Radiation fixation of vinyl chloride in an insecticide aerosol container
International Nuclear Information System (INIS)
Kagiya, V.T.; Takemoto, K.
1975-01-01
Recently, a large quantity of vinyl chloride has been used as spraying additive for insecticide aerosols. Since January 1974 when the Food and Drug Administration of the United States of America announced that vinyl chloride causes liver cancer, it has been forbidden in Japan and the United States of America to market insecticide aerosol containers containing vinyl chloride. In Japan, following a government order, about 20 million insecticide aerosol containers have been collected and put into storage. A report is given on the radiation fixation of vinyl chloride as polyvinylchloride powder by gamma-ray-induced polymerization in the aerosol container. Insecticide aerosol containers containing vinyl chloride were irradiated by gamma rays from 60 Co at room temperature. Vinyl chloride polymerized to form powdered polymer in the container. Polymerization conversion increased with the irradiation dose, and after 10 Mrad irradiation, vinyl chloride was not found in the sprayed gas. This establishes that vinyl chloride can be fixed by gamma-ray irradiation in the aerosol container. To accelerate the reaction rate, the effect of various additives on the reaction was investigated. It was found that halogenated hydrocarbons, such as chloroform and carbon tetrachloride, accelerated the initiation of the polymerization, and that a vinyl monomer such as vinyl acetate accelerated the reaction rate due to the promotion of the initiation and the high reactivity of the polyvinylacetate radical to vinyl chloride. Consequently, the required irradiation dose for the fixation of vinyl chloride was decreased to less than 5 Mrad by the addition of various kinds of additives. Following the request of the Ministry of Public Welfare, various technical problems for large-scale treatment are being studied with the co-operation of the Federation of Insecticide Aerosols. (author)
Modeling global distribution of agricultural insecticides in surface waters
International Nuclear Information System (INIS)
Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J.; Schäfer, Ralf B.; Fornaroli, Riccardo; Liess, Matthias
2015-01-01
Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. - Highlights: • First global map on insecticide runoff through modelling. • Model predicts upper limit of insecticide exposure when compared to field data. • Water bodies in 40% of global land surface may be at risk of adverse effects. • Insecticide application rate, terrain slope and rainfall main drivers of exposure. - We provide the first global map on insecticide runoff to surface water predicting that water bodies in 40% of global land surface may be at risk of adverse effects
Directory of Open Access Journals (Sweden)
G. J. Engelhart
2011-02-01
Full Text Available The composition and physical properties of aged atmospheric aerosol were characterized at a remote sampling site on the northern coast of Crete, Greece during the Finokalia Aerosol Measurement Experiment in May 2008 (FAME-2008. A reduced Dry-Ambient Aerosol Size Spectrometer (DAASS was deployed to measure the aerosol water content and volumetric growth factor of fine particulate matter. The particles remained wet even at relative humidity (RH as low as 20%. The aerosol was acidic during most of the measurement campaign, which likely contributed to the water uptake at low RH. The water content observations were compared to the thermodynamic model E-AIM, neglecting any contribution of the organics to aerosol water content. There was good agreement between the water measurements and the model predictions. Adding the small amount of water associated with the organic aerosol based on monoterpene water absorption did not change the quality of the agreement. These results strongly suggest that the water uptake by aged organic aerosol is relatively small (a few percent of the total water for the conditions during FAME-08 and generally consistent with what has been observed in laboratory experiments. The water concentration measured by a Q-AMS was well correlated with the DAASS measurements and in good agreement with the predicted values for the RH of the Q-AMS inlet. This suggests that, at least for the conditions of the study, the Q-AMS can provide valuable information about the aerosol water concentrations if the sample is not dried.
Stehle, Sebastian; Knäbel, Anja; Schulz, Ralf
2013-08-01
Due to the specific modes of action and application patterns of agricultural insecticides, the insecticide exposure of agricultural surface waters is characterized by infrequent and short-term insecticide concentration peaks of high ecotoxicological relevance with implications for both monitoring and risk assessment. Here, we apply several fixed-interval strategies and an event-based sampling strategy to two generalized and two realistic insecticide exposure patterns for typical agricultural streams derived from FOCUS exposure modeling using Monte Carlo simulations. Sampling based on regular intervals was found to be inadequate for the detection of transient insecticide concentrations, whereas event-triggered sampling successfully detected all exposure incidences at substantially lower analytical costs. Our study proves that probabilistic risk assessment (PRA) concepts in their present forms are not appropriate for a thorough evaluation of insecticide exposure. Despite claims that the PRA approach uses all available data to assess exposure and enhances risk assessment realism, we demonstrate that this concept is severely biased by the amount of insecticide concentrations below detection limits and therefore by the sampling designs. Moreover, actual insecticide exposure is of almost no relevance for PRA threshold level exceedance frequencies and consequential risk assessment outcomes. Therefore, we propose a concept that features a field-relevant ecological risk analysis of agricultural insecticide surface water exposure. Our study quantifies for the first time the environmental and economic consequences of inappropriate monitoring and risk assessment concepts used for the evaluation of short-term peak surface water pollutants such as insecticides.
Modeling global distribution of agricultural insecticides in surface waters.
Ippolito, Alessio; Kattwinkel, Mira; Rasmussen, Jes J; Schäfer, Ralf B; Fornaroli, Riccardo; Liess, Matthias
2015-03-01
Agricultural insecticides constitute a major driver of animal biodiversity loss in freshwater ecosystems. However, the global extent of their effects and the spatial extent of exposure remain largely unknown. We applied a spatially explicit model to estimate the potential for agricultural insecticide runoff into streams. Water bodies within 40% of the global land surface were at risk of insecticide runoff. We separated the influence of natural factors and variables under human control determining insecticide runoff. In the northern hemisphere, insecticide runoff presented a latitudinal gradient mainly driven by insecticide application rate; in the southern hemisphere, a combination of daily rainfall intensity, terrain slope, agricultural intensity and insecticide application rate determined the process. The model predicted the upper limit of observed insecticide exposure measured in water bodies (n = 82) in five different countries reasonably well. The study provides a global map of hotspots for insecticide contamination guiding future freshwater management and conservation efforts. Copyright © 2014 Elsevier Ltd. All rights reserved.
Effectiveness of a Reduced-Risk Insecticide Based Bed Bug Management Program in Low-Income Housing
Directory of Open Access Journals (Sweden)
Narinderpal Singh
2013-11-01
Full Text Available Bed bug (Cimex lectularius L. infestations are becoming increasingly common in low-income communities. Once they are introduced, elimination is very difficult. As part of the efforts to develop effective and safe bed bug management programs, we conducted a laboratory study evaluating the efficacy of a reduced-risk insecticide—Alpine aerosol (0.5% dinotefuran. We then conducted a field evaluation of a reduced-risk insecticide based integrated pest management (IPM program in low-income family apartments with young children. In laboratory evaluations, direct spray and 5 min exposure to dry Alpine aerosol residue caused 100.0 ± 0.0 and 91.7 ± 8.3% mortality to bed bug nymphs, respectively. Direct Alpine aerosol spray killed 91.3 ± 4.3% of the eggs. The IPM program included education, steam, bagging infested linens, placing intercepting devices under furniture legs and corners of rooms, applying Alpine aerosol and Alpine dust (0.25% dinotefuran, 95% diatomaceous earth dust, and regularly scheduled monitoring and re-treatment. Nine apartments ranging from 1–1,428 (median: 29 bed bugs based on visual inspection and Climbup interceptor counts were included. Over a 6-month period, an average 172 g insecticide (Alpine aerosol + Alpine dust was used in each apartment, a 96% reduction in pesticide usage compared to chemical only treatment reported in a similar environment. The IPM program resulted in an average of 96.8 ± 2.2% reduction in the number of bed bugs. However, elimination of bed bugs was only achieved in three lightly infested apartments (<30 bed bugs at the beginning. Elimination success was closely correlated with the level of bed bug populations.
Wintertime water-soluble aerosol composition and particle water content in Fresno, California
Parworth, Caroline L.; Young, Dominique E.; Kim, Hwajin; Zhang, Xiaolu; Cappa, Christopher D.; Collier, Sonya; Zhang, Qi
2017-03-01
The composition and concentrations of water-soluble gases and ionic aerosol components were measured from January to February 2013 in Fresno, CA, with a particle-into-liquid sampler with ion chromatography and annular denuders. The average (±1σ) ionic aerosol mass concentration was 15.0 (±9.4) µg m-3, and dominated by nitrate (61%), followed by ammonium, sulfate, chloride, potassium, nitrite, and sodium. Aerosol-phase organic acids, including formate and glycolate, and amines including methylaminium, triethanolaminium, ethanolaminium, dimethylaminium, and ethylaminium were also detected. Although the dominant species all came from secondary aerosol formation, there were primary sources of ionic aerosols as well, including biomass burning for potassium and glycolate, sea spray for sodium, chloride, and dimethylamine, and vehicles for formate. Particulate methanesulfonic acid was also detected and mainly associated with terrestrial sources. On average, the molar concentration of ammonia was 49 times greater than nitric acid, indicating that ammonium nitrate formation was limited by nitric acid availability. Particle water was calculated based on the Extended Aerosol Inorganics Model (E-AIM) thermodynamic prediction of inorganic particle water and κ-Köhler theory approximation of organic particle water. The average (±1σ) particle water concentration was 19.2 (±18.6) µg m-3, of which 90% was attributed to inorganic species. The fractional contribution of particle water to total fine particle mass averaged at 36% during this study and was greatest during early morning and night and least during the day. Based on aqueous-phase concentrations of ions calculated by using E-AIM, the average (±1σ) pH of particles in Fresno during the winter was estimated to be 4.2 (±0.2).
Agricultural insecticides threaten surface waters at the global scale.
Stehle, Sebastian; Schulz, Ralf
2015-05-05
Compared with nutrient levels and habitat degradation, the importance of agricultural pesticides in surface water may have been underestimated due to a lack of comprehensive quantitative analysis. Increasing pesticide contamination results in decreasing regional aquatic biodiversity, i.e., macroinvertebrate family richness is reduced by ∼30% at pesticide concentrations equaling the legally accepted regulatory threshold levels (RTLs). This study provides a comprehensive metaanalysis of 838 peer-reviewed studies (>2,500 sites in 73 countries) that evaluates, for the first time to our knowledge on a global scale, the exposure of surface waters to particularly toxic agricultural insecticides. We tested whether measured insecticide concentrations (MICs; i.e., quantified insecticide concentrations) exceed their RTLs and how risks depend on insecticide development over time and stringency of environmental regulation. Our analysis reveals that MICs occur rarely (i.e., an estimated 97.4% of analyses conducted found no MICs) and there is a complete lack of scientific monitoring data for ∼90% of global cropland. Most importantly, of the 11,300 MICs, 52.4% (5,915 cases; 68.5% of the sites) exceeded the RTL for either surface water (RTLSW) or sediments. Thus, the biological integrity of global water resources is at a substantial risk. RTLSW exceedances depend on the catchment size, sampling regime, and sampling date; are significantly higher for newer-generation insecticides (i.e., pyrethroids); and are high even in countries with stringent environmental regulations. These results suggest the need for worldwide improvements to current pesticide regulations and agricultural pesticide application practices and for intensified research efforts on the presence and effects of pesticides under real-world conditions.
Evaluating Global Aerosol Models and Aerosol and Water Vapor Properties Near Clouds
Energy Technology Data Exchange (ETDEWEB)
Turner, David, D.; Ferrare, Richard, A.
2011-07-06
The 'Evaluating Global Aerosol Models and Aerosol and Water Vapor Properties Near Clouds' project focused extensively on the analysis and utilization of water vapor and aerosol profiles derived from the ARM Raman lidar at the Southern Great Plains ARM site. A wide range of different tasks were performed during this project, all of which improved quality of the data products derived from the lidar or advanced the understanding of atmospheric processes over the site. These activities included: upgrading the Raman lidar to improve its sensitivity; participating in field experiments to validate the lidar aerosol and water vapor retrievals; using the lidar aerosol profiles to evaluate the accuracy of the vertical distribution of aerosols in global aerosol model simulations; examining the correlation between relative humidity and aerosol extinction, and how these change, due to horizontal distance away from cumulus clouds; inferring boundary layer turbulence structure in convective boundary layers from the high-time-resolution lidar water vapor measurements; retrieving cumulus entrainment rates in boundary layer cumulus clouds; and participating in a field experiment that provided data to help validate both the entrainment rate retrievals and the turbulent profiles derived from lidar observations.
G. J. Engelhart; L. Hildebrandt; E. Kostenidou; N. Mihalopoulos; N. M. Donahue; S. N. Pandis
2010-01-01
The composition and physical properties of aged atmospheric aerosol were characterized at a remote sampling site on the northern coast of Crete, Greece during the Finokalia Aerosol Measurement Experiment in May 2008 (FAME-2008). A reduced Dry-Ambient Aerosol Size Spectrometer (DAASS) was deployed to measure the aerosol water content and volumetric growth factor of fine particulate matter. The particles remained wet even at relative humidity (RH) as low as 20%. The aerosol was acidic during mo...
Aerosol Scrubbing Performance Test for Self-Priming Scrubbing Nozzle Submerged in Water Pool
Energy Technology Data Exchange (ETDEWEB)
Lee, Doo Yong; Jung, Woo Young; Lee, Hyun Chul; Lee, Jong Chan; Kim, Gyu Tae; Song, Yong Jae [FNC Technology Co., Yongin (Korea, Republic of)
2016-10-15
A scrubbing nozzle is one of the key components for a wet scrubber process based Containment Filtered Venting System (CFVS). As a part of a development of Korean CFVS, a self-priming scrubbing nozzle shown in Fig. 1 has been developed based on the well-known venturi scrubber concept. The thermal-hydraulic performances such as the pressure drop across the nozzle, water suction behavior and droplet generation inside throat have been tested in the non-submerged condition as well as submerged condition. The self-priming scrubbing nozzle used for the wet scrubber based CFVS has been developed, which is submerged in the water pool. When there is gas flow at the inlet of the nozzle, the pool water is passively sucked from the water suction slit. The fine droplets generated inside the throat capture the aerosol particles and is discharged into the water pool. In the water pool, the pool scrubbing happens. The aerosol scrubbing performance tests for the developed self-priming scrubbing nozzle has been conducted under the operational conditions such as different aerosol sizes, different carrier gas steam fractions, different, different pool water level and nozzle inlet pressure. The major findings are as follows. (1) Aerosol scrubbing efficiency increases with the increase of the aerosol size. (2) Aerosol scrubbing efficiency increases with the increase of the carrier gas steam fraction. (3) Aerosol scrubbing.
Aerosol Scrubbing Performance Test for Self-Priming Scrubbing Nozzle Submerged in Water Pool
International Nuclear Information System (INIS)
Lee, Doo Yong; Jung, Woo Young; Lee, Hyun Chul; Lee, Jong Chan; Kim, Gyu Tae; Song, Yong Jae
2016-01-01
A scrubbing nozzle is one of the key components for a wet scrubber process based Containment Filtered Venting System (CFVS). As a part of a development of Korean CFVS, a self-priming scrubbing nozzle shown in Fig. 1 has been developed based on the well-known venturi scrubber concept. The thermal-hydraulic performances such as the pressure drop across the nozzle, water suction behavior and droplet generation inside throat have been tested in the non-submerged condition as well as submerged condition. The self-priming scrubbing nozzle used for the wet scrubber based CFVS has been developed, which is submerged in the water pool. When there is gas flow at the inlet of the nozzle, the pool water is passively sucked from the water suction slit. The fine droplets generated inside the throat capture the aerosol particles and is discharged into the water pool. In the water pool, the pool scrubbing happens. The aerosol scrubbing performance tests for the developed self-priming scrubbing nozzle has been conducted under the operational conditions such as different aerosol sizes, different carrier gas steam fractions, different, different pool water level and nozzle inlet pressure. The major findings are as follows. (1) Aerosol scrubbing efficiency increases with the increase of the aerosol size. (2) Aerosol scrubbing efficiency increases with the increase of the carrier gas steam fraction. (3) Aerosol scrubbing
Insight into Chemistry on Cloud/Aerosol Water Surfaces.
Zhong, Jie; Kumar, Manoj; Francisco, Joseph S; Zeng, Xiao Cheng
2018-05-15
Cloud/aerosol water surfaces exert significant influence over atmospheric chemical processes. Atmospheric processes at the water surface are observed to follow mechanisms that are quite different from those in the gas phase. This Account summarizes our recent findings of new reaction pathways on the water surface. We have studied these surface reactions using Born-Oppenheimer molecular dynamics simulations. These studies provide useful information on the reaction time scale, the underlying mechanism of surface reactions, and the dynamic behavior of the product formed on the aqueous surface. According to these studies, the aerosol water surfaces confine the atmospheric species into a specific orientation depending on the hydrophilicity of atmospheric species or the hydrogen-bonding interactions between atmospheric species and interfacial water. As a result, atmospheric species are activated toward a particular reaction on the aerosol water surface. For example, the simplest Criegee intermediate (CH 2 OO) exhibits high reactivity toward the interfacial water and hydrogen sulfide, with the reaction times being a few picoseconds, 2-3 orders of magnitude faster than that in the gas phase. The presence of interfacial water molecules induces proton-transfer-based stepwise pathways for these reactions, which are not possible in the gas phase. The strong hydrophobicity of methyl substituents in larger Criegee intermediates (>C1), such as CH 3 CHOO and (CH 3 ) 2 COO, blocks the formation of the necessary prereaction complexes for the Criegee-water reaction to occur at the water droplet surface, which lowers their proton-transfer ability and hampers the reaction. The aerosol water surface provides a solvent medium for acids (e.g., HNO 3 and HCOOH) to participate in reactions via mechanisms that are different from those in the gas and bulk aqueous phases. For example, the anti-CH 3 CHOO-HNO 3 reaction in the gas phase follows a direct reaction between anti-CH 3 CHOO and HNO 3
Liao, Chunyang; Richards, Jaben; Taylor, Allison R; Gan, Jay
2017-12-01
Widespread use of insecticides for the control of urban pests such as ants, termites, and spiders has resulted in contamination and toxicity in urban aquatic ecosystems in different regions of the world. Passive samplers are a convenient and integrative tool for in situ monitoring of trace contaminants in surface water. However, the performance of a passive sampler depends closely on its affinity for the target analytes, making passive samplers highly specific to the types of contaminants being monitored. The goal of this study was to develop a passive sampler compatible with a wide range of insecticides, including the strongly hydrophobic pyrethroids and the weakly hydrophobic fipronil and organophosphates. Of six candidate polymeric thin films, polyurethane film (PU) was identified to be the best at enriching the test compounds. The inclusion of stable isotope labeled analogs as performance reference compounds (PRCs) further allowed the use of PU film for pyrethroids under non-equilibrium conditions. The PU sampler was tested in a large aquarium with circulatory water flow, and also deployed at multiple sites in surface streams in southern California. The concentrations of pesticides derived from the PU sampler ranged from 0.5 to 18.5 ng/L, which were generally lower than the total chemical concentration measured by grab samples, suggesting that suspended particles and dissolved organic matter in water rendered them less available. The influence of suspended particles and dissolved organic matter on bioavailability was more pronounced for pyrethroids than for fipronils. The results show that the developed PU film sampler, when coupled with PRCs, may be used for rapid and sensitive in-situ monitoring of a wide range of insecticides in surface water. Copyright © 2017 Elsevier Ltd. All rights reserved.
