for 137 Cs and 60 Co than dicodyle-donean species. In model calculations radionuclide losses through the different pathways (physical decay, leaching plant uptake and removal) were quantified. (author)

Strategic Leader Competencies for the Twenty-First Century

National Research Council Canada - National Science Library

Becker, Bradley A

2007-01-01

...: interpersonal skills, conceptual skills, and technical skills. From these three primary strategic leadership skills, there is a list of twenty-one competencies that a strategic leader should posses...

Uptake of organic nitrogen by plants

Science.gov (United States)

Torgny Nasholm; Knut Kielland; Ulrika. Ganeteg

2009-01-01

Languishing for many years in the shadow of plant inorganic nitrogen (N) nutrition research, studies of organic N uptake have attracted increased attention during the last decade. The capacity of plants to acquire organic N, demonstrated in laboratory and field settings, has thereby been well established. Even so, the ecological significance of organic N uptake for...

Gallium 67 uptake in thymic rebound

International Nuclear Information System (INIS)

Hurst, R.; Sabio, H.; Teates, C.D.

1988-01-01

We have reported a case of localized thymic enlargement and uptake of gallium 67 in a child who had received antineoplastic chemotherapy. The enlarged thymus showed normal histology, a picture consistent with thymic rebound after nonspecific stress. This case further demonstrates the need to consider thymic rebound as a cause of gallium 67 uptake in children with neoplastic diseases

Enablers and Barriers to Large-Scale Uptake of Improved Solid Fuel Stoves: A Systematic Review

Science.gov (United States)

Puzzolo, Elisa; Stanistreet, Debbi; Pope, Daniel; Bruce, Nigel G.

2013-01-01

Background: Globally, 2.8 billion people rely on household solid fuels. Reducing the resulting adverse health, environmental, and development consequences will involve transitioning through a mix of clean fuels and improved solid fuel stoves (IS) of demonstrable effectiveness. To date, achieving uptake of IS has presented significant challenges. Objectives: We performed a systematic review of factors that enable or limit large-scale uptake of IS in low- and middle-income countries. Methods: We conducted systematic searches through multidisciplinary databases, specialist websites, and consulting experts. The review drew on qualitative, quantitative, and case studies and used standardized methods for screening, data extraction, critical appraisal, and synthesis. We summarized our findings as “factors” relating to one of seven domains—fuel and technology characteristics; household and setting characteristics; knowledge and perceptions; finance, tax, and subsidy aspects; market development; regulation, legislation, and standards; programmatic and policy mechanisms—and also recorded issues that impacted equity. Results: We identified 31 factors influencing uptake from 57 studies conducted in Asia, Africa, and Latin America. All domains matter. Although factors such as offering technologies that meet household needs and save fuel, user training and support, effective financing, and facilitative government action appear to be critical, none guarantee success: All factors can be influential, depending on context. The nature of available evidence did not permit further prioritization. Conclusions: Achieving adoption and sustained use of IS at a large scale requires that all factors, spanning household/community and program/societal levels, be assessed and supported by policy. We propose a planning tool that would aid this process and suggest further research to incorporate an evaluation of effectiveness. Citation: Rehfuess EA, Puzzolo E, Stanistreet D, Pope D, Bruce

Effects of heart rate on myocardial thallium-201 uptake and clearance

International Nuclear Information System (INIS)

Nordrehaug, J.E.; Danielsen, R.; Vik-Mo, H.

1989-01-01

The effects of heart rate on the myocardial uptake and clearance of 201 Tl were studied prospectively in seven healthy men, mean age 43 +/- 7 (s.d.) yr. Initial and delayed (3 hr) thallium images were obtained in three views after three bicycle exercise tests: to maximal, 80% and 60% of predicted maximal heart rate. The mean of three views initial myocardial 201 Tl uptake was higher at maximal than at both 80% and 60% of predicted maximal heart rate, being 81% (p less than 0.01) and 60% (p less than 0.01) of maximal activity, respectively. The myocardial activity in the delayed images was identical. There was a linear relationship between heart rate and the initial myocardial activity, r = 0.86 (p less than 0.001). The mean (range) 201 Tl clearance was 58% (51-65), 47% (34-56), and 34% (22-49) (all differences p less than 0.01), respectively. Concordance among the three individual views in estimating clearance was best for the highest exercise level. There was a linear relationship between heart rate and clearance, r = 0.80 (p less than 0.001). Clearance was altered by only 1.67 x 10%/heart bpm (0.024 hr/heart beat). Clearance in the liver, spleen and lungs increased at submaximal exercise levels. Thus, a linear relationship between heart rate and clearance is the result of changes in the initial exercise myocardial 201 Tl activity. Submaximal exercise may reduce reproducibility of clearance estimation, and the change of myocardial clearance with heart rate seems less than previously suggested

Uptake and metabolism of L-[3H]glutamate and L-[3H]glutamine in adult rat cerebellar slices

International Nuclear Information System (INIS)

de Barry, J.; Vincendon, G.; Gombos, G.

1983-01-01

Using very low concentrations (1 mumol range) of L-2-3-[ 3 H]glutamate, ( 3 H-Glu) or L-2-3-[ 3 H]glutamine ( 3 H-Gln), the authors have previously shown by autoradiography that these amino acids were preferentially taken up in the molecular layer of the cerebellar cortex. Furthermore, the accumulation of 3 H-Glu was essentially glial in these conditions. Uptake and metabolism of either ( 3 H-Glu) or ( 3 H-Gln) were studied in adult rat cerebellar slices. Both amino acids were rapidly converted into other metabolic compounds: after seven minutes of incubation in the presence of exogenous 3 H-Glu, 70% of the tissue accumulated radioactivity was found to be in compounds other than glutamate. The main metabolites were Gln (42%), alpha-ketoglutarate (25%) and GABA (1,4%). In the presence of exogenous 3 H-Gln the rate of metabolism was slightly slower (50% after seven minutes of incubation) and the metabolites were also Glu (29%), alpha-ketoglutarate (15%) and GABA (5%). Using depolarizing conditions (56 mM KCl) with either exogenous 3 H-Glu or 3 H-Gln, the radioactivity was preferentially accumulated in glutamate compared to control. From these results we conclude: i) there are two cellular compartments for the neurotransmission-glutamate-glutamine cycle; one is glial, the other neuronal; ii) these two cellular compartments contain both Gln and Glu; iii) transmitter glutamate is always in equilibrium with the so-called ''metabolic'' pool of glutamate; iv) the regulation of the glutamate-glutamine cycle occurs at least at two different levels: the uptake of glutamate and the enzymatic activity of the neuronal glutaminase

Clinical significance of abnormal nonosseous soft tissue uptake of bone tracer

International Nuclear Information System (INIS)

Zhu Bao; Shang Yukun; Li Jiannan; Bai Jing; Cai Liang

2006-01-01

Objective: To evaluate the clinical significance of abnormal soft tissue uptake of bone tracer. Methods: Thirty patients with abnormal soft tissue uptake of bone tracer on 99 Tc m -methylene diphosphonic acid (MDP) skeletal imaging were analyzed. Radioactivity of soft tissue accumulated equal to or greater than the ribs were considered as abnormal. The result was compared with pathology, MRI, CT, X-ray, ultrasound, findings for evaluating its clinical significance. Results: In 7 patients with diffuse liver uptake of 99 Tc m -MDP, 6 were massive and 1 nodular liver cancer. In 2 patients with local liver uptake, one was metastatic and the other primary liver cancer. In 5 local lung uptake cases 4 were primary lung cancer and one metastatic. In 5 cases with colonic uptake 1 was schistosomiasis while the other 4 unexplainable. Subcutaneous tissue uptake was observed in 4 patients, symmetrical uptake in 2 patients with metastatic calcification microfoci in multiple myeloma, unsymmetrical uptake in 2 patients with hemangioma and abscess. Pleural uptake in 3 patients all was metastatic cancer. Abdominal uptake in 3 patients was omentum, paravertebral soft tissue metastasis and unknown cause. Breast uptake in one patient was due to breast cancer. Conclusions: There are many causes resulting in abnormal nonosseous soft tissue uptake of 99 Tc m -MDP. The final diagnosis should correlate with clinical data and other examinations. (authors)

Uptake of proline by the scutellum of germinating barley grain

International Nuclear Information System (INIS)

Vaeisaenen, E.; Sopanen, T.

1986-01-01

Scutella separated from germinating grains of barley (Hordeum vulgare L. cv Himalaya) took up 1 millimolar L-[ 14 C]proline at an initial rate of about 6.5 micromoles gram -1 fresh weight hour -1 (pH 5, 30 0 C). The uptake had a pH optimum at 5. The bulk of the uptake (93%) was via carrier-mediated active transport. All of the 19 L-amino acids tested at 10 millimolar concentration inhibited the mediated uptake of 1 millimolar proline, the inhibitions varying from 18 to 76%. By studying how large a fraction of the mediated uptake was inhibitable by asparagine, alanine, glutamine, and leucine, the mediated uptake was shown to be due to three components. Two of these are most probably attributable to the two nonspecific uptake systems proposed earlier to act in the uptake of glutamine and leucine. The third component was not inhibited by glutamine, asparagine, or alanine, but was inhibited by unlabeled proline and leucine. The uptake by this system was apparently carrier-mediated active transport. D-Proline inhibited this system as strongly as L-proline. Nine of the 16 L-amino tested at 50 millimolar concentrations did not inhibit the uptake of 1 millimolar proline by this system. Valine, leucine, isoleucine, and the basic amino acids were inhibitory, but in spite of this, they did not appear to be taken up by this system. It seems therefore that in addition to two nonspecific amino acid uptake systems the scutella have an uptake system which is specific for proline. It is likely that this proline-specific system accounts for the bulk of proline uptake in a germinating grain

Gene : CBRC-PABE-07-0025 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-82 48% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-130 78% MINDSYFSGFILLGFT...QIFIDVALYSVECILLAMMSCDRLNAICKPLHHMTIMNLQLCQGLVVISWVVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAA

Gene : CBRC-PTRO-07-0026 [SEVENS

Lifescience Database Archive (English)

Full Text Available e-79 50% ref|XP_001253185.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] ref|XP_00...1250982.1| PREDICTED: similar to seven transmembrane helix receptor [Bos taurus] 1e-120 76% MINDSRFSGFILLGFT...QLFIDVALYSVECILLSMMSYDRLNAICKPLHHMTIMNLQLCQGLVVISWIVGVINCIIPSPYAMSLPRSMEVTTFAMCLIIVLVPLLLILVSYGFIAVAVLKIKSAAGRQKAFGTCSSHLIVVSIFYGTVRYMYTQPGNSPSQDEGKLLHIFYSIFTPTLNPSH ...

Quantitative 99mTc diphosphonate uptake measurements

International Nuclear Information System (INIS)

Smith, M.L.

1987-01-01

There are several different techniques currently in use for quantifying diphosphonate uptake by the skeleton. These can be considered in two main categories: local bone or whole-body uptake measurements. The choice of technique depends on the clinical problem being investigated and also on available equipment an expertise. The wide variety of approaches to diphosphonate quantitation ensures that these measurements can be obtained in almost any nuclear medicine department. This chapter discusses the general factors which may influence diphosphonate uptake measurements and outlines the techniques most relevant to current clinical practice

Experimental increase in brain HIPDM uptake by hypercapnia

International Nuclear Information System (INIS)

Karatzas, N.D.; Sfakianakis, G.N.; Pappas, D.; Duncan, R.; Heal, A.; Serafini, A.; Kung, H.F.

1988-01-01

The 30-min brain uptake of [ 125 I]HIPDM was measured in conscious rats--normocapnic (n = 8), hypercapnic (n = 12), and hyperoxic (n = 6). A mean 41.2% higher uptake was found in the brains of hypercapnic animals (p less than 0.01). In the three groups of rats, brain HIPDM uptake had a negative correlation with body weight (p less than 0.001) and a positive correlation with arterial pCO 2 (p less than 0.01), when adjusted for body weight. These results indicate that HIPDM uptake with hypercapnia may be used as a provocative test to measure cerebral blood flow reserves

Twenty-One at TREC-7: ad-hoc and cross-language track

NARCIS (Netherlands)

Hiemstra, Djoerd; Kraaij, Wessel; Voorhees, E.M; Harman, D.K.

1999-01-01

This paper describes the official runs of the Twenty-One group for TREC-7. The Twenty-One group participated in the ad-hoc and the cross-language track and made the following accomplishments: We developed a new weighting algorithm, which outperforms the popular Cornell version of BM25 on the ad-hoc

Metallic mercury uptake by catalase Part 1 In Vitro metallic mercury uptake by various kind of animals' erythrocytes and purified human erythrocyte catalase

OpenAIRE

劒持,堅志

1980-01-01

The uptake of metallic mercury was studied using erythrocytes with different catalase activities taken from various kind of animals. The results were: 1) The uptake of metallic mercury by erythrocytes paralleled the activity of catalase in the erythrocytes with and without hydrogen peroxide, suggesting that the erythrocyte catalase activity is related to the uptake of metallic mercury. 2) The uptake of metallic mercury occurred not only with purified human erythrocyte catalase but also with h...

Coupling nutrient uptake and energy flow in headwater streams

Energy Technology Data Exchange (ETDEWEB)

Mulholland, Patrick J [ORNL; Fellows, Christine [Griffith University, Nathan, Queensland, Australia; Valett, H. Maurice [Virginia Polytechnic Institute and State University (Virginia Tech); Dahm, Cliff [University of New Mexico, Albuquerque; Thomas, Steve [University of Nebraska

2006-08-01

Nutrient cycling and energy flow in ecosystems are tightly linked through the metabolic processes of organisms. Greater uptake of inorganic nutrients is expected to be associated with higher rates of metabolism [gross primary production (GPP) and respiration (R)], due to assimilatory demand of both autotrophs and heterotrophs. However, relationships between uptake and metabolism should vary with the relative contribution of autochthonous and allochthonous sources of organic matter. To investigate the relationship between metabolism and nutrient uptake, we used whole-stream and benthic chamber methods to measure rates of nitrate-nitrogen (NO{sub 3}-N) uptake and metabolism in four headwater streams chosen to span a range of light availability and therefore differing rates of GPP and contributions of autochthonous carbon. We coupled whole-stream metabolism with measures of NO{sub 3}-N uptake conducted repeatedly over the same stream reach during both day and night, as well as incubating benthic sediments under both light and dark conditions. NO{sub 3}-N uptake was generally greater in daylight compared to dark conditions, and although day-night differences in whole-stream uptake were not significant, light-dark differences in benthic chambers were significant at three of the four sites. Estimates of N demand indicated that assimilation by photoautotrophs could account for the majority of NO{sub 3}-N uptake at the two sites with relatively open canopies. Contrary to expectations, photoautotrophs contributed substantially to NO{sub 3}-N uptake even at the two closed-canopy sites, which had low values of GPP/R and relied heavily on allochthonous carbon to fuel R.

FDG uptake in vaginal tampons is caused by urinary contamination and related to tampon position

International Nuclear Information System (INIS)

Burger, Irene A.; Crook, David W.; Treyer, Valerie; Hany, Thomas F.; Schulthess, Gustav K. von; Scheiner, David A.

2011-01-01

The aim of the study was to determine the aetiology of FDG uptake in vaginal tampons (VT), a known artefact in premenopausal women evaluated by PET/CT. This Institutional Review Board approved study consisted of retrospective and prospective parts. The retrospective analysis included 685 women examined between January 2008 and December 2009 regarding VT presence. PET/CT images were analysed to determine the localization and the standardized uptake value (SUV) of VTs. We prospectively recruited 24 women (20-48 years old) referred for staging or follow-up in an oncology setting between February and April 2010, who were provided a commercial VT to be used during the entire examination after obtaining written informed consent. After image acquisition, VTs were individually analysed for creatinine concentration and blood traces. Statistical significance was tested with the Mann-Whitney U test. In the retrospective part, 38 of 685 women were found to have a VT of which 17 (45%) were FDG positive. A statistically significant correlation was found between FDG activity and VT position below the pubococcygeal line (PCL) (13 ± 11.2 mm). In the prospective study, 7 of 24 (29%) women had increased FDG activity in their VTs (SUV 18.8 ± 11 g/ml) but were not menstruating. FDG-positive VTs were significantly lower in position (14.6 ± 11.4 mm,below the PCL) than FDG-negative VTs (p = 0.039). The creatinine concentration was significantly increased in all seven positive VTs (931 ± 615 μmol/l). FDG uptake in VTs is caused by urine contamination, which is likely related to localization below the PCL resulting in contact with urine during voiding. (orig.)

Uptake and depuration of pharmaceuticals in aquatic invertebrates

International Nuclear Information System (INIS)

Meredith-Williams, Melanie; Carter, Laura J.; Fussell, Richard; Raffaelli, David; Ashauer, Roman; Boxall, Alistair B.A.

2012-01-01

The uptake and depuration of a range of pharmaceuticals in the freshwater shrimp (Gammarus pulex) and the water boatman (Notonecta glauca) was studied. For one compound, studies were also done using the freshwater snail Planobarius corneus. In G. pulex, bioconcentration factors (BCFs) ranged from 4.6 to 185,900 and increased in the order moclobemide < 5-fluoruracil < carbamazepine < diazepam < carvedilol < fluoxetine. In N. glauca BCFs ranged from 0.1 to 1.6 and increased in the order 5-fluorouracil < carbamazepine < moclobemide < diazepam < fluoxetine < carvedilol. For P. corneus, the BCF for carvedilol was 57.3. The differences in degree of uptake across the three organisms may be due to differences in mode of respiration, behaviour and the pH of the test system. BCFs of the pharmaceuticals for each organism were correlated to the pH-corrected liposome–water partition coefficient of the pharmaceuticals. - Highlights: ► One of the first studies exploring the uptake of pharmaceuticals into aquatic invertebrates. ► Data presented on uptake, depuration rates and bioconcentration for a range of pharmaceuticals. ► Uptake is correlated with the pH-corrected liposome–water partition coefficient. ► Findings can be used to better predict impacts of pharmaceuticals on the aquatic environment. - The factors affecting the degree of uptake of pharmaceuticals into aquatic invertebrates were studied. The results indicate that species traits such as respiration and behaviour of the organisms and pH-corrected liposome–water partition coefficients are important factors in determining pharmaceutical uptake.

Uptake of inorganic contaminants by pteridophytes

International Nuclear Information System (INIS)

Zheng Jiemin; Chen Ziyuan; Tang Shirong; Guangzhou Univ., Guangzhou; Ding Bingyang

2005-01-01

The review covers results at home and abroad in terms of uptake of inorganic contaminants by pteridophytes, and suggests pteridophytes' significance in phytoremediation; the mechanisms related to uptake of inorganic contaminants by pteridophytes and some methods and means used for research on the mechanism are also introduced; the authors' viewpoints on future development trends are presented in this paper. (authors)

Determinants in the uptake of the human papillomavirus vaccine

DEFF Research Database (Denmark)

de Casadevante, Victoria Fernández; Cuesta, Julita Gil; Cantarero Arevalo, Lourdes

2015-01-01

of HPVV uptake in Europe. Methods: We performed a systematic Pubmed, Scopus, and Science Direct search to find articles published from HPVV availability in European countries until April 2014. No age restriction was applied. We included all studies assessing factors associated with HPVV uptake. Uptake...

Increased muscle glucose uptake after exercise

DEFF Research Database (Denmark)

Richter, Erik; Ploug, Thorkil; Galbo, Henrik

1985-01-01

responsiveness of glucose uptake was noted only in controls. Analysis of intracellular glucose-6-phosphate, glucose, glycogen synthesis, and glucose transport suggested that the exercise effect on responsiveness might be due to enhancement of glucose disposal. After electrical stimulation of diabetic...... of glucose. At maximal insulin concentrations, the enhancing effect of exercise on glucose uptake may involve enhancement of glucose disposal, an effect that is probably less in muscle from diabetic rats.(ABSTRACT TRUNCATED AT 250 WORDS)......It has recently been shown that insulin sensitivity of skeletal muscle glucose uptake and glycogen synthesis is increased after a single exercise session. The present study was designed to determine whether insulin is necessary during exercise for development of these changes found after exercise...

Reduced 125I-meta-iodobenzylguanidine uptake and norepinephrine transporter density in the hearts of mice with MPTP-induced parkinsonism

International Nuclear Information System (INIS)

Fukumitsu, Nobuyoshi; Suzuki, Masahiko; Fukuda, Takahiro; Kiyono, Yasushi; Kajiyama, Satomi; Saji, Hideo

2006-01-01

Uptake of 123 I-meta-iodobenzylguanidine ( 123 I-MIBG) is markedly reduced in the hearts of patients with Parkinson's disease. Although the mechanism of this reduction is unclear, 12 5 I-MIBG uptake is similarly reduced in the hearts of mice with 1-methyl-4-phenyl-1,2,3,6-tetrahydroxypyridine (MPTP)-induced parkinsonism. Three groups of ten 15-week-old C57BL6 mice received intraperitoneal injections of (1) saline (control) (2) 10 mg/kg MPTP or (3) 40 mg/kg MPTP. After 0.185 MBq of 125 I-MIBG was injected, the percent injected dose of 125 I-MIBG per gram of tissue (%ID/g) was determined and cardiac concentrations of norepinephrine were measured. Cardiac concentrations of norepinephrine transporter (NET) were measured in three groups of twenty 15-week-old C57BL6 mice receiving these same treatments. The %ID/g in mice receiving 10 or 40 mg/kg MPTP (5.7±1.1 and 4.4±1.2%/g) was significantly lower than that in control mice (11.3±2.2%/g; P 5 and 7.50±0.89x10 5 pg/wet g) was significantly lower than that in control mice (9.21±0.97x10 5 pg/wet g; P 125 I-MIBG and NET density decreased as the dose of MPTP increased. This study clearly shows that reduced cardiac 12 5 I-MIBG uptake in mice with MPTP-induced parkinsonism is closely related to the reduced NET density in postganglionic cardiac sympathetic nerve terminals

Explaining variation in the uptake of HPV vaccination in England

Directory of Open Access Journals (Sweden)

Whynes David K

2011-03-01

Full Text Available Abstract Background In England, two national programmes of HPV vaccination for girls have been instituted, a routine programme for 12- and 13-year-olds and a catch-up programme for 17- and 18-year-olds. Uptake rates across the country have been far from uniform, and this research sought to identify factors explaining the variation in uptake by locality. Methods An association between uptake, deprivation and ethnic background had been established in pilot research. The present analysis was conducted at an aggregate, Primary Care Trust (PCT, level for the first year of the programmes. Published measures of HPV vaccination uptake, material deprivation, ethnic composition of PCT populations, primary care quality, and uptake of cervical screening and of other childhood immunisations were collated. Strong evidence of collinearity amongst the explanatory variables required a factor analysis to be undertaken. This provided four independent factors, used thereafter in regression models to explain uptake by PCT. Results The factor analysis revealed that ethnic composition was associated with attitudes towards cervical screening and other childhood vaccinations, whilst material deprivation and quality of primary care were orthogonal. Ethnic composition, early childhood vaccination, cervical screening and primary care quality were found to be influential in predicting uptake in both the routine and the catch-up cohorts, although with a lower degree of confidence in the case of the last two independent variables. Lower primary care quality was significant in explaining a greater fall in vaccination uptake between the first two doses in the catch-up cohort. Greater deprivation was a significant explanatory factor for both uptake and the fall in uptake between doses for the catch-up cohort but not for uptake in the routine cohort. Conclusion These results for uptake of the first year of the national programme using aggregate data corroborate findings from

Flavonoid rutin increases thyroid iodide uptake in rats.

Directory of Open Access Journals (Sweden)

Carlos Frederico Lima Gonçalves

Full Text Available Thyroid iodide uptake through the sodium-iodide symporter (NIS is not only an essential step for thyroid hormones biosynthesis, but also fundamental for the diagnosis and treatment of different thyroid diseases. However, part of patients with thyroid cancer is refractory to radioiodine therapy, due to reduced ability to uptake iodide, which greatly reduces the chances of survival. Therefore, compounds able to increase thyroid iodide uptake are of great interest. It has been shown that some flavonoids are able to increase iodide uptake and NIS expression in vitro, however, data in vivo are lacking. Flavonoids are polyhydroxyphenolic compounds, found in vegetables present in human diet, and have been shown not only to modulate NIS, but also thyroperoxidase (TPO, the key enzyme in thyroid hormones biosynthesis, besides having antiproliferative effect in thyroid cancer cell lines. Therefore, we aimed to evaluate the effect of some flavonoids on thyroid iodide uptake in Wistar rats in vivo. Among the flavonoids tested, rutin was the only one able to increase thyroid iodide uptake, so we decided to evaluate the effect of this flavonoid on some aspects of thyroid hormones synthesis and metabolism. Rutin led to a slight reduction of serum T4 and T3 without changes in serum thyrotropin (TSH, and significantly increased hypothalamic, pituitary and brown adipose tissue type 2 deiodinase and decreased liver type 1 deiodinase activities. Moreover, rutin treatment increased thyroid iodide uptake probably due to the increment of NIS expression, which might be secondary to increased response to TSH, since TSH receptor expression was increased. Thus, rutin might be useful as an adjuvant in radioiodine therapy, since this flavonoid increased thyroid iodide uptake without greatly affecting thyroid function.

Ficus Deltoidea Enhance Glucose Uptake Activity in Cultured Muscle Cells

International Nuclear Information System (INIS)

Zainah Adam; Shafii Khamis; Amin Ismail; Muhajir Hamid

2015-01-01

Ficus deltoidea or locally known as Mas cotek is one of the common medicinal plants used in Malaysia. Our previous studies showed that this plant have blood glucose lowering effect. Glucose uptake into muscle and adipocytes cells is one of the known mechanisms of blood glucose lowering effect. This study was performed to evaluate the effect of Ficus deltoidea on glucose uptake activity into muscle cells. The cells were incubated with Ficus deltoidea extracts either alone or combination with insulin. Amount of glucose uptake by L6 myotubes was determined using glucose tracer, 2-deoxy-(1- 3 H 1 )-glucose. The results showed that Ficus deltoidea extracts at particular doses enhanced basal or insulin-mediated glucose uptake into muscle cells significantly. Hot aqueous extract enhanced glucose uptake at the low concentration (10 μg/ ml) whereas methanolic extract enhanced glucose uptake at low and high concentrations. Methanolic extract also mimicked insulin activity during enhancing glucose uptake into L^ muscle cells. Glucose uptake activity of Ficus deltoidea could be attributed by the phenolic compound presence in the plant. This study had shown that Ficus deltoidea has the ability to enhance glucose uptake into muscle cells which is partly contributed the antidiabetic activity of this plant. (author)

Accurate and Practical Identification of 20 Fusarium Species by Seven-Locus Sequence Analysis and Reverse Line Blot Hybridization, and an In Vitro Antifungal Susceptibility Study▿†

Science.gov (United States)

Wang, He; Xiao, Meng; Kong, Fanrong; Chen, Sharon; Dou, Hong-Tao; Sorrell, Tania; Li, Ruo-Yu; Xu, Ying-Chun

2011-01-01

Eleven reference and 25 clinical isolates of Fusarium were subject to multilocus DNA sequence analysis to determine the species and haplotypes of the fusarial isolates from Beijing and Shandong, China. Seven loci were analyzed: the translation elongation factor 1 alpha gene (EF-1α); the nuclear rRNA internal transcribed spacer (ITS), large subunit (LSU), and intergenic spacer (IGS) regions; the second largest subunit of the RNA polymerase gene (RPB2); the calmodulin gene (CAM); and the mitochondrial small subunit (mtSSU) rRNA gene. We also evaluated an IGS-targeted PCR/reverse line blot (RLB) assay for species/haplotype identification of Fusarium. Twenty Fusarium species and seven species complexes were identified. Of 25 clinical isolates (10 species), the Gibberella (Fusarium) fujikuroi species complex was the commonest (40%) and was followed by the Fusarium solani species complex (FSSC) (36%) and the F. incarnatum-F. equiseti species complex (12%). Six FSSC isolates were identified to the species level as FSSC-3+4, and three as FSSC-5. Twenty-nine IGS, 27 EF-1α, 26 RPB2, 24 CAM, 18 ITS, 19 LSU, and 18 mtSSU haplotypes were identified; 29 were unique, and haplotypes for 24 clinical strains were novel. By parsimony informative character analysis, the IGS locus was the most phylogenetically informative, and the rRNA gene regions were the least. Results by RLB were concordant with multilocus sequence analysis for all isolates. Amphotericin B was the most active drug against all species. Voriconazole MICs were high (>8 μg/ml) for 15 (42%) isolates, including FSSC. Analysis of larger numbers of isolates is required to determine the clinical utility of the seven-locus sequence analysis and RLB assay in species classification of fusaria. PMID:21389150

Nitrogen and phosphorus uptake in two Idaho (USA) headwater wilderness streams.

Science.gov (United States)

Davis, Jeffrey C; Minshall, G Wayne

1999-05-01

Nitrate and phosphate solutions were released into two reaches of two central Idaho streams to determine within- and between-stream variability in uptake lengths, uptake rates, and mass transfer coefficients. Physical and biotic stream characteristics and periphyton nitrate-uptake rates in recirculating chambers were measured to determine their influence on nutrient dynamics. Phosphate uptake length did not differ among the four reaches. There were no within-stream differences in nitrate uptake lengths but they did differ between the two streams. Long nitrate uptake lengths likely were due to instream concentrations above saturation but also may have been influenced by differences in active surface area and algal abundance. Nitrate and phosphate uptake lengths were longer, and uptake rates higher, than most other published values. However, mass transfer coefficients were comparable to measurements in other streams. Mass transfer coefficients may be a better parameter for temporal and spatial comparisons of instream nutrient dynamics, and for determining the underlying causes of variability in uptake length.

Bacterial uptake of photosynthetic carbon from freshwater phytoplankton

International Nuclear Information System (INIS)

Coveney, M.F.

1982-01-01

Microheterotrophic uptake of algal extracellular products was studied in two eutrophic lakes in southern Sweden. Size fractionation was used in H 14 CO 3 uptake experiments to measure 14 C fixation in total particulate, small particulate and dissolved organic fractions. Carbon fixed in algal photosynthesis was recovered as dissolved and small particulate 14 C, representing excretion and bacterial uptake of algal products. Estimated gross extracellular release was low in these eutrophic systems, 1 to 7% of total 14 C uptake per m 2 lake surface. From 28 to 80 % of 14 C released was recovered in the small particulate fraction after ca. 4h incubation.This percentage was uniform within each depth profile, but varied directly with in situ water temperature. Laboratory time-series incubations indicated steady state for the pool of algal extracellular products on one occasion, while increasing pool size was indicated in the remaining two experiments. Uptake of photosynthetic carbon to small particles in situ was 32 to 95% of estimted heterotrophic bacterial production (as dark 14 CO 2 uptake) on four occasions. While excretion apparently was not an important loss of cabon for phytoplankton, it may have represented an important carbon source for planktonic bacteria. (author)

Maximum standard uptake value on pre-chemotherapeutic FDG-PET is a significant parameter for disease progression of newly diagnosed lymphoma

International Nuclear Information System (INIS)

Eo, Jae Seon; Lee, Won Woo; Chung, June Key; Lee, Myung Chul; Kim, Sang Eun

2005-01-01

F-18 FDG-PET is useful for detection and staging of lymphoma. We investigated the prognostic significance of maximum standard uptake (maxSUV) value of FDG-PET for newly diagnosed lymphoma patients before chemotherapy. Twenty-seven patients (male: female = 17: 10: age: 49±19 years) with newly diagnosed lymphoma were enrolled. Nine-teen patients suffered from B cell lymphoma, 6 Hodgkins disease and 2 T cell lymphoma. One patient was stage I, 9 stage II, 3 stage III, 1 stage IV and 13 others. All patients underwent FDG-PET before initiation of chemotherapy. MaxSUV values using lean body weight were obtained for main and largest lesion to represent maxSUV of the patients. The disease progression was defined as total change of the chemotherapeutic regimen or addition of new chemotherapeutic agent during follow up period. The observed period was 389±224 days. The value of maxSUV ranged from 3 to 18 (mean±SD = 10.6±4.4). The disease progressions occurred in 6 patients. Using Cox proportional-hazard regression analysis, maxSUV was identified as a significant parameter for the disease progression free survival (p=0.044). Kaplan-Meier survival curve analysis revealed that the group with higher maxSUV (=10.6, n=5) suffered from shorter disease progression free survival (median 299 days) than the group with lower maxSUV (<10.6, n = 22) (median 378 days, p=0.0146). We found that maxSUV on pre-chemotherapeutic F-18 FDG-PET for newly diagnosed lymphoma patients is a significant parameter for disease progression. Lymphoma patients can be stratified before initiation of chemotherapy in terms of disease progression by the value of maxSUV 10.6

Lactate, Glucose and Oxygen Uptake in Human Brain During Recovery from Maximal Exercise

DEFF Research Database (Denmark)

Kojiro, I.; Schmalbruch, I.K.; Quistorff, B.

1999-01-01

Skeletal muscle, brain lactate uptake, brain oxygen uptake, energy metabolism, brain glucose uptake......Skeletal muscle, brain lactate uptake, brain oxygen uptake, energy metabolism, brain glucose uptake...

Heavy metal uptake of Geosiphon pyriforme

Energy Technology Data Exchange (ETDEWEB)

Scheloske, Stefan E-mail: stefan.scheloske@mpi-hd.mpg.de; Maetz, Mischa; Schuessler, Arthur

2001-07-01

Geosiphon pyriforme represents the only known endosymbiosis between a fungus, belonging to the arbuscular mycorrhizal (AM) fungi, and cyanobacteria (blue-green algae). Therefore we use Geosiphon as a model system for the widespread AM symbiosis and try to answer some basic questions regarding heavy metal uptake or resistance of AM fungi. We present quantitative micro-PIXE measurements of a set of heavy metals (Cu, Cd, Tl, Pb) taken up by Geosiphon-cells. The uptake is studied as a function of the metal concentration in the nutrient solution and of the time Geosiphon spent in the heavy metal enriched medium. The measured heavy metal concentrations range from several ppm to some hundred ppm. Also the influence of the heavy metal uptake on the nutrition transfer of other elements will be discussed.

Indium-111-labeled white blood cells in the detection of osteomyelitis complicated by a pre-existing condition

International Nuclear Information System (INIS)

McCarthy, K.; Velchik, M.G.; Alavi, A.; Mandell, G.A.; Esterhai, J.L.; Goll, S.

1988-01-01

Forty-six patients (23M, 23F) ranging in age from 19 to 79 yr with a clinical history of a nonunion fracture, surgery, diabetes or a soft-tissue infection were studied with [ 111 In]oxine WBCs to detect osteomyelitis. There were 27 true-positive, nine true-negative, two false-positive and one false-negative. The false-positives and the false-negative occurred in patients with soft-tissue infections overlying the area of interest. All diagnoses were confirmed by intraoperative bone biopsies and cultures. Bone biopsy and scan were performed within 2 days of each other in 39 patients. The overall sensitivity was 97% (27/28), specificity, 82% (9/11) and the diagnostic accuracy, 92% (36/39). The remaining seven patients had negative [ 111 In]WBC scans several months after positive bone biopsies and definite antibiotic treatment. This suggests that [In]WBC scans become negative after appropriate therapy is undertaken. Interobserver data was obtained from four nuclear physicians of varying experience blinded to clinical information. A high degree of agreement was found in over 90% of the cases. This study demonstrates the utility of [ 111 In]WBC scans in the diagnosis and follow-up of complicated osteomyelitis and a high level of interobserver agreement in scan interpretation

Selective uptake of manganese in seawater by hybrid microcapsules

International Nuclear Information System (INIS)

Kuzumaki, Takenori; Yan, Wu; Mimura, Hitoshi; Niibori, Yuichi

2008-01-01

The selective separation and recovery of low concentrated elements in seawater are very important subjects for the advancement of environmental monitoring. Selective uptake of manganese from seawater was carried out by using two kinds of microcapsules (MCs) including activated carbon (AC) and insoluble tannin (T). The adsorbents, AC and T, having affinity for manganese, were enclosed into MCs (ACMS, TMC) by sol-gel method using matrices of biopolymer (calcium alginate gel polymer, CaALG). The uptake properties and selectivity of Mn 2+ (1 ppm) for MCs were examined by batch method. Relatively large uptake percentages of Mn 2+ above 80% were obtained within 1 h, and the uptake percentage above 80% was kept at pH 3-6. The uptake order was found to be T, AC, CaALG > ACMC, TMC. The uptake of Mn 2+ decreased with increasing Na + ion concentration. This tendency depends on the swelling property of CaALG; it tends to solate in the presence of highly concentrated Na + ions. The manganese ions were adsorbed on CaALG, ACMC and TMC from seawater containing 1,000 ppm Mn 2+ . ACMC and TMC had selectivity to Mn 2+ , and, especially, the matrices of CaALG also had an excellent uptake and selectivity properties. (author)

Selenium Uptake and Volatilization by Marine Algae

Science.gov (United States)

Luxem, Katja E.; Vriens, Bas; Wagner, Bettina; Behra, Renata; Winkel, Lenny H. E.

2015-04-01

Selenium (Se) is an essential trace nutrient for humans. An estimated one half to one billion people worldwide suffer from Se deficiency, which is due to low concentrations and bioavailability of Se in soils where crops are grown. It has been hypothesized that more than half of the atmospheric Se deposition to soils is derived from the marine system, where microorganisms methylate and volatilize Se. Based on model results from the late 1980s, the atmospheric flux of these biogenic volatile Se compounds is around 9 Gt/year, with two thirds coming from the marine biosphere. Algae, fungi, and bacteria are known to methylate Se. Although algal Se uptake, metabolism, and methylation influence the speciation and bioavailability of Se in the oceans, these processes have not been quantified under environmentally relevant conditions and are likely to differ among organisms. Therefore, we are investigating the uptake and methylation of the two main inorganic Se species (selenate and selenite) by three globally relevant microalgae: Phaeocystis globosa, the coccolithophorid Emiliania huxleyi, and the diatom Thalassiosira oceanica. Selenium uptake and methylation were quantified in a batch experiment, where parallel gas-tight microcosms in a climate chamber were coupled to a gas-trapping system. For E. huxleyi, selenite uptake was strongly dependent on aqueous phosphate concentrations, which agrees with prior evidence that selenite uptake by phosphate transporters is a significant Se source for marine algae. Selenate uptake was much lower than selenite uptake. The most important volatile Se compounds produced were dimethyl selenide, dimethyl diselenide, and dimethyl selenyl sulfide. Production rates of volatile Se species were larger with increasing intracellular Se concentration and in the decline phase of the alga. Similar experiments are being carried out with P. globosa and T. oceanica. Our results indicate that marine algae are important for the global cycling of Se

[Long-Term Inhibition of FNA on Aerobic Phosphate Uptake and Variation of Phosphorus Uptake Properties of the Sludge].

Science.gov (United States)

Ma, Juan; Li, Lu; Yu, Xiao-jun; Sun, Lei-jun; Sun, Hong-wei; Chen, Yong-zhi

2015-10-01

An alternating anaerobic/oxic ( An/O) sequencing batch reactor (SBR) was employed to investigate the long-term inhibitory effect of free nitrous acid (FNA) on aerobic phosphorus uptake performance and variation of phosphorus uptake properties of the sludge by adding nitrite. The reactor was started up under the condition of 21-23 degrees C. The results showed that FNA had no impact on phosphate release and uptake capacities of the sludge. However, the specific phosphate release/uptake rates was found to be higher. As FNA concentration (measure by HNO2-N) was lower than 0.53 x 10(-3) mg x L(-1), phosphorus removal efficiency of the system was higher than 96.9%. When the FNA concentration was increased to 0.99 x 10(-3) mg x L(-1), 1.46 x 10(-3) mg x L(-1) and 1.94 x 10(-3) mg x L(-1), the phosphorus removal performance deteriorated rapidly. The phosphorus removal efficiency was recovered to 64.42%, 67.33% and 44.14% after 50, 12 and 30 days, respectively, which implied the deterioration of phosphorus removal performance caused by FNA inhibition could be recovered and long-term acclimation could shorten the recovery process. Notably, increasing nitrite consumption appeared during aerobic phase with the concentration of FNA below 1.46 x 10(-3) mg x L(-1). It was also observed that the phosphorus uptake properties of the sludge varied after long-term inhibition. Nitrate and nitrite type anoxic phosphorus uptake capacity was increased by 3.35 and 3.86 times, respectively, suggesting long-term dosing FNA may facilitate the denitrifying of polyphosphate in organisms utilizing nitrite as electron acceptor. Moreover, long-term acclimation favored sludge settling.

Projecting twenty-first century regional sea-level changes

NARCIS (Netherlands)

Slangen, A.B.A.; Carson, M.; Katsman, C.A.; van de Wal, R.S.W.; Köhl, A.; Vermeersen, L.L.A.; Stammer, D.

2014-01-01

We present regional sea-level projections and associated uncertainty estimates for the end of the 21 (st) century. We show regional projections of sea-level change resulting from changing ocean circulation, increased heat uptake and atmospheric pressure in CMIP5 climate models. These are combined

99 mTc antigranulocyte monoclonal antibody imaging for the detection and assessment of inflammatory bowel disease newly diagnosed by colonoscopy in children

International Nuclear Information System (INIS)

Charron, M.; Hickeson, M.P.

2001-01-01

Objective: This prospective study evaluated a 99m Tc antigranulocyte monoclonal antibody Fab' imaging agent (Sulesomab) in children with inflammatory bowel disease (IBD) newly diagnosed by colonoscopy. Materials and methods: Ten children (4 boys, 6 girls; mean age 14 years) with newly diagnosed Crohn's disease (n = 6) or ulcerative colitis (n = 4) were studied. Colonoscopy was performed in all of these patients. Within 24 h after colonoscopy, they underwent scintigraphy with 99 m Tc-Sulesomab. Abdominal/pelvic images were acquired at 30 min (planar) and 2-4 h (planar and SPECT) after injection of Sulesomab. Eighty bowel segments were evaluated semi-quantitatively by the investigators, using these three sets of images. The Pediatric Disease Activity (PDA) was correlated with the erythrocyte sedimentation rate (ESR), white blood cell (WBC) count, albumin, Kirschner's score, the Sulesomab bowel segment with maximum uptake, and the sum of Sulesomab score in each segment. Results: The median PDA score was 26 (range 12.5-40). Three children had normal ESR and six normal WBC counts. All patients had at least one positive mucosal biopsy for IBD. While using the Kirschner's scale, the maximal severity of colonoscopy findings was graded as none (n = 2), mild (n = 4), moderate (n = 3), or severe (n = 1). Of the 59 segments evaluated with endoscopy, 35 were found to be endoscopically abnormal. The planar images identified 17 of these abnormal segments and the SPECT images 20. Nine of these ten children had abnormal bowel uptake by scintigraphy. Thus, the sensitivity of Sulesomab per patient was 90 % and per bowel segment 57 %. The correlation coefficient between the scintigraphic score for the segment with the Sulesomab maximum activity and the PDA was 0.3 (P = 0.41). Conclusion: In pediatric IBD assessment, planar imaging with Sulesomab did not prove very sensitive in detecting inflammation in each bowel segment. However, SPECT detected the presence of inflammation in the

Subacute haematotoxicity after PRRT with {sup 177}Lu-DOTA-octreotate: prognostic factors, incidence and course

Energy Technology Data Exchange (ETDEWEB)

Bergsma, Hendrik; Konijnenberg, Mark W.; Kam, Boen L.R.; Teunissen, Jaap J.M.; Kooij, Peter P.; Krenning, Eric P.; Kwekkeboom, Dik J. [Erasmus University Medical Center, Department of Nuclear Medicine, Rotterdam (Netherlands); Herder, Wouter W. de [Erasmus Medical Center, Department of Internal Medicine, Rotterdam (Netherlands); Franssen, Gaston J.H.; Eijck, Casper H.J. van [Erasmus Medical Center, Department of Surgery, Rotterdam (Netherlands)

2016-03-15

In peptide receptor radionuclide therapy (PRRT), the bone marrow (BM) is one of the dose-limiting organs. The accepted dose limit for BM is 2 Gy, adopted from {sup 131}I treatment. We investigated the incidence and duration of haematological toxicity and its risk factors in patients treated with PRRT with {sup 177}Lu-DOTA{sup 0}-Tyr{sup 3}-octreotate ({sup 177}Lu-DOTATATE). Also, absorbed BM dose estimates were evaluated and compared with the accepted 2 Gy dose limit. The incidence and duration of grade 3 or 4 haematological toxicity (according to CTCAE v3.0) and risk factors were analysed. Mean BM dose per unit (gigabecquerels) of administered radioactivity was calculated and the correlations between doses to the BM and haematological risk factors were determined. Haematological toxicity (grade 3/4) occurred in 34 (11 %) of 320 patients. In 15 of the 34 patients, this lasted more than 6 months or blood transfusions were required. Risk factors significantly associated with haematological toxicity were: poor renal function, white blood cell (WBC) count <4.0 x 10{sup 9}/l, age over 70 years, extensive tumour mass and high tumour uptake on the OctreoScan. Previous chemotherapy was not associated. The mean BM dose per administered activity in 23 evaluable patients was 67 ± 7 mGy/GBq, resulting in a mean BM dose of 2 Gy in patients who received four cycles of 7.4 GBq {sup 177}Lu-DOTATATE. Significant correlations between (cumulative) BM dose and platelet and WBC counts were found in a selected group of patients. The incidence of subacute haematological toxicity after PRRT with {sup 177}Lu-DOTATATE is acceptable (11 %). Patients with impaired renal function, low WBC count, extensive tumour mass, high tumour uptake on the OctreoScan and/or advanced age are more likely to develop grade 3/4 haematological toxicity. The BM dose limit of 2 Gy, adopted from {sup 131}I, seems not to be valid for PRRT with {sup 177}Lu-DOTATATE. (orig.)

Gallium-67 uptake in meningeal sarcoidosis

International Nuclear Information System (INIS)

Ayres, J.G.; Hicks, B.H.; Maisey, M.N.

1986-01-01

A case of sarcoidosis limited to the central nervous system is described in which the diagnosis was suggested by high Ga-67 uptake in the cranial and spinal meninges. The diagnosis was confirmed by meningeal biopsy. Treatment with oral corticosteroids resulted in clinical improvement and marked reduction in Ga-67 uptake in the meninges. This is the first reported case of the central nervous system sarcoid diagnosed by Ga-67 imaging

The uptake of radionuclides by plants

International Nuclear Information System (INIS)

Cawse, P.A.; Turner, G.S.

1982-02-01

A review of the literature, since 1970, on the research into the uptake of radionuclides by plants, with references to earlier soil and plant studies on the fate of nuclear weapons fallout. Experimental data on the uptake of plutonium isotopes, americium 241, cesium 137, radium 226, curium 244 and neptunium 237 and details of the chemical form of the radionuclide, soil type and plant growth period are tabulated. (U.K.)

Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations

Energy Technology Data Exchange (ETDEWEB)

Goyal, Manoj K; Sinha, Sanjib [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neurology, Bangalore, Karnataka (India); Ravishankar, Shivshankar; Shivshankar, Jai Jai [National Institute of Mental Health and Neurosciences (NIMHANS), Department of Neuroimaging and Interventional Radiology, Bangalore (India)

2009-03-15

Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 {+-} 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 {+-} 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)

Peri-ictal signal changes in seven patients with status epilepticus: interesting MRI observations

International Nuclear Information System (INIS)

Goyal, Manoj K.; Sinha, Sanjib; Ravishankar, Shivshankar; Shivshankar, Jai Jai

2009-01-01

Transient peri-ictal changes on imaging had been described following status epilepticus (SE), but its cause is not very well understood. We analyzed the magnetic resonance imaging (MRI) findings in SE patients in order to elucidate such changes including peri-ictal signal. This prospective study involved 34 patients (M/F 23:11, mean age 25.8 ± 17.2 years) who experienced SE. MRI was performed during or within 96 h of cessation of seizures. Twenty-five patients had generalized convulsive status epilectus (GCSE; ten secondary GCSE and 15 primary GCSE). Seven patients had epilepsia partialis continua and two patients non-convulsive SE. Eight patients had a history of seizures and three patients previous SE. The mean duration of SE prior to MRI was 89.2 ± 105.3 h (range 2-360 h). MRI provided diagnosis in 17 patients, and in 13 patients, no structural cause was identified. Peri-ictal focal signal changes with restricted diffusion on apparent diffusion coefficient maps were present in seven (20.6%) patients with SE (generalized convulsive, three; partial, three; non-convulsive, one). The changes were observed when MRI was performed during SE in 3/10 (30%) patients, or within 24 h in 1/7 (14.3%), 48 h in 1/5 (20%), 72 h in 1/6 (16.7%), or 96 h in 1/6 (16.7%) patients after cessation of seizures. Repeat MRI revealed disappearance of signal changes in two patients. Peri-ictal MR changes with restricted diffusion appear to be an effect rather than the cause of SE. (orig.)

Thyroid uptake of I-131 during anti-thyroid drug treatment

International Nuclear Information System (INIS)

Hoque, M.; Alam, F.; Haque, F.S.; Karim, M.A.; Fariduddin, M.

2004-01-01

Hyperthyroidism is a global ailment and its treatment is very promising either by ant-thyroid drug or by radioiodine. Iodine-131 uptake test is very important for evaluation of hyperthyroid in respect to its therapy and to exclude thyroiditis. This study was performed to observe the thyroid uptake pattern during intake of anti-thyroid medicine and workout the possibility to start I-131 therapy just after withdraw of antithyroid drug without waiting few days. In this study total 252 patient's I-131 uptake test is performed. Among the patient 135 (53.57%) were female, 117 (64.43%) were male. All this patients were hyperthyroid both clinically and biochemically. Thyroid uptake was taken to all patients at 24 hours after oral administration of 5 to 10 micro-curie of I -131. Uptake was taken by an uptake system and recorded as percentage uptake. These patients are grouped into three categories. Group-A-newly diagnosed cases, who have not taken antithyroid drug or I-131 therapy, there were 82 patients in this group, and their mean uptake was 37.12 ±18.5%. Group B - this group of patients were studied during intake of antithyroid medicine, there were 130 patients in this group and their mean uptake was 34.34±16.0%. Group-B patients were further divided in two sub-groups, patients having antithyroid drug for 1 to 3 weeks (group-B 1), group B1 have mean uptake 37±21% and those were taking antithyroid for 3 weeks to 2 years (group-B2), group B2 have uptake 34.34±20%. Group C- these patients are taken from those patients who had withdrawn antithyroid drug for 3 days to 3 months, there were 40 such patients. Group C further divided into two sub-group, group-C1 (stopped for 3-10 days) and group C2 (stopped for 11 days to 3 months). Group C1 had mean uptake 38±16% and group C2 had mean uptake 35±19%. From this study it is observed that Iodine-131 uptake percentage of untreated hyperthyroid; during antithyroid drug treatment and after withdraw of antithyroid drug almost

Retinal uptake and release of (/sup 3/H)DABA

Energy Technology Data Exchange (ETDEWEB)

Bauer, B; Ehinger, B [Lund Univ. (Sweden)

1978-03-01

The uptake of (/sup 3/H)DABA was studied in rat, guinea-pig and cat retinas in vivo and in rabbit retinas both in vivo and in vitro by autoradiography. (/sup 3/H)DABA was preferentially accumulated by a type of amacrine cell but after brief incubation or shortly after intravitreal injections there was not only a neuronal uptake but also a glial one. In guinea-pigs the glial labelling in vivo was significant also after 4 hr. The glial uptake (rabbits) was found to be saturable and temperature dependent as expected for an active uptake mechanism. The Ksub(m) of DABA uptake was 2.11 x 10/sup -5/ m and Vsub(max) 2.38 x 10/sup -5/ mol/mg/min. GABA competitively inhibited the DABA uptake. The uptake was not statistically significantly influenced by OMEGA-amino acids such as glycine, ..beta..-alanine, ..cap alpha..-alanine or epsilon-aminocaproic acid. The effect of different stimuli on the spontaneous efflux of radioactivity from (/sup 3/H)DABA preloaded rabbit retinas was studied with (/sup 3/H)DABA localized to neurons. Light flashes evoked a small but not statistically significant increased release whereas 40mM-K/sup +/ evoked an immediate and large increase. Unlabelled DABA, GABA and ..beta..-alanine (10/sup -5/M) increased the spontaneous efflux of (/sup 3/H)DABA but not glycine. It is concluded that there is in the retina of rats, guinea-pigs, cats, and rabbits, a glial high affinity uptake mechanism in addition to the neuronal uptake. DABA seems to be transported by the same mechanism as GABA in both systems. The DABA seems to be better retained in neurons than in glia in rats, cats and rabbits, which allows it to be used as a neuronal marker.

The Seven Sisters

DEFF Research Database (Denmark)

Söderqvist, Thomas

2011-01-01

Today, scientific biography is primarily thought of as a way of writing contextual history of science. But the genre has other functions as well. This article discusses seven kinds of ideal-typical subgenres of scientific biography. In addition to its mainstream function as an ancilla historiae...

Uptake of thallium-201 in enlarged thyroid glands. Concise communication

International Nuclear Information System (INIS)

Fukuchi, M.; Kido, A.; Hyodo, K.; Tachibana, K.; Onoue, K.; Morita, T.; Nagai, K.

1979-01-01

We have investigated the thyroid uptake of Tl-201 in 37 patients with various types of goiter, and in six with normal thyroids. Significant thallium uptake was found in all cases in which there was thyroid enlargement, including Graves' disease, toxic thyroid nodule, primary hypothyroidism, simple goiter, Hashimoto's disease, thyroid carcinoma, and thyroid adenoma. If goiter was absent, however, there was no demonstrable uptake - e.g., in secondary hypothyroidism, subacute thyroiditis, and the normal controls. Thallium uptake did not correlate with thyroid function tests such as BMR, T 3 -RU, T 3 , T 4 , TSH, antithyroid antibodies, or the 24-hr I-131 uptake. In 23 patients with diffuse goiter, on the other hand, maximum Tl-201 uptake correlated well with thyroid weight: r = 0.836 (p < 0.001); y = 0.02 x + 0.06

Growth, 14C-sucrose uptake, and metabolites of starch synthesis in apical and basal kernels of corn (Zea mays L.)

International Nuclear Information System (INIS)

Greenberg, J.M.

1985-01-01

Developing field-grown kernels of corn (Zea mays L. cv. Cornell 175) from the base and apex of the ear were sampled from seven to 70 days after pollination (DAP) an compared with respect to dry weight, ability to take up 14 C-sucrose from solution in vitro, and content of sucrose, glucose, starch, glucose-1-P (G1P), glucose-6-P (G6P), fructose-6-P (F6P), ADP-glucose (ADPG), and UDP-glucose (UDPG). ADPG and UDPG were analyzed by HPLC. All other metabolites were analyzed enzymatically. Simultaneous hand-pollination of all ovaries in an ear did not reduce the difference between apical and basal kernels in dry weight, indicating that the latter fertilization of apical kernels was not responsible for their lesser mature dry weight. Detached kernels took up 14 C-sucrose (0.3-400 mM) and glucose (5-100 mM) at rates linearly proportional to the sugar concentration. Glucose, fructose, and sorbitol did not inhibit uptake of 14 C-sucrose. Uptake was not stimulated by 5 mM CaCl 2 or the addition of buffers (pH 4.5-6.7) to the medium. Sulfhydryl reagents (PCMBS, NEM) and metabolic inhibitors (TNBS, DNP, NaF) did not reduce uptake. These observations suggest that sucrose is taken up by a non-saturable, non-energy-requiring mechanism. Sucrose uptake increased throughout development, especially at the stage when basal kernels began to accumulate more dry weight than apical kernels (10-20 DAP in freely pollinated ears; 25 DAP in synchronously pollinated ears). Hydrolysis of incorporated sucrose increased from 87% at 14 DAP to 99% by 57 DAP

Modeling uptake kinetics of cadmium by field-grown lettuce

Energy Technology Data Exchange (ETDEWEB)

Chen Weiping [Department of Environmental Sciences, University of California, 900 University Avenue, Riverside, CA 92521 (United States)], E-mail: chenweip@yahoo.com.cn; Li Lianqing [Institute of Resources, Ecosystem and Environment of Agriculture, Nanjing Agricultural University, Nanjing 210095 (China); Chang, Andrew C.; Wu Laosheng [Department of Environmental Sciences, University of California, 900 University Avenue, Riverside, CA 92521 (United States); Kwon, Soon-Ik [Agricultural Environmental and Ecology Division, National Institute of Agricultural Science and Technology, Suwon 441-707 (Korea, Republic of); Bottoms, Rick [Desert Research and Extension Center, 1004 East Holton Road, El Centro, CA 92243 (United States)

2008-03-15

Cadmium uptake by field grown Romaine lettuce treated with P-fertilizers of different Cd levels was investigated over an entire growing season. Results indicated that the rate of Cd uptake at a given time of the season can be satisfactorily described by the Michaelis-Menten kinetics, that is, plant uptake increases as the Cd concentration in soil solution increases, and it gradually approaches a saturation level. However, the rate constant of the Michaelis-Menten kinetics changes over the growing season. Under a given soil Cd level, the cadmium content in plant tissue decreases exponentially with time. To account for the dynamic nature of Cd uptake, a kinetic model integrating the time factor was developed to simulate Cd plant uptake over the growing season: C{sub Plant} = C{sub Solution} . PUF{sub max} . exp[-b . t], where C{sub Plant} and C{sub Solution} refer to the Cd content in plant tissue and soil solution, respectively, PUF{sub max} and b are kinetic constants. - A kinetic model was developed to evaluate the uptake of Cd under field conditions.