Efficiency of protective dermal equipment against silver nanoparticles with water aerosol
International Nuclear Information System (INIS)
Park, Junsu; Kwak, Byoung Kyu; Kim, Younghun; Yi, Jongheop
2011-01-01
Protective dermal equipment (PDE) should be provided for protecting against the penetration of nanomaterials into the skin in the workplace. It is important that workers utilize appropriate PDE with characteristics to accomplish this. During the liquid-phase process, nanomaterials are released with water aerosol, which can easily affect the health of workers. The efficiency of PDE in protecting workers against silver nanoparticles (AgNPs) aerosolized with water aerosol was evaluated. The rate of penetration of AgNPs with water aerosol through cleanroom wear was faster than that for a lab coat. This can be attributed to differences in the filling rate of water, as the result of differences in capillary force. Therefore, humidity appears to be a major factor in the rate of penetration of nanomaterials in the presence of water aerosol. Although no penetration was observed when disposable protective gloves were observed, the presence of AgNPs on the surface of gloves was clearly found. Based on these findings, recommendations for the safe use of PDE can now be made.
Household use of insecticide consumer products in a dengue-endemic area in México.
Loroño-Pino, María Alba; Chan-Dzul, Yamili N; Zapata-Gil, Rocio; Carrillo-Solís, Claudia; Uitz-Mena, Ana; García-Rejón, Julián E; Keefe, Thomas J; Beaty, Barry J; Eisen, Lars
2014-10-01
To evaluate the household use of insecticide consumer products to kill mosquitoes and other insect pests, as well as the expenditures for using these products, in a dengue-endemic area of México. A questionnaire was administered to 441 households in Mérida City and other communities in Yucatán to assess household use of insecticide consumer products. A total of 86.6% of surveyed households took action to kill insect pests with consumer products. The most commonly used product types were insecticide aerosol spray cans (73.6%), electric plug-in insecticide emitters (37.4%) and mosquito coils (28.3%). Mosquitoes were targeted by 89.7% of households using insecticide aerosol spray cans and >99% of households using electric plug-in insecticide emitters or mosquito coils. Products were used daily or every 2 days in most of the households for insecticide aerosol spray cans (61.4%), electric plug-in insecticide emitters (76.2%) and mosquito coils (82.1%). For all products used to kill insect pests, the median annual estimated expenditure per household that took action was 408 Mexican pesos ($MXN), which corresponded to approximately 31 $US. These numbers are suggestive of an annual market in excess of 75 million $MXN (>5.7 million $US) for Mérida City alone. Mosquitoes threaten human health and are major nuisances in homes in the study area in México. Households were found to have taken vigorous action to kill mosquitoes and other insect pests and spent substantial amounts of money on insecticide consumer products. © 2014 John Wiley & Sons Ltd.
Insecticide residue monitoring in sediments water fish and mangroves at the Cimanuk Delta
International Nuclear Information System (INIS)
Sumatra, Made
1982-01-01
The water and sediments from the upper stream of Cimanuk river carry insecticide residues especially during the rainy season. The insecticides are deposited in the estuary of Cimanuk river and along the coast of Cimanuk delta. The insecticide residues found at the delta were diazinon thiodan DDE o p-DDT and p p-DDT. Those insecticides are found in most of the water sediments and mangrove leaves samples and some of fishes samples. The samples were taken from the river the estuary the sea, the tambaks, the coast line, and from paddy field. No insecticide residue is found in the water samples taken in the dry season but they are found in the sediment samples taken in both the dry and rainy season. Generally the diazinon residues are higher at the surface than at 0.5m depth in compact sediment but they are higher at 0.5m depth than at the surface of the mud from the coast line. Diazinon and thiodan are found only in three fish samples out of twenty samples analyzed but thiodan is found in almost all of the sediment and mangrove leaves samples. DDT is found in almost all of the samples analyzed. (author)
Household use of insecticide consumer products in a dengue endemic area in México
Loroño-Pino, María Alba; Chan-Dzul, Yamili N.; Zapata-Gil, Rocio; Carrillo-Solís, Claudia; Uitz-Mena, Ana; García-Rejón, Julián E.; Keefe, Thomas J.; Beaty, Barry J.; Eisen, Lars
2014-01-01
Objectives To evaluate household use of insecticide consumer products to kill mosquitoes and other insect pests, as well as the expenditures for using these products, in a dengue endemic area in México. Methods A questionnaire was administered to 441 households in Mérida City or other communities in Yucatán State to assess household use of insecticide consumer products. Results Most (86.6%) households took action to kill insect pests with consumer products. Among those households, the most commonly used product types were insecticide aerosol spray cans (73.6%), electric plug-in insecticide emitters (37.4%), and mosquito coils (28.3%). Mosquitoes were targeted by 89.7% of households using insecticide aerosol spray cans and >99% of households using electric plug-in insecticide emitters or mosquito coils. During the part of the year when a given product type was used, the frequency of use was daily or every 2 days in most of the households for insecticide aerosol spray cans (61.4%), electric plug-in insecticide emitters (76.2%), and mosquito coils (82.1%). For all products used to kill insect pests, the median annual estimated expenditure per household that took action was 408 Mexican pesos ($MXN), which corresponded to ∼31 $U.S. These numbers are suggestive of an annual market in excess of 75 million $MXN (>5.7 million $U.S.) for Mérida City alone. Conclusion Mosquitoes threaten human health and are major nuisances in homes in the study area in México. Households were found to have taken vigorous action to kill mosquitoes and other insect pests and spent substantial amounts of money on insecticide consumer products. PMID:25040259
Photodegradation of neonicotinoid insecticides in water by semiconductor oxides.
Fenoll, José; Garrido, Isabel; Hellín, Pilar; Flores, Pilar; Navarro, Simón
2015-10-01
The photocatalytic degradation of three neonicotinoid insecticides (NIs), thiamethoxam (TH), imidacloprid (IM) and acetamiprid (AC), in pure water has been studied using zinc oxide (ZnO) and titanium dioxide (TiO2) as photocatalysts under natural sunlight and artificial light irradiation. Photocatalytic experiments showed that the addition of these chalcogenide oxides in tandem with the electron acceptor (Na2S2O8) strongly enhances the degradation rate of these compounds in comparison with those carried out with ZnO and TiO2 alone and photolytic tests. Comparison of catalysts showed that ZnO is the most efficient for the removal of such insecticides in optimal conditions and at constant volumetric rate of photon absorption. Thus, the complete disappearance of all the studied compounds was achieved after 10 and 30 min of artificial light irradiation, in the ZnO/Na2S2O8 and TiO2/Na2S2O8 systems, respectively. The highest degradation rate was noticed for IM, while the lowest rate constant was obtained for AC under artificial light irradiation. In addition, solar irradiation was more efficient compared to artificial light for the removal of these insecticides from water. The main photocatalytic intermediates detected during the degradation of NIs were identified.
Directory of Open Access Journals (Sweden)
RA Mandour
2011-12-01
Full Text Available Background: The environmental degradation products of pesticides may enter drinking water and result in serious health problems. Objective: To evaluate the occurrence of insecticides in drinking surface and ground water in Dakahlyia Governorate, northern Egypt in 2011. Methods: We studied blood samples collected from 36 consecutive patients diagnosed with pesticides poisoning and 36 tap drinking water (surface and ground. Blood and water samples were analyzed for pesticides using gas chromatography-electron captured detector (GC-ECD. In addition, blood samples were analyzed for plasma pseudo-cholinesterase level (PChE and red blood cells acetyl cholinesterase activity (AChE. Results: The results confirmed the presence of high concentrations of insecticides, including organonitrogenous and organochlorine in tap drinking surface and ground water. Conclusion: Drinking water contaminated with insecticides constitutes an important health concern in Dakahlyia governorate, Egypt.
Aerosol-Water Cycle Interaction: A New Challenge in Monsoon Climate Research
Lau, William K. M.
2006-01-01
Long recognized as a major environmental hazard, aerosol is now known to have strong impacts on both regional and global climate. It has been estimated that aerosol may reduce by up to 10% of the seasonal mean solar radiation reaching the earth surface, producing a global cooling effect that opposes global warming (Climate Change 2001). This means that the potential perils that humans have committed to global warming may be far greater than what we can detect at the present. As a key component of the Earth climate system, the water cycle is profoundly affected by the presence of aerosols in the atmosphere. Through the so-called "direct effect", aerosol scatters and/or absorbs solar radiation, thus cooling the earth surface and changing the horizontal and vertical radiational heating contrast in the atmosphere. The heating contrast drives anomalous atmospheric circulation, resulting in changes in convection, clouds, and rainfall. Another way aerosol can affect the water cycle is through the so-called "indirect effects", whereby aerosol increases the number of cloud condensation nuclei, prolongs life time of clouds, and inhibits the growth of cloud drops to raindrops. This leads to more clouds, and increased reflection of solar radiation, and further cooling at the earth surface. In monsoon regions, the response of the water cycle to aerosol forcing is especially complex, not only because of presence of diverse mix of aerosol species with vastly different radiative properties, but also because the monsoon is strongly influenced by ocean and land surface processes, land use, land change, as well as regional and global greenhouse warming effects. Thus, sorting out the impacts of aerosol forcing, and interaction with the monsoon water cycle is a very challenging problem. In this talk, I will offer some insights into how aerosols may impact the Asian monsoon based on preliminary results from satellite observations and climate model experiments. Specifically, I will
Evaluating Global Aerosol Models and Aerosol and Water Vapor Properties Near Clouds
Energy Technology Data Exchange (ETDEWEB)
Richard A. Ferrare; David D. Turner
2011-09-01
Project goals: (1) Use the routine surface and airborne measurements at the ARM SGP site, and the routine surface measurements at the NSA site, to continue our evaluations of model aerosol simulations; (2) Determine the degree to which the Raman lidar measurements of water vapor and aerosol scattering and extinction can be used to remotely characterize the aerosol humidification factor; (3) Use the high temporal resolution CARL data to examine how aerosol properties vary near clouds; and (4) Use the high temporal resolution CARL and Atmospheric Emitted Radiance Interferometer (AERI) data to quantify entrainment in optically thin continental cumulus clouds.
On the implications of aerosol liquid water and phase separation for organic aerosol mass
U.S. Environmental Protection Agency — This dataset contains data presented in the figures of the paper "On the implications of aerosol liquid water and phase separation for organic aerosol mass"...
Directory of Open Access Journals (Sweden)
Xiang Zhang
2017-12-01
Full Text Available This study was conducted to investigate the effects of soil water deficit on insecticidal protein expression in boll shells of cotton transgenic for a Bt gene. In 2014, Bt cotton cultivars Sikang 1 (a conventional cultivar and Sikang 3 (a hybrid cultivar were planted in pots and five soil water content treatments were imposed at peak boll stage: 15% (G1, 35% (G2, 40% (G3, 60% (G4, and 75% field capacity (CK, respectively. Four treatments (G2, G3, G4, and CK were repeated in 2015 in the field. Results showed that the insecticidal protein content of boll shells decreased with increasing water deficit. Compared with CK, boll shell insecticidal protein content decreased significantly when soil water content was below 60% of maximum water holding capacity for Sikang 1 and Sikang 3. However, increased Bt gene expression was observed when boll shell insecticidal protein content was significantly reduced. Activity assays of key enzymes in nitrogen metabolism showed that boll shell protease and peptidase increased but nitrogen reductase and glutamic-pyruvic transaminase (GPT decreased. Insecticidal protein content exhibited significant positive correlation with nitrogen reductase and GPT activities; and significant negative correlation with protease and peptidase activities. These findings suggest that the decrease of insecticidal protein content associated with increasing water deficit was a net result of decreased synthesis and increased decomposition.
Gao, M.; Zhai, P.; Franz, B. A.; Hu, Y.; Knobelspiesse, K. D.; Xu, F.; Ibrahim, A.
2017-12-01
Ocean color remote sensing in coastal waters remains a challenging task due to the complex optical properties of aerosols and ocean water properties. It is highly desirable to develop an advanced ocean color and aerosol retrieval algorithm for coastal waters, to advance our capabilities in monitoring water quality, improve our understanding of coastal carbon cycle dynamics, and allow for the development of more accurate circulation models. However, distinguishing the dissolved and suspended material from absorbing aerosols over coastal waters is challenging as they share similar absorption spectrum within the deep blue to UV range. In this paper we report a research algorithm on aerosol and ocean color retrieval with emphasis on coastal waters. The main features of our algorithm include: 1) combining co-located measurements from a hyperspectral ocean color instrument (OCI) and a multi-angle polarimeter (MAP); 2) using the radiative transfer model for coupled atmosphere and ocean system (CAOS), which is based on the highly accurate and efficient successive order of scattering method; and 3) incorporating a generalized bio-optical model with direct accounting of the total absorption of phytoplankton, CDOM and non-algal particles(NAP), and the total scattering of phytoplankton and NAP for improved description of ocean light scattering. The non-linear least square fitting algorithm is used to optimize the bio-optical model parameters and the aerosol optical and microphysical properties including refractive indices and size distributions for both fine and coarse modes. The retrieved aerosol information is used to calculate the atmospheric path radiance, which is then subtracted from the OCI observations to obtain the water leaving radiance contribution. Our work aims to maximize the use of available information from the co-located dataset and conduct the atmospheric correction with minimal assumptions. The algorithm will contribute to the success of current MAP
Large-scale experiments on aerosol behavior in light water reactor containments
International Nuclear Information System (INIS)
Schock, W.; Bunz, H.; Adams, R.E.; Tobias, M.L.; Rahn, F.J.
1988-01-01
Recently, three large-scale experimental programs were carried out dealing with the behavior of aerosols during core-melt accidents in light water reactors (LWRs). In the Nuclear Safety Pilot Plant (NSPP) program, the principal behaviors of different insoluble aerosols and of mixed aerosols were measured in dry air atmospheres and in condensing steam-air atmospheres contained in a 38-m/sup 3/ steel vessel. The Demonstration of Nuclear Aerosol Behavior (DEMONA) program used a 640-m/sup 3/ concrete containment model to simulate typical accident sequence conditions, and measured the behavior of different insoluble aerosols and mixed aerosols in condensing and transient atmospheric conditions. Part of the LWR Aerosol Containment Experiments (LACE) program was also devoted to aerosol behavior in containment; and 852-m/sup 3/ steel vessel was used, and the aerosols were composed of mixtures of insoluble and soluble species. The results of these experiments provide a suitable data base for validation of aerosol behavior codes. Fundamental insight into details of aerosol behavior in condensing environments has been gained through the results of the NSPP tests. Code comparisons have been and are being performed in the DEMONA and LACE experiments
Enhanced water use efficiency in global terrestrial ecosystems under increasing aerosol loadings
Energy Technology Data Exchange (ETDEWEB)
Lu, Xiaoliang; Chen, Min; Liu, Yaling; Miralles, Diego G.; Wang, Faming
2017-05-01
Aerosols play a crucial role in the climate system, affecting incoming radiation and cloud formation. Based on a modelling framework that couples ecosystem processes with the atmospheric transfer of radiation, we analyze the effect of aerosols on surface incoming radiation, gross primary productivity (GPP), water losses from ecosystems through evapotranspiration (ET) and ecosystem water use efficiency (WUE, defined as GPP/ET) for 2003–2010 and validate them at global FLUXNET sites. The total diffuse radiation increases under relatively low or intermediate aerosol loadings, but decreases under more polluted conditions. We find that aerosol-induced changes in GPP depend on leaf area index, aerosol loading and cloudiness. Specifically, low and moderate aerosol loadings cause increases in GPP for all plant types, while heavy aerosol loadings result in enhancement (decrease) in GPP for dense (sparse) vegetation. On the other hand, ET is mainly negatively affected by aerosol loadings due to the reduction in total incoming radiation. Finally, WUE shows a consistent rise in all plant types under increasing aerosol loadings. Overall, the simulated daily WUE compares well with observations at 43 eddy-covariance tower sites (R2=0.84 and RMSE=0.01gC (kg H2O)-1) with better performance at forest sites. In addition to the increasing portions of diffuse light, the rise in WUE is also favored by the reduction in radiation- and heat-stress caused by the aerosols, especially for wet and hot climates.
CalWater 2 - Precipitation, Aerosols, and Pacific Atmospheric Rivers Experiment
Spackman, J. R.; Ralph, F. M.; Prather, K. A.; Cayan, D. R.; DeMott, P. J.; Dettinger, M. D.; Fairall, C. W.; Leung, L. R.; Rosenfeld, D.; Rutledge, S. A.; Waliser, D. E.; White, A. B.