Modeling uptake kinetics of cadmium by field-grown lettuce

International Nuclear Information System (INIS)

Chen Weiping; Li Lianqing; Chang, Andrew C.; Wu Laosheng; Kwon, Soon-Ik; Bottoms, Rick

2008-01-01

Cadmium uptake by field grown Romaine lettuce treated with P-fertilizers of different Cd levels was investigated over an entire growing season. Results indicated that the rate of Cd uptake at a given time of the season can be satisfactorily described by the Michaelis-Menten kinetics, that is, plant uptake increases as the Cd concentration in soil solution increases, and it gradually approaches a saturation level. However, the rate constant of the Michaelis-Menten kinetics changes over the growing season. Under a given soil Cd level, the cadmium content in plant tissue decreases exponentially with time. To account for the dynamic nature of Cd uptake, a kinetic model integrating the time factor was developed to simulate Cd plant uptake over the growing season: C Plant = C Solution . PUF max . exp[-b . t], where C Plant and C Solution refer to the Cd content in plant tissue and soil solution, respectively, PUF max and b are kinetic constants. - A kinetic model was developed to evaluate the uptake of Cd under field conditions

Confronting quasi-exponential inflation with WMAP seven

International Nuclear Information System (INIS)

Pal, Barun Kumar; Pal, Supratik; Basu, B.

2012-01-01

We confront quasi-exponential models of inflation with WMAP seven years dataset using Hamilton Jacobi formalism. With a phenomenological Hubble parameter, representing quasi exponential inflation, we develop the formalism and subject the analysis to confrontation with WMAP seven using the publicly available code CAMB. The observable parameters are found to fair extremely well with WMAP seven. We also obtain a ratio of tensor to scalar amplitudes which may be detectable in PLANCK

Comparison of 99mTc-MIBI Myocardial Uptake at Rest with Reinjection and 24-hour after Reinjection Images of 201T1

International Nuclear Information System (INIS)

Bom, Hee Seung; Kim, Ji Yeul; Park, Joo Hyung; Ahn, Young Keun; Jeong, Myung Ho; Cho, Jeong Gwan; Park, Jong Choon; Kang, Jung Chaee

1992-01-01

Clinical role of 99m Tc-MIBI myocardial scintigraphy in the diagnosis of coronary artery disease (CAD) is now well accepted, however, the role of it in the identification of viable myocardium in patients with chronic CAD has not yet been clarified. To determine the usefulness of rest-injected 99m Tc-MIBI scan as a marker of myocardial viability, the regional uptake of this agent at rest was compared with that of '2 01 T1 on reinjection and 24 hours after reinjection images. Subject patients were 13 chronic CAD patients who showed irreversible perfusion defect(s) on standard pharmacologic (dipyridamole) stress-redistribution images. Immediately after the redistribution images were obtained, 37 MBq thallium was injected at rest, and images were reacquired at 10 minutes and 24 hours after reinjection. After then 740 MBq 99m Tc-MIBI was injected, and 1 hour later rest MIBI myocardial imaging was performed. Five sets of images (stress, redistribution, reinjection, delayed images of thallium, and rest image of MIBI) were then analyzed qualitatively and quantitatively. Left ventricle was arbitrarily divided into 9 segments (apex, basal and apical portions of anterior, septal, inferior, and lateral walls). Seven patients and 30 regions showed a fixed perfusion defect on the stress-redistribution images. Among 30 regions, 15 showed positive uptakes and 6 showed negative uptakes on both 201 T1 reinjection/delayed images and 99m Tc-MIBI rest images. Five regions showed only thallium uptake and were regarded as viable clinically. Of four regions which showed only 99m Tc-MIBI uptake, two were regarded as viable, while the other two were regarded as a nonviable scar tissue clinically. In conclusion, 201 T1 reinjection technique was more reliable in the identification of viable myocardium. However, the role of 99m Tc-MIBI in identification of viable myocardium was still remained to be clarified because 2 of 9 regions showed only 99m Tc-MIBI uptake and were regarded as viable

Menadione inhibits MIBG uptake in two neuroendocrine cell lines

NARCIS (Netherlands)

Cornelissen, J.; Tytgat, G. A.; van den Brug, M.; van Kuilenburg, A. B.; Voûte, P. A.; van Gennip, A. H.

1997-01-01

In this paper we report on our studies of the effect of menadione on the uptake of MIBG in the neuroendocrine cell lines PC12 and SK-N-SH. Menadione inhibits the uptake of MIBG in both cell lines in a dose-dependent manner. Inhibition of MIBG uptake is most pronounced in the PC12 cell line.

[Increased glucose uptake by seborrheic keratosis on PET scan].

Science.gov (United States)

Merklen-Djafri, C; Truntzer, P; Hassler, S; Cribier, B

2017-05-01

Positron emission tomography (PET) is an examination based upon the uptake of a radioactive tracer by hypermetabolic cells. It is primarily used in tandem with tomodensitometry (PET-TDM) for cancer staging because of its high sensitivity and specificity for the detection of metastases. However, unusually high uptake may occur with benign tumours, including skin tumours. Herein, we report an extremely rare case of pathological uptake levels resulting from seborrhoeic keratosis. A 55-year-old male patient with oesophageal squamous-cell carcinoma was referred to us following the discovery of an area of high marker uptake following PET-TDM and corresponding to a pigmented skin lesion. No other areas of suspect high uptake were seen. The lesion was surgically excised and histological examination indicated seborrhoeic keratosis. The histological appearance was that of standard seborrhoeic keratosis without any notable mitotic activity. PET-TDM is an examination that enables diagnosis of malignancy. However, rare cases have been described of increased marker uptake by benign cutaneous tumours such as histiocytofibroma, pilomatricoma and condyloma. To date, there have only been only very few cases of increased uptake due to seborrhoeic keratosis. This extremely unusual case of increased glucose uptake in PET-TDM due to seborrhoeic keratosis confirms that the hypermetabolic activity detected by this examination is not necessarily synonymous with malignancy and that confirmation by clinical and histological findings is essential. The reasons for increased metabolic activity within such benign tumours are not known. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

Correlation of hepatic {sup 18}F-fluorodeoxyglucose uptake with fatty liver

Energy Technology Data Exchange (ETDEWEB)

An, Young Sil; Yoon, Joon Kee; Hong, Seon Pyo; Joh, Chul Woo; Yoon, Seok Nam [Ajou University School of Medicine, Suwon (Korea, Republic of)

2006-10-15

Liver demonstrates heterogeneous FDG uptake and sometimes it shows abnormally increased uptake even though there is no malignant tissue. However, there was no previous study to correlate these various pattern of hepatic FDG uptake with benign liver disease. Therefore, we evaluated the significance of hepatic FDG uptake associated with various clinical factors including fatty liver, liver function tests and lipid profiles. We reviewed a total of 188 patients (male/female: 120/68, mean age: 50 {+-} 9) who underwent PET/CT for screening of malignancy. Patients with DM, impaired glucose tolerance, previous severe hepatic disease or long-term medication history were excluded. The FDG uptake in liver was analyzed semi-quantitatively using ROI on transaxial images (segment 8) and we compared mean standardized uptake value (SUV) between fatty liver and non-fatty liver group. We also evaluated the correlation between hepatic FDG uptake and various clinical factors including serum liver function test (ALT, AST), {gamma} -GT, total cholesterol and triglyceride concentration. The effect of alcoholic history and body mass index on hepatic FDG uptake was analyzed within the fatty liver patients. The hepatic FDG uptake of fatty liver group was significantly higher than that of non-fatty liver group. Serum total cholesterol and triglyceride concentration showed significant correlation with hepatic FDG uptake. However, there was no significant correlation between other factors (ALT, AST, and {gamma} -GT) and FDG uptake. Also there was no difference of mean SUV between normal and abnormal groups on the basis of alcoholic history and body mass index within fatty liver patients. Fatty liver and high serum triglyceride concentration were the independent factors affecting hepatic FDG uptake according to multivariate analysis. In conclusion, hepatic FDG uptake was strongly correlated with fatty liver and serum triglyceride concentration.

Game Demands of Seven-A-Side Soccer in Young Players.

Science.gov (United States)

Barbero-Alvarez, José C; Gómez-López, Maite; Castagna, Carlo; Barbero-Alvarez, Verónica; Romero, David V; Blanchfield, Anthony W; Nakamura, Fábio Y

2017-07-01

Barbero-Alvarez, JC, Gómez-López, M, Castagna, C, Barbero-Alvarez, V, Romero, DV, Blanchfield, AW, and Nakamura, FY. Game demands of seven-a-side soccer in young players. J Strength Cond Res 31(7): 1771-1779, 2017-The aim of this study was to examine the activity patterns and physiological demands of 7-a-side youth soccer matches across 2 chronological age categories (U12 and U14). Twenty-two soccer players of a national youth soccer academy were investigated. Players of each age category performed 2 training matches (2 × 25 minutes) and were monitored by global positioning system and heart rate monitor units. Players of both categories covered similar total distance (5,348 ± 307 m), at similar mean heart rate values (86 ± 4% of maximum). However, the number of high-intensity runs (82.5 ± 17.4 vs. 69.7 ± 15.2) and total distance covered during sprints (264 ± 207 vs. 128 ± 74 m) were significantly (p ≤ 0.05) higher in U14 compared with U12. The results suggest a highly demanding nature of 7-a-side soccer for skilled players, with physical maturity possibly influencing the match-related high-intensity performance at these ages.

Uptake of cadmium from hydroponic solutions by willows ( Salix spp ...

African Journals Online (AJOL)

Salix integra 'Weishanhu') and Yizhibi (S. integra 'Yizhibi') were chosen as model plants to evaluate their potential for uptake of cadmium from hydroponic culture and relative uptake mechanism. Cadmium uptake showed a linear increase in the ...

Twenty-First Century Literacy: A Matter of Scale from Micro to Mega

Science.gov (United States)

Brown, Abbie; Slagter van Tryon, Patricia J.

2010-01-01

Twenty-first century technologies require educators to look for new ways to teach literacy skills. Current communication methods are combinations of traditional and newer, network-driven forms. This article describes the changes twenty-first century technologies cause in the perception of time, size, distance, audience, and available data, and…

Prognostic value of metabolic indices and bone marrow uptake pattern on preoperative 18F-FDG PET/CT in pediatric patients with neuroblastoma

Energy Technology Data Exchange (ETDEWEB)

Li, Chao; Chen, Suyun; Huang, Shuo; Wu, Shuqi; Zhang, Linlin; Zhang, Fengxian; Wang, Hui [Shanghai Jiao Tong University School of Medicine, Department of Nuclear Medicine, Xinhua Hospital, Shanghai (China); Zhang, Jian [Shanghai Jiao Tong University School of Medicine, Department of Nuclear Medicine, Xinhua Hospital, Shanghai (China); Shanghai Universal Medical Imaging Diagnostic Center, Shanghai (China)

2018-02-15

To evaluate the prognostic value of metabolic parameters and bone marrow uptake (BMU) patterns on pretherapeutic 18-F-fluorodeoxyglucose (18F-FDG) positron emission tomography/computed tomography (PET/CT) in pediatric patients with neuroblastoma (NB). Forty-seven pediatric patients with newly diagnosed neuroblastoma who underwent 18F-FDG PET/CT were retrospectively reviewed. Clinicopathological factors and metabolic parameters including maximum standardized uptake value (SUVmax), metabolic tumor volume (MTV), total lesion glycolysis (TLG) and bone marrow uptake patterns on PET/CT were compared to predict recurrence-free survival (RFS) and overall survival (OS) by univariate and multivariate analysis. During the follow-up period, 27 (57.4%) patients experienced recurrence. MTV (P = 0.001), TLG (P = 0.004) and BMU patterns (P = 0.025) remained significant predictive factors for tumor recurrence, along with tumor size, histology, stage, lactate dehydrogenase (LDH) and other distant metastasis (except bone metastasis). Univariate analysis showed that histology, stage, tumor size (>37.25 cm), other distant metastasis, MTV (>88.10cm{sup 3}) and TLG (>1045.2 g) and BMU patterns correlated with both RFS and OS (P < 0.05). On multivariate analysis, TLG remained the only independent prognostic factor for RFS (P = 0.016) and OS (P = 0.012), and BMU patterns and MTV were statistically significant for OS (P = 0.024 and P = 0.038, respectively). Pretherapeutic 18F-FDG PET/CT can provide reliable prognostic information for neuroblastoma pediatric patients, and patients with high MTV, TLG and focal bone marrow (unifocal and multifocal) uptake on PET/CT may have inferior outcomes during subsequent treatment. (orig.)

Leukopenia and neutropenia caused by sertraline%舍曲林致白细胞和中性粒细胞减少

Institute of Scientific and Technical Information of China (English)

庄红艳; 刘珊珊; 杜海霞; 崔永华

2016-01-01

1例11岁女性患儿因童年情绪障碍服用舍曲林25 mg、喹硫平25 mg，1次/ d。2 d 后实验室检查：WBC 4.6×109/ L，中性粒细胞计数（NEUT）1.8×109/ L。诊断：中性粒细胞减少。停用喹硫平，继续服用舍曲林，给予盐酸小檗胺84 mg、利可君20 mg，3次/ d 口服。6 d 后为改善病情，舍曲林剂量增至50 mg，1次/ d。同时加用维生素 B610 mg，3次/ d 口服。舍曲林治疗第13天，患儿 WBC 3.5×109/ L ，NEUT 1.4×109/ L，诊断为白细胞减少。舍曲林治疗第24天，患儿 WBC 3.3×109/ L， NEUT 1.4×109/ L。加用安多霖胶囊0.64 g，2次/ d 口服。次日舍曲林减量至25 mg，1次/ d，2 d 后停用。5 d 后复查，患儿 WBC 4.4×109/ L，NEUT 2.0×109/ L。给予氟伏沙明改善情绪。7 d 后，患儿WBC 4.6×109/ L，NEUT 2.3×109/ L。%An 11-year-old female patient was given sertraline 25 mg once daily and quetiapine 25 mg once daily for childhood emotional disorders. The patient's white blood cells count(WBC)was 4. 6 ×109 / L and neutrophil count( NEUT)was 1. 8 ×109 / L two days later. The patient was diagnosed as neutropenia. Quetiapine was stopped and sertraline was given continually. At the same time berbamine hydrochloride 84 mg thrice daily and leucogen 20 mg thrice daily were given. Six days later,the dosage of sertraline was increased to 50 mg once daily to improve the symptoms and vitamin B6 10 mg thrice daily was given. On day 13 of sertraline therapy,the WBC was 3. 5 ×109 / L and the NEUT was 1.4×109 / L. Leukopenia was diagnosed. On day 24 of sertraline therapy,the WBC was 3. 3 ×109 / L and the NEUT was 1.4×109 / L. Anduolin(安多霖)capsules 0. 64 g twice daily were added to her regimen. Sertraline dose was reduced to 25 mg once daily the next day and was stopped 2 days later. Five days later,the patient's WBC was 4.4×109 / L and NEUT was 2. 0 ×109 / L. Then,fluvoxamine was given to improve mood. Seven days later,the patient's WBC was 4. 6

Uptake of thallium-201 in enlarged thyroid glands. Concise communication

Energy Technology Data Exchange (ETDEWEB)

Fukuchi, M.; Kido, A.; Hyodo, K.; Tachibana, K.; Onoue, K.; Morita, T.; Nagai, K.

1979-08-01

We have investigated the thyroid uptake of Tl-201 in 37 patients with various types of goiter, and in six with normal thyroids. Significant thallium uptake was found in all cases in which there was thyroid enlargement, including Graves' disease, toxic thyroid nodule, primary hypothyroidism, simple goiter, Hashimoto's disease, thyroid carcinoma, and thyroid adenoma. If goiter was absent, however, there was no demonstrable uptake - e.g., in secondary hypothyroidism, subacute thyroiditis, and the normal controls. Thallium uptake did not correlate with thyroid function tests such as BMR, T/sub 3/-RU, T/sub 3/, T/sub 4/, TSH, antithyroid antibodies, or the 24-hr I-131 uptake. In 23 patients with diffuse goiter, on the other hand, maximum Tl-201 uptake correlated well with thyroid weight: r = 0.836 (p < 0.001); y = 0.02 x + 0.06.

Uptake of rare earth elements by dryopteris erythrosora (autumn fern)

International Nuclear Information System (INIS)

Ozaki, Takuo; Enomoto, Shuichi

2001-01-01

Mechanisms of uptake of rare earth elements (REEs) were investigated, particularly those by REE accumulator species (autumn fern). Rare earth elements are practically insoluble under natural conditions, suggesting some unknown mechanisms in REE accumulator species. In the present investigation, two notable phenomena were observed. (1) Concerning the ionic-radius dependence of REE uptake by leaves, nonaccumulator species showed an extremely high uptake for Y compared with the adjacent-ionic-radius REEs in the multitracer, while accumulator species showed no anomaly. (2) REE uptake by autumn fern was influenced by the addition of chelating chemical reagents in the uptake solution, while no effect was observed for nonaccumulator species. (author)

Influence of drugs on myocardial iodine-123 metaiodobenzylguanidine uptake in rabbit myocardium

Energy Technology Data Exchange (ETDEWEB)

Mayer, S.; Karanikas, G.; Rodrigues, M.; Sinzinger, H. [Dept. of Nuclear Medicine, University of Vienna (Austria)

2000-03-01

About 15 years ago, iodine-123 metaiodobenzylguanidine (MIBG) myocardial imaging was introduced for the evaluation of myocardial sympathetic nerve function. Two uptake mechanisms for MIBG have so far been identified: uptake type I, a saturable, energy-dependent mechanism, and uptake type II, a non-saturable, energy-independent mechanism. We incubated isolated rabbit myocardial tissue samples with{sup 123}I-MIBG in order to assess the uptake characteristics and the influence of varying incubation conditions. Furthermore, we examined the effects of several drugs and uptake inhibitors on the myocardial uptake of MIBG. The in vitro myocardial uptake of MIBG reached a steady plateau at 23.87%{+-}3.63% after 1 h, i.e. a concentration gradient of 10, in a thermo-independent manner within a concentration range from 1.5 to 1500 {mu}M. This indicates an unsaturable uptake process in the tested concentrations. Pre-incubation with the following drugs caused a significant inhibitory effect on myocardial MIBG uptake: haloperidol, levomepromazine, metoprolol, labetalol and clomipramine. According to our findings, the uptake mechanism seems to be an unspecific process, but the concentration gradient of 10 makes passive diffusion unlikely. Further studies with uptake-II-blocking substances as well as with isolated myocardial cells will be needed to clarify the nature of the myocardial MIBG uptake mechanism. (orig.)

Actin-cytoskeleton rearrangement modulates proton-induced uptake

Energy Technology Data Exchange (ETDEWEB)

Ben-Dov, Nadav [Department of Physiology and Pharmacology, Faculty of Medicine, Tel-Aviv University, 69978 Tel-Aviv (Israel); Korenstein, Rafi, E-mail: korens@post.tau.ac.il [Department of Physiology and Pharmacology, Faculty of Medicine, Tel-Aviv University, 69978 Tel-Aviv (Israel)

2013-04-15

Recently it has been shown that elevating proton concentration at the cell surface stimulates the formation of membrane invaginations and vesicles accompanied by an enhanced uptake of macromolecules. While the initial induction of inward membrane curvature was rationalized in terms of proton-based increase of charge asymmetry across the membrane, the mechanisms underlying vesicle formation and its scission are still unknown. In light of the critical role of actin in vesicle formation during endocytosis, the present study addresses the involvement of cytoskeletal actin in proton-induced uptake (PIU). The uptake of dextran-FITC is used as a measure for the factual fraction of inward invaginations that undergo scission from the cell's plasma membrane. Our findings show that the rate of PIU in suspended cells is constant, whereas the rate of PIU in adherent cells is gradually increased in time, saturating at the level possessed by suspended cells. This is consistent with pH induced gradual degradation of stress-fibers in adherent cells. Wortmannin and calyculin-A are able to elevate PIU by 25% in adherent cells but not in suspended cells, while cytochalasin-D, rapamycin and latrunculin-A elevate PIU both in adherent and suspended cells. However, extensive actin depolymerization by high concentrations of latrunculin-A is able to inhibit PIU. We conclude that proton-induced membrane vesiculation is restricted by the actin structural resistance to the plasma membrane bending. Nevertheless, a certain degree of cortical actin restructuring is required for the completion of the scission process. - Highlights: ► Acidification of cells' exterior enhances uptake of macromolecules by the cells. ► Disruption of actin stress fibers leads to enhancement of proton induced uptake. ► Extensive depolymerization of cellular actin attenuates proton-induced uptake.

Nitrogen uptake kinetics of freshly isolated zooxanthellae

Digital Repository Service at National Institute of Oceanography (India)

Wafar, M.V.M.; Wafar, S.; Rajkumar, R.

that for nitrate [2.8 nmol. ( mu chl-a)./1h/1] and urea [0.37 nmol. ( mu chl-a)./1h/1]. Half-saturation constants for uptake of the three nitrogen compounds were in the range of 10-15 mu mol.l/1. Generally, uptake of any one nitrogen substrate appears to be inhibit...

Afterword: Victorian Sculpture for the Twenty-First Century

Directory of Open Access Journals (Sweden)

David J. Getsy

2016-06-01

Full Text Available Commenting on the directions proposed by this issue of '19', the afterword discusses the broad trends in twenty-first century studies of Victorian sculpture and the opportunity for debate arising from the first attempt at a comprehensive exhibition.

Uptake of carnitine by red blood cells

International Nuclear Information System (INIS)

Campa, M.; Borum, P.

1986-01-01

A significant amount of blood carnitine (70% of cord blood and 40% of blood from healthy adults) is partitioned into the red blood cell compartment of whole blood. Data indicate that the plasma compartment and the red blood cell compartment of whole blood represent different metabolic pools of carnitine. There are no data to indicate that red blood cells synthesize carnitine, but our understanding of the uptake of carnitine by red blood cells is negligible. Red blood cells were obtained from healthy adults, washed twice with normal saline, and used for uptake experiments. When the cells were incubated at 37 0 C in the presence of 14 C-carnitine, radioactivity was found both in the soluble cytosolic and membrane fractions of the cells following lysis. The uptake was dependent upon the time of incubation, temperature of incubation, and carnitine concentration in the incubation medium. Washed red blood cell membranes incubated with 14 C-carnitine showed specific binding of radioactivity. These data are consistent with the hypothesis that red blood cells have an uptake mechanism for L-carnitine

Investigation into the relationship between body surface area and total body potassium using Monte Carlo and measurement

Energy Technology Data Exchange (ETDEWEB)

Rogers, J.A. [Medical Physics and Imaging, Queen Elizabeth Hospital, Birmingham (United Kingdom)]. E-mail: jane.rogers@university-b.wmids.nhs.uk; Blake-James, M. [School of Physics and Astronomy, University of Birmingham, Birmingham (United Kingdom); Green, S.; Beddoe, A.H. [Medical Physics and Imaging, Queen Elizabeth Hospital, Birmingham (United Kingdom)

2002-03-07

The use of body surface area (BSA) as a means of indexing chemotherapy doses is widespread even though the value of this practice is uncertain. In principle, the body cell mass (BCM) more closely represents the body's metabolic size and this is investigated here as an alternative to BSA; since 98% of body potassium is intracellular the derivation of total body potassium (TBK) via the measurement of {sup 40}K in a whole body counter (WBC) will provide a useful normalizing index for metabolic size, potentially avoiding toxicity and underdosing. The Queen Elizabeth Hospital WBC has been used in this study, initially involving single geometrical phantoms and then combinations of these to simulate human body habitus. Monte Carlo N-particle (MCNP) codes were constructed to model the phantoms and simulate the measurements made in the WBC. Efficiency corrections were derived by comparing measurement and modelled data for each detector separately. A method of modelling a person in the WBC as a series of ellipsoids was developed. Twenty-four normal males and 24 females were measured for their {sup 40}K emissions. Individual MCNP codes were constructed for each volunteer and the results used in conjunction with the measurements to derive TBK, correcting for body habitus effects and detector efficiencies. An estimate of the component of error arising from sources other than counting statistics was included by analysing data from the measurement of phantoms. The total residual errors (expressed as coefficients of variation) for males and females were 10.1% and 8.5% respectively. The measurement components were determined to be 2.4% and 2.5%, implying that the biological components were 9.8% and 8.1% respectively. These results suggest that the use of BSA for indexing chemotherapy doses is likely to give rise to clinically significant under- or overdosing. (author)

Effect of counting system dead time on thyroid uptake measurements

International Nuclear Information System (INIS)

Simpkin, D.J.

1984-01-01

Equations are derived and the results of numerical calculations shown that illustrate the effect of counting system dead time on measured thyroid uptake of radioiodine. It is predicted that the observed uptake is higher than the true uptake due to system dead time. This is shown for both paralyzing and nonparalyzing dead time. The effect of increasing the administered activity is shown to increase the measured uptake, in a manner predicted by the paralyzable and nonparalyzable dead time models

Tritium uptake kinetics in crayfish (Orconectes immunis)

International Nuclear Information System (INIS)

Patrick, P.H.

1985-06-01

Uptake of tritiated water (HTO) by Orconectes immunis was investigated under laboratory conditions. Tritium uptake in the tissue-free water fraction (TFWT) was described using an exponential model. When steady-state was reached, the ratio of TFWT to HTO was approximately 0.9. Uptake of tritium in the organically-bound fraction (OBT) proceeded slowly, and had not reached steady-state after 117 days of culture. Although steady-state was never reached, the maximum observed ration of OBT to TFWT in whole animals was approximately 0.6. However, this ratio exceeded unity in the exoskeleton. Specific activity ratios of OBT between crayfish and lettuce (food source) were less than or at unity for various test conditions

Radiocolloid Uptake in the Pancreas Islet Cell Tumor: Case Report

Energy Technology Data Exchange (ETDEWEB)

Yang, W. J.; Chung, S. K.; Yeon, S. K.; Shinn, K. S.; Bahk, Y. W. [Catholic University College of Medicine, Seoul (Korea, Republic of)

1994-03-15

Colloid uptake in various hepatic conditions such as focal nodular hyperplasia, regenerating nodular in the cirrhotic liver, hamartoma, hemangioma and rarely hepatoma has been documented. Extrahepatic tumors may show colloid uptake and they include splenic hemangioma, malignant fibrous histiocytoma, breast carcinoma and Kaposi's sarcoma. The mechanism of colloid uptake in those lesions is associated with phagocytic activity in or around the tumors. We report a pancreas islet cell tumor that showed colloid uptake on {sup 99m}Tc-phytate liver scan without histologic evidence of phagocytosis by tumor cells or infiltration of phagocytes in the tumor. Microscopically the tumor was highly vascular and showed diffuse hemorrhage throughout the tumor. We postulated that extravasation of the colloid into the tumor interstitium caused nonspecific colloid uptake in this tumor. It is expected that hemorrhagic tumor may show nonspecific colloid uptake without phagocytosis in or about the lesion.

Radiocolloid Uptake in the Pancreas Islet Cell Tumor: Case Report

International Nuclear Information System (INIS)

Yang, W. J.; Chung, S. K.; Yeon, S. K.; Shinn, K. S.; Bahk, Y. W.

1994-01-01

Colloid uptake in various hepatic conditions such as focal nodular hyperplasia, regenerating nodular in the cirrhotic liver, hamartoma, hemangioma and rarely hepatoma has been documented. Extrahepatic tumors may show colloid uptake and they include splenic hemangioma, malignant fibrous histiocytoma, breast carcinoma and Kaposi's sarcoma. The mechanism of colloid uptake in those lesions is associated with phagocytic activity in or around the tumors. We report a pancreas islet cell tumor that showed colloid uptake on 99m Tc-phytate liver scan without histologic evidence of phagocytosis by tumor cells or infiltration of phagocytes in the tumor. Microscopically the tumor was highly vascular and showed diffuse hemorrhage throughout the tumor. We postulated that extravasation of the colloid into the tumor interstitium caused nonspecific colloid uptake in this tumor. It is expected that hemorrhagic tumor may show nonspecific colloid uptake without phagocytosis in or about the lesion.

Mechanism of Uptake of Trace Elements by Plants

International Nuclear Information System (INIS)

Broda, E.

1965-01-01

MECHANISM OF UPTAKE OF TRACE ELEMENTS BY PLANTS (EXPERIMENTS WlTH RADIOZINC). Some authors have assumed that the uptake of (essential or non-essential) trace elements by plants is due to active transport, and therefore needs metabolic energy. In our laboratory it has been found that the uptake of zinc (“6”5Zn) by chlorella and barley roots is, in the main, a passive process, and is based largely on ion exchange. In these experiments the Zn system contrasted sharply with actively transporting systems, e. g. the K system, although the extent of accumulation may be similar: (1) decouplers (DNP, azide) or anaerobiosis do not depress the uptake of Zn: (2) plants killed by grinding, freezing or alcohol treatment take up more Zn than living plants: (3) the temperature coefficient of the Zn uptake is small: (4) many ions compete with Zn, i.e. the uptake is unspecific. We have measured - primarily with dead cells, where equilibria are reached easily - the competition of several foreign ions with radiozinc at fixed pH (usually 6). These values have been compared with analogous values obtained with radiozinc (and verified with radiocopper) in respect to cation exchange resins. It is concluded from the sequence of the different ions that the active sites in the cells are mainly carboxyl groups. Probably most of the ‘exchanger’ consists of carbohydrate derivatives in the cell wall, i.e. in the ‘free space’, However, both by Langmuir analysis of the observed ‘uptake isotherm’ and by radiochemical work with partly blocked material, sites with anomalous affinity to Zn have been demonstrated. These may be imidazol groups in the proteins known to bind zinc strongly by complexation. (author)

Open Adoption Placement by Birth Mothers in Their Twenties.