2014-12-01
Emerging research has identified two phenomena that play key roles in the variability of the water supply and the incidence of extreme precipitation events along the West Coast of the United States. These phenomena include the role of (1) atmospheric rivers (ARs) in delivering much of the precipitation associated with major storms along the U.S. West Coast, and (2) aerosols—from local sources as well as those transported from remote continents—and their modulating effects on western U.S. precipitation. A better understanding of these processes is needed to reduce uncertainties in weather predictions and climate projections of extreme precipitation and its effects, including the provision of beneficial water supply. This presentation summarizes the science objectives and strategies to address gaps associated with (1) the evolution and structure of ARs including cloud and precipitation processes and air-sea interaction, and (2) aerosol interaction with ARs and the impact on precipitation, including locally-generated aerosol effects on orographic precipitation along the U.S. West Coast. Observations are proposed for multiple winter seasons as part of a 5-year broad interagency vision referred to as CalWater 2 to address these science gaps (http://esrl.noaa.gov/psd/calwater). In January-February 2015, a field campaign has been planned consisting of a targeted set of aircraft and ship-based measurements and associated evaluation of data in near-shore regions of California and in the eastern Pacific. In close coordination with NOAA, DOE's Atmospheric Radiation Measurement (ARM) program is also contributing air and shipborne facilities for ACAPEX (ARM Cloud Aerosol and Precipitation Experiment), a DOE-sponsored study complementing CalWater 2. Ground-based measurements from NOAA's HydroMeteorological Testbed (HMT) network in California and aerosol chemical instrumentation at Bodega Bay, California have been designed to add important near surface-level context for the
The pH Value of Fungicide, Insecticide and Mineral Fertilizer Mixtures Depending on Water Quality
Directory of Open Access Journals (Sweden)
Dušanka Inđić
2008-01-01
Full Text Available The paper deals with the effect of water quality on the pH value of fungicides, insecticides, mineral fertilizers and their mixtures. The fungicides propineb (Antracol WP-70 and mancozeb (Dithane M-70, insecticides pirimiphos-methyl (Actellic-50 and imidacloprid(Confidor 200-SL, several fertilizers (Ferticare I, Ferticare II, Ferticare III and Wuxal Super and their mixtures were analyzed for pH value under laboratory conditions using a potentiometric pH meter. Measurements were made directly after preparation or mixing with tap and well water and 24 hours later. Tap water exhibited a neutral reaction. A slightly alkaline reaction of well water was mostlikely due to high ammonium content. The suspensions of Antracol WP-70 exhibited slightly alkaline reactions with both water types during 24 hours. The spray liquids of Dithane M-70 mixed with tap or well water had neutral reaction after preparation and slightly alkaline reaction after 24 hours. The emulsions of Actellic-50 showed neutral reaction with both water types, followed by a pH increase in tap water after 24 hours. The solutions of Confidor200-SL had a slightly alkaline reaction after mixing and the pH value increased with both water types after 24 hours. It is therefore recommended to apply these insecticides directly after preparation. Mineral fertilizers considerably reduced pH values of the fungicide and insecticide components in double and triple mixtures, especially Ferticare nutrients which had a moderately acid reaction. Wuxal Super had a neutral reaction with both water types.The mixtures with well water increased pH values, which indicates that water pH does affect the pH value of the mixture. Both individual fertilizers and all mixtures (double and triple with Ferticare had pH values between 2.4 and 6, which allows their active liquids to be stored for 12 to 24 hours. The suspensions (Antracol WP-70, double and triple mixtures, emulsions (Actellic-50 and Actellic-50+Wuxal Super
MISR Dark Water aerosol retrievals: operational algorithm sensitivity to particle non-sphericity
Directory of Open Access Journals (Sweden)
O. V. Kalashnikova
2013-08-01
-sphericity artifacts occur at those view-illumination geometries where dust aerosols are indistinguishable from certain types of cirrus particles. Based on these results, we suggest that interested parties use caution with the version 22 MISR Dark Water aerosol non-sphericity product in situations where cirrus may be present.
Directory of Open Access Journals (Sweden)
A. J. Beyersdorf
2016-01-01
Full Text Available In order to utilize satellite-based aerosol measurements for the determination of air quality, the relationship between aerosol optical properties (wavelength-dependent, column-integrated extinction measured by satellites and mass measurements of aerosol loading (PM2.5 used for air quality monitoring must be understood. This connection varies with many factors including those specific to the aerosol type – such as composition, size, and hygroscopicity – and to the surrounding atmosphere, such as temperature, relative humidity (RH, and altitude, all of which can vary spatially and temporally. During the DISCOVER-AQ (Deriving Information on Surface conditions from Column and Vertically Resolved Observations Relevant to Air Quality project, extensive in situ atmospheric profiling in the Baltimore, MD–Washington, D.C. region was performed during 14 flights in July 2011. Identical flight plans and profile locations throughout the project provide meaningful statistics for determining the variability in and correlations between aerosol loading, composition, optical properties, and meteorological conditions. Measured water-soluble aerosol mass was composed primarily of ammonium sulfate (campaign average of 32 % and organics (57 %. A distinct difference in composition was observed, with high-loading days having a proportionally larger percentage of sulfate due to transport from the Ohio River Valley. This composition shift caused a change in the aerosol water-uptake potential (hygroscopicity such that higher relative contributions of inorganics increased the bulk aerosol hygroscopicity. These days also tended to have higher relative humidity, causing an increase in the water content of the aerosol. Conversely, low-aerosol-loading days had lower sulfate and higher black carbon contributions, causing lower single-scattering albedos (SSAs. The average black carbon concentrations were 240 ng m−3 in the lowest 1 km, decreasing to 35
Wintertime Arctic Ocean sea water properties and primary marine aerosol concentrations
Directory of Open Access Journals (Sweden)
J. Zábori
2012-11-01
Full Text Available Sea spray aerosols are an important part of the climate system through their direct and indirect effects. Due to the diminishing sea ice, the Arctic Ocean is one of the most rapidly changing sea spray aerosol source areas. However, the influence of these changes on primary particle production is not known.
In laboratory experiments we examined the influence of Arctic Ocean water temperature, salinity, and oxygen saturation on primary particle concentration characteristics. Sea water temperature was identified as the most important of these parameters. A strong decrease in sea spray aerosol production with increasing water temperature was observed for water temperatures between −1°C and 9°C. Aerosol number concentrations decreased from at least 1400 cm−3 to 350 cm−3. In general, the aerosol number size distribution exhibited a robust shape with one mode close to dry diameter Dp 0.2 μm with approximately 45% of particles at smaller sizes. Changes in sea water temperature did not result in pronounced change of the shape of the aerosol size distribution, only in the magnitude of the concentrations. Our experiments indicate that changes in aerosol emissions are most likely linked to changes of the physical properties of sea water at low temperatures. The observed strong dependence of sea spray aerosol concentrations on sea water temperature, with a large fraction of the emitted particles in the typical cloud condensation nuclei size range, provide strong arguments for a more careful consideration of this effect in climate models.
Klarich, Kathryn L.; Pflug, Nicholas C.; DeWald, Eden M.; Hladik, Michelle L.; Kolpin, Dana W.; Cwiertny, David M.; LeFevre, Gergory H.
2017-01-01
Neonicotinoid insecticides are widespread in surface waters across the agriculturally-intensive Midwestern US. We report for the first time the presence of three neonicotinoids in finished drinking water and demonstrate their general persistence during conventional water treatment. Periodic tap water grab samples were collected at the University of Iowa over seven weeks in 2016 (May-July) after maize/soy planting. Clothianidin, imidacloprid, and thiamethoxam were ubiquitously detected in finished water samples and ranged from 0.24-57.3 ng/L. Samples collected along the University of Iowa treatment train indicate no apparent removal of clothianidin and imidacloprid, with modest thiamethoxam removal (~50%). In contrast, the concentrations of all neonicotinoids were substantially lower in the Iowa City treatment facility finished water using granular activated carbon (GAC) filtration. Batch experiments investigated potential losses. Thiamethoxam losses are due to base-catalyzed hydrolysis at high pH conditions during lime softening. GAC rapidly and nearly completely removed all three neonicotinoids. Clothianidin is susceptible to reaction with free chlorine and may undergo at least partial transformation during chlorination. Our work provides new insights into the persistence of neonicotinoids and their potential for transformation during water treatment and distribution, while also identifying GAC as an effective management tool to lower neonicotinoid concentrations in finished drinking water.
CalWater 2 - Precipitation, Aerosols, and Pacific Atmospheric Rivers Experiment
Spackman, Ryan; Ralph, Marty; Prather, Kim; Cayan, Dan; DeMott, Paul; Dettinger, Mike; Fairall, Chris; Leung, Ruby; Rosenfeld, Daniel; Rutledge, Steven; Waliser, Duane; White, Allen
2014-05-01
Emerging research has identified two phenomena that play key roles in the variability of the water supply and the incidence of extreme precipitation events along the West Coast of the United States. These phenomena include the role of (1) atmospheric rivers (ARs) in delivering much of the precipitation associated with major storms along the U.S. West Coast, and (2) aerosols—from local sources as well as those transported from remote continents—and their modulating effects on western U.S. precipitation. A better understanding of these processes is needed to reduce uncertainties in weather predictions and climate projections of extreme precipitation and its effects, including the provision of beneficial water supply. This presentation summarizes science gaps associated with (1) the evolution and structure of ARs including cloud and precipitation processes and air-sea interaction, and (2) aerosol interaction with ARs and the impact on precipitation, including locally-generated aerosol effects on orographic precipitation along the U.S. West Coast. Observations are proposed for multiple winter seasons as part of a 5-year broad interagency vision referred to as CalWater 2 to address these science gaps (http://esrl.noaa.gov/psd/calwater). In the near term, a science investigation is being planned including a targeted set of aircraft and ship-based measurements and associated evaluation of data in near-shore regions of California and in the eastern Pacific for an intensive observing period between January 2015 and March 2015. DOE's Atmospheric Radiation Measurement (ARM) program and NOAA are coordinating on deployment of airborne and ship-borne facilities for this period in a DOE-sponsored study called ACAPEX (ARM Cloud Aerosol and Precipitation Experiment) to complement CalWater 2. The motivation for this major study is based on findings that have emerged in the last few years from airborne and ground-based studies including CalWater and NOAA's HydroMeterology Testbed
Aerosol behavior and light water reactor source terms
International Nuclear Information System (INIS)
Abbey, F.; Schikarski, W.O.
1988-01-01
The major developments in nuclear aerosol modeling following the accident to pressurized water reactor Unit 2 at Three Mile Island are briefly reviewed and the state of the art summarized. The importance and implications of these developments for severe accident source terms for light water reactors are then discussed in general terms. The treatment is not aimed at identifying specific source term values but is intended rather to illustrate trends, to assess the adequacy of the understanding of major aspects of aerosol behavior for source term prediction, and demonstrate in qualitative terms the effect of various aspects of reactor design. Areas where improved understanding of aerosol behavior might lead to further reductions in current source terms predictions are also considered
Directory of Open Access Journals (Sweden)
Ousmane Sy Savane
2015-03-01
Full Text Available Studies show a divergence in correlation between aerosol and cloud proxies, which has been thought of in the past as the results of varying physical mechanisms. Though modeling studies have supported this idea, from an observational standpoint it is difficult to attribute with confidence the correlations to specific physical mechanisms. We explore a methodology to assess the correlation between cloud water path and aerosol optical depth using Moderate-resolution Imaging Spectroradiometer (MODIS Aqua retrieved aerosol and cloud properties for absorbing and non-absorbing aerosol types over land and over the Atlantic Ocean for various meteorological conditions. The data covers a three-month period, June through August, during which different aerosol types are predominant in specific regions. Our approach eliminates outliers; sorts the data into aerosol bins; and the mean Aerosol Optical Depth (AOD value for each bin and the corresponding mean Cloud Water Path (CWP value are determined. The mean CWP is plotted against the mean AOD. The response curve for all aerosol types shows a peak CWP value corresponding to an aerosol loading value AODpeak. The peak is used to divide the total range of aerosol loading into two sub ranges. For AOD value below AODpeak, mean CWP and mean AOD are positively correlated. The correlation between mean CWP and mean AOD is negative for aerosol loading above AODpeak. Irrespective of aerosol type, atmospheric water vapor content and lower tropospheric static stability, the peak observed for each aerosol type seems to describe a universal feature that calls for further investigation. It has been observed for a variety of geographical locations and different seasons.
Comparing the mechanism of water condensation and evaporation in glassy aerosol.
Bones, David L; Reid, Jonathan P; Lienhard, Daniel M; Krieger, Ulrich K
2012-07-17
Atmospheric models generally assume that aerosol particles are in equilibrium with the surrounding gas phase. However, recent observations that secondary organic aerosols can exist in a glassy state have highlighted the need to more fully understand the kinetic limitations that may control water partitioning in ambient particles. Here, we explore the influence of slow water diffusion in the condensed aerosol phase on the rates of both condensation and evaporation, demonstrating that significant inhibition in mass transfer occurs for ultraviscous aerosol, not just for glassy aerosol. Using coarse mode (3-4 um radius) ternary sucrose/sodium chloride/aqueous droplets as a proxy for multicomponent ambient aerosol, we demonstrate that the timescale for particle equilibration correlates with bulk viscosity and can be ≫10(3) s. Extrapolation of these timescales to particle sizes in the accumulation mode (e.g., approximately 100 nm) by applying the Stokes-Einstein equation suggests that the kinetic limitations imposed on mass transfer of water by slow bulk phase diffusion must be more fully investigated for atmospheric aerosol. Measurements have been made on particles covering a range in dynamic viscosity from 10(13) Pa s. We also retrieve the radial inhomogeneities apparent in particle composition during condensation and evaporation and contrast the dynamics of slow dissolution of a viscous core into a labile shell during condensation with the slow percolation of water during evaporation through a more homogeneous viscous particle bulk.
Development of Raman-Mie lidar system for aerosol and water vapor profiling
Deng, Qian; Wang, Zhenzhu; Xu, Jiwei; Tan, Min; Wu, Decheng; Xie, Chenbo; Liu, Dong; Wang, Yingjian
2018-03-01
Aerosol and water vapor are two important atmospheric parameters. The accurate quantification of diurnal variation of these parameters are very useful for environment assessment and climate change studies. A moveable, compact and unattended lidar system based on modular design is developed for aerosol extinction coefficients and water vapor mixing ratios measurements. In the southern suburbs of Beijing, the continuous observation was carried out by this lidar since the middle of the year of 2017. The lidar equipment is presented and the case study is also described in this paper. The observational results show that the lidar kept a very good status from the long-time continuous measurements which is suitable for networking especially in meteorological research field.
Dry deposition of submicron atmospheric aerosol over water surfaces in motion
International Nuclear Information System (INIS)
Nevenick, Calec
2013-01-01
Whether by chronic or accidental releases, the impact of a nuclear installation on the environment mainly depends on atmospheric transfers; and as the accidents at Chernobyl and Fukushima show, affect the contamination of surfaces and impacts in the medium and long-term on the environment and the population. In this context, this work focuses on the characterization and modeling of dry deposition of submicron aerosols on liquid surfaces in motion such as rivers. Unlike wet deposition which is conditioned by washout and rainout (rain and clouds), dry deposition is a phenomenon that depends entirely on the characteristics of aerosols, receiving surfaces, and air flow. In practice, the evaluation of dry deposition is based on the estimation of flux modeling as the product of particle concentration and deposition velocity which can vary over several orders of magnitude depending on the receiving surfaces (forest, snow, urban, grassland...). This topic is motivated by the virtual non-existence of studies on the mechanisms of dry deposition on continental water systems such as rivers; and respect for submicron aerosols. They have the lowest deposition efficiencies and filtration and the longer residence time in the atmosphere. In addition, they are potentially the most dangerous to living beings because they can penetrate deeper into the airway. Due to the lack of data on the dry deposition of submicron aerosols on a liquid surface in motion, the approach was based on two axes: 1) the acquisition of experimental deposition velocities and 2) the analysis and interpretation of results through modeling. The experiments were performed with uranine aerosols released into the IOA wind tunnel (Interface Ocean Atmosphere) of the Institute for Research on Non Equilibrium Phenomena which is configured to study the coupling between the air flow and water. These experiments have given many dry deposition velocities for different configurations characterized according to wind
Dry deposition of submicron atmospheric aerosol over water surfaces in motion
International Nuclear Information System (INIS)
Calec, Nevenick
2013-01-01
Whether by chronic or accidental releases, the impact of a nuclear installation on the environment mainly depends on atmospheric transfers; and as the accidents at Chernobyl and Fukushima show, affect the contamination of surfaces and impacts in the medium and long-term on the environment and the population. In this context, this work focuses on the characterization and modeling of dry deposition of submicron aerosols on liquid surfaces in motion such as rivers. Unlike wet deposition which is conditioned by washout and rainout (rain and clouds), dry deposition is a phenomenon that depends entirely on the characteristics of aerosols, receiving surfaces, and air flow. In practice, the evaluation of dry deposition is based on the estimation of flux modeling as the product of particle concentration and deposition velocity which can vary over several orders of magnitude depending on the receiving surfaces (forest, snow, urban, grassland..). This topic is motivated by the virtual non-existence of studies on the mechanisms of dry deposition on continental water systems such as rivers; and respect for submicron aerosols. They have the lowest deposition efficiencies and filtration and the longer residence time in the atmosphere. In addition, they are potentially the most dangerous to living beings because they can penetrate deeper into the airway. Due to the lack of data on the dry deposition of submicron aerosols on a liquid surface in motion, the approach was based on two axes: 1) the acquisition of experimental deposition velocities and 2) the analysis and interpretation of results through modeling. The experiments were performed with uranine aerosols released into the IOA wind tunnel (Interface Ocean Atmosphere) of the Institute for Research on Non Equilibrium Phenomena which is configured to study the coupling between the air flow and water. These experiments have given many dry deposition velocities for different configurations characterized according to wind
Jha, Vandana
In this study we examine the cumulative effect of dust acting as cloud nucleating aerosol (cloud condensation nuclei (CCN), giant cloud condensation nuclei (GCCN), and ice nuclei (IN)) along with anthropogenic aerosol pollution acting primarily as CCN, over the entire Colorado Rocky Mountains from the months of October to April in the year 2004-2005; the snow year. This ˜6.5 months analysis provides a range of snowfall totals and variability in dust and anthropogenic aerosol pollution. The specific objectives of this research is to quantify the impacts of both dust and pollution aerosols on wintertime precipitation in the Colorado Mountains using the Regional Atmospheric Modeling System (RAMS). In general, dust enhances precipitation primarily by acting as IN, while aerosol pollution reduces water resources in the CRB via the so-called "spill-over" effect, by enhancing cloud droplet concentrations and reducing riming rates. Dust is more episodic and aerosol pollution is more pervasive throughout the winter season. Combined response to dust and aerosol pollution is a net reduction of water resources in the CRB. The question is by how much are those water resources affected? Our best estimate is that total winter-season precipitation loss for for the CRB the 2004-2005 winter season due to the combined influence of aerosol pollution and dust is 5,380,00 acre-feet of water. Sensitivity studies for different cases have also been run for the specific cases in 2004-2005 winter season to analyze the impact of changing dust and aerosol ratios on precipitation in the Colorado River Basin. The dust is varied from 3 to 10 times in the experiments and the response is found to be non monotonic and depends on various environmental factors. The sensitivity studies show that adding dust in a wet system increases precipitation when IN affects are dominant. For a relatively dry system high concentrations of dust can result in over-seeding the clouds and reductions in precipitation
Characterizing the Vertical Distribution of Aerosols using Ground-based Multiwavelength Lidar Data
Ferrare, R. A.; Thorsen, T. J.; Clayton, M.; Mueller, D.; Chemyakin, E.; Burton, S. P.; Goldsmith, J.; Holz, R.; Kuehn, R.; Eloranta, E. W.; Marais, W.; Newsom, R. K.; Liu, X.; Sawamura, P.; Holben, B. N.; Hostetler, C. A.
2016-12-01
Observations of aerosol optical and microphysical properties are critical for developing and evaluating aerosol transport model parameterizations and assessing global aerosol-radiation impacts on climate. During the Combined HSRL And Raman lidar Measurement Study (CHARMS), we investigated the synergistic use of ground-based Raman lidar and High Spectral Resolution Lidar (HSRL) measurements to retrieve aerosol properties aloft. Continuous (24/7) operation of these co-located lidars during the ten-week CHARMS mission (mid-July through September 2015) allowed the acquisition of a unique, multiwavelength ground-based lidar dataset for studying aerosol properties above the Southern Great Plains (SGP) site. The ARM Raman lidar measured profiles of aerosol backscatter, extinction and depolarization at 355 nm as well as profiles of water vapor mixing ratio and temperature. The University of Wisconsin HSRL simultaneously measured profiles of aerosol backscatter, extinction and depolarization at 532 nm and aerosol backscatter at 1064 nm. Recent advances in both lidar retrieval theory and algorithm development demonstrate that vertically-resolved retrievals using such multiwavelength lidar measurements of aerosol backscatter and extinction can help constrain both the aerosol optical (e.g. complex refractive index, scattering, etc.) and microphysical properties (e.g. effective radius, concentrations) as well as provide qualitative aerosol classification. Based on this work, the NASA Langley Research Center (LaRC) HSRL group developed automated algorithms for classifying and retrieving aerosol optical and microphysical properties, demonstrated these retrievals using data from the unique NASA/LaRC airborne multiwavelength HSRL-2 system, and validated the results using coincident airborne in situ data. We apply these algorithms to the CHARMS multiwavelength (Raman+HSRL) lidar dataset to retrieve aerosol properties above the SGP site. We present some profiles of aerosol effective
Kawakami, Tsuyoshi; Isama, Kazuo; Ikarashi, Yoshiaki
2015-01-01
Japan has published safety guideline on waterproof aerosol sprays. Furthermore, the Aerosol Industry Association of Japan has adopted voluntary regulations on waterproof aerosol sprays. Aerosol particles of diameter less than 10 µm are considered as "fine particles". In order to avoid acute lung injury, this size fraction should account for less than 0.6% of the sprayed aerosol particles. In contrast, the particle size distribution of aerosols released by hand-pump sprays containing fluorine-based or silicone-based compounds have not been investigated in Japan. Thus, the present study investigated the aerosol particle size distribution of 16 household hand-pump sprays. In 4 samples, the ratio of fine particles in aerosols exceeded 0.6%. This study confirmed that several hand-pump sprays available in the Japanese market can spray fine particles. Since the hand-pump sprays use water as a solvent and their ingredients may be more hydrophilic than those of aerosol sprays, the concepts related to the safety of aerosol-sprays do not apply to the hand pump sprays. Therefore, it may be required for the hand-pump spray to develop a suitable method for evaluating the toxicity and to establish the safety guideline.
Gao, Meng; Zhai, Peng-Wang; Franz, Bryan; Hu, Yongxiang; Knobelspiesse, Kirk; Werdell, P Jeremy; Ibrahim, Amir; Xu, Feng; Cairns, Brian
2018-04-02
Ocean color remote sensing is an important tool to monitor water quality and biogeochemical conditions of ocean. Atmospheric correction, which obtains water-leaving radiance from the total radiance measured by satellite-borne or airborne sensors, remains a challenging task for coastal waters due to the complex optical properties of aerosols and ocean waters. In this paper, we report a research algorithm on aerosol and ocean color retrieval with emphasis on coastal waters, which uses coupled atmosphere and ocean radiative transfer model to fit polarized radiance measurements at multiple viewing angles and multiple wavelengths. Ocean optical properties are characterized by a generalized bio-optical model with direct accounting for the absorption and scattering of phytoplankton, colored dissolved organic matter (CDOM) and non-algal particles (NAP). Our retrieval algorithm can accurately determine the water-leaving radiance and aerosol properties for coastal waters, and may be used to improve the atmospheric correction when apply to a hyperspectral ocean color instrument.
Schleier, Jerome J.; Peterson, Robert K.D.; Irvine, Kathryn M.; Marshall, Lucy M.; Weaver, David K.; Preftakes, Collin J.
2012-01-01
One of the more effective ways of managing high densities of adult mosquitoes that vector human and animal pathogens is ultra-low-volume (ULV) aerosol applications of insecticides. The U.S. Environmental Protection Agency uses models that are not validated for ULV insecticide applications and exposure assumptions to perform their human and ecological risk assessments. Currently, there is no validated model that can accurately predict deposition of insecticides applied using ULV technology for adult mosquito management. In addition, little is known about the deposition and drift of small droplets like those used under conditions encountered during ULV applications. The objective of this study was to perform field studies to measure environmental concentrations of insecticides and to develop a validated model to predict the deposition of ULV insecticides. The final regression model was selected by minimizing the Bayesian Information Criterion and its prediction performance was evaluated using k-fold cross validation. Density of the formulation and the density and CMD interaction coefficients were the largest in the model. The results showed that as density of the formulation decreases, deposition increases. The interaction of density and CMD showed that higher density formulations and larger droplets resulted in greater deposition. These results are supported by the aerosol physics literature. A k-fold cross validation demonstrated that the mean square error of the selected regression model is not biased, and the mean square error and mean square prediction error indicated good predictive ability.
MODIS Retrieval of Aerosol Optical Depth over Turbid Coastal Water
Directory of Open Access Journals (Sweden)
Yi Wang
2017-06-01
Full Text Available We present a new approach to retrieve Aerosol Optical Depth (AOD using the Moderate Resolution Imaging Spectroradiometer (MODIS over the turbid coastal water. This approach supplements the operational Dark Target (DT aerosol retrieval algorithm that currently does not conduct AOD retrieval in shallow waters that have visible sediments or sea-floor (i.e., Class 2 waters. Over the global coastal water regions in cloud-free conditions, coastal screening leads to ~20% unavailability of AOD retrievals. Here, we refine the MODIS DT algorithm by considering that water-leaving radiance at 2.1 μm to be negligible regardless of water turbidity, and therefore the 2.1 μm reflectance at the top of the atmosphere is sensitive to both change of fine-mode and coarse-mode AODs. By assuming that the aerosol single scattering properties over coastal turbid water are similar to those over the adjacent open-ocean pixels, the new algorithm can derive AOD over these shallow waters. The test algorithm yields ~18% more MODIS-AERONET collocated pairs for six AERONET stations in the coastal water regions. Furthermore, comparison of the new retrieval with these AERONET observations show that the new AOD retrievals have equivalent or better accuracy than those retrieved by the MODIS operational algorithm’s over coastal land and non-turbid coastal water product. Combining the new retrievals with the existing MODIS operational retrievals yields an overall improvement of AOD over those coastal water regions. Most importantly, this refinement extends the spatial and temporal coverage of MODIS AOD retrievals over the coastal regions where 60% of human population resides. This expanded coverage is crucial for better understanding of impact of anthropogenic aerosol particles on coastal air quality and climate.
Influence of organic films on the evaporation and condensation of water in aerosol.
Davies, James F; Miles, Rachael E H; Haddrell, Allen E; Reid, Jonathan P
2013-05-28
Uncertainties in quantifying the kinetics of evaporation and condensation of water from atmospheric aerosol are a significant contributor to the uncertainty in predicting cloud droplet number and the indirect effect of aerosols on climate. The influence of aerosol particle surface composition, particularly the impact of surface active organic films, on the condensation and evaporation coefficients remains ambiguous. Here, we report measurements of the influence of organic films on the evaporation and condensation of water from aerosol particles. Significant reductions in the evaporation coefficient are shown to result when condensed films are formed by monolayers of long-chain alcohols [C(n)H(2n+1)OH], with the value decreasing from 2.4 × 10(-3) to 1.7 × 10(-5) as n increases from 12 to 17. Temperature-dependent measurements confirm that a condensed film of long-range order must be formed to suppress the evaporation coefficient below 0.05. The condensation of water on a droplet coated in a condensed film is shown to be fast, with strong coherence of the long-chain alcohol molecules leading to islanding as the water droplet grows, opening up broad areas of uncoated surface on which water can condense rapidly. We conclude that multicomponent composition of organic films on the surface of atmospheric aerosol particles is likely to preclude the formation of condensed films and that the kinetics of water condensation during the activation of aerosol to form cloud droplets is likely to remain rapid.
Influence of organic films on the evaporation and condensation of water in aerosol
Davies, James F.; Miles, Rachael E. H.; Haddrell, Allen E.; Reid, Jonathan P.
2013-01-01
Uncertainties in quantifying the kinetics of evaporation and condensation of water from atmospheric aerosol are a significant contributor to the uncertainty in predicting cloud droplet number and the indirect effect of aerosols on climate. The influence of aerosol particle surface composition, particularly the impact of surface active organic films, on the condensation and evaporation coefficients remains ambiguous. Here, we report measurements of the influence of organic films on the evaporation and condensation of water from aerosol particles. Significant reductions in the evaporation coefficient are shown to result when condensed films are formed by monolayers of long-chain alcohols [CnH(2n+1)OH], with the value decreasing from 2.4 × 10−3 to 1.7 × 10−5 as n increases from 12 to 17. Temperature-dependent measurements confirm that a condensed film of long-range order must be formed to suppress the evaporation coefficient below 0.05. The condensation of water on a droplet coated in a condensed film is shown to be fast, with strong coherence of the long-chain alcohol molecules leading to islanding as the water droplet grows, opening up broad areas of uncoated surface on which water can condense rapidly. We conclude that multicomponent composition of organic films on the surface of atmospheric aerosol particles is likely to preclude the formation of condensed films and that the kinetics of water condensation during the activation of aerosol to form cloud droplets is likely to remain rapid. PMID:23674675
Formulation of insecticide profenofos using Surfactant Diethanolamide (DEA) based on palm olein
Dewi, H. S.; Rahayuningsih, M.; Hambali, E.
2017-05-01
Soybean is one of the major food commodities in Indonesia that the consumption is increasing each year, but this is not in line with the domestic soybean production capacity. One cause of the low production capacity is the armyworm attact. Generally, the armyworm attack controled by spread insecticide profenofos. Profenofos need to be dissolved, but profenofos couldn’t dissolved in water. So that, it need the right formulation between the solvent and other ingredients which can supprotprofenofos performance. One of that ingredient is surfactant. This research used surfactant diethanolamide (DEA) based on palm olein. DEAfunction in insecticide formulation are as homogenizer, dispersant, sticker and spreader agent.The aims of this research are to obtain the best emultion insecticide product based on profenofos as the active ingredients and DEA as the surfactant, moreover it also to obtain information of the physico-chemical properties. The formulation test performed with compeletely randomized design (CRD) with two factors, first factor is DEA concentrationand the second factor is profenofos concentration. Data of physico-chemical properties test was analyzed by analysis of variance (ANOVA) and significant result tested by Duncant Multiple Range Test (DMRT).The result showed that, surfactant DEA could make good emultion between profenofos and sodium ethoxide as the solvent. The best treatment which obtain from formulation stage is concentrate with DEA 10% and profenofos 40%. Physico-chemical properties test result showed that droplet size is 1,76-2,07 µm, contact angle 11,575-24,218°, density 0,996-0,998 g/cm3, surface tension 16,56-40,72 dyne/cm, viscosity 1,032-1,078 Cp and pH 6,87-8,22.
Hu, Lu; Wang, Huazi; Qian, Heng; Liu, Chaoran; Lu, Runhua; Zhang, Sanbing; Zhou, Wenfeng; Gao, Haixiang; Xu, Donghui
2016-11-11
An on-site dispersive liquid liquid microextraction base on the solidification of switchable solvent has been developed as a simple, rapid and eco-friendly sample extraction method for the fast determination of pyrethroid insecticides in aqueous samples using high-performance liquid chromatography with ultraviolet detection. In this extraction method, medium-chain saturated fatty acids (n≥10), which can rapidly solidify at low temperatures (centrifugation. The microextraction process was performed in a 10mL syringe and the pretreatment process could thus be finished in 5min. No external energy resources were required in this method, which makes it a potential method for on-site extraction. The optimal experimental parameters were as follows: 350μL of decanoic acid (1mol/L) was used as the extraction solvent, 150μL of sulfuric acid (2mol/L) was used to decrease the pH of the samples, no salt was added, and the temperature of the samples was in the range of 20-40°C. Finally, the sample was cooled in an ice bath for three minutes. Under these optimal conditions, good responses for four pyrethroid insecticides were obtained in the concentration ranges of 1-500μg/L, with coefficients of determination greater than 0.9993. The recoveries of the four pyrethroid insecticides ranged from 84.7 to 95.3%, with relative standard deviations ranging from 1.6 to 4.6%. The limits of detection based on a signal-to-noise ratio of 3 were in the range of 0.24-0.68μg/L, and the enrichment factors were in the range of 121-136. The results demonstrate that this method was successfully applied to determine pyrethroid insecticides in real water samples. No centrifugation or any special apparatus are required, make this a promising method for rapid field-sampling procedures. Copyright © 2016 Elsevier B.V. All rights reserved.
Aerosol optical properties and precipitable water vapor column in the atmosphere of Norway.
Muyimbwa, Dennis; Frette, Øyvind; Stamnes, Jakob J; Ssenyonga, Taddeo; Chen, Yi-Chun; Hamre, Børge
2015-02-20
Between February 2012 and April 2014, we measured and analyzed direct solar radiances at a ground-based station in Bergen, Norway. We discovered that the spectral aerosol optical thickness (AOT) and precipitable water vapor column (PWVC) retrieved from these measurements have a seasonal variation with highest values in summer and lowest values in winter. The highest value of the monthly median AOT at 440 nm of about 0.16 was measured in July and the lowest of about 0.04 was measured in December. The highest value of the monthly median PWVC of about 2.0 cm was measured in July and the lowest of about 0.4 cm was measured in December. We derived Ångström exponents that were used to deduce aerosol particle size distributions. We found that coarse-mode aerosol particles dominated most of the time during the measurement period, but fine-mode aerosol particles dominated during the winter seasons. The derived Ångström exponent values suggested that aerosols containing sea salt could have been dominating at this station during the measurement period.
2010-01-01
deionized water. One percent oil concentration was used based on commercial botanical insecticides such as Neem (Azadiractin), Ecotrol (Rosmarinus...analyses for E. capillifolium oil and two commercial insecticides (Malathion, Neem ) topically applied to adult azalea lace bugs, S. pyrioides...0.93 (0.06) . . . 262.58 < 0.0001 exposure time . 695 0.44 (0.04) . . . 135.87 < 0.0001 a Malathion and Neem used as positive baseline controls for
Sareen, N.; McNeill, V. F.
2011-12-01
In recent years, glyoxal and methylglyoxal have emerged to be potentially important SOA precursors with significant implications for climate-related aerosol properties. Here we will discuss how the chemistry of these and similar organic compounds in aerosol water can affect the aerosol optical and cloud formation properties. Aqueous-phase SOA production from glyoxal and methylglyoxal is a potential source of strongly light-absorbing organics, or "brown carbon". We characterized the kinetics of brown carbon formation from these precursors in mixtures of ammonium sulfate and water using UV-Vis spectrophotometry. This mechanism has been incorporated into a photochemical box model with coupled gas phase-aqueous aerosol chemistry. Methylglyoxal and related compounds also may impact an aerosol's ability to act as a cloud condensation nucleus. We recently showed via pendant drop tensiometry and aerosol chamber studies that uptake of methylglyoxal from the gas phase driven by aqueous-phase oligomerization chemistry is a potentially significant, previously unidentified source of surface-active organic material in aerosols. Results from pendant drop tensiometry showed significantly depressed surface tension in methylglyoxal-ammonium sulfate solutions. We further found that ammonium sulfate particles exposed to gas-phase methylglyoxal in a 3.5 m3 aerosol reaction chamber activate into cloud droplets at sizes up to 15% lower at a given supersaturation than do pure ammonium sulfate particles. The observed enhancement exceeds that predicted based on Henry's Law and our measurements of surface tension depression in bulk solutions, suggesting that surface adsorption of methylglyoxal plays a role in determining CCN activity. Methylglyoxal and similar gas-phase surfactants may be an important and overlooked source of enhanced CCN activity in the atmosphere. To characterize the SOA products formed in these solutions, an Aerosol Chemical Ionization Mass Spectrometer (CIMS) was used
Biomass burning and its effects on fine aerosol acidity, water content and nitrogen partitioning
Bougiatioti, Aikaterini; Nenes, Athanasios; Paraskevopoulou, Despina; Fourtziou, Luciana; Stavroulas, Iasonas; Liakakou, Eleni; Myriokefalitakis, Stelios; Daskalakis, Nikos; Weber, Rodney; Kanakidou, Maria; Gerasopoulos, Evangelos; Mihalopoulos, Nikolaos
2017-04-01
Aerosol acidity is an important property that drives the partitioning of semi-volatile species, the formation of secondary particulate matter and metal and nutrient solubility. Aerosol acidity varies considerably between aerosol types, RH, temperature, the degree of atmospheric chemical aging and may also change during transport. Among aerosol different sources, sea salt and dust have been well studied and their impact on aerosol acidity and water uptake is more or less understood. Biomass burning (BB) on the other hand, despite its significance as a source in a regional and global scale, is much less understood. Currently, there is no practical and accurate enough method, to directly measure the pH of in-situ aerosol. The combination of thermodynamic models, with targeted experimental observations can provide reliable predictions of aerosol particle water and pH, using as input the concentration of gas/aerosol species, temperature (T), and relative humidity (RH). As such an example, ISORROPIA-II (Fountoukis and Nenes, 2007) has been used for the thermodynamic analysis of measurements conducted in downtown Athens during winter 2013, in order to evaluate the effect of BB on aerosol water and acidity. Biomass burning, especially during night time, was found to contribute significantly to the increased organics concentrations, but as well to the BC component associated with wood burning, particulate nitrates, chloride, and potassium. These increased concentrations were found to impact on fine aerosol water, with Winorg having an average concentration of 11±14 μg m-3 and Worg 12±19 μg m-3 with the organic component constituting almost 38% of the total calculated submicron water. When investigating the fine aerosol acidity it was derived that aerosol was generally acidic, with average pH during strong BB influence of 2.8±0.5, value similar to the pH observed for regional aerosol influenced by important biomass burning episodes at the remote background site of
Vertical Distribution of Dust and Water Ice Aerosols from CRISM Limb-geometry Observations
Smith, Michael Doyle; Wolff, Michael J.; Clancy, Todd; Kleinbohl, Armin; Murchie, Scott L.
2013-01-01
[1] Near-infrared spectra taken in a limb-viewing geometry by the Compact Reconnaissance Imaging Spectrometer for Mars (CRISM) on board the Mars Reconnaissance Orbiter provide a useful tool for probing atmospheric structure. Specifically, the observed radiance as a function of wavelength and height above the limb enables the vertical distribution of both dust and water ice aerosols to be retrieved. More than a dozen sets of CRISM limb observations have been taken so far providing pole-to-pole cross sections, spanning more than a full Martian year. Radiative transfer modeling is used to model the observations taking into account multiple scattering from aerosols and the spherical geometry of the limb observations. Both dust and water ice vertical profiles often show a significant vertical structure for nearly all seasons and latitudes that is not consistent with the well-mixed or Conrath-v assumptions that have often been used in the past for describing aerosol vertical profiles for retrieval and modeling purposes. Significant variations are seen in the retrieved vertical profiles of dust and water ice aerosol as a function of season. Dust typically extends to higher altitudes (approx. 40-50km) during the perihelion season than during the aphelion season (water ice clouds are common, and water ice aerosols are observed to cap the dust layer in all seasons.
Impact of fog processing on water soluble organic aerosols.