Science.gov (United States)

Clutter, Lynn B

The purpose of this study was to summarize birth mothers' descriptions of unplanned pregnancy experienced in their twenties and how open adoption influenced their lives. Naturalistic inquiry was used with purposive sampling from one agency and telephone interviews of women who experienced unplanned pregnancy in their twenties and relinquishment through open adoption. Recorded, transcribed, and deidentified interviews were analyzed for qualitative themes. Fifteen participants judiciously weighed the open adoption decision. Over half parented other children prior to placement. Most knew they could not have parented this child due to life stressors. Placement was a hard decision, but ongoing contact with birth child and adoptive family was valued. Open adoption processes made them stronger by being happy that their child experienced family life with greater opportunities than birth mothers could offer at the time. Summarized themes used the acronym COMMITTED: C-care deeply about what is best for the child, O-ongoing open adoption: good and hard, M-meeting together regularly, M-moving on in personal growth, accomplishments, and milestones, I-independence from previous stressors or crises, T-transitions, T-therapeutic support, E-emotions, D-depression giving way to deepened strength and personal direction. Open adoption is reinforced as a positive resolution of unintended pregnancy for birth mothers in their twenties.

Decreased cisplatin uptake by resistant L1210 leukemia cells

International Nuclear Information System (INIS)

Hromas, R.A.; North, J.A.; Burns, C.P.

1987-01-01

Cisplatin resistance remains poorly understood compared to other forms of anti-neoplastic drug resistance. In this report radiolabelled cisplatin and rapid separation techniques were used to compare drug uptake by L1210 leukemia cells that are sensitive (K25) or resistant (SCR9) to cisplatin. Uptake of cisplatin by both cell lines was linear without saturation kinetics up to 100 μM. The resistant ZCR9 cells had 36-60% reduced drug uptake as compared to its sensitive parent line, K25. In contrast, there was no difference in the rate of efflux. We conclude that a decreased rate of uptake is one possible mechanism of cellular cisplatin resistance. (Author)

The effect of hydrate promoters on gas uptake.

Science.gov (United States)

Xu, Chun-Gang; Yu, Yi-Song; Ding, Ya-Long; Cai, Jing; Li, Xiao-Sen

2017-08-16

Gas hydrate technology is considered as a promising technology in the fields of gas storage and transportation, gas separation and purification, seawater desalination, and phase-change thermal energy storage. However, to date, the technology is still not commercially used mainly due to the low gas hydrate formation rate and the low gas uptake. In this study, the effect of hydrate promoters on gas uptake was systematically studied and analyzed based on hydrate-based CH 4 storage and CO 2 capture from CO 2 /H 2 gas mixture experiments. Raman spectroscopy, Fourier transform infrared spectroscopy (FTIR) and gas chromatography (GC) were employed to analyze the microstructures and gas compositions. The results indicate that the effect of the hydrate promoter on the gas uptake depends on the physical and chemical properties of the promoter and gas. A strong polar ionic promoter is not helpful towards obtaining the ideal gas uptake because a dense hydrate layer is easily formed at the gas-liquid interface, which hinders gas diffusion from the gas phase to the bulk solution. For a weak polar or non-polar promoter, the gas uptake depends on the dissolution characteristics among the different substances in the system. The lower the mutual solubility among the substances co-existing in the system, the higher the independence among the substances in the system; this is so that each phase has an equal chance to occupy the hydrate cages without or with small interactions, finally leading to a relatively high gas uptake.

Calibration of a Plant Uptake Model with Plant- and Site-Specific. Data for Uptake of Chlorinated Organic Compounds into Radish

DEFF Research Database (Denmark)

Trapp, Stefan

2015-01-01

The uptake of organic pollutants by plants is an important process for the exposure of humans to toxic chemicals. The objective of this study was to calibrate the parameters of a common plant uptake model by comparison to experimental results from literature. Radish was grown in contaminated soil...... with default data and site-specific data were similar. Deposition from air was the major uptake mechanism into shoots. Transport from soil with resuspended particles was only relevant for the contaminated plot. The calculation results (in dry weight) were most sensitive to changes of the water content of plant...

Uptake and metabolism of diclofenac in Typha latifolia--how plants cope with human pharmaceutical pollution.

Science.gov (United States)

Bartha, Bernadett; Huber, Christian; Schröder, Peter

2014-10-01

The fate of pharmaceuticals in our environment is a very important issue for environmental and health research. Although these substances have been detected in environmental compartments in low concentration until now, they will pose considerable environmental risk to ecosystems, animals and human due to their biological activity. Alternative plant based removal technologies that make use of some potential wetland species like Phragmites or Typha within traditional wastewater treatment plants have to be established to cope with this "new generation" of pollutants. We investigated uptake and translocation of diclofenac (1mgl(-1)) in the macrophyte Typha latifolia L. during one week exposure in greenhouse experiments. Detoxification products and involved key enzymatic processes were identified. We also examined the oxidative stress induced by the treatment and the defense capacity of the plants. Rapid uptake and effective metabolism were observed, where glycoside and glutathione conjugates represent dominant metabolites. Up to seven-fold induction of glycosyltransferase activity was observed in roots, but not in shoots. Glutathione S-transferase activity was also induced, but to a lower extent. The activity changes of defense enzymes points to oxidative stress in the plants. Our results show that human pharmaceuticals can be metabolized by plants similar to xenobiotics, but that similarities to human metabolism are limited. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Automatic measurement of the radioactive mercury uptake by the kidney

International Nuclear Information System (INIS)

Zurowski, S.; Raynaud, C.; CEA, 91 - Orsay

1976-01-01

An entirely automatic method to measure the Hg uptake by the kidney is proposed. The following operations are carried out in succession: measurement of extrarenal activity, demarcation of uptake areas, anatomical identification of uptake areas, separation of overlapping organ images and measurement of kidney depth. The first results thus calculated on 30 patients are very close to those obtained with a standard manual method and are highly encouraging. Two important points should be stressed: a broad demarcation of the uptake areas is necessary and an original method, that of standard errors, is useful for the background noise determination and uptake area demarcation. This automatic measurement technique is so designed that it can be applied to other special cases [fr

Elevated [11C]-D-Deprenyl Uptake in Chronic Whiplash Associated Disorder Suggests Persistent Musculoskeletal Inflammation

Science.gov (United States)

Linnman, Clas; Appel, Lieuwe; Fredrikson, Mats; Gordh, Torsten; Söderlund, Anne; Långström, Bengt; Engler, Henry

2011-01-01

There are few diagnostic tools for chronic musculoskeletal pain as structural imaging methods seldom reveal pathological alterations. This is especially true for Whiplash Associated Disorder, for which physical signs of persistent injuries to the neck have yet to be established. Here, we sought to visualize inflammatory processes in the neck region by means Positron Emission Tomography using the tracer 11C-D-deprenyl, a potential marker for inflammation. Twenty-two patients with enduring pain after a rear impact car accident (Whiplash Associated Disorder grade II) and 14 healthy controls were investigated. Patients displayed significantly elevated tracer uptake in the neck, particularly in regions around the spineous process of the second cervical vertebra. This suggests that whiplash patients have signs of local persistent peripheral tissue inflammation, which may potentially serve as a diagnostic biomarker. The present investigation demonstrates that painful processes in the periphery can be objectively visualized and quantified with PET and that 11C-D-deprenyl is a promising tracer for these purposes. PMID:21541010

Elevated [11C]-D-deprenyl uptake in chronic Whiplash Associated Disorder suggests persistent musculoskeletal inflammation.

Directory of Open Access Journals (Sweden)

Clas Linnman

Full Text Available There are few diagnostic tools for chronic musculoskeletal pain as structural imaging methods seldom reveal pathological alterations. This is especially true for Whiplash Associated Disorder, for which physical signs of persistent injuries to the neck have yet to be established. Here, we sought to visualize inflammatory processes in the neck region by means Positron Emission Tomography using the tracer (11C-D-deprenyl, a potential marker for inflammation. Twenty-two patients with enduring pain after a rear impact car accident (Whiplash Associated Disorder grade II and 14 healthy controls were investigated. Patients displayed significantly elevated tracer uptake in the neck, particularly in regions around the spineous process of the second cervical vertebra. This suggests that whiplash patients have signs of local persistent peripheral tissue inflammation, which may potentially serve as a diagnostic biomarker. The present investigation demonstrates that painful processes in the periphery can be objectively visualized and quantified with PET and that (11C-D-deprenyl is a promising tracer for these purposes.

Stem Cell Mobilization with G-CSF versus Cyclophosphamide plus G-CSF in Mexican Children

OpenAIRE

Meraz, Jos? Eugenio V?zquez; Arellano-Galindo, Jos?; Avalos, Armando Mart?nez; Mendoza-Garc?a, Emma; Jim?nez-Hern?ndez, Elva

2016-01-01

Fifty-six aphaereses were performed in 23 pediatric patients with malignant hematological and solid tumors, following three different protocols for PBPC mobilization and distributed as follows: A: seventeen mobilized with 4?g/m2 of cyclophosphamide (CFA) and 10??g/kg/day of granulocyte colony stimulating factor (G-CSF), B: nineteen with CFA + G-CSF, and C: twenty only with G-CSF when the WBC count exceeded 10 ? 109/L. The average number of MNC/kg body weight (BW)/aphaeresis was 0.4 ? 108 (0.1...

A modified assay method for determining serotonin uptake in human platelets

International Nuclear Information System (INIS)

Arora, R.C.; Meltzer, H.Y.

1981-01-01

Effects of various experimental conditions on serotonin (5-HT) uptake in human platelets were examined. The experimental design allowed the evaluation of the effect of diffusion and other non-saturable processes on the affinity and maximum activity of the membrane pump for 5-HT uptake. Total 5-HT uptake was determined by incubating platelet-rich plasma (PRP) with increasing concentrations of serotonin at 37 0 C for 4 min. The passive uptake was measured by the addition of various 5-HT concentrations to PRP in buffer at 37 0 C, followed by immediate transfer to an ice-cold water bath. The difference between the total and passive uptake was linear for 6 min. The affinity (Ksub(m)) for active platelet serotonin uptake was 0.45 +- 0.09 μmol/l and maximal rate of uptake (V) was 10.7 +- 2.1 pmol/10 7 platelets/min. The described method provides a convenient and reliable measure of active 5-HT uptake suitable for clinical investigation. The effect of passive diffusion on kinetic parameters is discussed. (Auth.)

Effect of nutrition peculiarities on 137Cs uptake

International Nuclear Information System (INIS)

Knizhnikov, V.A.; Marej, A.N.; Borisov, B.K.; Petukhova, Eh.V.

1980-01-01

Reasons for different 137 Cs uptake from diets of the vegetable-animal type are studied. Indexes of accumulation multiplicity for Moscow and the Byelorussian-Ukrainian wooded district are compared. 137 Cs buildup levels in the organism of the USSR and the USA population are presented. The most probable reason for peculiarities in 137 Cs uptake from various types of diet, as well as the reason for the alterations in the uptake of this radionuclide from the diet of the same type, is the non-uniformity of 137 Cs contribution of aerial and nonaerial origin

Effects of salt stress on phosphorus uptake by european rape sheiaralle

International Nuclear Information System (INIS)

Li Guihua; Zhang Jianfeng; Wei Dongpu; Yang Juncheng; Mei Yong

2007-01-01

The effects of different salinity on phosphorus uptake by European rape Sheiaralle were studied under hydroponics and sand culture conditions. The results showed that above ground uptake of instant P increased with the salinity increased, the uptake of 32 P by roots firstly decreased and then increased with the increase salinity. Instant P uptake by Brassica napus was lower under different salinity treatment than in non-saline condition (P - , but the biomass yield decreased much faster than P uptake, so P relatively condensed, and uptake of P by Brassica napus increased as the salinity (including non-saline treatment) was increased (P<0.05). Fresh weight of Brassica napus decreased significantly with the salinity increased (P<0.05). (authors)

Normal Health-Related Quality of Life and Ability to Work Twenty-nine Years After in Situ Arthrodesis for High-Grade Isthmic Spondylolisthesis.

Science.gov (United States)

Joelson, Anders; Hedlund, Rune; Frennered, Karin

2014-06-18

The purpose of this mixed prospective and retrospective case series was to evaluate the long-term health-related quality of life and physical disability after in situ arthrodesis for high-grade isthmic spondylolisthesis. Thirty-five of forty consecutive patients who had in situ spinal arthrodesis for high-grade isthmic spondylolisthesis at a mean age of fifteen years (range, nine to twenty-five years) completed validated questionnaires (Short Form-36 [SF-36], EuroQol-5 Dimensions [EQ-5D], Zung depression scale, Oswestry disability index [ODI], Million score, and back and leg pain visual analog scale [VAS]) and underwent physical examination twenty-nine years (range, twenty-three to thirty-five years) after surgery. The mean age at the time of follow-up was forty-three years (range, thirty-seven to fifty-one years). In the absence of a formal control group, the scores on the SF-36 and EQ-5D were compared with Swedish normative data. The proportion of patients at work was compared with an age-matched control group derived from official statistics of Sweden. The Million score at the long-term follow-up was compared with the corresponding results at the mid-term follow-up of the same patients at a mean age of twenty-two years. The scores on the SF-36 and EQ-5D were similar to the scores of the general Swedish population. The mean Zung depression scale score was 30 (range, 20 to 52), the mean ODI score was 10 (range, 0 to 34), the mean back pain VAS score was 13 (range, 0 to 72), and the mean leg pain VAS score was 9 (range, 0 to 60). The Million score averaged 28 (range, 0 to 109) and was slightly worsened compared with the score of 19 (range, 0 to 94) at the mid-term follow-up (p = 0.034). The proportion of patients at work was the same as that for the age-matched general Swedish population. Our study shows good outcomes in health-related quality of life, disability, pain, and ability to work at up to twenty-nine years after in situ lumbar spine arthrodesis for high

The effect of phosphorus level in the sheep diet on the element uptake by the erythrocytes

International Nuclear Information System (INIS)

Silva Filho, J.C. da; Vitti, D.M.S.S.

1995-01-01

A trial with sheep was carried out to investigate the effect of the level of phosphorus in the diet on the 32 P uptake by the red blood cells. Twenty four male sheep were kept in individual cages, during two periods of 45 days each. In the first one the animals received a basal diet without phosphorus supplementation. In the second period the animals were divided in four groups and different amounts of bone meal were offered to supply 1,2 and 3 gP/head/day. The control group received only the basal diet. An in vitro technique was used to incubate total blood and 32 P solution as Na HP O 4 . After 3 hours incubation, the red blood cells were washed thrice with an isotonic saline solution. The solid material was transferred to crucibles, dried at 100 0 C and reduced to ash 500 0 C. Diggestion with 6N H 2 SO 4 solution was followed and radioactivity was detected by Cherenkov effect. The average 32 P uptake were: 6.04± 0.40 and 6.56 ±- 1.94, 6.18± 0.36 and 5.53 ± 1.06, 5.84 ± 0.48 and 6.31 ± 1.32, 6.0 ± 0.80 and 6.03 ± 1.50 at the first and second periods in treatments 0, 1, 2 and 3gP/head/day, respectively. There was no differences between treatments. (author). 22 refs, 1 tab

Nuclear power in the twenty-first century - An assessment (Part 1)

OpenAIRE

von Hirschhausen, Christian

2017-01-01

Nuclear power was one of the most important discoveries of the twentieth century, and it continues to play an important role in twenty-first century discussions about the future energy mix, climate change, innovation, proliferation, geopolitics, and many other crucial policy topics. This paper addresses some key issues around the emergence of nuclear power in the twentieth century and perspectives going forward in the twenty-first, including questions of economics and competitiveness, the str...

Thyroid Scan and Uptake

Medline Plus

Full Text Available Toggle navigation Test/Treatment Patient Type Screening/Wellness Disease/Condition Safety En Español More Info Images/Videos About Us News Physician Resources Professions Site Index A-Z Thyroid Scan and Uptake ...

Multiple pathways for uptake of paraquat, methylglyoxal bis(guanylhydrazone), and polyamines

Energy Technology Data Exchange (ETDEWEB)

Byers, T.L.; Kameji, R.; Rannels, D.E.; Pegg, A.E.

1987-06-01

The uptake of polyamines, methylglyoxal bis(guanylhydrazone) (MGBG), and paraquat (N,N-dimethyl-4,4'-bipyridylium) into control Chinese hamster ovary (CHO) cells and a mutant CHO cell line selected for resistance to the toxicity of MGBG was examined. In contrast to control CHO cells, the mutant cells had no detectable uptake of (/sup 14/C)-MGBG or any of the polyamines. There was no difference between the two cell lines in the uptake of ..cap alpha..-aminoisobutyric (/sup 3/H-AIB), which indicates that there was no general change in membrane transport processes. The mutant cells were also found to be resistant to the toxicity of paraquat and to have a reduced capability to take up the herbicide. This finding confirms that the uptake of paraquat is necessary for the toxicity of this compound and that the paraquat is taken up by a transport system that also transports MGBG. Competition experiments showed that an excess of unlabeled paraquat inhibited uptake of MGBG and, to a lesser extent, uptake of putrescine and spermidine, but no inhibitory action on spermine uptake could be detected. Studies with type II cells isolated from rat lung also demonstrated uptake of paraquat and spermidine, but paraquat was only a weak inhibitor of spermidine uptake in this system. These results suggest that there may be multiple systems for the uptake of MGBG and polyamines and that paraquat is taken up by at least one but not by all of these systems.

Multiple pathways for uptake of paraquat, methylglyoxal bis(guanylhydrazone), and polyamines

International Nuclear Information System (INIS)

Byers, T.L.; Kameji, R.; Rannels, D.E.; Pegg, A.E.

1987-01-01

The uptake of polyamines, methylglyoxal bis(guanylhydrazone) (MGBG), and paraquat [N,N-dimethyl-4,4'-bipyridylium] into control Chinese hamster ovary (CHO) cells and a mutant CHO cell line selected for resistance to the toxicity of MGBG was examined. In contrast to control CHO cells, the mutant cells had no detectable uptake of [ 14 C]-MGBG or any of the polyamines. There was no difference between the two cell lines in the uptake of α-aminoisobutyric ( 3 H-AIB), which indicates that there was no general change in membrane transport processes. The mutant cells were also found to be resistant to the toxicity of paraquat and to have a reduced capability to take up the herbicide. This finding confirms that the uptake of paraquat is necessary for the toxicity of this compound and that the paraquat is taken up by a transport system that also transports MGBG. Competition experiments showed that an excess of unlabeled paraquat inhibited uptake of MGBG and, to a lesser extent, uptake of putrescine and spermidine, but no inhibitory action on spermine uptake could be detected. Studies with type II cells isolated from rat lung also demonstrated uptake of paraquat and spermidine, but paraquat was only a weak inhibitor of spermidine uptake in this system. These results suggest that there may be multiple systems for the uptake of MGBG and polyamines and that paraquat is taken up by at least one but not by all of these systems

Uptake and depuration of 131I by the edible periwinkle Littorina littorea: uptake from labelled seaweed (Chondrus crispus)

International Nuclear Information System (INIS)

Wilson, R.C.; Vives i Batlle, J.; McDonald, P.; Parker, T.G.

2005-01-01

Uptake and depuration experiments of 131 I from labelled seaweed (Chondrus crispus) by the edible periwinkle Littorina littorea have been performed. Radioiodine concentrations in winkles during uptake followed first-order kinetics with an uptake half-time of 1 day, and a calculated equilibrium concentration (C ∞ ) of 21 000 Bq kg -1 resulting in a transfer factor of 0.07 with respect to the labelled seaweed used as food. For depuration, a biphasic sequence with biological half-lives of 1 and 24 days was determined. The results suggest that in general, iodine turnover in periwinkles is slower than observed for other molluscs (monophasic biological half-lives in the order of 2-3 days). Both environmental media, food and seawater, can be significant sources of radioiodine for the winkle

Twenty-first workshop on geothermal reservoir engineering: Proceedings

Energy Technology Data Exchange (ETDEWEB)

None

1996-01-26

PREFACE The Twenty-First Workshop on Geothermal Reservoir Engineering was held at the Holiday Inn, Palo Alto on January 22-24, 1996. There were one-hundred fifty-five registered participants. Participants came from twenty foreign countries: Argentina, Austria, Canada, Costa Rica, El Salvador, France, Iceland, Indonesia, Italy, Japan, Mexico, The Netherlands, New Zealand, Nicaragua, the Philippines, Romania, Russia, Switzerland, Turkey and the UK. The performance of many geothermal reservoirs outside the United States was described in several of the papers. Professor Roland N. Horne opened the meeting and welcomed visitors. The key note speaker was Marshall Reed, who gave a brief overview of the Department of Energy's current plan. Sixty-six papers were presented in the technical sessions of the workshop. Technical papers were organized into twenty sessions concerning: reservoir assessment, modeling, geology/geochemistry, fracture modeling hot dry rock, geoscience, low enthalpy, injection, well testing, drilling, adsorption and stimulation. Session chairmen were major contributors to the workshop, and we thank: Ben Barker, Bobbie Bishop-Gollan, Tom Box, Jim Combs, John Counsil, Sabodh Garg, Malcolm Grant, Marcel0 Lippmann, Jim Lovekin, John Pritchett, Marshall Reed, Joel Renner, Subir Sanyal, Mike Shook, Alfred Truesdell and Ken Williamson. Jim Lovekin gave the post-dinner speech at the banquet and highlighted the exciting developments in the geothermal field which are taking place worldwide. The Workshop was organized by the Stanford Geothermal Program faculty, staff, and graduate students. We wish to thank our students who operated the audiovisual equipment. Shaun D. Fitzgerald Program Manager.

Summary record of the twenty-seventh meeting

International Nuclear Information System (INIS)

Young, P.

1990-01-01

The topics presented and discussed at the twenty-seventh international meeting of the Nuclear Data Committee of the Nuclear Energy Agency are summarized. Relations with other committees and reports of data centers are analyzed. Problems concerning nuclear model codes are underlined. National evaluation efforts on data library and data file are reported. Reports from several laboratories and subcommittees are summarized

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... A thyroid scan is a type of nuclear medicine imaging. The radioactive iodine uptake test (RAIU) is ... thyroid function, but does not involve imaging. Nuclear medicine is a branch of medical imaging that uses ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... which are encased in metal and plastic and most often shaped like a box, attached to a ... will I experience during and after the procedure? Most thyroid scan and thyroid uptake procedures are painless. ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... Actual scanning time for each thyroid uptake is five minutes or less. top of page What will ... diagnostic procedures have been used for more than five decades, and there are no known long-term ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... Because nuclear medicine procedures are able to pinpoint molecular activity within the body, they offer the potential ... or imaging device that produces pictures and provides molecular information. The thyroid scan and thyroid uptake provide ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... of page What will I experience during and after the procedure? Most thyroid scan and thyroid uptake ... you otherwise, you may resume your normal activities after your nuclear medicine scan. If any special instructions ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... for several hours before your exam because eating can affect the accuracy of the uptake measurement. Jewelry ... small hand-held device resembling a microphone that can detect and measure the amount of the radiotracer ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... scan and thyroid uptake provide information about the structure and function of the thyroid. The thyroid is ... computer, create pictures offering details on both the structure and function of organs and tissues in your ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... eat for several hours before your exam because eating can affect the accuracy of the uptake measurement. ... often unattainable using other imaging procedures. For many diseases, nuclear medicine scans yield the most useful information ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... When radiotracer is taken by mouth, in either liquid or capsule form, it is typically swallowed up ... radioactive iodine (I-123 or I-131) in liquid or capsule form to swallow. The thyroid uptake ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... eat for several hours before your exam because eating can affect the accuracy of the uptake measurement. ... its radioactivity over time. It may also pass out of your body through your urine or stool ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... procedures within the last two months that used iodine-based contrast material. Your doctor will instruct you ... a type of nuclear medicine imaging. The radioactive iodine uptake test (RAIU) is also known as a ...

Quantification of radionuclide uptake levels for primary bone tumors

Directory of Open Access Journals (Sweden)

Hasford Francis

2015-04-01

Full Text Available The purpose of the study is to quantify the level of uptake of administered radionuclide in primary bone tumors for patients undergoing bone scintigraphy. Retrospective study on 48 patient's scintigrams to quantify the uptake levels of administered radiopharmaceuticals was performed in a nuclear medicine unit in Ghana. Patients were administered with activity ranging between 0.555 and 1.110 MBq (15–30 mCi, and scanned on Siemens e.cam SPECT system. Analyses on scintigrams were performed with Image J software by drawing regions of interest (ROIs over identified hot spots (pathologic sites. Nine skeletal parts namely cranium, neck, shoulder, sacrum, sternum, vertebra, femur, ribcage, and knee were considered in the study, which involved 96 identified primary tumors. Radionuclide uptakes were quantified in terms of the estimated counts of activity per patient for identified tumor sites. Average normalized counts of activity (nGMC per patient ranged from 5.2759 ± 0.6590 cts/mm2/MBq in the case of cranium tumors to 72.7569 ± 17.8786 cts/mm2/MBq in the case of ribcage tumors. The differences in uptake levels could be attributed to different mechanisms of Tc-99m MDP uptake in different types of bones, which is directly related to blood flow and degree of osteoblastic activity. The overall normalized count of activity for the 96 identified tumors was estimated to be 23.0350 ± 19.5424 cts/mm2/MBq. The study revealed highest uptake of activity in ribcage and least uptake in cranium. Quantification of radionuclide uptakes in tumors is important and recommended in assessing patient's response to therapy, doses to critical organs and in diagnosing tumors.

The MDP skull uptake test: A new diagnostic tool

International Nuclear Information System (INIS)

Ell, P.J.; Jarritt, P.H.; Cullum, I.; Lui, D.

1984-01-01

An original approach to the measurement of bone turnover is presented. With SPECT, the authors have measured in pgr/ml, the uptake of MDP by the skull in man. The Cleon 710 scanner, ring phantoms and bone biopsies were used for ultimate in vivo/in vitro count recovery correlation and calibration. A normal range for 24 patients was found: 8.5 to 19.5 pgr/ml with a mean of 14. For patients with bony metastases (12), the values were: 22.5 to 50, mean of 30. For 5 patients with osteomalacia, the values were 46 to 68, mean of 62: for 12 patients with hyperparathyroidism, the values were 37 to 48.5, mean of 43. In 3 patients with Pagets disease, the values were 58.5 to 75, with a mean of 65. In 76 patients with metastatic disease to bone, the conventional wholebody bone scan was investigated against the following: 24h wholebody retention of MDP (WBR), skull uptake as described and GFR by Cr-51-DTPA. There is a correlation between GFR and WBR - r=0.67. There is a lesser correlation between GFR and skull uptake - r=0.3. There is no correlation between skull uptake and WBR - r=0.1. The comparison of skull uptake data with normal whole body bone scans leads to a significant proportion of cancer patients with positive skull uptake data. Monostotic disease (especially if metabolic in nature) expresses itself by abnormal skull uptake even if the clinical site of abnormality lies outside the skull. This new technique is ideal as a tool to investigate phosphonate concentration in bone. With it, the authors have shown the effect of specific activity of label on skull uptake, which increases as the specific activity of labelled MDP decreases

Silicate reduces cadmium uptake into cells of wheat

International Nuclear Information System (INIS)

Greger, Maria; Kabir, Ahmad H.; Landberg, Tommy; Maity, Pooja J.; Lindberg, Sylvia

2016-01-01

Cadmium (Cd) is a health threat all over the world and high Cd content in wheat causes high Cd intake. Silicon (Si) decreases cadmium content in wheat grains and shoot. This work investigates whether and how silicate (Si) influences cadmium (Cd) uptake at the cellular level in wheat. Wheat seedlings were grown in the presence or absence of Si with or without Cd. Cadmium, Si, and iron (Fe) accumulation in roots and shoots was analysed. Leaf protoplasts from plants grown without Cd were investigated for Cd uptake in the presence or absence of Si using the fluorescent dye, Leadmium Green AM. Roots and shoots of plants subjected to all four treatments were investigated regarding the expression of genes involved in the Cd uptake across the plasma membrane (i.e. LCT1) and efflux of Cd into apoplasm or vacuole from the cytosol (i.e. HMA2). In addition, phytochelatin (PC) content and PC gene (PCS1) expression were analysed. Expression of iron and metal transporter genes (IRT1 and NRAMP1) were also analysed. Results indicated that Si reduced Cd accumulation in plants, especially in shoot. Si reduced Cd transport into the cytoplasm when Si was added both directly during the uptake measurements and to the growth medium. Silicate downregulated LCT1 and HMA2 and upregulated PCS1. In addition, Si enhanced PC formation when Cd was present. The IRT1 gene, which was downregulated by Cd was upregulated by Si in root and shoot facilitating Fe transport in wheat. NRAMP1 was similarly expressed, though the effect was limited to roots. This work is the first to show how Si influences Cd uptake on the cellular level. - Highlights: • Si decreases accumulation and translocation of Cd in plants at tissue level. • This work is the first to show how Si influences Cd uptake. • Si decreases Cd uptake into cell and downregulates heavy metal transporter LCT1. • Si downregulates HMA2 transporter, which regulates Cd transport from root to shoot. • Si increases phytochelatin formation

Water uptake by salts during the electrolyte processing for thermal batteries

Science.gov (United States)

Masset, Patrick; Poinso, Jean-Yves; Poignet, Jean-Claude

Water uptake of single salts and electrolytes were measured in industrial conditions (dry-room). The water uptake rate ϑ (g h -1 cm -2) was expressed with respect to the apparent area of contact of the salt with atmosphere of the dry room. The water uptake by potassium-based salts was very low. LiF and LiCl salts were found to behave similarly. For LiBr- and LiI-based salts and mixtures, we pointed out a linear relationship between the water uptake and the elapsed time. Water uptake by magnesium oxide reached a limit after 200 h. This work provides a set of data concerning the rate of water uptake by single salts, salt mixtures and magnesia used in thermal battery electrolytes.

Quantification of tumour {sup 18}F-FDG uptake: Normalise to blood glucose or scale to liver uptake?

Energy Technology Data Exchange (ETDEWEB)

Keramida, Georgia [Brighton and Sussex Medical School, Clinical Imaging Sciences Centre, Brighton (United Kingdom); Brighton and Sussex University Hospitals NHS Trust, Department of Nuclear Medicine, Brighton (United Kingdom); University of Sussex, Clinical Imaging Sciences Centre, Brighton (United Kingdom); Dizdarevic, Sabina; Peters, A.M. [Brighton and Sussex Medical School, Clinical Imaging Sciences Centre, Brighton (United Kingdom); Brighton and Sussex University Hospitals NHS Trust, Department of Nuclear Medicine, Brighton (United Kingdom); Bush, Janice [Brighton and Sussex Medical School, Clinical Imaging Sciences Centre, Brighton (United Kingdom)

2015-09-15

To compare normalisation to blood glucose (BG) with scaling to hepatic uptake for quantification of tumour {sup 18}F-FDG uptake using the brain as a surrogate for tumours. Standardised uptake value (SUV) was measured over the liver, cerebellum, basal ganglia, and frontal cortex in 304 patients undergoing {sup 18}F-FDG PET/CT. The relationship between brain FDG clearance and SUV was theoretically defined. Brain SUV decreased exponentially with BG, with similar constants between cerebellum, basal ganglia, and frontal cortex (0.099-0.119 mmol/l{sup -1}) and similar to values for tumours estimated from the literature. Liver SUV, however, correlated positively with BG. Brain-to-liver SUV ratio therefore showed an inverse correlation with BG, well-fitted with a hyperbolic function (R = 0.83), as theoretically predicted. Brain SUV normalised to BG (nSUV) displayed a nonlinear correlation with BG (R = 0.55); however, as theoretically predicted, brain nSUV/liver SUV showed almost no correlation with BG. Correction of brain SUV using BG raised to an exponential power of 0.099 mmol/l{sup -1} also eliminated the correlation between brain SUV and BG. Brain SUV continues to correlate with BG after normalisation to BG. Likewise, liver SUV is unsuitable as a reference for tumour FDG uptake. Brain SUV divided by liver SUV, however, shows minimal dependence on BG. (orig.)

Capsinoids activate brown adipose tissue (BAT) with increased energy expenditure associated with subthreshold 18-fluorine fluorodeoxyglucose uptake in BAT-positive humans confirmed by positron emission tomography scan.

Science.gov (United States)

Sun, Lijuan; Camps, Stefan G; Goh, Hui Jen; Govindharajulu, Priya; Schaefferkoetter, Joshua D; Townsend, David W; Verma, Sanjay K; Velan, S Sendhil; Sun, Lei; Sze, Siu Kwan; Lim, Su Chi; Boehm, Bernhard Otto; Henry, Christiani Jeyakumar; Leow, Melvin Khee-Shing

2018-01-01

Capsinoids are reported to increase energy expenditure (EE) via brown adipose tissue (BAT) stimulation. However, imaging of BAT activation by capsinoids remains limited. Because BAT activation is a potential therapeutic strategy for obesity and related metabolic disorders, we sought to prove that capsinoid-induced BAT activation can be visualized by 18-fluorine fluorodeoxyglucose (18F-FDG) positron emission tomography (PET). We compared capsinoids and cold exposure on BAT activation and whole-body EE. Twenty healthy participants (8 men, 12 women) with a mean age of 26 y (range: 21-35 y) and a body mass index (kg/m2) of 21.7 (range: 18.5-26.0) underwent 18F-FDG PET and whole-body calorimetry after ingestion of 12 mg capsinoids or ≤2 h of cold exposure (∼14.5°C) in a crossover design. Mean standardized uptake values (SUVs) of the region of interest and BAT volumes were calculated. Blood metabolites were measured before and 2 h after each treatment. All of the participants showed negligible 18F-FDG uptake post-capsinoid ingestion. Upon cold exposure, 12 participants showed avid 18F-FDG uptake into supraclavicular and lateral neck adipose tissues (BAT-positive group), whereas the remaining 8 participants (BAT-negative group) showed undetectable uptake. Capsinoids and cold exposure increased EE, although cold induced a 2-fold increase in whole-body EE and higher fat oxidation, insulin sensitivity, and HDL cholesterol compared with capsinoids. Capsinoids only increased EE in BAT-positive participants, which suggests that BAT mediates EE evoked by capsinoids. This implies that capsinoids stimulate BAT to a lesser degree than cold exposure as evidenced by 18F-FDG uptake below the presently accepted SUV thresholds defining BAT activation. This trial was registered at www.clinicaltrials.gov as NCT02964442. © 2018 American Society for Nutrition. All rights reserved.

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... top of page Additional Information and Resources RTAnswers.org Radiation Therapy for Head and Neck Cancer top ... Scan and Uptake Sponsored by Please note RadiologyInfo.org is not a medical facility. Please contact your ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... information about your thyroid’s size, shape, position and function that is often unattainable using other imaging procedures. ... thyroid uptake. It is a measurement of thyroid function, but does not involve imaging. Nuclear medicine is ...

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... RAIU) is also known as a thyroid uptake. It is a measurement of thyroid function, but does ... they offer the potential to identify disease in its earliest stages as well as a patient’s immediate ...

Arsenic Uptake and Translocation in Plants.

Science.gov (United States)

Li, Nannan; Wang, Jingchao; Song, Won-Yong

2016-01-01

Arsenic (As) is a highly toxic metalloid that is classified as a non-threshold class-1 carcinogen. Millions of people worldwide suffer from As toxicity due to the intake of As-contaminated drinking water and food. Reducing the As concentration in drinking water and food is thus of critical importance. Phytoremediation of soil contaminated with As and the reduction of As contamination in food depend on a detailed understanding of As uptake and transport in plants. As transporters play essential roles in As uptake, translocation and accumulation in plant cells. In this review, we summarize the current understanding of As transport in plants, with an emphasis on As uptake, mechanisms of As resistance and the long-distance translocation of As, especially the accumulation of As in grains through phloem-mediated transport. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

Industries processing naturally occurring radioactive materials: twenty years of emission data in the Netherlands

International Nuclear Information System (INIS)

Tanzi, C.P.

2008-01-01

This paper provides a review of the dose assessment of discharges to air of two industries processing NORM (Naturally Occurring Radioactive Materials) in the Netherlands. An industrial plant producing elemental phosphorus (thermal process, unique within Europe) reports since 1987 its emission data to the Dutch Ministry of the Environment (VROM: Ministry of Housing, Spatial Planning and the Environment). This plant accounts for the highest release of Po-210 to air in the Netherlands, with a yearly average of approximately 500 GBq. Other significant NORM discharges to air arise from an industrial plant with blast-furnaces for steel production. Yearly discharges fall under permit, and are reported, since 1993. RIVM, the National Institute for Public Health and the Environment, is tasked by the Ministry to assess the dose to the general public arising from these discharges to air. Air transport modelling is used to determine both air concentration (for inhalation exposure) and deposition rate of the radionuclides. A (conservative) committed ingestion dose is determined by modelling the uptake of radionuclides from contaminated farmland, and assuming a food basket to be fairly representative for the population of the Netherlands. Discharges to water in the Netherlands have decreased in the past twenty years, due both to the closure of two phosphoric acid plants a decade ago and the improved treatment of waste fluids by other NORM industries. The collective dose assessed from discharges to air since 1987 is presented here. (author)

Excitatory amino acid-stimulated uptake of 22Na+ in primary astrocyte cultures

International Nuclear Information System (INIS)

Kimelberg, H.K.; Pang, S.; Treble, D.H.

1989-01-01

In this study we have found that L-glutamic acid, as well as being taken up by a Na+-dependent mechanism, will stimulate the uptake of 22Na+ by primary astrocyte cultures from rat brain in the presence of ouabain. By simultaneously measuring the uptake of 22Na+ and L-3H-glutamate a stoichiometry of 2-3 Na+ per glutamate was measured, implying electrogenic uptake. Increasing the medium K+ concentration to depolarize the cells inhibited L-3H-glutamate uptake, while calculations of the energetics of the observed L-3H-glutamate accumulation also supported an electrogenic mechanism of at least 2 Na+:1 glutamate. In contrast, kinetic analysis of the Na+ dependence of L-3H-glutamate uptake indicated a stoichiometry of Na+ to glutamate of 1:1, but further analysis showed that the stoichiometry cannot be resolved by purely kinetic studies. Studies with glutamate analogs, however, showed that kainic acid was a very effective stimulant of 22Na+ uptake, but 3H-kainic acid showed no Na+ -dependent uptake. Furthermore, while L-3H-glutamate uptake was very sensitive to lowered temperatures, glutamate-stimulated 22Na+ uptake was relatively insensitive. These results indicate that glutamate-stimulated uptake of 22Na+ in primary astrocytes cultures cannot be explained solely by cotransport of Na+ with glutamate, and they suggest that direct kainic acid-type receptor induced stimulation of Na+ uptake also occurs. Since both receptor and uptake effects involve transport of Na+, accurate measurements of the Na+ :glutamate stoichiometry for uptake can only be done using completely specific inhibitors of these 2 systems

Seeing the electroporative uptake of cell-membrane impermeable fluorescent molecules and nanoparticles

Science.gov (United States)

Kim, Kisoo; Kim, Jeong Ah; Lee, Soon-Geul; Lee, Won Gu

2012-07-01

This paper presents direct visualization of uptake directionality for cell-membrane impermeant fluorescent molecules and fluorescence-doped nanoparticles at a single-cell level during electroporation. To observe directly the uptake direction, we used microchannel-type electroporation that can generate a relatively symmetric and uniform electric field. For all the image frames during electroporation, fluorescence intensities that occurred at cell membranes in both uptake directions toward the electrodes have been sequentially recorded and quantitatively analyzed pixel by pixel. In our experiments, we found that fluorescent molecules, even not labeled to target biomolecules, had their own uptake direction with different intensities. It is also observed that the uptake intensity toward the cell membrane had a maximal value at a certain electric voltage, not at the highest value of voltages applied. The results also imply that the uptake direction of fluorescence-doped nanoparticles can be determined by a net surface charge of uptake materials and sizes in the electroporative environments. In summary, we performed a quantitative screening and direct visualization of uptake directionality for a set of fluorescent molecules and fluorescence-doped nanoparticles using electric-pulsation. Taking a closer look at the uptake direction of exogenous materials will help researchers to understand an unknown uptake phenomenon in which way foreign materials are inclined to move, and furthermore to design functional nanoparticles for electroporative gene delivery.This paper presents direct visualization of uptake directionality for cell-membrane impermeant fluorescent molecules and fluorescence-doped nanoparticles at a single-cell level during electroporation. To observe directly the uptake direction, we used microchannel-type electroporation that can generate a relatively symmetric and uniform electric field. For all the image frames during electroporation, fluorescence intensities

Post Approval Human Papillomavirus Vaccine Uptake Is Higher in Minorities Compared to Whites in Girls Presenting for Well-Child Care

Directory of Open Access Journals (Sweden)

Susan C. Modesitt

2013-07-01

Full Text Available Since introduction of the human papillomavirus (HPV vaccine, there remains low uptake compared to other adolescent vaccines. There is limited information postapproval about parental attitudes and barriers when presenting for routine care. This study evaluates HPV vaccine uptake and assesses demographics and attitudes correlating with vaccination for girls aged 11–12 years. A prospective cohort study was performed utilizing the University of Virginia (UVA Clinical Data Repository (CDR. The CDR was used to identify girls aged 11–12 presenting to any UVA practice for a well-child visit between May 2008 and April 2009. Billing data were searched to determine rates of HPV vaccine uptake. The parents of all identified girls were contacted four to seven months after the visit to complete a telephone questionnaire including insurance information, child’s vaccination status, HPV vaccine attitudes, and demographics. Five hundred and fifty girls were identified, 48.2% of whom received at least one HPV vaccine dose. White race and private insurance were negatively associated with HPV vaccine initiation (RR 0.72, 95% CI 0.61–0.85 and RR 0.85, 95% CI 0.72–1.01, respectively. In the follow-up questionnaire, 242 interviews were conducted and included in the final cohort. In the sample, 183 (75.6% parents reported white race, 38 (15.7% black race, and 27 (11.2% reported other race. Overall 85% of parents understood that the HPV vaccine was recommended and 58.9% of parents believed the HPV vaccine was safe. In multivariate logistic regression, patients of black and other minority races were 4.9 and 4.2 times more likely to receive the HPV vaccine compared to their white counterparts. Safety concerns were the strongest barrier to vaccination. To conclude, HPV vaccine uptake was higher among minority girls and girls with public insurance in this cohort.

Factors influencing the in vitro uptake of mercury vapour in blood

Energy Technology Data Exchange (ETDEWEB)

Kudsk, F.N.

1969-01-01

The influence of a number of factors on the in vitro uptake of mercury vapour in blood has been investigated in order to clarify the mechanism by which mercury is oxidized in blood. The rate of mercury uptake in blood in a pure oxygen atmosphere is moderately increased, but somewhat decreased in a nitrogen atmosphere when compared with the rate of uptake in an atmospheric air phase. Increasing concentrations of methylene blue induce a very pronounced acceleration of the rate of mercury uptake in blood up to a maximum of about 10 times the normal uptake in an atmospheric air phase. Menadione shows a similar, but even more pronounced effect. The menadione-stimulated uptake is markedly inhibited by low concentrations of ethyl alcohol. Concentrations of potassium cyanide from 1/8 x 10/sup -3/ to 4 x 10/sup -3/ M cause a progressive inhibition of the mercury uptake in the blood up to a maximum of about 60%, which is very similar to the effect produced by ethyl alcohol. The investigations point to hydrogen peroxide and oxidized glutathione as agents of importance in the oxidation and uptake of mercury vapour in blood. The way in which ethyl alcohol inhibits the uptake is still unknown. Some possible mechanisms are discussed. 24 references, 4 figures, 3 tables.

SUBSTRATE UPTAKE AND UTILIZATION BY A MARINE ULTRAMICROBACTERIUM

NARCIS (Netherlands)

SCHUT, F; JANSEN, M; GOMES, TMP; GOTTSCHAL, JC; HARDER, W; PRINS, RA

A facultatively oligotrophic ultramicrobacterium (strain RB2256) isolated from an Alaskan fjord by extinction dilution in seawater, was grown in batch culture and under single- and dual-substrate-limitation of alanine and glucose in a chemostat. The nature of the uptake systems, and the uptake

Increased brain fatty acid uptake in metabolic syndrome

DEFF Research Database (Denmark)

Karmi, Anna; Iozzo, Patricia; Viljanen, Antti

2010-01-01

To test whether brain fatty acid uptake is enhanced in obese subjects with metabolic syndrome (MS) and whether weight reduction modifies it.......To test whether brain fatty acid uptake is enhanced in obese subjects with metabolic syndrome (MS) and whether weight reduction modifies it....

High radio-isotope uptakes in patients with hypothyroidism

Energy Technology Data Exchange (ETDEWEB)

Wing, J.; Kalk, W.J.; Ganda, C. (University of the Witwatersrand, Johannesburg (South Africa). Dept. of Medicine)

1982-12-04

Hypothyroidism is usually associated with a low radio-isotope uptake by the thyriod gland. We report 8 cases of Hashimoto's thyroiditis with clinical and biochemical hypothyroidism and with borderline high or overtly increased technetium-99m pertechnetate and/or iodine-131 uptakes.

The Uptake by Plants of Diethylstilboestrol and of Its Glucuronide

DEFF Research Database (Denmark)

Gregers Hansen, B.

1964-01-01

The uptake of diethylstilboestrol and its glucuronide by plants could, under certain circumstances, present a potential health hazard. The relative uptake of the two compounds has therefore been studied in rye grass, red clover, mushrooms, and maize in pot and water culture experiments. It is con......The uptake of diethylstilboestrol and its glucuronide by plants could, under certain circumstances, present a potential health hazard. The relative uptake of the two compounds has therefore been studied in rye grass, red clover, mushrooms, and maize in pot and water culture experiments...

A systematic review of Hepatitis C virus treatment uptake among people who inject drugs in the European Region

DEFF Research Database (Denmark)

Lazarus, Jeffrey V; Sperle, Ida; Maticic, Mojca

2014-01-01

in relation to the number of patients who either: (a) tested HCV antibody-positive; (b) tested positive for HCV-RNA; or (c) tested positive for HCV-RNA and met additional treatment criteria. RESULTS: Twenty-five articles from 12 countries were included in the review. Among groups of drug-using study......BACKGROUND: Fifteen million adults in the World Health Organization European Region are estimated to have active hepatitis C infection. Intravenous drug use is a major hepatitis C transmission route in this region, and people who inject drugs (PWID) constitute a high-risk and high......-prevalence population. A systematic review was conducted to assess levels of hepatitis C treatment uptake among PWID in Europe. METHODS: Searches in MEDLINE and EMBASE were carried out for articles in any language published between 1 January 2000 and 31 December 2012. Articles were included in the review...

Digital earth applications in the twenty-first century

NARCIS (Netherlands)

de By, R.A.; Georgiadou, P.Y.

2014-01-01

In these early years of the twenty-first century, we must look at how the truly cross-cutting information technology supports other innovations, and how it will fundamentally change the information positions of government, private sector and the scientific domain as well as the citizen. In those

Nitrogen and Phosphorus Plant Uptake During Periods with no Photosynthesis Accounts for About Half of Global Annual Uptake

Science.gov (United States)

Riley, W. J.; Zhu, Q.; Tang, J.

2017-12-01

Uncertainties in current Earth System Model (ESM) predictions of terrestrial carbon-climate feedbacks over the 21st century are as large as, or larger than, any other reported natural system uncertainties. Soil Organic Matter (SOM) decomposition and photosynthesis, the dominant fluxes in this regard, are tightly linked through nutrient availability, and the recent Coupled Model Inter-comparison Project 5 (CMIP5) used for climate change assessment had no credible representations of these constraints. In response, many ESM land models (ESMLMs) have developed dynamic and coupled soil and plant nutrient cycles. Here we quantify terrestrial carbon cycle impacts from well-known observed plant nutrient uptake mechanisms ignored in most current ESMLMs. In particular, we estimate the global role of plant root nutrient competition with microbes and abiotic process at night and during the non-growing season using the ACME land model (ALMv1-ECA-CNP) that explicitly represents these dynamics. We first demonstrate that short-term nutrient uptake dynamics and competition between plants and microbes are accurately predicted by the model compared to 15N and 33P isotopic tracer measurements from more than 20 sites. We then show that global nighttime and non-growing season nitrogen and phosphorus uptake accounts for 46 and 45%, respectively, of annual uptake, with large latitudinal variation. Model experiments show that ignoring these plant uptake periods leads to large positive biases in annual N leaching (globally 58%) and N2O emissions (globally 68%). Biases these large will affect modeled carbon cycle dynamics over time, and lead to predictions of ecosystems that have overly open nutrient cycles and therefore lower capacity to sequester carbon.

Sphagnum mosses--masters of efficient N-uptake while avoiding intoxication.

Science.gov (United States)

Fritz, Christian; Lamers, Leon P M; Riaz, Muhammad; van den Berg, Leon J L; Elzenga, Theo J T M

2014-01-01

Peat forming Sphagnum mosses are able to prevent the dominance of vascular plants under ombrotrophic conditions by efficiently scavenging atmospherically deposited nitrogen (N). N-uptake kinetics of these mosses are therefore expected to play a key role in differential N availability, plant competition, and carbon sequestration in Sphagnum peatlands. The interacting effects of rain N concentration and exposure time on moss N-uptake rates are, however, poorly understood. We investigated the effects of N-concentration (1, 5, 10, 50, 100, 500 µM), N-form ((15)N-ammonium or nitrate) and exposure time (0.5, 2, 72 h) on uptake kinetics for Sphagnum magellanicum from a pristine bog in Patagonia (Argentina) and from a Dutch bog exposed to decades of N-pollution. Uptake rates for ammonium were higher than for nitrate, and N-binding at adsorption sites was negligible. During the first 0.5 h, N-uptake followed saturation kinetics revealing a high affinity (Km 3.5-6.5 µM). Ammonium was taken up 8 times faster than nitrate, whereas over 72 hours this was only 2 times. Uptake rates decreased drastically with increasing exposure times, which implies that many short-term N-uptake experiments in literature may well have overestimated long-term uptake rates and ecosystem retention. Sphagnum from the polluted site (i.e. long-term N exposure) showed lower uptake rates than mosses from the pristine site, indicating an adaptive response. Sphagnum therefore appears to be highly efficient in using short N pulses (e.g. rainfall in pristine areas). This strategy has important ecological and evolutionary implications: at high N input rates, the risk of N-toxicity seems to be reduced by lower uptake rates of Sphagnum, at the expense of its long-term filter capacity and related competitive advantage over vascular plants. As shown by our conceptual model, interacting effects of N-deposition and climate change (changes in rainfall) will seriously alter the functioning of Sphagnum peatlands.

Sphagnum Mosses - Masters of Efficient N-Uptake while Avoiding Intoxication

Science.gov (United States)

Fritz, Christian; Lamers, Leon P. M.; Riaz, Muhammad; van den Berg, Leon J. L.; Elzenga, Theo J. T. M.

2014-01-01

Peat forming Sphagnum mosses are able to prevent the dominance of vascular plants under ombrotrophic conditions by efficiently scavenging atmospherically deposited nitrogen (N). N-uptake kinetics of these mosses are therefore expected to play a key role in differential N availability, plant competition, and carbon sequestration in Sphagnum peatlands. The interacting effects of rain N concentration and exposure time on moss N-uptake rates are, however, poorly understood. We investigated the effects of N-concentration (1, 5, 10, 50, 100, 500 µM), N-form (15N - ammonium or nitrate) and exposure time (0.5, 2, 72 h) on uptake kinetics for Sphagnum magellanicum from a pristine bog in Patagonia (Argentina) and from a Dutch bog exposed to decades of N-pollution. Uptake rates for ammonium were higher than for nitrate, and N-binding at adsorption sites was negligible. During the first 0.5 h, N-uptake followed saturation kinetics revealing a high affinity (Km 3.5–6.5 µM). Ammonium was taken up 8 times faster than nitrate, whereas over 72 hours this was only 2 times. Uptake rates decreased drastically with increasing exposure times, which implies that many short-term N-uptake experiments in literature may well have overestimated long-term uptake rates and ecosystem retention. Sphagnum from the polluted site (i.e. long-term N exposure) showed lower uptake rates than mosses from the pristine site, indicating an adaptive response. Sphagnum therefore appears to be highly efficient in using short N pulses (e.g. rainfall in pristine areas). This strategy has important ecological and evolutionary implications: at high N input rates, the risk of N-toxicity seems to be reduced by lower uptake rates of Sphagnum, at the expense of its long-term filter capacity and related competitive advantage over vascular plants. As shown by our conceptual model, interacting effects of N-deposition and climate change (changes in rainfall) will seriously alter the functioning of Sphagnum peatlands

Muscle contraction increases carnitine uptake via translocation of OCTN2

Energy Technology Data Exchange (ETDEWEB)

Furuichi, Yasuro [Graduate School of Natural Science and Technology, Kanazawa University, Kanazawa (Japan); Sugiura, Tomoko; Kato, Yukio [Faculty of Pharmacy, Kanazawa University, Kanazawa (Japan); Takakura, Hisashi [Faculty of Human Sciences, Kanazawa University, Kanazawa (Japan); Hanai, Yoshiteru [Nagoya Institute of Technology, Nagoya (Japan); Hashimoto, Takeshi [Ritsumeikan University, Kusatsu (Japan); Masuda, Kazumi, E-mail: masuda@ed.kanazawa-u.ac.jp [Faculty of Human Sciences, Kanazawa University, Kanazawa (Japan)

2012-02-24

Highlights: Black-Right-Pointing-Pointer Muscle contraction augmented carnitine uptake into rat hindlimb muscles. Black-Right-Pointing-Pointer An increase in carnitine uptake was due to an intrinsic clearance, not blood flow. Black-Right-Pointing-Pointer Histochemical analysis showed sarcolemmal OCTN2 was emphasized after contraction. Black-Right-Pointing-Pointer OCTN2 protein in sarcolemmal fraction was increased in contracting muscles. -- Abstract: Since carnitine plays an important role in fat oxidation, influx of carnitine could be crucial for muscle metabolism. OCTN2 (SLC22A5), a sodium-dependent solute carrier, is assumed to transport carnitine into skeletal muscle cells. Acute regulation of OCTN2 activity in rat hindlimb muscles was investigated in response to electrically induced contractile activity. The tissue uptake clearance (CL{sub uptake}) of L-[{sup 3}H]carnitine during muscle contraction was examined in vivo using integration plot analysis. The CL{sub uptake} of [{sup 14}C]iodoantipyrine (IAP) was also determined as an index of tissue blood flow. To test the hypothesis that increased carnitine uptake involves the translocation of OCTN2, contraction-induced alteration in the subcellular localization of OCTN2 was examined. The CL{sub uptake} of L-[{sup 3}H]carnitine in the contracting muscles increased 1.4-1.7-fold as compared to that in the contralateral resting muscles (p < 0.05). The CL{sub uptake} of [{sup 14}C]IAP was much higher than that of L-[{sup 3}H]carnitine, but no association between the increase in carnitine uptake and blood flow was obtained. Co-immunostaining of OCTN2 and dystrophin (a muscle plasma membrane marker) showed an increase in OCTN2 signal in the plasma membrane after muscle contraction. Western blotting showed that the level of sarcolemmal OCTN2 was greater in contracting muscles than in resting muscles (p < 0.05). The present study showed that muscle contraction facilitated carnitine uptake in skeletal muscles, possibly

Muscle contraction increases carnitine uptake via translocation of OCTN2

International Nuclear Information System (INIS)

Furuichi, Yasuro; Sugiura, Tomoko; Kato, Yukio; Takakura, Hisashi; Hanai, Yoshiteru; Hashimoto, Takeshi; Masuda, Kazumi

2012-01-01

Highlights: ► Muscle contraction augmented carnitine uptake into rat hindlimb muscles. ► An increase in carnitine uptake was due to an intrinsic clearance, not blood flow. ► Histochemical analysis showed sarcolemmal OCTN2 was emphasized after contraction. ► OCTN2 protein in sarcolemmal fraction was increased in contracting muscles. -- Abstract: Since carnitine plays an important role in fat oxidation, influx of carnitine could be crucial for muscle metabolism. OCTN2 (SLC22A5), a sodium-dependent solute carrier, is assumed to transport carnitine into skeletal muscle cells. Acute regulation of OCTN2 activity in rat hindlimb muscles was investigated in response to electrically induced contractile activity. The tissue uptake clearance (CL uptake ) of L-[ 3 H]carnitine during muscle contraction was examined in vivo using integration plot analysis. The CL uptake of [ 14 C]iodoantipyrine (IAP) was also determined as an index of tissue blood flow. To test the hypothesis that increased carnitine uptake involves the translocation of OCTN2, contraction-induced alteration in the subcellular localization of OCTN2 was examined. The CL uptake of L-[ 3 H]carnitine in the contracting muscles increased 1.4–1.7-fold as compared to that in the contralateral resting muscles (p uptake of [ 14 C]IAP was much higher than that of L-[ 3 H]carnitine, but no association between the increase in carnitine uptake and blood flow was obtained. Co-immunostaining of OCTN2 and dystrophin (a muscle plasma membrane marker) showed an increase in OCTN2 signal in the plasma membrane after muscle contraction. Western blotting showed that the level of sarcolemmal OCTN2 was greater in contracting muscles than in resting muscles (p < 0.05). The present study showed that muscle contraction facilitated carnitine uptake in skeletal muscles, possibly via the contraction-induced translocation of its specific transporter OCTN2 to the plasma membrane.