Tripathi, S. N.; Chakraborty, A.; Gupta, T.
2017-12-01
Fog is a natural meteorological phenomenon that occurs all around the world, and contains a substantial quantity of liquid water. Fog is generally seen as a natural cleansing agent but can also form secondary organic aerosols (SOA) via aqueous processing of ambient organics. Few field studies have reported elevated O/C ratio and SOA mass during or after fog events. However, mechanism behind aqueous SOA formation and its contribution to total organic aerosols (OA) still remains unclear. In this study we have tried to explore the impact of fog/aqueous processing on the characteristics of water soluble organic aerosols (WSOC), which to our knowledge has not been studied before. To assess this, both online (using HR-ToF-AMS) and offline (using a medium volume PM2.5 sampler and quartz filter) aerosol sampling were carried out at Kanpur, India from 15 December 2014 - 10 February 2015. Further, offline analysis of the aqueous extracts of the collected filters were carried out by AMS to characterize the water soluble OA (WSOA). Several (17) fog events occurred during the campaign and high concentrations of OA (151 ± 68 µg/m3) and WSOA (47 ± 19 µg/m3) were observed. WSOA/OA ratios were similar during fog (0.36 ± 0.14) and nofog (0.34 ± 0.15) periods. WSOA concentrations were also similar (slightly higher) during foggy (49 ± 18 µg/m3) and non-foggy periods (46 ± 20 µg/m3), in spite of fog scavenging. However, WSOA was more oxidized during foggy period (average O/C = 0.81) than non foggy periods (average O/C = 0.70). Like WSOA, OA was also more oxidized during foggy periods (average O/C = 0.64) than non foggy periods (average O/C = 0.53). During fog, WSOA to WIOA (water insoluble OA) ratios were higher (0.65 ± 0.16) compared to non foggy periods (0.56 ± 0.15). These observations clearly showed that WSOA become more dominant and processed during fog events, possibly due to the presence of fog droplets. This study highlights that fog processing of soluble organics
Brogan, William R; Relyea, Rick A
2017-01-01
Understanding the processes that regulate contaminant impacts in nature is an increasingly important challenge. For insecticides in surface waters, the ability of aquatic plants to sorb, or bind, hydrophobic compounds has been identified as a primary mechanism by which toxicity can be mitigated (i.e. the sorption-based model). However, recent research shows that submerged plants can also rapidly mitigate the toxicity of the less hydrophobic insecticide malathion via alkaline hydrolysis (i.e. the hydrolysis-based model) driven by increased water pH resulting from photosynthesis. However, it is still unknown how generalizable these mitigation mechanisms are across the wide variety of insecticides applied today, and whether any general rules can be ascertained about which types of chemicals may be mitigated by each mechanism. We quantified the degree to which the submerged plant Elodea canadensis mitigated acute (48-h) toxicity to Daphnia magna using nine commonly applied insecticides spanning three chemical classes (carbamates: aldicarb, carbaryl, carbofuran; organophosphates: malathion, diazinon, chlorpyrifos; pyrethroids: permethrin, bifenthrin, lambda-cyhalothrin). We found that insecticides possessing either high octanol-water partition coefficients (log K ow ) values (i.e. pyrethroids) or high susceptibility to alkaline hydrolysis (i.e. carbamates and malathion) were all mitigated to some degree by E. canadensis, while the plant had no effect on insecticides possessing intermediate log K ow values and low susceptibility to hydrolysis (i.e. chlorpyrifos and diazinon). Our results provide the first general insights into which types of insecticides are likely to be mitigated by different mechanisms based on known chemical properties. We suggest that current models and mitigation strategies would be improved by the consideration of both mitigation models. Copyright © 2016 Elsevier Ltd. All rights reserved.
Efficacy of Selected Insecticides Applied to Hybrid Rice Seed
Adams, A.; Gore, J.; Musser, F.; Cook, D.; Walker, T.; Dobbins, C.
2016-01-01
Hybrid rice and insecticide seed treatments targeting rice water weevil, Lissorhoptrus oryzophilus Kuschel, have altered the landscape of rice production. The effect of reduced seeding rates on seed treatment efficacy in hybrid rice has not been studied. During 2011 and 2012, an experiment was conducted at seven locations to determine the relationship between low seeding rates used in hybrid rice and efficacy of selected insecticidal seed treatments as measured by rice water weevil densities and yield. Labeled rates of thiamethoxam, chlorantraniliprole, and clothianidin were compared with higher rates of these products to determine if labeled rates provide an acceptable level of control of the rice water weevil. Study locations were divided into low, moderate, and high groups based on rice water weevil larval densities. All seed treatments and seed treatment rates reduced rice water weevil densities. However, there was no observed yield or economic benefit from the use of an insecticidal seed treatment in areas of low pressure. Differences in yield were observed among seed treatments and seed treatment rates in moderate and high pressure locations, and all seed treatments yielded better than the untreated plots, but these differences were not always economical. All seed treatments showed an economic advantage in areas of high weevil pressure, and there were no differences among seed treatment products or rates, suggesting that currently labeled seed treatment rates in hybrid rice are effective for rice water weevil management. PMID:26537671
Hudait, Arpa; Molinero, Valeria
2014-06-04
Atmospheric aerosols have a strong influence on Earth's climate. Elucidating the physical state and internal structure of atmospheric aqueous aerosols is essential to predict their gas and water uptake, and the locus and rate of atmospherically important heterogeneous reactions. Ultrafine aerosols with sizes between 3 and 15 nm have been detected in large numbers in the troposphere and tropopause. Nanoscopic aerosols arising from bubble bursting of natural and artificial seawater have been identified in laboratory and field experiments. The internal structure and phase state of these aerosols, however, cannot yet be determined in experiments. Here we use molecular simulations to investigate the phase behavior and internal structure of liquid, vitrified, and crystallized water-salt ultrafine aerosols with radii from 2.5 to 9.5 nm and with up to 10% moles of ions. We find that both ice crystallization and vitrification of the nanodroplets lead to demixing of pure water from the solutions. Vitrification of aqueous nanodroplets yields nanodomains of pure low-density amorphous ice in coexistence with vitrified solute rich aqueous glass. The melting temperature of ice in the aerosols decreases monotonically with an increase of solute fraction and decrease of radius. The simulations reveal that nucleation of ice occurs homogeneously at the subsurface of the water-salt nanoparticles. Subsequent ice growth yields phase-segregated, internally mixed, aerosols with two phases in equilibrium: a concentrated water-salt amorphous mixture and a spherical cap-like ice nanophase. The surface of the crystallized aerosols is heterogeneous, with ice and solution exposed to the vapor. Free energy calculations indicate that as the concentration of salt in the particles, the advance of the crystallization, or the size of the particles increase, the stability of the spherical cap structure increases with respect to the alternative structure in which a core of ice is fully surrounded by
A short history of insecticides
Directory of Open Access Journals (Sweden)
Oberemok Volodymyr Volodymyrovych
2015-07-01
Full Text Available This review contains a brief history of the use of insecticides. The peculiarities, main advantages, and disadvantages of some modern insecticides are described. The names of the discoverers of some of the most popular insecticide preparations on the world market, are listed. The tendencies to find new insecticides to control the quantity of phytophagous insects are discussed. Special attention is paid to the perspective of creating preparations based on nucleic acids, in particular DNA insecticides. The use of insect-specific, short single-stranded DNA fragments as DNA insecticides, is paving the way in the field of “intellectual” insecticides that “think” before they act. It is worth noting, though, that in the near future, the quantity of produced insecticides will increase due to the challenges associated with food production for a rapidly growing population. It is concluded, that an agreeable interaction of scientists and manufacturers of insecticides should lead to the selection of the most optimal solutions for insect pest control, which would be safe, affordable, and effective at the same time.
Jing, Bo; Wang, Zhen; Tan, Fang; Guo, Yucong; Tong, Shengrui; Wang, Weigang; Zhang, Yunhong; Ge, Maofa
2018-04-01
While nitrate salts have critical impacts on environmental effects of atmospheric aerosols, the effects of coexisting species on hygroscopicity of nitrate salts remain uncertain. The hygroscopic behaviors of nitrate salt aerosols (NH4NO3, NaNO3, Ca(NO3)2) and their internal mixtures with water-soluble organic acids were determined using a hygroscopicity tandem differential mobility analyzer (HTDMA). The nitrate salt / organic acid mixed aerosols exhibit varying phase behavior and hygroscopic growth depending upon the type of components in the particles. Whereas pure nitrate salt particles show continuous water uptake with increasing relative humidity (RH), the deliquescence transition is still observed for ammonium nitrate particles internally mixed with organic acids such as oxalic acid and succinic acid with a high deliquescence point. The hygroscopicity of submicron aerosols containing sodium nitrate and an organic acid is also characterized by continuous growth, indicating that sodium nitrate tends to exist in a liquid-like state under dry conditions. It is observed that in contrast to the pure components, the water uptake is hindered at low and moderate RH for calcium nitrate particles containing malonic acid or phthalic acid, suggesting the potential effects of mass transfer limitation in highly viscous mixed systems. Our findings improve fundamental understanding of the phase behavior and water uptake of nitrate-salt-containing aerosols in the atmospheric environment.
Directory of Open Access Journals (Sweden)
B. Jing
2018-04-01
Full Text Available While nitrate salts have critical impacts on environmental effects of atmospheric aerosols, the effects of coexisting species on hygroscopicity of nitrate salts remain uncertain. The hygroscopic behaviors of nitrate salt aerosols (NH4NO3, NaNO3, Ca(NO32 and their internal mixtures with water-soluble organic acids were determined using a hygroscopicity tandem differential mobility analyzer (HTDMA. The nitrate salt ∕ organic acid mixed aerosols exhibit varying phase behavior and hygroscopic growth depending upon the type of components in the particles. Whereas pure nitrate salt particles show continuous water uptake with increasing relative humidity (RH, the deliquescence transition is still observed for ammonium nitrate particles internally mixed with organic acids such as oxalic acid and succinic acid with a high deliquescence point. The hygroscopicity of submicron aerosols containing sodium nitrate and an organic acid is also characterized by continuous growth, indicating that sodium nitrate tends to exist in a liquid-like state under dry conditions. It is observed that in contrast to the pure components, the water uptake is hindered at low and moderate RH for calcium nitrate particles containing malonic acid or phthalic acid, suggesting the potential effects of mass transfer limitation in highly viscous mixed systems. Our findings improve fundamental understanding of the phase behavior and water uptake of nitrate-salt-containing aerosols in the atmospheric environment.
Energy Technology Data Exchange (ETDEWEB)
Lee, Jong Chan; Jung, Woo Young; Lee, Hyun Chul; Lee, Doo Young [FNC TECH., Yongin (Korea, Republic of)
2016-05-15
Optical Particle Counter (OPC) is used to provide real-time measurement of aerosol concentration and size distribution. Glass fiber membrane filter also be used to measure average mass concentration. Three tests (MTA-1, 2 and 3) have been conducted to study thermal-hydraulic effect, a filtering tendency at given SiO{sub 2} particles. Based on the experimental results, the experiment will be carried out further with a main carrier gas of steam and different aerosol size. The test results will provide representative behavior of the aerosols under various conditions. The aim of the tests, MTA 1, 2 and 3, are to be able to 1) establish the test manuals for aerosol generation, mixing, sampling and measurement system, which defines aerosol preparation, calibration, operating and evaluation method under high pressure and high temperature 2) develop commercial aerosol test modules applicable to the thermal power plant, environmental industry, automobile exhaust gas, chemical plant, HVAC system including nuclear power plant. Based on the test results, sampled aerosol particles in the filter indicate that important parameters affecting aerosol behavior aerosols are 1) system temperature to keep above a evaporation temperature of ethanol and 2) aerosol losses due to the settling by ethanol liquid droplet.
Jung, Jinsang; Lee, Hanlim; Kim, Young J; Liu, Xingang; Zhang, Yuanhang; Gu, Jianwei; Fan, Shaojia
2009-08-01
Optical and chemical aerosol measurements were obtained from 2 to 31 July 2006 at an urban site in the metropolitan area of Guangzhou (China) as part of the Program of Regional Integrated Experiment of Air Quality over Pearl River Delta (PRIDE-PRD2006) to investigate aerosol chemistry and the effect of aerosol water content on visibility impairment and radiative forcing. During the PRIDE-PRD2006 campaign, the average contributions of ammonium sulfate, organic mass by carbon (OMC), elemental carbon (EC), and sea salt (SS) to total PM(2.5) mass were measured to be 36.5%, 5.7%, 27.1%, 7.8%, and 3.7%, respectively. Compared with the clean marine period, (NH(4))(2)SO(4), NH(4)NO(3), and OMC were all greatly enhanced (by up to 430%) during local haze periods via the accumulation of a secondary aerosol component. The OMC dominance increased when high levels of biomass burning influenced the measurement site while (NH(4))(2)SO(4) and OMC did when both biomass burning and industrial emissions influenced it. The effect of aerosol water content on the total light-extinction coefficient was estimated to be 34.2%, of which 25.8% was due to aerosol water in (NH(4))(2)SO(4), 5.1% that in NH(4)NO(3), and 3.3% that in SS. The average mass-scattering efficiency (MSE) of PM(10) particles was determined to be 2.2+/-0.6 and 4.6+/-1.7m(2)g(-1) under dry (RHwater content, but MSE and SSA are also highly sensitive. It can be concluded that sulfate and carbonaceous aerosol, as well as aerosol water content, play important roles in the processes that determine visibility impairment and radiative forcing in the ambient atmosphere of the Guangzhou urban area.
Ismail, Syed; Ferrare, Richard A.; Browell, Edward V.; Kooi, Susan A.; Dunion, Jason P.; Heymsfield, Gerry; Notari, Anthony; Butler, Carolyn F.; Burton, Sharon; Fenn, Marta;
2010-01-01
LASE (Lidar Atmospheric Sensing Experiment) on-board the NASA DC-8 measured high resolution profiles of water vapor and aerosols, and cloud distributions in 14 flights over the eastern North Atlantic during the NAMMA (NASA African Monsoon Multidisciplinary Analyses) field experiment. These measurements were used to study African easterly waves (AEWs), tropical cyclones (TCs), and the Saharan Air Layer(s) (SAL). Interactions between the SAL and tropical air were observed during the early stages of the TC development. These LASE measurements represent the first simultaneous water vapor and aerosol lidar measurements to study the SAL and its impact on AEWs and TCs. Examples of profile measurements of aerosol scattering ratios, aerosol extinction coefficients, aerosol optical thickness, water vapor mixing ratios, RH, and temperature are presented to illustrate their characteristics in SAL, convection, and clear air regions. LASE data suggest that the SAL suppresses low-altitude convection at the convection-SAL interface region. Mid-level convection associated with the AEW and transport are likely responsible for high water vapor content observed in the southern regions of the SAL on August 20, 2008. This interaction is responsible for the transfer of about 7 x 10(exp 15) J latent heat energy within a day to the SAL. Measurements of lidar extinction-to-backscatter ratios in the range 36+/-5 to 45+/-5 are within the range of measurements from other lidar measurements of dust. LASE aerosol extinction and water vapor profiles are validated by comparison with onboard in situ aerosol measurements and GPS dropsonde water vapor soundings, respectively.
Study on the propagation properties of laser in aerosol based on Monte Carlo simulation
Leng, Kun; Wu, Wenyuan; Zhang, Xi; Gong, Yanchun; Yang, Yuntao
2018-02-01
When laser propagate in the atmosphere, due to aerosol scattering and absorption, laser energy will continue to decline, affecting the effectiveness of the laser effect. Based on the Monte Carlo method, the relationship between the photon spatial energy distributions of the laser wavelengths of 10.6μm in marine, sand-type, water-soluble and soot aerosols ,and the propagation distance, visibility and the divergence angle were studied. The results show that for 10.6μm laser, the maximum number of attenuation of photons arriving at the receiving plane is sand-type aerosol, the minimal attenuation is water soluble aerosol; as the propagation distance increases, the number of photons arriving at the receiving plane decreases; as the visibility increases, the number of photons arriving at the receiving plane increases rapidly and then stabilizes; in the above cases, the photon energy distribution does not deviated from the Gaussian distribution; as the divergence angle increases, the number of photons arriving at the receiving plane is almost unchanged, but the photon energy distribution gradually deviates from the Gaussian distribution.