100 cases of normal earlobe and vein blood hemoglobin and WBC determination comparison%100例正常人耳垂血与静脉血血红蛋白及白细胞测定的比较

Institute of Scientific and Technical Information of China (English)

郝云波

2016-01-01

Objective To normal earlobe blood and venous blood hemoglobin and WBC to compare the results of determination. Method Research object for the normal adults, 100 cases (conscription examination), the earlobe blood parts of blood and venous blood two parts, the determination of hemoglobin and WBC level. Results The 100 cases of Hb and white blood cells are higher than that of venous blood, earlobe blood Hb were higher than in venous blood of Hb, the difference between the two have 3 cases not more than 10 g (3%), 97% of Hb the difference between the two parts of 10 g/L ~ 60 g/L (31 g) on average, 95% difference within the 25 g ~ 60 g, 26.5 g to 26.5 g. Using two blood test method of the same parts as WBC determination results comparison, the earlobe blood leukocytes were higher than that of venous blood leukocytes, 98% of them significantly better than the earlobe blood of venous blood leukocyte number (differential value of 8.6 x 109 / L ~ 6.3 x 109 / L (8600 ~ 6300), the mean difference of 3.8 x 109 / L ~ 4.8 x 109 / L (3800 ~4800), only 2% of the people the earlobe blood leukocytes was slightly higher than that of venous blood, difference of 0.6 x 109 / L ~ 1.2 x 109 / L (600 ~ 1200). Conclusions Blood test result difference is big, the two parts should arouse our attention.%目的：对正常人耳垂血与静脉血血红蛋白及白细胞测定的结果进行比较。方法研究对象为正常成人100例（征兵体检），采血部位为耳垂血与静脉血两部位，测定血红蛋白与白细胞水平。结果经测定100例 Hb 及白细胞均高于静脉血，耳垂血 Hb 均高于静脉血的 Hb，两者之差有3例不超过10g（3%），有97%的人 Hb 两部位之差为10g/L ～60g/L（平均31g），95%差数在25g ～60g以内，平均26.5g ～30.4g。用同一种检验方法对两种采血部位做的白细胞测定结果比较，耳垂血白细胞均高于静脉血的白细胞，其中98%�

Radiation curing - twenty five years on

International Nuclear Information System (INIS)

Garnett, J.L.

1995-01-01

Progress in UV/EB curing during the past twenty five years is briefly reviewed. During this time developments in unique polymer chemistry, novel equipment design and the introduction of relevant educational programmes has enabled radiation curing to become an established technology with specific strengths in certain industries. Possible reasons for the emergence of the technology in these niche markets are discussed. Despite the worldwide recession, radiation curing is shown to be expanding at 5% per annum with the prospect of higher growth with improving economic conditions. (Author)

Early twenty-first-century droughts during the warmest climate

Directory of Open Access Journals (Sweden)

Felix Kogan

2016-01-01

Full Text Available The first 13 years of the twenty-first century have begun with a series of widespread, long and intensive droughts around the world. Extreme and severe-to-extreme intensity droughts covered 2%–6% and 7%–16% of the world land, respectively, affecting environment, economies and humans. These droughts reduced agricultural production, leading to food shortages, human health deterioration, poverty, regional disturbances, population migration and death. This feature article is a travelogue of the twenty-first-century global and regional droughts during the warmest years of the past 100 years. These droughts were identified and monitored with the National Oceanic and Atmospheric Administration operational space technology, called vegetation health (VH, which has the longest period of observation and provides good data quality. The VH method was used for assessment of vegetation condition or health, including drought early detection and monitoring. The VH method is based on operational satellites data estimating both land surface greenness (NDVI and thermal conditions. The twenty-first-century droughts in the USA, Russia, Australia and Horn of Africa were intensive, long, covered large areas and caused huge losses in agricultural production, which affected food security and led to food riots in some countries. This research also investigates drought dynamics presenting no definite conclusion about drought intensification or/and expansion during the time of the warmest globe.

Safety regulation - twenty years after Chernobyl accident

International Nuclear Information System (INIS)

Aleksashin, P.P.; Bukrinskij, A.M.; Gordon, B.G.

2006-01-01

Main stages of development, successes, achievements and shortcomings of activity of supervision body after the Chernobyl NPP accident are analysed. The estimation of the realized variations of the functions of the state supervision department is carried out. Results of the twenty year period of improvement of the supervision body are summed up. The measures for increasing the efficiency of the supervision body operation are outlined [ru

Calcidiol and vitamin D binding protein uptake by LLC-PK1 cells

International Nuclear Information System (INIS)

Keenan, M.J.; Holmes, R.P.

1986-01-01

The process by which target cells take up vitamin D and its metabolites is not known. The authors studied the uptake of both 3 H-calcidiol and 125 I-Vitamin D Binding Protein (DBP) by LLC-PK 1 cells. Uptake was directly related to their extracellular concentrations. In the presence of 55 serum in the growth media cells previously incubated with 10 nM calcitriol for 4 hr had a greater uptake of calcidiol than those cells not incubated with calcitriol. This effect of calcitriol on calcidiol uptake was absent when cells were grown in hormone-supplemented, serum-free media, despite these cells having a cytosolic calcitriol receptor. Equal uptake of calcidiol occurred when DBP was absent and when DBP was present in a one to one molar ratio to calcidiol. With a 1:1 ratio of DBP to calcidiol and a measured K/sub D/ of 2 x 10 -8 M, the uptake of calcidiol could not be accounted for by uptake of the free ligand alone. A large excess of DBP (100:1) in relation to calcidiol suppressed uptake of calcidiol by approx. 90%. The authors have not been able to identify a saturable, specific uptake of either calcidiol or DBP despite DBP appearing to facilitate calcidiol uptake

Heavy Metal uptake Potentials of Pseudomonas aeruginosa and ...

African Journals Online (AJOL)

Uptake of heavy metals, silver and cadmium by Pseudomonas aeruginosa (a Gram negative bacterium) and Micrococcus luteus (a Gram positive bacterium) was investigated in Cadmium and Silver stock solution using ion selective electrodes. Silver and cadmium uptake by the two organisms was described by Langmuir ...

Reduction of the influence of the liver uptake to the myocardial uptake on technetium-99m myocardial SPECT. Usefulness and problems of a mask processing method

Energy Technology Data Exchange (ETDEWEB)

Takaki, Akihiro; Okada, Kazuhiro; Urata, Johji; Matsuda, Hirofumi; Takao, Yuji [Saiseikai Kumamoto Hospital (Japan)

1999-07-01

The aim of this study is to evaluate the usefulness of a mask processing method for obtaining the true myocardial tracer distribution by eliminating the influence of the liver uptake to the myocardial uptake on myocardial SPECT images by using technetium-99m ({sup 99m}Tc) blood flow agents. A SPECT imaging was performed with a two-head SPECT system (GCA-7200A/DI) in both phantom and clinical studies. The mask processing method was applied to the reconstructed and projection images. The phantom consisted of heart, lung, liver and spine. A defect was located in the inferior wall of the left ventricle and other parts of the heart and liver were filled with {sup 99m}Tc solution. For clinical study 10 patients with difficulty in the interpretation of the inferior wall were selected for the evaluation of usefulness of the mask method. In the phantom study, the mask processing method applied to the reconstructed images was able to remove the overlapped liver from the heart, but was not able to remove the influence of the liver uptake to the myocardial uptake. Nevertheless, the mask processing method applied to the projection images successfully eliminated not only the overlapped liver but also the influence of the liver uptake to the myocardial uptake. In the clinical study, the liver uptake could be removed from the uptake in the inferior wall in 8 of 10 patients with the mask processing methods. In 2 patients, the overlapped liver uptake could not be eliminated from the uptake in the inferior wall because the distance between the liver and heart was too short. The mask processing method applied to the projection images was thought to be superior to that applied to the reconstruction images in both phantom and clinical studies. The mask processing method, especially applied to the projection images, seems to be useful for the elimination of the liver uptake from the inferior wall of the myocardium on myocardial SPECT images using {sup 99m}Tc blood flow agents. (author)

Reduction of the influence of the liver uptake to the myocardial uptake on technetium-99m myocardial SPECT. Usefulness and problems of a mask processing method

International Nuclear Information System (INIS)

Takaki, Akihiro; Okada, Kazuhiro; Urata, Johji; Matsuda, Hirofumi; Takao, Yuji

1999-01-01

The aim of this study is to evaluate the usefulness of a mask processing method for obtaining the true myocardial tracer distribution by eliminating the influence of the liver uptake to the myocardial uptake on myocardial SPECT images by using technetium-99m ( 99m Tc) blood flow agents. A SPECT imaging was performed with a two-head SPECT system (GCA-7200A/DI) in both phantom and clinical studies. The mask processing method was applied to the reconstructed and projection images. The phantom consisted of heart, lung, liver and spine. A defect was located in the inferior wall of the left ventricle and other parts of the heart and liver were filled with 99m Tc solution. For clinical study 10 patients with difficulty in the interpretation of the inferior wall were selected for the evaluation of usefulness of the mask method. In the phantom study, the mask processing method applied to the reconstructed images was able to remove the overlapped liver from the heart, but was not able to remove the influence of the liver uptake to the myocardial uptake. Nevertheless, the mask processing method applied to the projection images successfully eliminated not only the overlapped liver but also the influence of the liver uptake to the myocardial uptake. In the clinical study, the liver uptake could be removed from the uptake in the inferior wall in 8 of 10 patients with the mask processing methods. In 2 patients, the overlapped liver uptake could not be eliminated from the uptake in the inferior wall because the distance between the liver and heart was too short. The mask processing method applied to the projection images was thought to be superior to that applied to the reconstruction images in both phantom and clinical studies. The mask processing method, especially applied to the projection images, seems to be useful for the elimination of the liver uptake from the inferior wall of the myocardium on myocardial SPECT images using 99m Tc blood flow agents. (author)

Simultaneous Determination of Seven Constituents in Herbal ...

African Journals Online (AJOL)

Simultaneous Determination of Seven Constituents in Herbal Prescription Jaeumganghwa-Tang Using HPLC-PDA. CS Seo, JH Kim, HK Shin. Abstract. A simple and accurate high-performance liquid chromatographic method was applied to the quantitative analysis of seven components of the traditional herbal prescription ...

Forest Transpiration: Resolving Species-Specific Root Water Uptake Patterns

Science.gov (United States)

Blume, T.; Heidbuechel, I.; Simard, S.; Guntner, A.; Weiler, M.; Stewart, R. D.

2016-12-01

Transpiration and its spatio-temporal variability are still not fully understood, despite their importance for the global water cycle. This is in part due to our inability to measure transpiration comprehensively. Transpiration is usually either estimated with empirical equations based on climatic variables and crop factors, by measuring sap velocities, estimating sap wood area and scaling up to the forest stand based on a number of assumptions or by measuring the integral signal across a footprint with eddy flux towers. All these methods are focused on the cumulated loss of water to the atmosphere and do not provide information on where this water is coming from. In this study, spatio-temporal variability of root water uptake was investigated in a forest in the northeastern German lowlands. The soils are sandy and the depth of the unsaturated zone ranges from 1 to 30 m. We estimated root water uptake from different soil depths, from 0.1 m down to 2 m, based on diurnal fluctuations in soil moisture content during rain-free days. The 15 field sites cover different topographic positions and forest stands: 4 pure stands of both mature and young beech and pine and 9 mixed stands. The resulting daily data set of root water uptake shows that the forest stands differ in total amounts as well as in uptake depth distributions. Temporal dynamics of signal strength within the profile suggest a locally shifting spatial distribution of uptake that changes with water availability. The relationship of these depth-resolved uptake rates to overall soil water availability varies considerably between tree species. Using the physically-based soil hydrological model HYDRUS we investigated to what extent the observed patterns in uptake can be related to soil physical relationships alone and where tree species-specific aspects come into play. We furthermore used the model to test assumptions and estimate uncertainties of this soil moisture based estimation of plant water uptake. The

Kinetic parameters of silicon uptake by rice cultivars

Directory of Open Access Journals (Sweden)

Priscila Oliveira Martins

2012-02-01

Full Text Available Silicon is considered an important chemical element for rice, because it can improve tolerance to biotic and abiotic stress. However, in many situations no positive effect of silicon was observed, probably due to genetic factors. The objective of this research was to monitor Si uptake kinetics and identify responses of rice cultivars in terms of Si uptake capacity and use. The experiment was carried out in a greenhouse of the São Paulo State University (UNESP, Brazil. The experiment was arranged in a completely randomized, factorial design with three replications. that consisted of two rice cultivars and two Si levels. Kinetic parameters (Vmax, Km, and Cmin, root morphology variables, dry matter yield, Si accumulation and levels in shoots and roots, uptake efficiency, utilization efficiency, and root/shoot ratio were evaluated. Higher Si concentrations in the nutrient solution did not increase rice dry matter. The development of the low-affinity silicon uptake system of the rice cultivar 'Caiapó' was better than of 'Maravilha'.

Characteristics of sugar uptake by immature maize embryos

International Nuclear Information System (INIS)

Griffith, S.M.; Jones, R.J.; Brenner, M.L.

1986-01-01

Characteristics of sugar uptake by immature maize embryos were determined in vitro utilizing a 14 C-sugar solution incubation method. Hexose uptake rates were greater than those for sucrose, however, all showed biphasic kinetics. Glucose and fructose saturable components were evidence at <50 mM and sucrose at <5 mM. Chemical inhibitors (CCCP, DNP, NaCN, and PCMBS) and low temperature reduced sugar uptake. Sucrose influx was pH dependent while glucose was not. Embryos maintained a high sucrose to hexose ratio throughout development. At 25 days after pollination sucrose levels exceeded 200 mM while hexose levels remained below 5 mM. Glucose was rapidly converted to sucrose upon transport into the embryo. These circumstantial data indicate that sugar uptake by immature maize embryos is metabolically dependent and carrier mediated. Furthermore, sucrose transport appears to occur against its concentration gradient involving a H+/sucrose cotransport mechanism, while glucose influx is driven by its concentration gradient and subsequent metabolism

Lung damage and pulmonary uptake of serotonin in intact dogs

International Nuclear Information System (INIS)

Dawson, C.A.; Christensen, C.W.; Rickaby, D.A.; Linehan, J.H.; Johnston, M.R.

1985-01-01

The authors examined the influence of glass bead embolization and oleic acid, dextran, and imipramine infusion on the pulmonary uptake of trace doses of [ 3 H]serotonin and the extravascular volume accessible to [ 14 C]antipyrine in anesthetized dogs. Embolization and imipramine decreased serotonin uptake by 53 and 61%, respectively, but no change was observed with oleic acid or dextran infusion. The extravascular volume accessible to the antipyrine was reduced by 77% after embolization and increased by 177 and approximately 44% after oleic acid and dextran infusion, respectively. The results suggest that when the perfused endothelial surface is sufficiently reduced, as with embolization, the uptake of trace doses of serotonin will be depressed. In addition, decreases in serotonin uptake in response to imipramine in this study and in response to certain endothelial toxins in other studies suggest that serotonin uptake can reveal certain kinds of changes in endothelial function. However, the lack of a response to oleic acid-induced damage in the present study suggests that serotonin uptake is not sensitive to all forms of endothelial damage

Benign ovarian and endometrial uptake on FDG PET-CT. Patterns and pitfalls

International Nuclear Information System (INIS)

Liu, Y.

2009-01-01

Increased ovarian or endometrial uptake may cause a dilemma in the interpretation of whole body F18-fluorodeoxyglucose-positron emission tomography (FDG-PET) imaging or even misdiagnosis of malignant disease. Knowledge of benign FDG uptake of the ovaries and uterus is important for daily practice of nuclear medicine radiologists. Increased uptake in the ovaries or uterus indicates a pathologic or neoplastic process in postmenopausal patients. In premenopausal women, increased ovarian or endometrial uptake can be functional or malignant. Benign functional uptake of premenopausal ovaries or uterus is related to the menstrual cycle; therefore, information about the patient's menstrual status is crucial for interpretation. In addition, correlation with computed tomography (CT), especially diagnostic CT acquired at the same time of PET/CT is very useful in clarifying the location of the uptake and the existence or disappearance of the discrete lesion. Increased ovarian uptake may also be identified in histologically different benign tumor entities. Nonmenstrual-related endometrial uptake may be present in many benign diseases as well. (author)

H2WHOA - 6 to 8 glasses of water an hour: how water can distinguish physiological from pathological uptake in the GIT on PET/CT scans

International Nuclear Information System (INIS)

Crowther, M. D.

2009-01-01

Full text:Objectives: To determine the effectiveness of water as a negative contrast agent in PET/CT. To determine the amount and timing of water to be administered in order to evaluate specific regions of the gastro-intestinal tract (GIT). To evaluate whether the use of a 'bolus' of a large amount of water is effective in distinguishing physiological from pathological 18F-FDG uptake in the GIT. Method: Over the past seven months, patients who were scanned and on review had FDG-avidity in the stomach, or had FDG-avidity of an uncertain aetiology further along the GIT, were selected for further scanning. Depending on the site of FDG uptake, patients were either given 1) 2 glasses of water on the bed immediately before scanning or 2) given 6-8 glasses of water in the space of an hour and a delay preceded before scanning over the GIT. Results: To date, 11 patients who have had 13 FDG PET/CT scans have had further water-enhanced delayed imaging. 8(61.5%) scans proved water to be a useful contrast agent. In 11(84.6%) cases, an appropriate amount and timing of water ingested assisted in further evaluating a specific region. In 7(53.9%) cases a large bolus of water allowed the reporting doctor to effectively distinguish between physiological and pathological uptake in the GIT. Conclusions: Patients with gastric/gastro-oesophageal/pancreatic cancers benefit from imaging with water in the stomach or small bowel. Scanning patients with discrete, FDG uptake in the large bowel following a large 'bolus' of water can help to distinguish physiological from pathological FDG uptake.

High-Intensity Focused Ultrasound for the Treatment of Wrinkles and Skin Laxity in Seven Different Facial Areas.

Science.gov (United States)

Park, Hyunchul; Kim, Eunjin; Kim, Jeongeun; Ro, Youngsuck; Ko, Jooyeon

2015-12-01

High-intensity focused ultrasound (HIFU) treatment has recently emerged in response to the increasing demand for noninvasive procedures for skin lifting and tightening. This study was aimed at evaluating the clinical efficacy of and patient satisfaction with HIFU treatment for wrinkles and laxity in seven different areas of the face in Asian skin. Twenty Korean patients with facial wrinkle and laxity were analyzed after a single session of HIFU treatment. Two independent, blinded clinicians evaluated the clinical improvement in seven areas of the face by comparison of standardized photographs obtained before, and at 3 and 6 months after treatment. Assessment of subjective satisfaction and adverse effects of treatment were done by using questionnaires. The physicians' evaluation and patients' satisfaction with the clinical effects of HIFU in each area were similar regardless of the number of treatment shots. The jawline, cheek, and perioral areas were the sites where HIFU was most effective, in decreasing order. The adverse effects included erythema and swelling in six cases, and purpura and bruising in two cases. However, the adverse effects were mild and transient. HIFU could be a safe, effective, and noninvasive procedure that can be used to improve facial wrinkles and skin laxity in Asian skin. It is particularly effective for clinical improvement in the jawline, cheek, and perioral areas.

Radiolabeling as a tool to study uptake pathways in plants

Energy Technology Data Exchange (ETDEWEB)

Schymura, Stefan; Hildebrand, Heike; Franke, Karsten [Helmholtz-Zentrum Dresden-Rossendorf e.V., Dresden (Germany). Reactive Transport; Fricke, T. [Vita34 BioPlanta, Leipzig (Germany)

2017-06-01

The identification of major uptake pathways in plants is an important factor when evaluation the fate of manufactured nanoparticles in the environment and the associated risks. Using different radiolabeling techniques we were able to show a predominantly particulate uptake for CeO{sub 2} nanoparticles (NPs) in contrast to a possible uptake in the form of ionic cerium.

Stereoselective effects of MDMA on inhibition of monoamine uptake

International Nuclear Information System (INIS)

Steele, T.D.; Nichols, D.E.; Yim, G.K.W.

1986-01-01

The R(-)-isomers of hallucinogenic phenylisopropylamines are most active, whereas the S(+)-enantiomers of amphetamine (AMPH) and methylenedioxymethamphetamine (MDMA) are more potent centrally. To determine if MDMA exhibits stereoselective effects at the biochemical level that resemble either those of amphetamine or the potent hallucinogen 2,5-dimethoxy-4-methylamphetamine (DOM), the ability of the isomers of MDMA, AMPH and DOM to inhibit uptake of radiolabelled monoamines into synaptosomes was measured. AMPH was more potent than MDMA in inhibiting uptake of 3 H-norepinephrine (NE) into hypothalamic synaptosomes and 3 H-dopamine (DA) into striatal synaptosomes. The S(+)-isomer was more active in each case. MDMA was more potent than AMPH in inhibiting uptake of 3 H-serotonin (5-HT) into hippocampal synaptosomes and exhibited a high degree of stereoselectivity, in favor of the S(+)-isomer. DOM showed only minimal activity in inhibiting uptake of any monoamine (IC 50 > 10 -5 M). These results suggest that MDMA exhibits stereoselective effects similar to those of amphetamine on monoamine uptake inhibition, a parameter that is unrelated to the mechanism of action of the hallucinogen DOM

Unmasking the Role of Uptake Transporters for Digoxin Uptake Across the Barriers of the Central Nervous System in Rat

Directory of Open Access Journals (Sweden)

Kunal S Taskar

2017-03-01

Full Text Available The role of uptake transporter (organic anion–transporting polypeptide [Oatp] in the disposition of a P-glycoprotein (P-gp substrate (digoxin at the barriers of central nervous system, namely, the blood-brain barrier (BBB, blood-spinal cord barrier (BSCB, and brain-cerebrospinal fluid barrier (BCSFB, was studied using rat as a preclinical species. In vivo chemical inhibition of P-gp and Oatp was achieved using elacridar and rifampicin, respectively. Our findings show that (1 digoxin had a low brain-to-plasma concentration ratio (B/P (0.07 in rat; (2 in the presence of elacridar, the B/P of digoxin increased by about 12-fold; (3 rifampicin administration alone did not change the digoxin B/P significantly when compared with digoxin B/P alone; (4 rifampicin administration along with elacridar resulted only in 6-fold increase in the B/P of digoxin; (5 similar fold changes and trends were seen with the spinal cord-to-plasma concentration ratio of digoxin, indicating the similarity between BBB and the BSCB; and (6 unlike BBB and BSCB, the presence of rifampicin further increased the cerebrospinal fluid-to-plasma concentration ratio (CSF/P for digoxin, suggesting a differential orientation of the uptake transporters at the BCSFB (CSF to blood compared with the BBB (blood to brain. The observations for digoxin uptake, at least at the BBB and the BSCB, advocate the importance of uptake transporters (Oatps. However, the activity of such uptake transporters became evident only after inhibition of the efflux transporter (P-gp.

Heavy metal ion uptake properties of polystyrene-supported ...

Indian Academy of Sciences (India)

Unknown

concentration on the uptake of metal ions have been studied. The uptake ... employed for the removal of heavy metal pollutants from industrial waste water. ... nitrate, mercuric chloride, cadmium nitrate and potassium dichromate salts. ... polymer resin was determined by reacting 50, 100, 150, 200, 250 and 300 ppm of metal.

Effects of antibiotics on uptake of calcium into isolated nerve terminals

International Nuclear Information System (INIS)

Atchison, W.D.; Adgate, L.; Beaman, C.M.

1988-01-01

The goal of the present study was to determine whether several antibiotics which are known to block neuromuscular transmission would impair depolarization-dependent and/or -independent uptake of calcium into isolated nerve terminals prepared from forebrain synaptosomes of rats by conventional methods. Antibiotics tested for potential block of Ca++ uptake included the aminoglycosides neomycin and streptomycin, the lincosamide clindamycin, oxytetracycline and polymyxin B. Drugs were applied in concentrations ranging from 1 to 1000 microM. Uptake of 45Ca was determined during depolarization induced by an elevated K+ concentration (77.5 mM). Influxes of 45Ca during 1 and 10 sec of depolarization were used to assess Ca++ uptake via a fast, inactivating path and total uptake, respectively. Uptake of 45Ca during 10 sec of depolarization into synaptosomes which were previously depolarized for 10 sec in the presence of 77.5 mM K+ but in the absence of external Ca++ was used to measure uptake during a slow, noninactivating path. Total depolarization-dependent uptake of 45Ca was depressed significantly by all antibiotics tested except oxytetracycline; however, the various agents differed with respect to their efficacy and potency as blockers of Ca influx. The fast component of uptake, which is thought to be associated with neurotransmitter release, was decreased significantly by all antibiotics. Neomycin and polymyxin were the most potent and most effective at lowering fast phase 45Ca influx; streptomycin, was intermediate in effectiveness whereas clindamycin and oxytetracycline were only effective at concentrations greater than or equal to 100 microM. Only clindamycin, streptomycin and polymyxin B caused significant reductions in the slow phase of 45Ca uptake

Clinical and experimental analysis of 201thallium uptake of the heart

International Nuclear Information System (INIS)

Strauer, B.E.; Buell, U.; Buerger, S.; Klinikum Grosshadern, Muenchen

1978-01-01

Studies were carried out in order to determine the factors influencing myocardial 201 Tl uptake. A total of 158 patients was examined with regard to both 201 Tl uptake and the assessment of left ventricular and coronary function. Moreover, 42 animal experiments were performed. The results demonstrate that: 1) 201 Tl uptake in the normal and hypertrophied human heart is linearly correlated with the muscle mass of the left ventricle (LVMM); 2) 201 Tl uptake is enhanced in the inner layer and is decreased in the outer layer of the left ventricular wall. The 201 Tl uptake of the right ventricle is 40% lower in comparison to the left ventricle; 3) the basic correlation between 201 Tl uptake and LVMM is influenced by alterations of both myocardial flow and myocardial oxygen consumption; and 4) inotropic interventions (isoproterenol, calcium, norepinephrine) as well as coronary dilatation (dipyridamole) may considerably augment 201 Tl uptake in accordance with changes in myocardial oxygen consumption and/or myocardial flow. It is concluded that myocardial 201 Tl uptake is determined by multiple factors. The major determinants have been shown to include muscle mass, myocardial flow and myocardial oxygen consumption. The clinical data obtained from patient groups with normal ventricular function, with coronary artery disease, with left ventricular wall motion abnormalities and with different degree of left ventricular hypertrophy are correlated with quantitated myocardial 201 Tl uptake. (orig./MG) [de

The relevance of parametric U-uptake models in ESR age calculations

International Nuclear Information System (INIS)

Gruen, Rainer

2009-01-01

In the ESR dating three basic parametric U-uptake models have been applied for dating teeth: early U-uptake (EU: closed system), linear U-uptake (LU) and recent U-uptake (RU, it is assumed that the dose rate contribution of U in the dental tissues is zero). In many ESR dating publications it is still assumed that samples comply with one or the other parametric U-uptake model calculation or that their correct age lies somewhere between EU and LU. Observations of the spatial distribution of uranium in dental tissues show that it is difficult to predict any relationships between the relative uptake in the dental tissues. Combined U-series/ESR age estimates can give insights into the actual U-uptake. An evaluation of published data shows that for cave sites, a significant number of results fall outside the EU and LU bracket, while for open air sites, the majority of data are outside this bracket, particularly showing greatly delayed U-uptake. This may be due to changes in the hydrological system, leading to erosion which exposes the open air site. U-leaching has also been observed on samples from open air sites, in which case any reasonable age calculation is impossible.

Thyroid Scan and Uptake

Medline Plus

Full Text Available ... information. The thyroid scan and thyroid uptake provide information about the structure and function of the thyroid. The thyroid is a gland in the neck that controls metabolism , a chemical process that regulates the rate at which the body ...