Experiments on aerosol removal by high-pressure water spray
Energy Technology Data Exchange (ETDEWEB)
Corno, Ada del, E-mail: delcorno@rse-web.it [RSE, Power Generation Technologies and Materials Dept, via Rubattino 54, I-20134 Milano (Italy); Morandi, Sonia, E-mail: morandi@rse-web.it [RSE, Power Generation Technologies and Materials Dept, via Rubattino 54, I-20134 Milano (Italy); Parozzi, Flavio, E-mail: parozzi@rse-web.it [RSE, Power Generation Technologies and Materials Dept, via Rubattino 54, I-20134 Milano (Italy); Araneo, Lucio, E-mail: lucio.araneo@polimi.it [Politecnico di Milano, Department of Energy, via Lambruschini 4A, I-20156 Milano (Italy); CNR-IENI, via Cozzi 53, I-20125 Milano (Italy); Casella, Francesco, E-mail: francesco2.casella@mail.polimi.it [Politecnico di Milano, Department of Energy, via Lambruschini 4A, I-20156 Milano (Italy)
2017-01-15
Highlights: • Experimental research to measure the efficiency of high-pressure sprays in capturing aerosols if applied to a filtered containment venting system in case of severe accident. • Cloud of monodispersed SiO{sub 2} particles with sizes 0.5 or 1.0 μm and initial concentration in the range 2–90 mg/m{sup 3}. • Carried out in a chamber 0.5 × 1.0 m and 1.5 m high, with transparent walls equipped with a high pressure water spray with single nozzle. • Respect to low-pressure sprays, removal efficiency turned out significant: the half-life for 1 μm particles with a removal high-pressure spray system is orders of magnitude shorter than that with a low-pressure sprays system. - Abstract: An experimental research was managed in the framework of the PASSAM European Project to measure the efficiency of high-pressure sprays in capturing aerosols when applied to a filtered containment venting system in case of severe accident. The campaign was carried out in a purposely built facility composed by a scrubbing chamber 0.5 × 1.0 m and 1.5 m high, with transparent walls to permit the complete view of the aerosol removal process, where the aerosol was injected to form a cloud of specific particle concentration. The chamber was equipped with a high pressure water spray system with a single nozzle placed on its top. The test matrix consisted in the combination of water pressure injections, in the range 50–130 bar, on a cloud of monodispersed SiO{sub 2} particles with sizes 0.5 or 1.0 μm and initial concentration ranging between 2 and 99 mg/m{sup 3}. The spray was kept running for 2 min and the efficiency of the removal was evaluated, along the test time, using an optical particle sizer. With respect to low-pressure sprays, the removal efficiency turned out much more significant: the half-life for 1 μm particles with a removal high-pressure spray system is orders of magnitude shorter than that with a low-pressure spray system. The highest removal rate was
Experiments on aerosol removal by high-pressure water spray
International Nuclear Information System (INIS)
Corno, Ada del; Morandi, Sonia; Parozzi, Flavio; Araneo, Lucio; Casella, Francesco
2017-01-01
Highlights: • Experimental research to measure the efficiency of high-pressure sprays in capturing aerosols if applied to a filtered containment venting system in case of severe accident. • Cloud of monodispersed SiO_2 particles with sizes 0.5 or 1.0 μm and initial concentration in the range 2–90 mg/m"3. • Carried out in a chamber 0.5 × 1.0 m and 1.5 m high, with transparent walls equipped with a high pressure water spray with single nozzle. • Respect to low-pressure sprays, removal efficiency turned out significant: the half-life for 1 μm particles with a removal high-pressure spray system is orders of magnitude shorter than that with a low-pressure sprays system. - Abstract: An experimental research was managed in the framework of the PASSAM European Project to measure the efficiency of high-pressure sprays in capturing aerosols when applied to a filtered containment venting system in case of severe accident. The campaign was carried out in a purposely built facility composed by a scrubbing chamber 0.5 × 1.0 m and 1.5 m high, with transparent walls to permit the complete view of the aerosol removal process, where the aerosol was injected to form a cloud of specific particle concentration. The chamber was equipped with a high pressure water spray system with a single nozzle placed on its top. The test matrix consisted in the combination of water pressure injections, in the range 50–130 bar, on a cloud of monodispersed SiO_2 particles with sizes 0.5 or 1.0 μm and initial concentration ranging between 2 and 99 mg/m"3. The spray was kept running for 2 min and the efficiency of the removal was evaluated, along the test time, using an optical particle sizer. With respect to low-pressure sprays, the removal efficiency turned out much more significant: the half-life for 1 μm particles with a removal high-pressure spray system is orders of magnitude shorter than that with a low-pressure spray system. The highest removal rate was detected with 1
Directory of Open Access Journals (Sweden)
N. Hodas
2016-10-01
supersaturation of 0.8 %. We also observed a marked increase in apparent hygroscopicity for mixtures of higher molecular mass PEG and AS under supersaturated conditions as compared to subsaturated hygroscopic growth. AIOMFAC-based predictions and estimations of water diffusivity in PEG suggest that such discontinuities in apparent hygroscopicity above and below water saturation can be attributed, at least in part, to differences in the sensitivity of water uptake behavior to surface tension effects. There is no evidence that kinetic limitations to water uptake due to the presence of viscous aerosol components influenced hygroscopic growth. For the systems that display an enhancement in apparent hygroscopicity above water saturation, LLPS is predicted to persist to high RH. This indicates a miscibility gap and is likely to influence bulk-to-surface partitioning of PEG at high RH, impacting droplet surface tension and CCN activity. This work provides insight into the factors likely to be contributing to discontinuities in aerosol water-uptake behavior below and above water saturation that have been observed previously in the ambient atmosphere.
Kourtidis, Konstantinos; Georgoulias, Aristeidis
2017-04-01
We studied the impact of anthropogenic aerosols, fine mode natural aerosols, Saharan dust, atmospheric water vapor, cloud fraction, cloud optical depth and cloud top height on the magnitude of fair weather PG at the rural station of Xanthi. Fair weather PG was measured in situ while the other parameters were obtained from the MODIS instrument onboard the Terra and Aqua satellites. All of the above parameteres were found to impact fair weather PG magnitude. Regarding aerosols, the impact was larger for Saharan dust and fine mode natural aerosols whereas regarding clouds the impact was larger for cloud fraction while less than that of aerosols. Water vapour and ice precipitable water were also found to influence fair weather PG. Since aerosols and water are ubiquitous in the atmosphere and exhibit large spatial and temporal variability, we postulate that our understanding of the Carnegie curve might need revision.
Lee, C S; Wetzel, K; Buckley, T; Wozniak, D; Lee, J
2011-10-01
For the rapid detection of Pseudomonas aeruginosa from chlorinated water and aerosols, gyrB gene-based real-time PCR assay was developed and investigated. Two novel primer sets (pa722F/746MGB/899R and pa722F/746MGB/788R) were designed using the most updated 611 Pseudomonas and 748 other bacterial gyrB genes for achieving high specificity. Their specificity showed 100% accuracy when tested with various strains including clinical isolates from cystic fibrosis patients. The assay was tested with Ps. aeruginosa-containing chlorinated water and aerosols to simulate the waterborne and airborne transmission routes (detection limit 3·3 × 10² CFU per PCR-2·3 × 10³ CFU per PCR). No chlorine interference in real-time PCR was observed at drinking water level (c. 1 mg l⁻¹), but high level of chorine (12 mg l⁻¹) interfered the assay, and thus neutralization was needed. Pseudomonas aeruginosa in aerosol was successfully detected after capturing with gelatin filters with minimum 2 min of sampling time when the initial concentration of 10⁴ CFU ml⁻¹ bacteria existed in the nebulizer. A highly specific and rapid assay (2-3 h) was developed by targeting gyrB gene for the detection of Ps. aeruginosa in chlorinated water and aerosols, combined with optimized sample collection methods and sample processing, so the direct DNA extraction from either water or aerosol was possible while achieving the desired sensitivity of the method. The new assay can provide timely and accurate risk assessment to prevent Ps. aeruginosa exposure from water and aerosol, resulting in reduced disease burden, especially among immune-compromised and susceptible individuals. This approach can be easily utilized as a platform technology for the detection of other types of micro-organisms, especially for those that are transmitted via water and aerosol routes, such as Legionella pneumophila. © 2011 The Authors. Journal of Applied Microbiology © 2011 The Society for Applied Microbiology.
Case study of water-soluble metal containing organic constituents of biomass burning aerosol.
Chang-Graham, Alexandra L; Profeta, Luisa T M; Johnson, Timothy J; Yokelson, Robert J; Laskin, Alexander; Laskin, Julia
2011-02-15
Natural and prescribed biomass fires are a major source of aerosols that may persist in the atmosphere for several weeks. Biomass burning aerosols (BBA) can be associated with long-range transport of water-soluble N-, S-, P-, and metal-containing species. In this study, BBA samples were collected using a particle-into-liquid sampler (PILS) from laboratory burns of vegetation collected on military bases in the southeastern and southwestern United States. The samples were then analyzed using high resolution electrospray ionization mass spectrometry (ESI/HR-MS) that enabled accurate mass measurements for hundreds of species with m/z values between 70 and 1000 and assignment of elemental formulas. Mg, Al, Ca, Cr, Mn, Fe, Ni, Cu, Zn, and Ba-containing organometallic species were identified. The results suggest that the biomass may have accumulated metal-containing species that were re-emitted during biomass burning. Further research into the sources, dispersion, and persistence of metal-containing aerosols, as well as their environmental effects, is needed.
Herich, Hanna; Tritscher, Torsten; Wiacek, Aldona; Gysel, Martin; Weingartner, Ernest; Lohmann, Ulrike; Baltensperger, Urs; Cziczo, Daniel J
2009-09-28
Airborne mineral dust particles serve as cloud condensation nuclei (CCN), thereby influencing the formation and properties of warm clouds. It is therefore of atmospheric interest how dust aerosols with different mineralogy behave when exposed to high relative humidity (RH) or supersaturation (SS) with respect to liquid water. In this study the subsaturated hygroscopic growth and the supersaturated cloud condensation nucleus activity of pure clays and real desert dust aerosols were determined using a hygroscopicity tandem differential mobility analyzer (HTDMA) and a cloud condensation nuclei counter (CCNC), respectively. Five different illite, montmorillonite and kaolinite clay samples as well as three desert dust samples (Saharan dust (SD), Chinese dust (CD) and Arizona test dust (ATD)) were investigated. Aerosols were generated both with a wet and a dry disperser. The water uptake was parameterized via the hygroscopicity parameter kappa. The hygroscopicity of dry generated dust aerosols was found to be negligible when compared to processed atmospheric aerosols, with CCNC derived kappa values between 0.00 and 0.02 (the latter corresponds to a particle consisting of 96.7% by volume insoluble material and approximately 3.3% ammonium sulfate). Pure clay aerosols were generally found to be less hygroscopic than natural desert dust particles. The illite and montmorillonite samples had kappa approximately 0.003. The kaolinite samples were less hygroscopic and had kappa=0.001. SD (kappa=0.023) was found to be the most hygroscopic dry-generated desert dust followed by CD (kappa=0.007) and ATD (kappa=0.003). Wet-generated dust showed an increased water uptake when compared to dry-generated samples. This is considered to be an artifact introduced by redistribution of soluble material between the particles. Thus, the generation method is critically important when presenting such data. These results indicate any atmospheric processing of a fresh mineral dust particle which
Jung, Chang Hoon; Lee, Ji Yi; Um, Junshik; Lee, Seung Soo; Kim, Yong Pyo
2018-02-01
This study investigated the optical properties of aerosols involved in different meteorological events, including smog and Asian dust days. Carbonaceous components and inorganic species were measured in Seoul, Korea between 25 and 31 March 2012. Based on the measurements, the optical properties of aerosols were calculated by considering composition, size distribution, and mixing state of aerosols. To represent polydisperse size distributions of aerosols, a lognormal size distribution with a wide range of geometric mean diameters and geometric standard deviations was used. For the optical property calculations, the Mie theory was used to compute single-scattering properties of aerosol particles with varying size and composition. Analysis of the sampled data showed that the water-soluble components of organic matter increased on smog days, whereas crustal elements increased on dust days. The water content significantly influenced the optical properties of aerosols during the smog days as a result of high relative humidity and an increase in the water-soluble component. The absorption coefficients depended on the aerosol mixture type and the aerosol size distributions. Therefore, to improve our knowledge on radiative impacts of aerosols, especially the regional impacts of aerosols in East Asia, accurate measurements of aerosols, such as size distribution, composition, and mixture type, under different meteorological conditions are required.
Application of remote sensing techniques to study aerosol water vapour uptake in a real atmosphere
Fernández, A. J.; Molero, F.; Becerril-Valle, M.; Coz, E.; Salvador, P.; Artíñano, B.; Pujadas, M.
2018-04-01
In this work, a study of several observations of aerosol water uptake in a real (non-controlled) atmosphere, registered by remote sensing techniques, are presented. In particular, three events were identified within the Atmospheric Boundary Layer (ABL) and other two events were detected in the free troposphere (beyond the top of the ABL). Then, aerosol optical properties were measured at different relative humidity (RH) conditions by means of a multi-wavelength (MW) Raman lidar located at CIEMAT (Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, Research Centre for Energy, Environment and Technology) facilities in Madrid (Spain). Additionally, aerosol optical and microphysical properties provided by automatic sun and sky scanning spectral radiometers (CIMEL CE-318) and a meteorological analysis complement the study. However, a detailed analysis only could be carried out for the cases observed within the ABL since well-mixed atmospheric layers are required to properly characterize these processes. This characterization of aerosol water uptake is based on the curve described by the backscatter coefficient at 532 nm as a function of RH which allows deriving the enhancement factor. Thus, the Hänel parameterization is utilized, and the results obtained are in the range of values reported in previous studies, which shows the suitability of this approach to study such hygroscopic processes. Furthermore, the anti-correlated pattern observed on backscatter-related Ångström exponent (532/355 nm) and RH indicates plausible signs of aerosol hygroscopic growth. According to the meteorological analysis performed, we attribute such hygroscopic behaviour to marine aerosols which are advected from the Atlantic Ocean to the low troposphere in Madrid. We have also observed an interesting response of aerosols to RH at certain levels which it is suggested to be due to a hysteresis process. The events registered in the free troposphere, which deal with volcano
Insecticide Exposures on Commercial Aircraft: A Literature Review and Screening Level Assessment
Energy Technology Data Exchange (ETDEWEB)
Maddalena, Randy I.; McKone, Thomas E.
2008-10-01
The objective of this project was to provide initial estimates of the relationship between insecticide use on passenger aircraft and exposure levels present in the cabin environment. The work was initially divided into three tasks including 1) a review of insecticide application practices in commercial aircraft, 2) exploratory measurements of insecticide concentrations in treated aircraft and 3) screening level exposure modeling. Task 1 gathered information that is needed to assess the time-concentration history of insecticides in the airline cabin. The literature review focused on application practices, information about the cabin environment and existing measurements of exposure concentrations following treatment. Information from the airlines was not available for estimating insecticide application rates in the U.S. domestic fleet or for understanding how frequently equipment rotate into domestic routes following insecticide treatment. However, the World Health Organization (WHO) recommends several methods for treating aircraft with insecticide. Although there is evidence that these WHO guidelines may not always be followed, and that practices vary by airline, destination, and/or applicator company, the guidelines in combination with information related to other indoor environments provides a plausible basis for estimating insecticide loading rates on aircraft. The review also found that while measurements of exposure concentrations following simulated aerosol applications are available, measurements following residual treatment of aircraft or applications in domestic aircraft are lacking. Task 2 focused on developing an approach to monitor exposure concentrations in aircraft using a combination of active and passive sampling methods. An existing active sampling approach was intended to provide data immediately following treatment while a passive sampler was developed to provide wider coverage of the fleet over longer sampling periods. The passive sampler, based
Climate change, agricultural insecticide exposure, and risk for freshwater communities.
Kattwinkel, Mira; Kühne, Jan-Valentin; Foit, Kaarina; Liess, Matthias
2011-09-01
Climate change exerts direct effects on ecosystems but has additional indirect effects due to changes in agricultural practice. These include the increased use of pesticides, changes in the areas that are cultivated, and changes in the crops cultivated. It is well known that pesticides, and in particular insecticides, affect aquatic ecosystems adversely. To implement effective mitigation measures it is necessary to identify areas that are affected currently and those that will be affected in the future. As a consequence, we predicted potential exposure to insecticide (insecticide runoff potential, RP) under current conditions (1990) and under a model scenario of future climate and land use (2090) using a spatially explicit model on a continental scale, with a focus on Europe. Space-for-time substitution was used to predict future levels of insecticide application, intensity of agricultural land use, and cultivated crops. To assess the indirect effects of climate change, evaluation of the risk of insecticide exposure was based on a trait-based, climate-insensitive indicator system (SPEAR, SPEcies At Risk). To this end, RP and landscape characteristics that are relevant for the recovery of affected populations were combined to estimate the ecological risk (ER) of insecticides for freshwater communities. We predicted a strong increase in the application of, and aquatic exposure to, insecticides under the future scenario, especially in central and northern Europe. This, in turn, will result in a severe increase in ER in these regions. Hence, the proportion of stream sites adjacent to arable land that do not meet the requirements for good ecological status as defined by the EU Water Framework Directive will increase (from 33% to 39% for the EU-25 countries), in particular in the Scandinavian and Baltic countries (from 6% to 19%). Such spatially explicit mapping of risk enables the planning of adaptation and mitigation strategies including vegetated buffer strips and
Directory of Open Access Journals (Sweden)
Bożena Krogulska
2013-02-01
Full Text Available Background: The frequency of respiratory symptoms in workers exposed to water aerosol was evaluated along with the preliminary assessment of microbiological contamination of air and water used in glass processing plants. Material and Methods: A questionnaire survey was conducted in 131 workers from 9 glass processing plants. Questions focused on working conditions, respiratory symptoms and smoking habits. A pilot study of air and water microbiological contamination in one glass processing plant was performed. Water samples were tested for Legionella in accordance with EN ISO 11731-2:2008 and for total colony count according to PN-EN ISO 6222:2004. Air samples were tested for total numbers of molds and mildews. Results: During the year preceding the survey acute respiratory symptoms occurred in 28.2% of participants, while chronic symptoms were reported by 29% of respondents. Increased risks of cough and acute symptoms suggestive of pneumonia were found among the respondents working at a distance up to 20 m from the source of water aerosol compared to other workers (OR = 2.7, with no difference in the frequency of other symptoms. A microbiological analysis of water samples from selected glass plant revealed the presence of L. pneumophila, exceeding 1000 cfu/100 ml. The number of bacteria and fungi detected in air samples (above 1000 cfu/m3 suggested that water aerosol at workplaces can be one of the sources of the air microbial contamination. Conclusions: The questionnaire survey revealed an increased risk of cough and acute symptoms suggestive of pneumonia in the group working at a shortest distance form the source of water aerosol. Med Pr 2013;64(1:47–55
Impact of aerosols on ice crystal size
Zhao, Bin; Liou, Kuo-Nan; Gu, Yu; Jiang, Jonathan H.; Li, Qinbin; Fu, Rong; Huang, Lei; Liu, Xiaohong; Shi, Xiangjun; Su, Hui; He, Cenlin
2018-01-01
The interactions between aerosols and ice clouds represent one of the largest uncertainties in global radiative forcing from pre-industrial time to the present. In particular, the impact of aerosols on ice crystal effective radius (Rei), which is a key parameter determining ice clouds' net radiative effect, is highly uncertain due to limited and conflicting observational evidence. Here we investigate the effects of aerosols on Rei under different meteorological conditions using 9-year satellite observations. We find that the responses of Rei to aerosol loadings are modulated by water vapor amount in conjunction with several other meteorological parameters. While there is a significant negative correlation between Rei and aerosol loading in moist conditions, consistent with the "Twomey effect" for liquid clouds, a strong positive correlation between the two occurs in dry conditions. Simulations based on a cloud parcel model suggest that water vapor modulates the relative importance of different ice nucleation modes, leading to the opposite aerosol impacts between moist and dry conditions. When ice clouds are decomposed into those generated from deep convection and formed in situ, the water vapor modulation remains in effect for both ice cloud types, although the sensitivities of Rei to aerosols differ noticeably between them due to distinct formation mechanisms. The water vapor modulation can largely explain the difference in the responses of Rei to aerosol loadings in various seasons. A proper representation of the water vapor modulation is essential for an accurate estimate of aerosol-cloud radiative forcing produced by ice clouds.