Nanodiamond internalization in cells and the cell uptake mechanism

Energy Technology Data Exchange (ETDEWEB)

Perevedentseva, E. [National Dong Hwa University, Department of Physics (China); Hong, S.-F.; Huang, K.-J. [National Dong Hwa University, Department of Life Sciences (China); Chiang, I.-T.; Lee, C.-Y. [National Dong Hwa University, Department of Physics (China); Tseng, Y.-T. [National Dong Hwa University, Department of Life Sciences (China); Cheng, C.-L., E-mail: clcheng@mail.ndhu.edu.tw [National Dong Hwa University, Department of Physics (China)

2013-08-15

Cell type-dependent penetration of nanodiamond in living cells is one of the important factors for using nanodiamond as cellular markers/labels, for drug delivery as well as for other biomedical applications. In this work, internalization of 100 nm nanodiamonds by A549 lung human adenocarcinoma cell, Beas-2b non-tumorigenic human bronchial epithelial cell, and HFL-1 fibroblast-like human fetal lung cell is studied and compared. The penetration of nanodiamond into the cells was observed using confocal fluorescence imaging and Raman imaging methods. Visualization of the nanodiamond in cells allows comparison of the internalization for diamond nanoparticles in cancer A549 cell, non-cancer HFL-1, and Beas-2b cells. The dose-dependent and time-dependent behavior of nanodiamond uptake is observed in both cancer as well as non-cancer cells. The mechanism of nanodiamond uptake by cancer and non-cancer cells is analyzed by blocking different pathways. The uptake of nanodiamond in both cancer and non-cancer cells was found predominantly via clathrin-dependent endocytosis. In spite of observed similarity in the uptake mechanism for cancer and non-cancer cells, the nanodiamond uptake for cancer cell quantitatively exceeds the uptake for non-cancer cells, for the studied cell lines. The observed difference in internalization of nanodiamond by cancer and non-cancer cells is discussed.

Nanodiamond internalization in cells and the cell uptake mechanism

International Nuclear Information System (INIS)

Perevedentseva, E.; Hong, S.-F.; Huang, K.-J.; Chiang, I.-T.; Lee, C.-Y.; Tseng, Y.-T.; Cheng, C.-L.

2013-01-01

Cell type-dependent penetration of nanodiamond in living cells is one of the important factors for using nanodiamond as cellular markers/labels, for drug delivery as well as for other biomedical applications. In this work, internalization of 100 nm nanodiamonds by A549 lung human adenocarcinoma cell, Beas-2b non-tumorigenic human bronchial epithelial cell, and HFL-1 fibroblast-like human fetal lung cell is studied and compared. The penetration of nanodiamond into the cells was observed using confocal fluorescence imaging and Raman imaging methods. Visualization of the nanodiamond in cells allows comparison of the internalization for diamond nanoparticles in cancer A549 cell, non-cancer HFL-1, and Beas-2b cells. The dose-dependent and time-dependent behavior of nanodiamond uptake is observed in both cancer as well as non-cancer cells. The mechanism of nanodiamond uptake by cancer and non-cancer cells is analyzed by blocking different pathways. The uptake of nanodiamond in both cancer and non-cancer cells was found predominantly via clathrin-dependent endocytosis. In spite of observed similarity in the uptake mechanism for cancer and non-cancer cells, the nanodiamond uptake for cancer cell quantitatively exceeds the uptake for non-cancer cells, for the studied cell lines. The observed difference in internalization of nanodiamond by cancer and non-cancer cells is discussed

Study on kinetics of glucose uptake by some species of plankton

Science.gov (United States)

Li, Wenquan; Wang, Xian; Zhang, Yaohua

1993-03-01

The rates of glucose uptake by some species of plankton were determined by3H-glucose tracer method. Experimental results indicated that the observed glucose uptake at natural seawater concentrations by Platymonas subcordiformis and Brachionus plicatilis was principally a metabolic process fitted with the Michaelis-Menten equation in the range of adaptive temperatures. Heterotrophic uptake by Platymonas subcordiformis was mainly dependent on diffusion at high glucose levels. The uptake by Brachionus plicatilis showed active transport even at high glucose levels, indicating its high heterotrophic activity. The uptake rate by Artemia salina was lower, and its V m/K ratio was lower than those of the other two species of plankton.

Uptake and accumulation of lead by plants from the Bo Ngam lead mine area in Thailand

International Nuclear Information System (INIS)

Rotkittikhun, P.; Kruatrachue, M.; Chaiyarat, R.; Ngernsansaruay, C.; Pokethitiyook, P.; Paijitprapaporn, A.; Baker, A.J.M.

2006-01-01

A field survey of terrestrial plants growing on Bo Ngam lead mine area, Thailand, was conducted to identify species accumulating exceptionally high concentrations of lead. Plant and soil samples were collected from five areas. Lead concentrations in surface soil ranged from 325 to 142 400 mg/kg. The highest lead concentration in soil was found at the ore dressing plant area and lowest at a natural pond area. In different areas, the concentrations of lead in plants were different when comparing various study sites. A total of 48 plant species belonging to 14 families were collected from five sampling sites. Twenty-six plant species had lead concentrations more than 1000 mg/kg in their shoots. Three species (Microstegium ciliatum, Polygala umbonata, Spermacoce mauritiana) showed extremely high lead concentrations in their shoots (12 200-28 370 mg/kg) and roots (14 580-128 830 mg/kg). - Uptake and accumulation of lead by plants

Toward a transport-based analysis of nutrient spiraling and uptake in streams

Science.gov (United States)

Runkel, Robert L.

2007-01-01

Nutrient addition experiments are designed to study the cycling of nutrients in stream ecosystems where hydrologic and nonhydrologic processes determine nutrient fate. Because of the importance of hydrologic processes in stream ecosystems, a conceptual model known as nutrient spiraling is frequently employed. A central part of the nutrient spiraling approach is the determination of uptake length (SW), the average distance traveled by dissolved nutrients in the water column before uptake. Although the nutrient spiraling concept has been an invaluable tool in stream ecology, the current practice of estimating uptake length from steady-state nutrient data using linear regression (called here the "SW approach") presents a number of limitations. These limitations are identified by comparing the exponential SW equation with analytical solutions of a stream solute transport model. This comparison indicates that (1) SW, is an aggregate measure of uptake that does not distinguish between main channel and storage zone processes, (2) SW, is an integrated measure of numerous hydrologie and nonhydrologic processes-this process integration may lead to difficulties in interpretation when comparing estimates of SW, and (3) estimates of uptake velocity and areal uptake rate (Vf and U) based on S W, are not independent of system hydrology. Given these findings, a transport-based approach to nutrient spiraling is presented for steady-state and time-series data sets. The transport-based approach for time-series data sets is suggested for future research on nutrient uptake as it provides a number of benefits, including the ability to (1) separately quantify main channel and storage zone uptake, (2) quantify specific hydrologic and nonhydrologic processes using various model parameters (process separation), (3) estimate uptake velocities and areal uptake rates that are independent of hydrologic effects, and (4) use short-term, non-plateau nutrient additions such that the effects of

{sup 18}F-FDG uptake on PET in primary mediastinal non-thymic neoplasm: A clinicopathological study

Energy Technology Data Exchange (ETDEWEB)

Kaira, Kyoichi, E-mail: kkaira1970@yahoo.co.jp [Division of Thoracic Oncology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Abe, Masato [Division of Pathology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Nakagawa, Kazuo; Ohde, Yasuhisa; Okumura, Takehiro [Division of Thoracic Surgery, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Takahashi, Toshiaki; Murakami, Haruyasu; Shukuya, Takehito; Kenmotsu, Hirotsugu; Naito, Tateaki [Division of Thoracic Oncology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Hayashi, Isamu [Division of Pathology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Oriuchi, Noboru [Department of Diagnostic Radiology and Nuclear medicine, Gunma University Graduate School of Medicine, Showa-machi, Maebashi 371-8511, Gunma (Japan); Endo, Masahiro [Division of Diagnostic Radiology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Kondo, Haruhiko [Division of Thoracic Surgery, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Nakajima, Takashi [Division of Pathology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan); Yamamoto, Nobuyuki [Division of Thoracic Oncology, Shizuoka Cancer Center, 1007 Shimonagakubo Nagaizumi-cho, Sunto-gun, Shizuoka 411-8777 (Japan)

2012-09-15

Background: The usefulness of 2-[{sup 18}F]-fluoro-2-deoxy-D-glucose ({sup 18}F-FDG) positron emission tomography (PET) has been investigated in thymic epithelial tumors. However, little is known about PET imaging of {sup 18}F-FDG in primary non-thymic mediastinal neoplasms. The aim of this study is to explore the clinicopathological significance of {sup 18}F-FDG PET in primary mediastinal (non-thymic) neoplasms. Methods: Twenty-one patients with mediastinal neoplasms who underwent {sup 18}F-FDG PET before treatment were included in this study. Tumor sections were stained by immunohistochemistry for glucose transporter 1 (Glut1); glucose transporter 3 (Glut3); hypoxia-inducible factor-1 alpha (HIF-1α); hexokinase I; vascular endothelial growth factor (VEGF); microvessels (CD34); epidermal growth factor receptor (EGFR); Akt/mTOR signaling pathway (p-Akt and p-mTOR); cell cycle control (p53). Results: Seventeen of 21 patients were imaged on PET system using {sup 18}F-FDG, but 4 patients with a histology of cyst showed nothing abnormal in PET scans. The histology of the resected tumors was as follows: 6 schwannoma, 3 teratoma, 4 cyst, 3 sarcoma, 1 undifferentiated carcinoma, 1 seminoma, 1 mediastinal goiter, 1 ganglioneuroma, and 1 Hodgkin lymphoma. {sup 18}F-FDG uptake was significantly correlated with Glut1, HIF-1α, EGFR, p-Akt and p-S6K. These biomarkers were highly expressed in schwannoma, teratoma and high grade malignancies, whereas all patients with cyst and ganglioneuroma had no positive expression of these biomarkers. High uptake of {sup 18}F-FDG was significant associated with Glut1, VEGF, EGFR, p-Akt, p-S6K and tumor maximal size. Conclusion: The amount of {sup 18}F-FDG uptake in primary mediastinal non-thymic neoplasms is determined by the presence of glucose metabolism (Glut1), hypoxia (HIF-1α) and upstream components of HIF-1α (EGFR, p-Akt and p-S6K)

Uptake of americium-241 by algae and bacteria

Energy Technology Data Exchange (ETDEWEB)

Giesy, Jr, J P; Paine, D [Savannah River Ecology Lab., Aiken, S.C. (USA)

1978-01-01

The uptake of americium by three algae, Scenedesmus obliguus, Selenastrum capricomutum and Chlorella pyrenosdosa and a bacterium Aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. It is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am /sup 241/ in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites.

Seven years after Chernobyl

International Nuclear Information System (INIS)

Siwicki, R.

1993-01-01

The paper contains information of the WHO about the state of public health in Russia, Ukraine and Belarus seven years after the Chernobyl accident. The results of medical investigations obtained after two years run of IPHECA project have been also presented

Notes on the physiology of Hg uptake by the kidney

International Nuclear Information System (INIS)

Raynaud, C.

1976-01-01

The kidney has many functions of which the best known is excretion, and the purpose of most functional exploration methods is to study the excretion capacity. The Hg uptake test explores another function, the uptake of metals and toxic substances. The uptake process involves an active transport through the peritubular membrane and a concentration inside the kidney cell in a bound or insoluble form. Transfer into the tubular lumen, if any, is quantitatively negligible and appears to be due to neither an active nor a passive transfer. This uptake process may be identified in vivo from the shape of the kidney and urine radioactivity curves, even when excretion and uptake are associated, the former curve rising slowly to a plateau while the latter, very low, also appears to reach a plateau. The kidney and urine 197 HgCl 2 radioactivity curves illustrate this process very well. The 197 Hg uptake fraction at the plateau level has been proposed has a kidney function exploration test, this value being related by a highly significant correlation to other quantitative tests such as inuline and PAH clearances, PAH Tm and urine concentration capacity. In rats the 197 HgCl 2 uptake area has been located, by measurements on dissected nephrons, at the pars recta and to a lesser extent the whole of the proximal convolution [fr

Regulation of Dopamine Uptake by Vasoactive Peptides in the Kidney

Directory of Open Access Journals (Sweden)

N. L. Rukavina Mikusic

2016-01-01

Full Text Available Considering the key role of renal dopamine in tubular sodium handling, we hypothesized that c-type natriuretic peptide (CNP and Ang-(1-7 may regulate renal dopamine availability in tubular cells, contributing to Na+, K+-ATPase inhibition. Present results show that CNP did not affect either 3H-dopamine uptake in renal tissue or Na+, K+-ATPase activity; meanwhile, Ang-(1-7 was able to increase 3H-dopamine uptake and decreased Na+, K+-ATPase activity in renal cortex. Ang-(1-7 and dopamine together decreased further Na+, K+-ATPase activity showing an additive effect on the sodium pump. In addition, hydrocortisone reversed Ang-(1-7-dopamine overinhibition on the enzyme, suggesting that this inhibition is closely related to Ang-(1-7 stimulation on renal dopamine uptake. Both anantin and cANP (4-23-amide did not modify CNP effects on 3H-dopamine uptake by tubular cells. The Mas receptor antagonist, A-779, blocked the increase elicited by Ang-(1-7 on 3H-dopamine uptake. The stimulatory uptake induced by Ang-(1-7 was even more pronounced in the presence of losartan, suggesting an inhibitory effect of Ang-(1-7 on AT1 receptors on 3H-dopamine uptake. By increasing dopamine bioavailability in tubular cells, Ang-(1-7 enhances Na+, K+-ATPase activity inhibition, contributing to its natriuretic and diuretic effects.

Uptake and translocation of imidacloprid, clothianidin and flupyradifurone in seed-treated soybeans.

Science.gov (United States)

Stamm, Mitchell D; Heng-Moss, Tiffany M; Baxendale, Frederick P; Siegfried, Blair D; Blankenship, Erin E; Nauen, Ralf

2016-06-01

Seed treatment insecticides have become a popular management option for early-season insect control. This study investigated the total uptake and translocation of seed-applied [(14) C]imidacloprid, [(14) C]clothianidin and [(14) C]flupyradifurone into different plant parts in three soybean vegetative stages (VC, V1 and V2). The effects of soil moisture stress on insecticide uptake and translocation were also assessed among treatments. We hypothesized that (1) uptake and translocation would be different among the insecticides owing to differences in water solubility, and (2) moisture stress would increase insecticide uptake and translocation. Uptake and translocation did not follow a clear trend in the three vegetative stages. Initially, flupyradifurone uptake was greater than clothianidin uptake in VC soybeans. In V1 soybeans, differences in uptake among the three insecticides were not apparent and unaffected by soil moisture stress. Clothianidin was negatively affected by soil moisture stress in V2 soybeans, while imidacloprid and flupyradifurone were unaffected. Specifically, soil moisture stress had a positive effect on the distribution of flupyradifurone in leaves. This was not observed with the neonicotinoids. This study enhances our understanding of the uptake and distribution of insecticides used as seed treatments in soybean. The uptake and translocation of these insecticides differed in response to soil moisture stress. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

Heterogeneous Uptake of HO2 Radicals onto Atmospheric Aerosols

Science.gov (United States)

George, I. J.; Matthews, P. S.; Brooks, B.; Goddard, A.; Whalley, L. K.; Baeza-Romero, M. T.; Heard, D. E.

2011-12-01

The hydroxyl (OH) and hydroperoxyl (HO2) radicals, together known as HOx, play a vital role in atmospheric chemistry by controlling the oxidative capacity of the troposphere. The atmospheric lifetime and concentrations of many trace reactive species, such as volatile organic compounds (VOCs), are determined by HOx radical levels. Therefore, the ability to accurately predict atmospheric HOx concentrations from a detailed knowledge of their sources and sinks is a very useful diagnostic tool to assess our current understanding of atmospheric chemistry. Several recent field studies have observed significantly lower concentrations of HO2 radicals than predicted using box models, where HO2 loss onto aerosols was suggested as a possible missing sink [1, 2]. However, the mechanism on HO2 uptake onto aerosols and its impact on ambient HOx levels are currently not well understood. To improve our understanding of this process, we have conducted laboratory experiments to measure HO2 uptake coefficients onto submicron aerosol particles. The FAGE (Fluorescence Assay by Gas Expansion) technique, a highly sensitive laser induced fluorescence based detection method, was used to monitor HO2 uptake kinetics onto aerosol particles in an aerosol flow tube. The application of the FAGE technique allowed for kinetic experiments to be performed under low HO2 concentrations, i.e. [HO2] atomizing dilute salt solutions or by homogeneous nucleation. HO2 uptake coefficients (γ) have been measured for single-component solid and aqueous inorganic salt and organic aerosol particles with a wide range of hygroscopicities. HO2 uptake coefficients on solid particles were below the detection limit (γ < 0.001), whereas on aqueous aerosols uptake coefficients were somewhat larger (γ = 0.001 - 0.008). HO2 uptake coefficients were highest on aerosols containing metal ions, such as Cu and Fe. Humidity and aerosol pH did not significantly impact the reactive HO2 uptake. Preliminary experiments have also

Seven Deadliest Wireless Technologies Attacks

CERN Document Server

Haines, Brad

2010-01-01

How can an information security professional keep up with all of the hacks, attacks, and exploits? One way to find out what the worst of the worst are is to read the seven books in our Seven Deadliest Attacks Series. Not only do we let you in on the anatomy of these attacks but we also tell you how to get rid of them and how to defend against them in the future. Countermeasures are detailed so that you can fight against similar attacks as they evolve. Attacks featured in this book include:Bluetooth AttacksCredit Card, Access Card, and Passport AttacksBad Encryption

Whole-body cryostimulation and oxidative stress in rowers: the preliminary results.

Science.gov (United States)

Wozniak, Alina; Mila-Kierzenkowska, Celestyna; Szpinda, Michał; Chwalbinska-Moneta, Jolanta; Augustynska, Beata; Jurecka, Alicja

2013-04-20

The effect of whole-body cryostimulation (WBC) on the biomarkers of oxidative stress, lysosomal enzymes, creatine kinase and cortisol was studied. The rowers underwent two 6-day training cycles: with pre-training daily WBC (temperature: from -125°C to -150°C) and without cryostimulation (control). Blood samples were taken before and after the third and sixth day of training. The activity of superoxide dismutase and glutathione peroxidase was lower (by 44% and 42%, respectively) after the third day of training with WBC than without WBC. The concentration of lipid peroxidation products was also lower after the training preceded by WBC. Moreover, the acid phosphatase activity was 50% lower after the third day of training with WBC than training without WBC. Considering the antioxidant enzymes activity during training without WBC, the increase of superoxide dismutase and glutathione peroxidase activity was observed after the third day of training (by about 74% and 100%, respectively). The level of lipid peroxidation products also increased after the training without WBC. No statistically significant changes were observed in creatine kinase activity after the training preceded with WBC, while after the training without WBC activity of this enzyme was two-fold higher than before the training. The use of WBC prior to training may reduce the risk of oxidative stress and the extent of muscle fibre injuries provoked by intense exercise. The WBC seems to be an effective and safe method for limiting exercise-induced damage; thus it may be used in biological regeneration of sportsmen.

Thyroid Scan and Uptake

Science.gov (United States)

... type your comment or suggestion into the following text box: Comment: E-mail: Area code: Phone no: ... of a typical probe counter used for thyroid uptake exams. The patient sits with the camera directed at the neck for five minutes, and then the leg for ...

Seven durable ideas.

Science.gov (United States)

Glaser, John P

2008-01-01

Partners Healthcare, and its affiliated hospitals, have a long track record of accomplishments in clinical information systems implementations and research. Seven ideas have shaped the information systems strategies and tactics at Partners; centrality of processes, organizational partnerships, progressive incrementalism, agility, architecture, embedded research, and engage the field. This article reviews the ideas and discusses the rationale and steps taken to put the ideas into practice.

Microbial uptake of uranium, cesium, and radium

Energy Technology Data Exchange (ETDEWEB)

Strandberg, G.W.; Shumate, S.E. II; Parrott, J.R. Jr.; McWhirter, D.A.

1980-01-01

The ability of diverse microbial species to concentrate uranium, cesium, and radium was examined. Saccharomyces cerevisiae, Pseudomonas aeruginosa, and a mixed culture of denitrifying bacteria accumulated uranium to 10 to 15% of the dry cell weight. Only a fraction of the cells in a given population had visible uranium deposits in electron micrographs. While metabolism was not required for uranium uptake, mechanistic differences in the metal uptake process were indicated. Uranium accumulated slowly (hours) on the surface of S. cerevisiae and was subject to environmental factors (i.e., temperature, pH, interfering cations and anions). In contrast, P. aeruginosa and the mixed culture of denitrifying bacteria accumulated uranium rapidly (minutes) as dense, apparently random, intracellular deposits. This very rapid accumulation has prevented us from determining whether the uptake rate during the transient between the initial and equilibrium distribution of uranium is affected by environmental conditions. However, the final equilibrium distributions are not affected by those conditions which affect uptake by S. cerevisiae. Cesium and radium were concentrated to a considerably lesser extent than uranium by the several microbial species tested. The potential utility of microorganisms for the removal and concentration of these metals from nuclear processing wastes and several bioreactor designs for contacting microorganisms with contaminated waste streams will be discussed.

Gallium-67-labeled lactam bridge-cyclized alpha-MSH peptides with enhanced melanoma uptake and reduced renal uptake.

Science.gov (United States)

Guo, Haixun; Gallazzi, Fabio; Miao, Yubin

2012-06-20

The purpose of this study was to examine the melanoma targeting and pharmacokinetic properties of (67)Ga-DOTA-GGNle-CycMSHhex {(67)Ga-1,4,7,10-tetraazacyclononane-1,4,7,10-tetraacetic acid-Gly-Gly-Nle-c[Asp-His-DPhe-Arg-Trp-Lys]-CONH2} and (67)Ga-NOTA-GGNle-CycMSHhex {(67)Ga-1,4,7-triazacyclononane-1,4,7-triacetic acid-Gly-Gly-Nle-c[Asp-His-DPhe-Arg-Trp-Lys]-CONH2} and compare with (67)Ga-DOTA-GlyGlu-CycMSH {(67)Ga-DOTA-Gly-Glu-c[Lys-Nle-Glu-His-DPhe-Arg-Trp-Gly-Arg-Pro-Val-Asp]} we previously reported. DOTA-GGNle-CycMSHhex and NOTA-GGNle-CycMSHhex were synthesized using fluorenylmethyloxy carbonyl (Fmoc) chemistry. The melanocortin-1 (MC1) receptor binding affinity of NOTA-GGNle-CycMSHhex was determined in B16/F1 melanoma cells and compared with DOTA-GGNle-CycMSHhex. The melanoma targeting and pharmacokinetic properties of (67)Ga-NOTA-GGNle-CycMSHhex and (67)Ga-DOTA-GGNle-CycMSHhex were determined in B16/F1 melanoma-bearing C57 mice. NOTA-GGNle-CycMSHhex and DOTA-GGNle-CycMSHhex displayed comparable MC1 receptor binding affinities (1.6 vs 2.1 nM) in B16/F1 melanoma cells. Both (67)Ga-NOTA-GGNle-CycMSHhex and (67)Ga-DOTA-GGNle-CycMSHhex exhibited dramatically enhanced melanoma uptake and reduced renal uptake than (67)Ga-DOTA-GlyGlu-CycMSH in B16/F1 melanoma-bearing C57 mice. Furthermore, (67)Ga-NOTA-GGNle-CycMSHhex exhibited more favorable radiolabeling conditions (>85% radiolabeling yields started at 37 °C), as well as higher tumor/kidney uptake ratios than (67)Ga-DOTA-GGNle-CycMSHhex at 0.5, 2, and 24 h postinjection. High melanoma uptake coupled with low renal uptake highlighted the potential of (67)Ga-NOTA-GGNle-CycMSHhex for melanoma imaging and therapy.

Dependence of mitochondrial coenzyme A uptake on the membrane electrical gradient

International Nuclear Information System (INIS)

Tahiliani, A.G.

1989-01-01

Coenzyme A (CoA) transport was studied in isolated rat heart mitochondria. Uptake of CoA was assayed by determining [3H]CoA associated with mitochondria under various conditions. Various oxidizable substrates including alpha-ketoglutarate, succinate, or malate stimulated CoA uptake. The membrane proton (delta pH) and electrical (delta psi) gradients, which dissipated with time in the absence of substrate, were maintained at their initial levels throughout the incubation in the presence of substrate. Addition of phosphate caused a concentration-dependent decrease of both delta pH and CoA uptake. Nigericin also dissipated the proton gradient and prevented CoA uptake. Valinomycin also prevented CoA uptake into mitochondria. Although the proton gradient was unaffected, the electrical gradient was completely abolished in the presence of valinomycin. Addition of 5 mM phosphate 10 min after the start of incubation prevented further uptake of CoA into mitochondria. A rapid dissipation of the proton gradient upon addition of phosphate was observed. Addition of nigericin or valinomycin 10 min after the start of incubation also resulted in no further uptake of CoA into with mitochondria; valinomycin caused an apparent efflux of CoA from mitochondria. Uptake was found to be sensitive to external pH displaying a pH optimum at pHext 8.0. Although nigericin significantly inhibited CoA uptake over the pHext range of 6.75-8, maximal transport was observed around pHext 8.0-8.25. Valinomycin, on the other hand, abolished transport over the entire pH range. The results suggest that mitochondrial CoA transport is determined by the membrane electrical gradient. The apparent dependence of CoA uptake on an intact membrane pH gradient is probably the result of modulation of CoA transport by matrix pH

Bounding the heterogeneous gas uptake on aerosols and ground using resistance model

Science.gov (United States)

Su, H.; Li, M.; Cheng, Y.

2017-12-01

Heterogeneous uptake on aerosols and ground are potential important atmospheric sinks for gases. Different schemes have been used to characterize the dry deposition and heterogeneous aerosol gas uptake, although they share similar characteristics. In this work, we propose a unified resistance model to compare the uptake flux on both ground and aerosols, to identify the dominate heterogeneous process within the planetary boundary layer (PBL). The Gamma(eq) is introduced to represent the reactive uptake coefficient on aerosols when these two processes are equally important. It's shown that Gamma(eq) is proportional to the dry deposition velocity, inversely proportional to aerosol surface area concentration. Under typical regional background condition, Gamma(eq) vary from 1x10-5 to 4x10-4 with gas species, land-use type and season, which indicates that aerosol gas uptake should be included in atmospheric models when uptake coefficient higher than 10-5. We address the importance of heterogeneous gas uptake on aerosols over ground especially for ozone uptake on liquid organic aerosols and for marine PBL atmosphere.

Mechanisms of Hg(II) uptake and methylation in methylating bacteria

Energy Technology Data Exchange (ETDEWEB)

Morel, Francois M. M. [Princeton Univ., NJ (United States). Geosciences

2016-10-14

The goal of this project was to understand the critical factors which control the availability and transport of Hg(II) into cells, a first step in the production of the neurotoxin, methylmercury. Specifically, this research focused on understanding the mechanism of bacterial mercury uptake and how mercury speciation affects the specificity and kinetics of mercury transport. Our research has shown that Hg(II) uptake in three different iron and sulfate-reducing proteobacteria occurs by the following mechanism (1) : Hg(II) uptake is an active transport process requiring energy, (2) it is dependent upon the structure of the Hg binding ligand, and (3) it is mediated by a heavy metal transporter such as one which transports the essential metal, Zn(II). In order to determine whether this mechanism extends to more diverse phylogenetic groups, we have begun examining Hg(II) uptake and bioavailability in two representative Hg methylating strains within the Firmicutes. These organisms have remarkably different membrane structures distinct from the Proteobacteria. Our results show low uptake rates in these two species of Firmicutes relative to the previously characterized Proteobacteria. This may explain the low methylation rates and yields observed in these organisms. Most surprisingly, however, these organisms appear to take up Hg(II) passively, as the addition of a protonophore failed to reduce Hg(II) uptake in these organisms. This is quite different to what has been observed previously for the Proteobacteria and suggests a different mechanism for Hg(II) uptake in the Firmicutes. We are continuing to understand and describe Hg(II) uptake in these organisms. A manuscript is expected to be submitted on this research in June 2016.

SEAPOWER: A GUIDE FOR THE TWENTY- FIRST CENTURY

African Journals Online (AJOL)

Abel

$154,37 (amazon.com hardback). With the publication of Seapower: A Guide for the Twenty-First Century. Geoffrey Till has set the standard for publications on all things maritime. The updated and expanded new edition of the book is an essential guide for students of naval history and maritime strategy and provides ...

Variation in summer nitrogen and phosphorus uptake among Siberian headwater streams

Directory of Open Access Journals (Sweden)

John D. Schade

2016-06-01

Full Text Available Arctic streams are likely to receive increased inputs of dissolved nutrients and organic matter from thawing permafrost as climate warms. Documenting how Arctic streams process inorganic nutrients is necessary to understand mechanisms that regulate watershed fluxes of permafrost-derived materials to downstream ecosystems. We report on summer nitrogen (N and phosphorus (P uptake in streams draining upland soils from the Pleistocene, and lowland floodplain soils from the Holocene, in Siberia's Kolyma River watershed. Uptake of N and P differed between upland and floodplain streams, suggesting topographic variation in nutrient limitation. In floodplain streams, P uptake rate and uptake velocity were higher than N, while upland streams had similar values for all N and P uptake metrics. Phosphorus uptake velocity and size of the transient hydrologic storage zone were negatively related across all study streams, indicating strong influence of hydrologic processes on nutrient fluxes. Physical sorption of P was higher in floodplain stream sediments relative to upland stream sediments, suggesting more physically driven uptake in floodplain streams and higher biological activity in upland streams. Overall, these results demonstrate that high-latitude headwater streams actively retain N and P during summer base flows; however, floodplain and upland streams varied substantially in N and P uptake and may respond differently to inorganic nutrient and organic matter inputs. Our results highlight the need for a comprehensive assessment of N and P uptake and retention in Arctic streams in order to fully understand the impact of permafrost-derived materials on ecosystem processes, and their fate in continental drainage networks.