Shi, Chong; Nakajima, Teruyuki
2018-03-01
Retrieval of aerosol optical properties and water-leaving radiance over ocean is challenging since the latter mostly accounts for ˜ 10 % of the satellite-observed signal and can be easily influenced by the atmospheric scattering. Such an effort would be more difficult in turbid coastal waters due to the existence of optically complex oceanic substances or high aerosol loading. In an effort to solve such problems, we present an optimization approach for the simultaneous determination of aerosol optical thickness (AOT) and normalized water-leaving radiance (nLw) from multispectral satellite measurements. In this algorithm, a coupled atmosphere-ocean radiative transfer model combined with a comprehensive bio-optical oceanic module is used to jointly simulate the satellite-observed reflectance at the top of atmosphere and water-leaving radiance just above the ocean surface. Then, an optimal estimation method is adopted to retrieve AOT and nLw iteratively. The algorithm is validated using Aerosol Robotic Network - Ocean Color (AERONET-OC) products selected from eight OC sites distributed over different waters, consisting of observations that covered glint and non-glint conditions from the Moderate Resolution Imaging Spectroradiometer (MODIS) instrument. Results show a good consistency between retrieved and in situ measurements at each site. It is demonstrated that more accurate AOTs are determined based on the simultaneous retrieval method, particularly in shorter wavelengths and sunglint conditions, where the averaged percentage difference (APD) of retrieved AOT is generally reduced by approximate 10 % in visible bands compared with those derived from the standard atmospheric correction (AC) scheme, since all the spectral measurements can be used jointly to increase the information content in the inversion of AOT, and the wind speed is also simultaneously retrieved to compensate the specular reflectance error estimated from the rough ocean surface model. For the
Bystander Exposure to Ultra-Low-Volume Insecticide Applications Used for Adult Mosquito Management
Directory of Open Access Journals (Sweden)
Robert K.D. Peterson
2011-06-01
Full Text Available A popular and effective management option for adult mosquitoes is the use of insecticides applied by ultra-low-volume (ULV equipment. However, there is a paucity of data on human dermal exposure to insecticides applied by this method. The objective of the current study was to estimate dermal exposures to the insecticide active ingredient permethrin using water- (Aqua-Reslin® and oil-based (Permanone® 30-30 formulations with passive dosimetry. No significant differences in deposition of permethrin were observed between years, distance from the spray source, front or back of the body, or the placement of the patches on the body. However, exposure to Aqua-Reslin was significantly greater than Permanone 30-30 and average concentrations deposited on the body were 4.2 and 2.1 ng/cm2, respectively. The greater deposition of Aqua-Reslin is most likely due to the higher density of the water-based formulation which causes it to settle out faster than the lighter oil-based formulation of Permanone 30-30. The estimated average absorbed dermal exposure for permethrin from Aqua-Reslin and Permanone 30-30 was 0.00009 and 0.00005 mg/kg body weight, respectively. We also found that ground deposition of ULV insecticides can be used as a surrogate for estimating dermal exposure. The estimated exposures support the findings of previous risk assessments that exposure to ULV applications used for mosquito management are below regulatory levels of concern.
McConnochie, Timothy H.; Smith, Michael D.; Wolff, Michael J.; Bender, Steve; Lemmon, Mark; Wiens, Roger C.; Maurice, Sylvestre; Gasnault, Olivier; Lasue, Jeremie; Meslin, Pierre-Yves; Harri, Ari-Matti; Genzer, Maria; Kemppinen, Osku; Martínez, Germán M.; DeFlores, Lauren; Blaney, Diana; Johnson, Jeffrey R.; Bell, James F.
2018-06-01
We derive water vapor column abundances and aerosol properties from Mars Science Laboratory (MSL) ChemCam passive mode observations of scattered sky light. This paper covers the methodology and initial results for water vapor and also provides preliminary results for aerosols. The data set presented here includes the results of 113 observations spanning from Mars Year 31 Ls = 291° (March 30, 2013) to Mars Year 33 Ls= 127° (March 24, 2016). Each ChemCam passive sky observation acquires spectra at two different elevation angles. We fit these spectra with a discrete-ordinates multiple scattering radiative transfer model, using the correlated-k approximation for gas absorption bands. The retrieval proceeds by first fitting the continuum of the ratio of the two elevation angles to solve for aerosol properties, and then fitting the continuum-removed ratio to solve for gas abundances. The final step of the retrieval makes use of the observed CO2 absorptions and the known CO2 abundance to correct the retrieved water vapor abundance for the effects of the vertical distribution of scattering aerosols and to derive an aerosol scale height parameter. Our water vapor results give water vapor column abundance with a precision of ±0.6 precipitable microns and systematic errors no larger than ±0.3 precipitable microns, assuming uniform vertical mixing. The ChemCam-retrieved water abundances show, with only a few exceptions, the same seasonal behavior and the same timing of seasonal minima and maxima as the TES, CRISM, and REMS-H data sets that we compare them to. However ChemCam-retrieved water abundances are generally lower than zonal and regional scale from-orbit water vapor data, while at the same time being significantly larger than pre-dawn REMS-H abundances. Pending further analysis of REMS-H volume mixing ratio uncertainties, the differences between ChemCam and REMS-H pre-dawn mixing ratios appear to be much too large to be explained by large scale circulations and thus
Kim, J. A.; Lee, M.; Yoon, H. O.; Bae, M. S.
2017-12-01
The water-soluble components of aerosols are rapidly permeated to various biosurfaces through the deposition process due to their high solubility and have profound effects on ecosystem functioning as well as human health. In this context, the ecotoxicity of atmospheric aerosol was assessed, particularly for water-soluble components. For measurements of ecotoxicity of water soluble components, ambient aerosols of PM1, PM2.5, and PM10 were collected on filters at Gosan Climate Observatory (GCO), Jeju, Korea in May, August, October 2010, March and July 2011. The ecotoxicity was estimated using Vibrio fischeri based on bioluminescence inhibition bioassay. In this study, EC10 (10% effective concentration) value was used as an ecotoxicity indicator. The EC10 value was generally in good relation with major water-soluble constituents such as SO42-, NH4+, and water-soluble organic carbon (WSOC). The characteristics of ecotoxicity was different in PM1, PM2.5, and PM10 aerosols. The EC10 of PM10 was correlated well with SO42- (r=-0.53) and Mg2+(r=-0.52). The ecotoxicity was relatively high in smaller particles with either high NO3-/SO42- ratio or WSOC concentration. The high ecotoxicity was found in outflows mostly from nearby lands especially under stagnant condition.
El-Sayed, Marwa M. H.; Ortiz-Montalvo, Diana L.; Hennigan, Christopher J.
2018-01-01
Isoprene oxidation produces water-soluble organic gases capable of partitioning to aerosol liquid water. The formation of secondary organic aerosols through such aqueous pathways (aqSOA) can take place either reversibly or irreversibly; however, the split between these fractions in the atmosphere is highly uncertain. The aim of this study was to characterize the reversibility of aqSOA formed from isoprene at a location in the eastern United States under substantial influence from both anthropogenic and biogenic emissions. The reversible and irreversible uptake of water-soluble organic gases to aerosol water was characterized in Baltimore, Maryland, USA, using measurements of particulate water-soluble organic carbon (WSOCp) in alternating dry and ambient configurations. WSOCp evaporation with drying was observed systematically throughout the late spring and summer, indicating reversible aqSOA formation during these times. We show through time lag analyses that WSOCp concentrations, including the WSOCp that evaporates with drying, peak 6 to 11 h after isoprene concentrations, with maxima at a time lag of 9 h. The absolute reversible aqSOA concentrations, as well as the relative amount of reversible aqSOA, increased with decreasing NOx / isoprene ratios, suggesting that isoprene epoxydiol (IEPOX) or other low-NOx oxidation products may be responsible for these effects. The observed relationships with NOx and isoprene suggest that this process occurs widely in the atmosphere, and is likely more important in other locations characterized by higher isoprene and/or lower NOx levels. This work underscores the importance of accounting for both reversible and irreversible uptake of isoprene oxidation products to aqueous particles.
Impact of aerosols on ice crystal size
Directory of Open Access Journals (Sweden)
B. Zhao
2018-01-01
Full Text Available The interactions between aerosols and ice clouds represent one of the largest uncertainties in global radiative forcing from pre-industrial time to the present. In particular, the impact of aerosols on ice crystal effective radius (Rei, which is a key parameter determining ice clouds' net radiative effect, is highly uncertain due to limited and conflicting observational evidence. Here we investigate the effects of aerosols on Rei under different meteorological conditions using 9-year satellite observations. We find that the responses of Rei to aerosol loadings are modulated by water vapor amount in conjunction with several other meteorological parameters. While there is a significant negative correlation between Rei and aerosol loading in moist conditions, consistent with the "Twomey effect" for liquid clouds, a strong positive correlation between the two occurs in dry conditions. Simulations based on a cloud parcel model suggest that water vapor modulates the relative importance of different ice nucleation modes, leading to the opposite aerosol impacts between moist and dry conditions. When ice clouds are decomposed into those generated from deep convection and formed in situ, the water vapor modulation remains in effect for both ice cloud types, although the sensitivities of Rei to aerosols differ noticeably between them due to distinct formation mechanisms. The water vapor modulation can largely explain the difference in the responses of Rei to aerosol loadings in various seasons. A proper representation of the water vapor modulation is essential for an accurate estimate of aerosol–cloud radiative forcing produced by ice clouds.
Nehrir, A. R.; Ferrare, R. A.; Kooi, S. A.; Butler, C. F.; Notari, A.; Hair, J. W.; Collins, J. E., Jr.; Ismail, S.
2015-12-01
The Lidar Atmospheric Sensing Experiment (LASE) system was deployed on the NASA DC-8 aircraft during the Plains Elevated Convection At Night (PECAN) field experiment, which was conducted during June-July 2015 over the central and southern plains. LASE is an active remote sensor that employs the differential absorption lidar (DIAL) technique to measure range resolved profiles of water vapor and aerosols above and below the aircraft. The DC-8 conducted nine local science flights from June 30- July 14 where LASE sampled water vapor and aerosol fields in support of the PECAN primary science objectives relating to better understanding nocturnal Mesoscale Convective Systems (MCSs), Convective Initiation (CI), the Low Level Jet (LLJ), bores, and to compare different airborne and ground based measurements. LASE observed large spatial and temporal variability in water vapor and aerosol distributions in advance of nocturnal MCSs, across bores resulting from MCS outflow boundaries, and across the LLJ associated with the development of MCSs and CI. An overview of the LASE data collected during the PECAN field experiment will be presented where emphasis will be placed on variability of water vapor profiles in the vicinity of severe storms and intense convection in the central and southern plains. Preliminary comparisons show good agreement between coincident LASE and radiosonde water vapor profiles. In addition, an advanced water vapor DIAL system being developed at NASA Langley will be discussed.
Zhao, Ximei; Xi, Xin; Hu, Zhan; Wu, Wenjun; Zhang, Jiwen
2016-02-24
The discovery of novel leads and new mechanisms of action is of vital significance to the development of pesticides. To explore lead compounds for botanical insecticides, 77 β-dihydroagarofuran derivatives were designed and synthesized. Their structures were mainly confirmed by (1)H NMR, (13)C NMR, DEPT-135°, IR, MS, and HRMS. Their insecticidal activity was evaluated against the third-instar larvae of Mythimna separata Walker, and the results indicated that, of these derivatives, eight exhibited more promising insecticidal activity than the positive control, celangulin-V. Particularly, compounds 5.7, 6.6, and 6.7 showed LD50 values of 37.9, 85.1, and 21.1 μg/g, respectively, which were much lower than that of celangulin-V (327.6 μg/g). These results illustrated that β-dihydroagarofuran ketal derivatives can be promising lead compounds for developing novel mechanism-based and highly effective botanical insecticides. Moreover, some newly discovered structure-activity relationships are discussed, which may provide some important guidance for insecticide development.
Atmospheric pollution in the mediterranean area: geochemical studies of aerosols and rain waters
International Nuclear Information System (INIS)
Caboi, R.; Chester, R.
1998-01-01
It is now recognised that the atmosphere is a major pathway for the transport of material to the oceans. The material in the atmosphere is present as gaseous and particulate (aerosol) phases. Aerosols may be removed from the atmosphere by a combination of 'dry' (i.e. not involving an atmospheric aqueous phase) and 'wet' (precipitation scavenging) processes. Thus, aerosols are intimately related to rain waters, and interactions between the two are discusses below in relation to the input of material to the Mediterranean Sea
Development of Aerosol Scrubbing Test Loop for Containment Filtered Venting System
International Nuclear Information System (INIS)
Lee, Doo Yong; Jung, Woo Young; Lee, Hyun Chul; Lee, Jong Chan; Kim, Gyu Tae
2016-01-01
The scrubber tank is filled with scrubbing water with the chemical additives. The droplet separator based on a cyclone is installed above the scrubbing water pool to remove the large droplets that may clog a metal fiber filter installed at the upper section of the scrubber tank. The outlet piping is connected from the scrubber tank to the molecular sieve to chemically remove the gaseous iodine. The aerosol as a particle is physically captured in the scrubbing water pool passing through the scrubbing nozzle as well as the metal fiber filter. The gaseous iodine such as molecular iodine as well as organic iodide is chemically removed in the scrubbing water pool and molecular sieve. The thermal-hydraulic as well as scrubbing performance for the CFVS should be verified with the experiments. The experiment can be divided into the filtration component based experiment and whole system based one. In this paper, the aerosol scrubbing test loop developed to test the thermal-hydraulic and aerosol scrubbing performance of the scrubbing nozzle with the scrubbing water pool is introduced. The aerosol scrubbing test loop has been developed as a part of the Korean CFVS project. In this loop, the filtration components such as the scrubbing nozzle submerged in the scrubbing water pool as well as the cyclone as droplet separator can be tested under the CFVS operating conditions. The aerosol scrubbing performance of the filtration components including pool scrubbing behavior can be tested with the aerosol generation and feeding system and aerosol measurement system.
Development of Aerosol Scrubbing Test Loop for Containment Filtered Venting System
Energy Technology Data Exchange (ETDEWEB)
Lee, Doo Yong; Jung, Woo Young; Lee, Hyun Chul; Lee, Jong Chan; Kim, Gyu Tae [FNC Technology, Yongin (Korea, Republic of)
2016-05-15
The scrubber tank is filled with scrubbing water with the chemical additives. The droplet separator based on a cyclone is installed above the scrubbing water pool to remove the large droplets that may clog a metal fiber filter installed at the upper section of the scrubber tank. The outlet piping is connected from the scrubber tank to the molecular sieve to chemically remove the gaseous iodine. The aerosol as a particle is physically captured in the scrubbing water pool passing through the scrubbing nozzle as well as the metal fiber filter. The gaseous iodine such as molecular iodine as well as organic iodide is chemically removed in the scrubbing water pool and molecular sieve. The thermal-hydraulic as well as scrubbing performance for the CFVS should be verified with the experiments. The experiment can be divided into the filtration component based experiment and whole system based one. In this paper, the aerosol scrubbing test loop developed to test the thermal-hydraulic and aerosol scrubbing performance of the scrubbing nozzle with the scrubbing water pool is introduced. The aerosol scrubbing test loop has been developed as a part of the Korean CFVS project. In this loop, the filtration components such as the scrubbing nozzle submerged in the scrubbing water pool as well as the cyclone as droplet separator can be tested under the CFVS operating conditions. The aerosol scrubbing performance of the filtration components including pool scrubbing behavior can be tested with the aerosol generation and feeding system and aerosol measurement system.
Case study of water-soluble metal containing organic constituents of biomass burning aerosol
Alexandra L. Chang-Graham; Luisa T. M. Profeta; Timothy J. Johnson; Robert J. Yokelson; Alexander Laskin; Julia Laskin
2011-01-01
Natural and prescribed biomass fires are a major source of aerosols that may persist in the atmosphere for several weeks. Biomass burning aerosols (BBA) can be associated with long-range transport of water-soluble N-, S-, P-, and metal-containing species. In this study, BBA samples were collected using a particle-into-liquid sampler (PILS) from laboratory burns of...
Rico, A.; Brink, van den P.J.
2015-01-01
In the present study, the authors evaluated the vulnerability of aquatic invertebrates to insecticides based on their intrinsic sensitivity and their population-level recovery potential. The relative sensitivity of invertebrates to 5 different classes of insecticides was calculated at the genus,
Insecticide solvents: interference with insecticidal action.
Brattsten, L B; Wilkinson, C F
1977-06-10
Several commercial solvent mixtures commonly used as insecticide carriers in spray formulations increase by more than threefold the microsomal N-demethylation of p-chloro N-methylaniline in midgut preparations of southern army-worm (Spodoptera eridania) larvae exposed orally to the test solvents. Under laboratory conditions, the same solvent mixtures exhibit a protective action against the in vivo toxicity of the insecticide carbaryl to the larvae. The data are discussed with respect to possible solvent-insecticide interactions occurring under field conditions and, more broadly, to potential toxicological hazards of these solvents to humans.
Effectiveness of plant based insecticides as a sustainable means of ...
African Journals Online (AJOL)
Cucumber (Cucumis sativus) is an important crop in Pakistan. It is affected by many biotic and abiotic factors. Among these, Cucumber mosaic virus is the important disease with economic losses. The purpose of this study was to evaluate the effectiveness of plant based insecticides as a sustainable means to control the ...
Hygroscopic behavior of water-soluble matter in marine aerosols over the East China Sea.
Yan, Yu; Fu, Pingqing; Jing, Bo; Peng, Chao; Boreddy, S K R; Yang, Fan; Wei, Lianfang; Sun, Yele; Wang, Zifa; Ge, Maofa
2017-02-01
In this study, we investigated hygroscopic properties of water-soluble matter (WSM) in marine aerosols over the East China Sea, which were collected during a Natural Science Foundation of China (NSFC) sharing cruise in 2014. Hygroscopic growth factors (g) of WSM were measured by a hygroscopicity tandem differential mobility analyzer (H-TDMA) with an initial dry particle mobility diameter of 100nm. The observed g at 90% relative humidity (RH), g(90%) WSM , defined as the ratio of the particle diameter at 90% RH to that at RHsea water was likely due to the transport of anthropogenic aerosols, chemical aging of dust particles, the contribution of biomass burning products, and the aerosol hygroscopic growth inhibition of organics. Copyright © 2016 Elsevier B.V. All rights reserved.
Stell, F M; Roe, R M; Arellano, C; Kennedy, L; Thornton, H; Saavedra-Rodriguez, K; Wesson, D M; Black, W C; Apperson, C S
2013-09-01
Aedes aegypti L. (Stegomyia aegypti) (Diptera: Culicidae) is the principal vector of dengue and yellow fever viruses in tropical and subtropical regions of the world. Disease management is largely based on mosquito control achieved by insecticides applied to interior resting surfaces and through space sprays. Population monitoring to detect insecticide resistance is a significant component of integrated disease management programmes. We developed a bioassay method for assessing insecticide susceptibility based on the feeding activity of mosquitoes on plant sugars. Our prototype sugar-insecticide feeding bioassay system was composed of inexpensive, disposable components, contained minimal volumes of insecticide, and was compact and highly transportable. Individual mosquitoes were assayed in a plastic cup that contained a sucrose-permethrin solution. Trypan blue dye was added to create a visual marker in the mosquito's abdomen for ingested sucrose-permethrin solution. Blue faecal spots provided further evidence of solution ingestion. With the sugar-insecticide feeding bioassay, the permethrin susceptibility of Ae. aegypti females from two field-collected strains was characterized by probit analysis of dosage-response data. The field strains were also tested by forced contact of females with permethrin residues on filter paper. Dosage-response patterns were similar, indicating that the sugar-insecticide feeding bioassay had appropriately characterized the permethrin susceptibility of the two strains. © 2012 The Royal Entomological Society.