Uptake of [18F]fluorodeoxyglucose in human monocyte-macrophages in vitro

International Nuclear Information System (INIS)

Deichen, Jan Thiess; Prante, Olaf; Gack, Michaela; Schmiedehausen, Kristin; Kuwert, Torsten

2003-01-01

The fact that fluorine-18 fluorodeoxyglucose ([ 18 F]FDG) accumulates in inflammatory lesions as well as in tumours reduces the diagnostic specificity of positron emission tomography (PET) in oncology. The aim of this study was to characterise the uptake of [ 18 F]FDG in isolated human monocyte-macrophages (HMMs) in vitro in comparison with that in human glioblastoma (GLI) and pancreatic carcinoma cells (PAN). The purity of HMM preparations was determined by immunohistochemical staining and their functional integrity was assessed by long-term incubation with iodine-131 acetylated bovine serum albumin. [ 18 F]FDG uptake in HMMs was quantified as percent of whole [ 18 F]FDG activity per well (% ID) or as % ID in relation to total protein mass. [ 18 F]FDG uptake in HMMs significantly increased with culture duration, yielding 7.5%±0.9% (% ID/100 μg) at day 14. Stimulation by lipopolysaccharide further enhanced [ 18 F]FDG uptake in HMMs by a factor of 2. [ 18 F]FDG uptake significantly decreased with increasing glucose concentration in the medium. Radio-thin layer chromatography of intracellular metabolites revealed that [ 18 F]FDG was trapped by HMMs mainly as [ 18 F]FDG-6-phosphate and [ 18 F]FDG-1,6-diphosphate. [ 18 F]FDG uptake was in the range of uptake values measured in GLI and PAN. By accumulating [ 18 F]FDG in a manner analogous to uptake by tumour cells, activated HMMs may contribute to the [ 18 F]FDG uptake values measured by PET in neoplasms. (orig.)

Incidental colonic focal FDG uptake on PET/CT: can the maximum standardized uptake value (SUVmax) guide us in the timing of colonoscopy?

NARCIS (Netherlands)

van Hoeij, F. B.; Keijsers, R. G. M.; Loffeld, B. C. A. J.; Dun, G.; Stadhouders, P. H. G. M.; Weusten, B. L. A. M.

2015-01-01

In patients undergoing F-18-FDG PET/CT, incidental colonic focal lesions can be indicative of inflammatory, premalignant or malignant lesions. The maximum standardized uptake value (SUVmax) of these lesions, representing the FDG uptake intensity, might be helpful in differentiating malignant from

Efficacy of SPECT over planar bone scan in the diagnosis of solitary vertebral lesions in patients with low back pain

International Nuclear Information System (INIS)

Sudhakar, Pushpalatha; Bhushan, Shanti M.; Ranadhir, G.; Prabhakar Rao, V.V.S.; Sharma, Anshu Rajnish; Narsimuhulu, G.

2010-01-01

The purpose of our study has been to evaluate the efficacy of single photon emission computed tomography (SPECT) over planar bone scan in identifying solitary vertebral lesions in patients with low backache and its ability to differentiate various pathologies according to the uptake pattern. Materials and Methods: The study included twenty patients out of whom six patients presented with known carcinoma and fourteen patients with low back pain. SPECT was done in all following planar skeletal survey. Benign and malignant lesions were identified according to the uptake pattern in vertebral elements, based on Gary F. Gates observations. Final diagnosis was obtained by means of biopsy or correlation with radiograph or computed tomography (CT) or magnetic resonance imaging (MRI), and/or follow up. Results: SPECT detected additional 30% of solitary vertebral lesions that were obscured on planar scan. Seven out of twenty were localized in anterior vertebral body and were diagnosed as benign ostophytes in six and osteoma in one substantiating the previous observations. Out of six cases of known carcinoma, three were having solitary metastases and showed posterior vertebral body uptake with pedicle involvement. SPECT could localize specific lesions as source of pain in eleven patients with low back pain (78%) and identified various etiologies including benign tumors (osteoid osteoma and osteoma), facet arthritis, discitis, transverse process fractures and spondylolysis. Conclusion: Our study highlighted the higher diagnostic value of SPECT over planar skeletal scintigraphy in localizing solitary vertebral lesions in low backache patients. Based on SPECT pattern, malignant and benign lesions could be differentiated in the given clinical context. (author)

An analysis of the physiological FDG uptake pattern in the stomach

International Nuclear Information System (INIS)

Koga, Hirofumi; Kuwabara, Yasuo; Hiraka, Kiyohisa; Nakagawa, Makoto; Abe, Koichiro; Kaneko, Koichiro; Hayashi, Kazutaka; Honda, Hiroshi; Sasaki, Masayuki

2003-01-01

The purpose of this study was to clarify the normal gastric FDG uptake pattern to provide basic information to make an accurate diagnosis of gastric lesions by FDG PET. We examined 22 cases, including 9 of malignant lymphoma, 8 of lung cancer, 2 of esophageal cancer, and 3 of other malignancies. No gastric lesions were observed in any of the 22 cases on upper gastrointestinal examinations using either barium meal or endoscopic techniques. The intervals between FDG PET and the gastrointestinal examination were within one week in all cases. The stomach regions were classified into the following three areas: U (upper)-area, M (middle)-area, and L (lower)-area. The degree of FDG uptake in these three gastric regions was qualitatively evaluated by visual grading into 4 degrees, and then a semiquantitative evaluation was carried out using the standardized uptake value (SUV). Based on a visual grading evaluation, the mean FDG uptake score in the U-, M-, and L-areas was 1.14±0.96, 0.82±0.96, and 0.36±0.49 (mean±S.D.), respectively. The FDG uptake scores obtained in the three areas were significantly different (Friedman test, p M>L. In conclusion, the physiological gastric FDG uptake was significantly higher at the oral end. A stronger gastric FDG uptake at the anal end may therefore be suggestive of a pathological uptake. (author)

Urological indications of Hg uptake in adults

International Nuclear Information System (INIS)

Jardin, A.

1976-01-01

The circumstances motivating the mercury bichloride uptake study of the kidney are specified: choice between excision and conservation surgery; estimation of the benefits of conservation surgical operations on the kidney or its excretion passage; estimation of the degree of compensative kidney hypertrophy in unilateral diseases or after nephrectomy. The urinary disorders for which mercury bichloride uptake is particularly suitable are also listed: acquires and congenital bilateral diseases of the excretion passage; hydronephrosis; complex lithiases [fr

Twenty-first century vaccines

Science.gov (United States)

Rappuoli, Rino

2011-01-01

In the twentieth century, vaccination has been possibly the greatest revolution in health. Together with hygiene and antibiotics, vaccination led to the elimination of many childhood infectious diseases and contributed to the increase in disability-free life expectancy that in Western societies rose from 50 to 78–85 years (Crimmins, E. M. & Finch, C. E. 2006 Proc. Natl Acad. Sci. USA 103, 498–503; Kirkwood, T. B. 2008 Nat. Med 10, 1177–1185). In the twenty-first century, vaccination will be expected to eliminate the remaining childhood infectious diseases, such as meningococcal meningitis, respiratory syncytial virus, group A streptococcus, and will address the health challenges of this century such as those associated with ageing, antibiotic resistance, emerging infectious diseases and poverty. However, for this to happen, we need to increase the public trust in vaccination so that vaccines can be perceived as the best insurance against most diseases across all ages. PMID:21893537

Vesico-vaginal fistula repair: experience with first twenty-three ...

African Journals Online (AJOL)

Vesico-vaginal fistula repair: experience with first twenty-three patients seen at a tertiary hospital in north-central Nigeria. Stephen D. Ngwan, Bassey E. Edem, Ajen S. Anzaku, Barnabas A. Eke, Mohammed A. Shittu, Solomon A. Obekpa ...

Clinical evaluation of 67Ga-citrate uptake in the hilar areas

International Nuclear Information System (INIS)

Kubota, Hisashi; Komatani, Akio; Watarai, Jiro; Yamaguchi, Koichi; Takamiya, Makoto.

1983-01-01

In the last 4 years 67 Ga-citrate scans had been performed at our department in 914 patients with various diseases. Out of these, 173 showed 67 Ga uptake of varied degree and patterns in the hilar areas. The clinical records of the 173 patients were reviewed to clarify the significance of the hilar uptake. The results were as follows : 1. On a routine 67 Ga-citrte scintigraphy, physiological hilar uptake may be seen in any disease. 2. Bilateral symmetrical hilar 67 Ga accumulation revealed no pathological significance in most cases. Such a 67 Ga uptake might be said as physiological even in the patients with malignancy, if any pathological findings in the both hila could not be noted on the chest film. Degree of the hilar uptake does not contribute much in differentiation between physiological uptake and abnormal one. 3. Primary lung cancer or metastatic lymph node from any origin at the hilar region demonstrated large and definite accumulation. Even if bilateral hilar uptake was noted in these cases, smaller and lower accumulation of the unaffected side might be diagnosed as physiological. (author)

Estimation of 123I-metaiodobenzylguanidine lung uptake in heart and lung diseases. With reference to lung uptake ratio and decrease of lung uptake

International Nuclear Information System (INIS)

Fujii, Tadashige; Tanaka, Masao; Yazaki, Yoshikazu; Kitabayashi, Hiroshi; Koizumi, Tomonori; Sekiguchi, Morie; Gomi, Tsutomu; Yano, Kesato; Itoh, Atsuko.

1997-01-01

123 I-metaiodobenzylguanidine (MIBG) myocardial scintigraphy was performed in 64 patients with heart and lung diseases. Distribution of MIBG in the chest was evaluated by planar images, using counts ratios of the heart to the mediastinum (H/M) and the unilateral lung to the mediastinum (Lu/M). Most of patients with heart diseases showed obvious lung uptake of MIBG. The ratios of H/M were 1.75±0.20 in the group without heart failure and 1.55±0.19 in the group with heart failure. The ratios of Lu/M in the right and left lung were 1.56±0.16 and 1.28±0.16 in the group without heart failure. And those were 1.45±0.16 and 1.19±0.15 in the group with heart failure. But 3 patients complicated with chronic pulmonary emphysema and one patient with interstitial pneumonia due to dermatomyositis showed markedly decreased lung uptake. The ratios of Lu/M in the right and left lung of these patients were 1.20, 1.17; 1.17, 1.13; 1.01, 0.97 and 1.27, 0.94, respectively. These results suggest that the lung uptake of MIBG may reflect the state of pulmonary endothelial cell function in clinical situations, considering that it has been demonstrated that MIBG may be useful as a marker of pulmonary endothelial cell function in the isolated rat lung. (author)

Further advances in modeling transdermal uptake of SVOCs

DEFF Research Database (Denmark)

Morrison, Glenn; Weschler, Charles J.; Bekö, Gabriel

2016-01-01

the overall resistance to uptake of SVOCs from air but also allows for more rapid release of SVOCs to sinks like clothing or clean air. We compare the model results to reported experimental uptake of di-ethyl phthalate (DEP) and di-n-butyl phthalate (DnBP), normalized by exposed skin area and the phthalate...

Uptake of uranium from sea water by Synechococcus elongatus

International Nuclear Information System (INIS)

Horikoshi, Takao; Nakajima, Akira; Sakaguchi, Takashi

1979-01-01

Basic features of the uranium uptake by Synechococcus elongatus, and the factors affecting it were examined. Synechococcus elongatus was grown in Roux flasks containing 1 liter of culture solution in light (20,000 lux) and with aeration at 30 deg C. Synechococcus cells in the linear growth phase were collected by centrifugation at 6,000 x g for 5 minutes, washed with sea water, and used for the uranium-uptake experiments. The uptake of uranium from sea water containing 1 ppm of the element was strongly affected by the pH of sea water. The optimum uptake was at pH 5. Presence of carbonate ions markedly inhibited and decarbonation of sea water greatly enhanced the uptake. Absorption of uranium by Synechococcus cells was initially rapid, and reached a plateau within 24 hours. The uranium accumulation capacity of Synechococcus cells was increased by heat treatment, the capacity of scalded cells being about twice as much as that of living cells. Most of the uranium absorbed by Synechococcus was found in the inner space of the cells, and only a small amount was present in the cell walls. (Kaihara, S.)

Channel-mediated and carrier-mediated uptake of K+ into cultured ovine oligodendrocytes

Energy Technology Data Exchange (ETDEWEB)

Hertz, L.; Soliven, B.; Hertz, E.; Szuchet, S.; Nelson, D.J. (Univ. of Saskatchewan, Saskatoon (Canada))

1990-01-01

Uptake of radioactive K+ by mature ovine oligodendrocytes (OLGs) maintained in primary culture was measured under steady-state conditions, i.e., in cells maintained in a normal tissue culture medium (5.4 mM K+), and in cells after depletion of intracellular K+ to less than 15% of its normal value by pre-incubation in K(+)-free medium. The latter value is dominated by an active, carrier-mediated uptake (although it may include some diffusional uptake), whereas the former, in addition to active uptake, also reflects passive K+ diffusion through ion selective channels and possible self-exchange between extracellular and intracellular K+, which may be carrier-mediated. The total uptake rate was 144 +/- 10 nmol/min/mg protein, and the uptake after K+ depletion was 60 +/- 2 nmol/min/mg protein, much lower rates than previously observed in astrocytes. The uptake into K(+)-depleted cells was inhibited by about 80% in the presence of ouabain (1 mM) and about 30% in the presence of furosemide (2 mM). Activators of protein kinase C (phorbol esters) and cAMP-dependent protein kinase (forskolin) have been shown to alter the myelinogenic metabolism as well as outward K+ current in cultured OLGs. The present study demonstrates that K+ homeostasis in OLGs is modulated through similar second messenger pathways. Active uptake was inhibited by about 60% in the presence of active phorbol esters (100 nM) but was not affected by forskolin (100 nM). Forskolin likewise had no effect on total uptake, whereas phorbol esters caused a much larger inhibition than expected from their effect on carrier-mediated uptake alone, suggesting that channel-mediated uptake was also reduced.

Deformation quantization: Twenty years after

International Nuclear Information System (INIS)

Sternheimer, Daniel

1998-01-01

We first review the historical developments, both in physics and in mathematics, that preceded (and in some sense provided the background of) deformation quantization. Then we describe the birth of the latter theory and its evolution in the past twenty years, insisting on the main conceptual developments and keeping here as much as possible on the physical side. For the physical part the accent is put on its relations to, and relevance for, 'conventional' physics. For the mathematical part we concentrate on the questions of existence and equivalence, including most recent developments for general Poisson manifolds; we touch also noncommutative geometry and index theorems, and relations with group theory, including quantum groups. An extensive (though very incomplete) bibliography is appended and includes background mathematical literature

Isopycnal mixing by mesoscale eddies significantly impacts oceanic anthropogenic carbon uptake

Science.gov (United States)

Gnanadesikan, Anand; Pradal, Marie-Aude; Abernathey, Ryan

2015-06-01

Anthropogenic carbon dioxide uptake varies across Earth System Models for reasons that have remained obscure. When varied within a single model, the lateral eddy mixing coefficient ARedi produces a range of uptake similar to the modeled range. The highest uptake, resulting from a simulation with a constant ARedi of 2400 m2/s, simulates 15% more historical carbon uptake than a model with ARedi = 400 m2/s. A sudden doubling in carbon dioxide produces a 21% range in carbon uptake across the models. Two spatially dependent representations of ARedi produce uptake that lies in the middle of the range of constant values despite predicting very large values in the subtropical gyres. One-dimensional diffusive models of the type used for integrated assessments can be fit to the simulations, with ARedi accounting for a substantial fraction of the effective vertical diffusion. Such models, however, mask significant regional changes in stratification and biological carbon storage.

Uptake of oxytetracycline and its phytotoxicity to alfalfa (Medicago sativa L.)

International Nuclear Information System (INIS)

Kong, W.D.; Zhu, Y.G.; Liang, Y.C.; Zhang, J.; Smith, F.A.; Yang, M.

2007-01-01

A series of experiments were conducted in a hydroponic system to investigate the uptake of oxytetracycline (OTC) and its toxicity to alfalfa (Medicago sativa L.). OTC inhibited alfalfa shoot and root growth by up to 61% and 85%, respectively. The kinetics of OTC uptake could be well described by Michaelis-Menten equation with V max of 2.25 μmol g -1 fresh weight h -1 , and K m of 0.036 mM. The uptake of OTC by alfalfa was strongly inhibited by the metabolic inhibitor, 2,4-DNP (2,4-dinitrophenol), at pH 3.5 and 6.0, but not by the aquaporin competitors, glycerol and Ag + . OTC uptake, however, was significantly inhibited by Hg 2+ , suggesting that the inhibition of influx was due to general cellular stress rather than the specific action of Hg 2+ on aquaporins. Results from the present study suggested that OTC uptake into alfalfa is an energy-dependent process. - Plant uptake of antibiotic oxytetracycline is energy-dependent

Ensemble learned vaccination uptake prediction using web search queries

DEFF Research Database (Denmark)

Hansen, Niels Dalum; Lioma, Christina; Mølbak, Kåre

2016-01-01

We present a method that uses ensemble learning to combine clinical and web-mined time-series data in order to predict future vaccination uptake. The clinical data is official vaccination registries, and the web data is query frequencies collected from Google Trends. Experiments with official...... vaccine records show that our method predicts vaccination uptake eff?ectively (4.7 Root Mean Squared Error). Whereas performance is best when combining clinical and web data, using solely web data yields comparative performance. To our knowledge, this is the ?first study to predict vaccination uptake...

Uptake of gold nanoparticles in primary human endothelial cells

DEFF Research Database (Denmark)

Klingberg, Henrik; Oddershede, Lene B.; Löschner, Katrin

2015-01-01

Gold nanoparticles (AuNPs) are relevant in nanomedicine for drug delivery in the vascular system, where endothelial cells are the first point of contact. We investigated the uptake of 80 nm AuNPs in primary human umbilical vein endothelial cells (HUVECs) by flow cytometry, 3D confocal microscopy......–3 or more particles. Pre-treatment with chlorpromazine inhibited the AuNP-uptake in HUVECs, indicating that internalisation occurred mainly by clathrin-mediated endocytosis. Cell activation by exposure to tumour necrosis factor or lipopolysaccharide had a slight or no effect on the uptake of Au...

Twenty-one year old female with an iris tumor: a case report

International Nuclear Information System (INIS)

Zettinig, G.; Kurtaran, A.; Dudczak, R.; Maca, S.; Barisani, T.; Horvat, R.

2002-01-01

Full text: A 21-year-old female with multiple granulomas an the right iris with concomitant therapy refractive panuveitis was referred to the Department of Ophthalmology to exclude an ocular malignancy. The patient had a history of minimal change glomerulonephritis and cutaneous granulomas at the age of six years that were successfully treated with cyclophosphamide. Her visual acuity initially already reduced to 30 % decreased rapidly to 'counting fingers'. A clinical work-up including chest x-ray, spiral computed tomography of the lungs and a detailed serological examination including angiotensin converting enzyme showed no evidence of infection or neoplasia. Planar scintigraphy 24 hours after administration of 185 MBq Gallium-67 citrate demonstrated an intense tracer accumulation in both lacrimal glands. Salivary gland uptake was normal and there was only a faint accumulation in the mediastinum interpreted as normal. A biopsy of the right iris revealed a granulomatous non caseating inflammation diagnosed as sarcoidosis. A systemic combination treatment with prednisolone and methotrexate for 4 months could not control the inflammation. After therapy was changed to cyclosporine the inflammation decreased and visual acuity decreased to 60 %. Neither a 'lambda sign' (characteristic uptake of Ga-67 in intrathoracic lymph nodes resembling the Greek letter lambda) nor a typical 'panda sign' (bilateral salivary and lacrimal gland uptake of Ga-67) commonly present in sarcoidosis were seen in our patient. This case demonstrates that in individual patients with sarcoidosis, lacrimal gland uptake of Ga-67 may be the only significant noninvasive finding. (author)

Intestinal uptake of bone seeking radiotracer: possible mechanisms and review of the literature

Energy Technology Data Exchange (ETDEWEB)

Kim, D. W.; Kim, C. G.; Park, S. A.; Chang, J. A. [WonKwang University Hospital, Iksan (Korea, Republic of)

2007-07-01

This study was undertaken to investigate the frequency of intestinal accumulation of Tc-99m 3, 3-diphosphono-1, 2-propanedicarboxylic acid (DPD) on bone scans, describe the patterns of intestinal Tc-99m DPD uptake and discuss the possible mechanisms of this unusual finding. Three thousand, one hundred and ninety-four consecutive patients have been evaluated for intestinal Tc-99m DPD uptake on bone scans. A whole-body bone scan and various spot views were obtained to evaluate the location and intensity of intestinal uptake. Delayed scan and SPECT study were performed to define characteristics of intestinal uptake in some of patients. Available reports of co-relative radiologic imaging, endoscopic studies and laboratory tests were also reviewed to explain the intestinal uptake. Eighteen (9 female, 9 male) patients out of 3194 with a mean age of 57 years showed intestinal Tc-99m DPD uptake. The locations of intestinal uptake were well dispersed throughout the abdomen. The majority of the cases showed lower intensity than iliac spine (12/18, 67%). Eight patients didn't show significant change of uptake characteristics on the delayed images, while intestinal uptake traveled distally in nine patients. Two cases were revealed uptake of peritoneal carcinomatosis with small amount ascites and three cases were revealed tumoral uptake of intestine. Four patients with gastritis showed similar characteristic of intestinal uptake. Six cases of distally traveled intestinal uptake suggested intraluminal Tc-99m DPD activity such as gastrointestinal bleeding. However, stool occult blood tests were negative in three patients, and there is no clinical evidence of gastrointestinal bleeding in other three patients. Intestinal Tc-99m DPD uptake can be observed in 0.5% of bone scans. The mechanism of intestinal uptake is still unclear in some of the patients. Delayed imaging additional spot views and SPECT studies help in the differentiation of this finding from possible

Technetium uptake by Sinapis Alba

International Nuclear Information System (INIS)

Mueller, H.; Ter Meer-Bekk, Ch.

1986-01-01

Transfer factors for pertechnetate uptake was determined for Sinapis Alba cultured hydroponically. For the freshly harvested, undried plants transfer factors were found between 13 and 40 depending on the growth period. (author)

In whole blood, LPS, TNF-alpha and GM-CSF increase monocyte uptake of {sup 99m}technetium stannous colloid but do not affect neutrophil uptake

Energy Technology Data Exchange (ETDEWEB)

Ramsay, Stuart C. [Townsville Nuclear Medicine, Mater Hospital, Pimlico, Queensland 4812 (Australia) and School of Medicine, James Cook University, Townsville, Queensland 4811 (Australia)]. E-mail: stuart.ramsay1@jcu.edu.au; Maggs, Jacqueline [Department of Nuclear Medicine, Townsville Hospital, Townsville, Queensland 4814 (Australia); Powell, Kellie [School of Veterinary and Biomedical Sciences, James Cook University, Townsville, Queensland 4811 (Australia); School of Medicine, James Cook University, Townsville, Queensland 4811 (Australia); Barnes, Jodie [School of Veterinary and Biomedical Sciences, James Cook University, Townsville, Queensland 4811 (Australia); Ketheesan, Natkunam [School of Veterinary and Biomedical Sciences, James Cook University, Townsville, Queensland 4811 (Australia); School of Medicine, James Cook University, Townsville, Queensland 4811 (Australia)

2006-07-15

Introduction: {sup 99m}Technetium stannous colloid (TcSnC) is used in white cell scanning. It labels neutrophils and monocytes via phagocytosis, with uptake mediated by the phagocytic receptor CD11b/CD18 in neutrophils. Uptake of TcSnC is altered by gram-negative infection, possibly due to the endotoxin component lipopolysaccharide (LPS) or to cytokines released during infection (e.g., TNF-alpha and IFN-gamma). Endotoxemia and increased TNF-alpha levels also occur in inflammatory bowel disease. Another potential confounder in cell labeling is that sepsis patients may be treated with GM-CSF and G-CSF, which alter phagocytic cell function. This study aimed to determine how these factors affect TcSnC cellular uptake. Methods: Whole blood from six healthy volunteers was incubated with LPS, TNF-alpha, IFN-gamma, GM-CSF or G-CSF. Samples were then mixed with TcSnC. Blood was separated across density gradients and imaged using a gamma camera. Three radioactive count peaks were observed in each tube: free plasma activity, mononuclear cell uptake and neutrophil uptake. Results: Compared with controls, significant increases in mononuclear cell uptake were induced by LPS, TNF-alpha and GM-CSF stimulation. It was incidentally noted that exogenous estrogens appear to affect TcSnC labeling and may influence the neutrophil response to stimulation. Neutrophil uptake and plasma activity were not significantly affected. IFN-gamma and G-CSF had no significant effect. Conclusions: In whole blood, the effect of LPS on TcSnC monocyte uptake is different to its effect on neutrophils, consistent with previously reported differences in CD11b/CD18 expression. TNF-alpha response parallels LPS response. GM-CSF also increases TcSnC uptake by monocytes. These effects should be considered when using TcSnC for imaging purposes, as they will tend to increase monocyte labeling. Estrogens may also affect TcSnC labeling. Responses to IFN-gamma and G-CSF are consistent with previously reported effects

Carbonation and CO2 uptake of concrete

International Nuclear Information System (INIS)

Yang, Keun-Hyeok; Seo, Eun-A; Tae, Sung-Ho

2014-01-01

This study developed a reliable procedure to assess the carbon dioxide (CO 2 ) uptake of concrete by carbonation during the service life of a structure and by the recycling of concrete after demolition. To generalize the amount of absorbable CO 2 per unit volume of concrete, the molar concentration of carbonatable constituents in hardened cement paste was simplified as a function of the unit content of cement, and the degree of hydration of the cement paste was formulated as a function of the water-to-cement ratio. The contribution of the relative humidity, type of finishing material for the concrete surface, and the substitution level of supplementary cementitious materials to the CO 2 diffusion coefficient in concrete was reflected using various correction factors. The following parameters varying with the recycling scenario were also considered: the carbonatable surface area of concrete crusher-runs and underground phenomena of the decreased CO 2 diffusion coefficient and increased CO 2 concentration. Based on the developed procedure, a case study was conducted for an apartment building with a principal wall system and an office building with a Rahmen system, with the aim of examining the CO 2 uptake of each structural element under different exposure environments during the service life and recycling of the building. As input data necessary for the case study, data collected from actual surveys conducted in 2012 in South Korea were used, which included data on the surrounding environments, lifecycle inventory database, life expectancy of structures, and recycling activity scenario. Ultimately, the CO 2 uptake of concrete during a 100-year lifecycle (life expectancy of 40 years and recycling span of 60 years) was estimated to be 15.5%–17% of the CO 2 emissions from concrete production, which roughly corresponds to 18%–21% of the CO 2 emissions from the production of ordinary Portland cement. - Highlights: • CO 2 uptake assessment approach owing to the

Gbu Glycine Betaine Porter and Carnitine Uptake in Osmotically Stressed Listeria monocytogenes Cells

Science.gov (United States)

Mendum, Mary Lou; Smith, Linda Tombras

2002-01-01

The food-borne pathogen Listeria monocytogenes grows actively under high-salt conditions by accumulating compatible solutes such as glycine betaine and carnitine from the medium. We report here that the dominant transport system for glycine betaine uptake, the Gbu porter, may act as a secondary uptake system for carnitine, with a Km of 4 mM for carnitine uptake and measurable uptake at carnitine concentrations as low as 10 μM. This porter has a Km for glycine betaine uptake of about 6 μM. The dedicated carnitine porter, OpuC, has a Km for carnitine uptake of 1 to 3 μM and a Vmax of approximately 15 nmol/min/mg of protein. Mutants lacking either opuC or gbu were used to study the effects of four carnitine analogs on growth and uptake of osmolytes. In strain DP-L1044, which had OpuC and the two glycine betaine porters Gbu and BetL, triethylglycine was most effective in inhibiting growth in the presence of glycine betaine, but trigonelline was best at inhibiting growth in the presence of carnitine. Carnitine uptake through OpuC was inhibited by γ-butyrobetaine. Dimethylglycine inhibited both glycine betaine and carnitine uptake through the Gbu porter. Carnitine uptake through the Gbu porter was inhibited by triethylglycine. Glycine betaine uptake through the BetL porter was strongly inhibited by trigonelline and triethylglycine. These results suggest that it is possible to reduce the growth of L. monocytogenes under osmotically stressful conditions by inhibiting glycine betaine and carnitine uptake but that to do so, multiple uptake systems must be affected. PMID:12406761