Importance of Raman Lidar Aerosol Extinction Measurements for Aerosol-Cloud Interaction Studies
Directory of Open Access Journals (Sweden)
Han Zaw
2016-01-01
Full Text Available Using a UV Raman Lidar for aerosol extinction, and combining Microwave Radiometer derived Liquid Water Path (LWP with Multifilter Rotating Shadowband Radiometer derived Cloud Optical depth, to get cloud effective radius (Reff, we observe under certain specialized conditions, clear signatures of the Twomey Aerosol Indirect effect on cloud droplet properties which are consistent with the theoretical bounds. We also show that the measurement is very sensitive to how far the aerosol layer is from the cloud base and demonstrate that surface PM25 is far less useful. Measurements from both the DOE ARM site and new results at CCNY are presented.
Removal of chlorpyrifos insecticide in constructed wetlands with different plant species
Directory of Open Access Journals (Sweden)
Tamara D. de Souza
Full Text Available ABSTRACT The objective of this study was to evaluate the remediation of water containing the insecticide chlorpyrifos by using constructed wetlands (CW cultivated with Polygonum punctatum, Cynodon spp. and Mentha aquatica, operated under different hydraulic retention times: 24, 48, 96, 144 and 192 h. The system efficiency was based on reduction of the initial concentration of chlorpyrifos and toxicity of the contaminated water. The results showed that constructed wetlands are an excellent alternative for remediation of the insecticide chlorpyrifos in aqueous medium. It was observed that the average overall removal efficiency of the insecticide was 98.6%, and in the first hydraulic retention time, 24 h, chlorpyrifos was removed to levels below the detection limit in all CW. This result is mainly attributed to adsorption and microbial degradation. For the qualitative standard acute toxicity tests with Daphnia similis, for most samples there was a reduction in toxicity greater than 80%. It was reported that the ecotoxicological tests with the effluents of the constructed wetland are a good option as an indicator of the effectiveness of treatments and a promising alternative to complement the physical and chemical analyses.
Godfray, H.Charles J.; Blacquiere, Tjeerd; Field, Linda M.; Hails, Rosemary S.; Petrokofsky, Gillian; Potts, Simon G.; Raine, Nigel E.; Vanbergen, Adam J.; McLean, Angela R.
2014-01-01
There is evidence that in Europe and North America many species of pollinators are in decline, both in abundance and distribution. Although there is a long list of potential causes of this decline, there is concern that neonicotinoid insecticides, in particular through their use as seed treatments are, at least in part, responsible. This paper describes a project that set out to summarize the natural science evidence base relevant to neonicotinoid insecticides and insect pollinators in as pol...
Dissolved organic matter in sea spray: a transfer study from marine surface water to aerosols
Schmitt-Kopplin, P.; Liger-Belair, G.; Koch, B. P.; Flerus, R.; Kattner, G.; Harir, M.; Kanawati, B.; Lucio, M.; Tziotis, D.; Hertkorn, N.; Gebefügi, I.
2012-04-01
Atmospheric aerosols impose direct and indirect effects on the climate system, for example, by absorption of radiation in relation to cloud droplets size, on chemical and organic composition and cloud dynamics. The first step in the formation of Organic primary aerosols, i.e. the transfer of dissolved organic matter from the marine surface into the atmosphere, was studied. We present a molecular level description of this phenomenon using the high resolution analytical tools of Fourier transform ion cyclotron resonance mass spectrometry (FT-ICR MS) and nuclear magnetic resonance spectroscopy (NMR). Our experiments confirm the chemoselective transfer of natural organic molecules, especially of aliphatic compounds from the surface water into the atmosphere via bubble bursting processes. Transfer from marine surface water to the atmosphere involves a chemical gradient governed by the physicochemical properties of the involved molecules when comparing elemental compositions and differentiating CHO, CHNO, CHOS and CHNOS bearing compounds. Typical chemical fingerprints of compounds enriched in the aerosol phase were CHO and CHOS molecular series, smaller molecules of higher aliphaticity and lower oxygen content, and typical surfactants. A non-targeted metabolomics analysis demonstrated that many of these molecules corresponded to homologous series of oxo-, hydroxy-, methoxy-, branched fatty acids and mono-, di- and tricarboxylic acids as well as monoterpenes and sugars. These surface active biomolecules were preferentially transferred from surface water into the atmosphere via bubble bursting processes to form a significant fraction of primary organic aerosols. This way of sea spray production leaves a selective biological signature of the surface water in the corresponding aerosol that may be transported into higher altitudes up to the lower atmosphere, thus contributing to the formation of secondary organic aerosol on a global scale or transported laterally with
Xie, Mingjie; Mladenov, Natalie; Williams, Mark W.; Neff, Jason C.; Wasswa, Joseph; Hannigan, Michael P.
2016-01-01
Atmospheric aerosols have been shown to be an important input of organic carbon and nutrients to alpine watersheds and influence biogeochemical processes in these remote settings. For many remote, high elevation watersheds, direct evidence of the sources of water soluble organic aerosols and their chemical and optical characteristics is lacking. Here, we show that the concentration of water soluble organic carbon (WSOC) in the total suspended particulate (TSP) load at a high elevation site in...
Onshore Wind Speed Modulates Microbial Aerosols along an Urban Waterfront
Directory of Open Access Journals (Sweden)
M. Elias Dueker
2017-11-01
Full Text Available Wind blowing over aquatic and terrestrial surfaces produces aerosols, which include microbial aerosols. We studied the effect of onshore wind speeds on aerosol concentrations as well as total and culturable microbial aerosols (bacterial and viral at an urban waterfront (New York, NY, United States of America. We used two distinct methods to characterize microbial aerosol responses to wind speed: A culture-based exposure-plate method measuring viable bacterial deposition near-shore (CFU accumulation rate; and a culture-independent aerosol sampler-based method measuring total bacterial and viral aerosols (cells m−3 air. While ambient coarse (>2 µm and fine (0.3–2 µm aerosol particle number concentrations (regulated indicators of air quality decreased with increasing onshore wind speeds, total and depositing culturable bacterial aerosols and total viral aerosols increased. Taxonomic identification of the 16S rDNA of bacterial aerosol isolates suggested both terrestrial and aquatic sources. Wind appears to increase microbial aerosol number concentrations in the near-shore environment by onshore transport at low wind speeds (<4 m s−1, and increased local production and transport of new microbial aerosols from adjacent water surfaces at higher wind speeds (>4 m s−1. This study demonstrates a wind-modulated microbial connection between water and air in the coastal urban environment, with implications for public health management and urban microbial ecology.
Volcano and ship tracks indicate excessive aerosol-induced cloud water increases in a climate model.
Toll, Velle; Christensen, Matthew; Gassó, Santiago; Bellouin, Nicolas
2017-12-28
Aerosol-cloud interaction is the most uncertain mechanism of anthropogenic radiative forcing of Earth's climate, and aerosol-induced cloud water changes are particularly poorly constrained in climate models. By combining satellite retrievals of volcano and ship tracks in stratocumulus clouds, we compile a unique observational dataset and confirm that liquid water path (LWP) responses to aerosols are bidirectional, and on average the increases in LWP are closely compensated by the decreases. Moreover, the meteorological parameters controlling the LWP responses are strikingly similar between the volcano and ship tracks. In stark contrast to observations, there are substantial unidirectional increases in LWP in the Hadley Centre climate model, because the model accounts only for the decreased precipitation efficiency and not for the enhanced entrainment drying. If the LWP increases in the model were compensated by the decreases as the observations suggest, its indirect aerosol radiative forcing in stratocumulus regions would decrease by 45%.
Development of Environment-Friendly Insecticides Based on Enantioselectivity: Bifenthrin as a Case.
Qian, Yi; Zhou, Peixue; Zhang, Quan
2017-01-01
Chiral insecticides significantly contribute to the environmental pollutions recently. As the development of industry and agriculture, increasing number of chiral insecticides are to be introduced into the market. However, their enantioselective toxicology to ecosystem still remains uncertain. In this review, we embarked on a structured search of bibliographic databases for peer-reviewed articles regarding the enantioselective effects of bifenthrin, a typical chiral insecticide, on both target and non-target species. With this enantioselective property of chiral insecticides, they often exhibit adverse effects on non-target species enantioselectively. Specifically, the enantioselective effects of bifenthrin on target and non-target organisms were discussed. In target species, R-bifenthrin exerts more significant activities in deinsectization, compared with S-bifenthrin. On the other hand, Sbifenthrin is more toxic to non-target species than R-bifenthrin, which suggests that the application of sole enantiomer is more efficient and environment-friendly than that of racemate. This review confirms the choice of environment-friendly insecticides from the perspective of the enantioselectivity of chiral insecticides. To make insecticides more efficient to target species and less toxic to non-target species, further research should be done to investigated the potential effects of targetactive enantiomers on non-target organisms as well as the enantioselective fate of enantiomers in multiple environmental matrix.
Directory of Open Access Journals (Sweden)
M. M. Chim
2017-12-01
Full Text Available Organic compounds present at or near the surface of aqueous droplets can be efficiently oxidized by gas-phase OH radicals, which alter the molecular distribution of the reaction products within the droplet. A change in aerosol composition affects the hygroscopicity and leads to a concomitant response in the equilibrium amount of particle-phase water. The variation in the aerosol water content affects the aerosol size and physicochemical properties, which in turn governs the oxidation kinetics and chemistry. To attain better knowledge of the compositional evolution of aqueous organic droplets during oxidation, this work investigates the heterogeneous OH-radical-initiated oxidation of aqueous methylsuccinic acid (C5H8O4 droplets, a model compound for small branched dicarboxylic acids found in atmospheric aerosols, at a high relative humidity of 85 % through experimental and modeling approaches. Aerosol mass spectra measured by a soft atmospheric pressure ionization source (Direct Analysis in Real Time, DART coupled with a high-resolution mass spectrometer reveal two major products: a five carbon atom (C5 hydroxyl functionalization product (C5H8O5 and a C4 fragmentation product (C4H6O3. These two products likely originate from the formation and subsequent reactions (intermolecular hydrogen abstraction and carbon–carbon bond scission of tertiary alkoxy radicals resulting from the OH abstraction occurring at the methyl-substituted carbon site. Based on the identification of the reaction products, a kinetic model of oxidation (a two-product model coupled with the Aerosol Inorganic–Organic Mixtures Functional groups Activity Coefficients (AIOMFAC model is built to simulate the size and compositional changes of aqueous methylsuccinic acid droplets during oxidation. Model results show that at the maximum OH exposure, the droplets become slightly more hygroscopic after oxidation, as the mass fraction of water is predicted to increase from
Charging and coagulation of water aerosols with negligible addition of high-radioactive droplets
International Nuclear Information System (INIS)
Vasil'eva, N.L.; Sedova, G.L.; Chernyj, L.T.
1994-01-01
The mechanics of electrocoagulation of water aerosols with negligible admixture of high-radioactive droplets is considered. A corresponding mathematical model has been worked out which describes the processes of ionization, electrification and coagulation of radioactive aerosols. Numerical studies are carried out for a series of typical aerosols on the time dependence of ion concentrations, charge and pure droplet concentrations, as well as the charge and radius of radioactive droplets. It is shown that coagulation can give rise to the growth of droplet radius from 5-10 μm up to 30-40 μm for a 10 4 s period f time, and therefore it can play a considerable role in the development of aerosols with droplet radius up to 20 μm when gravitational coagulation is insignificant
Ruggeri, G.; Ergin, G.; Modini, R. L.; Takahama, S.
2013-12-01
The SOAS campaign was conducted from June 1 to July 15 of 2013 in order to understand the relationship between biogenic and anthropogenic emissions in the South East US1,2. In this study, the organic and inorganic composition of submicron aerosol in the Centreville SEARCH site was measured by Fourier Transform Infrared Spectroscopy (FTIR) and the Ambient Ion Monitor (AIM; URG Corporation), whereas the aerosol water content was measured with a Dry Ambient Aerosol Size Spectrometer (DAASS)3. Organic functional group analysis was performed on PM1 aerosol selected by cyclone and collected on teflon filters with a time resolution of 4-12 hours, using one inlet heated to 50 °C and the other operated either at ambient temperature or 70 °C 4. The AIM measured both condensed and gas phase composition with a time resolution of 1 hour, providing partitioning behavior of inorganic species such as NH3/NH4+, HNO3/NO3-. These measurements collectively permit calculation of pure-component vapor pressures of candidate organic compounds and activity coefficients of interacting components in the condensed phase, using models such as SIMPOL.15, E-AIM6, and AIOMFAC7. From these results, the water content of the aerosol is predicted, and a comparison between modeled and measured partitioning of inorganic compounds and water vapor are discussed, in addition to organic aerosol volatility prediction based on functional group analysis. [1]- Goldstein, A.H., et al., Biogenic carbon and anthropogenic pollutants combine to form a cooling haze over the southeastern United States. Proceedings of the National Academy of Sciences of the United States of America, 2009. 106(22), 8835-8840. [2]- Carlton, A.G., Turpin, B.J., 2013. Particle partitioning potential of organic compounds is highest in the Eastern US and driven by anthropogenic water. Atmospheric Chemistry and Physics Discussions 13, 12743-12770. [3]- Khlystov, A., Stanier, C.O., Takahama, S., Pandis, S.N., 2005. Water content of ambient
Directory of Open Access Journals (Sweden)
S. G. Tsyro
2005-01-01
Full Text Available Inter-comparisons of European air quality models show that regional transport models, including the EMEP (Co-operative Programme for monitoring and evaluation of the long-range transmission of air pollutants in Europe aerosol model, tend to underestimate the observed concentrations of PM10 and PM2.5. Obviously, an accurate representation of the individual aerosol constituents is a prerequisite for adequate calculation of PM concentrations. On the other hand, available measurements on the chemical characterization of ambient particles reveal that full chemical PM mass closure is rarely achieved. The fraction unaccounted for by chemical analysis can comprise as much as 30-40% of gravimetric PM10 or PM2.5 mass. The unaccounted PM mass can partly be due to non-C atoms in organic aerosols and/or due to sampling and measurement artefacts. Moreover, a part of the unaccounted PM mass is likely to consist of water associated with particles. Thus, the gravimetrically measured particle mass does not necessarily represent dry PM10 and PM2.5 mass. This is thought to be one of the reasons for models under-prediction of observed PM, if calculated dry PM10 and PM2.5 concentrations are compared with measurements. The EMEP aerosol model has been used to study to what extent particle-bound water can explain the chemically unidentified PM mass in filter-based particle samples. Water content of PM2.5 and PM10 has been estimated with the model for temperature 20°C and relative humidity 50%, which are conditions required for equilibration of dust-loaded filters according to the Reference method recommended by the European Committee for Standardization (CEN. Model calculations for Europe show that, depending on particle composition, particle-bound water constitutes 20-35% of the annual mean PM10 and PM2.5 concentrations, which is consistent with existing experimental estimates. At two Austrian sites, in Vienna and Streithofen, where daily measurements of PM2.5 mass
Dissolution of LMFBR fuel-sodium aerosols
International Nuclear Information System (INIS)
Allen, M.D.; Moss, O.R.
1979-01-01
Plutonium dioxide, normally insoluble in biological fluids, becomes much more soluble when mixed with sodium as the aerosol is formed. Sodium-fuel aerosols are approximately 20 times less soluble in simulated lung fluid than in distilled water. Solubility of sodium-fuel aerosols increases when Na 2 CO 3 are added to the distilled-water dissolution fluid. Mixed-oxide fuel aerosols without sodium present are relatively insoluble in distilled water, simulated lung fluid, and distilled water with Na 2 CO 3 and NaHCO 3 added
Aerosol Delivery for Amendment Distribution in Contaminated Vadose Zones
Hall, R. J.; Murdoch, L.; Riha, B.; Looney, B.
2011-12-01
Remediation of contaminated vadose zones is often hindered by an inability to effectively distribute amendments. Many amendment-based approaches have been successful in saturated formations, however, have not been widely pursued when treating contaminated unsaturated materials due to amendment distribution limitations. Aerosol delivery is a promising new approach for distributing amendments in contaminated vadose zones. Amendments are aerosolized and injected through well screens. During injection the aerosol particles are transported with the gas and deposited on the surfaces of soil grains. Resulting distributions are radially and vertically broad, which could not be achieved by injecting pure liquid-phase solutions. The objectives of this work were A) to characterize transport and deposition behaviors of aerosols; and B) to develop capabilities for predicting results of aerosol injection scenarios. Aerosol transport and deposition processes were investigated by conducting lab-scale injection experiments. These experiments involved injection of aerosols through a 2m radius, sand-filled wedge. A particle analyzer was used to measure aerosol particle distributions with time, and sand samples were taken for amendment content analysis. Predictive capabilities were obtained by constructing a numerical model capable of simulating aerosol transport and deposition in porous media. Results from tests involving vegetable oil aerosol injection show that liquid contents appropriate for remedial applications could be readily achieved throughout the sand-filled wedge. Lab-scale tests conducted with aqueous aerosols show that liquid accumulation only occurs near the point of injection. Tests were also conducted using 200 g/L salt water as the aerosolized liquid. Liquid accumulations observed during salt water tests were minimal and similar to aqueous aerosol results. However, particles were measured, and salt deposited distal to the point of injection. Differences between
Ismail, Hanafy M; O'Neill, Paul M; Hong, David W; Finn, Robert D; Henderson, Colin J; Wright, Aaron T; Cravatt, Benjamin F; Hemingway, Janet; Paine, Mark J I
2013-12-03
Pyrethroid insecticides are used to control diseases spread by arthropods. We have developed a suite of pyrethroid mimetic activity-based probes (PyABPs) to selectively label and identify P450s associated with pyrethroid metabolism. The probes were screened against pyrethroid-metabolizing and nonmetabolizing mosquito P450s, as well as rodent microsomes, to measure labeling specificity, plus cytochrome P450 oxidoreductase and b5 knockout mouse livers to validate P450 activation and establish the role for b5 in probe activation. Using PyABPs, we were able to profile active enzymes in rat liver microsomes and identify pyrethroid-metabolizing enzymes in the target tissue. These included P450s as well as related detoxification enzymes, notably UDP-glucuronosyltransferases, suggesting a network of associated pyrethroid-metabolizing enzymes, or "pyrethrome." Considering the central role P450s play in metabolizing insecticides, we anticipate that PyABPs will aid in the identification and profiling of P450s associated with insecticide pharmacology in a wide range of species, improving understanding of P450-insecticide interactions and aiding the development of unique tools for disease control.
Wang, Lingyan; Bi, Yanfeng; Zhang, Guosen; Liu, Sumei; Zhang, Jing; Xu, Zhaomeng; Ren, Jingling; Zhang, Guiling
2017-09-01
To probe the bioavailability and environmental mobility of aerosol nutrient elements (N, P, Si) in atmospheric water (rainwater, cloud and fog droplets), ten total suspended particulate (TSP) samples were collected at Fulong Mountain, Qingdao from prevailing air mass trajectory sources during four seasons. Then, a high time-resolution leaching experiment with simulated non-acidic atmospheric water (non-AAW, Milli-Q water, pH 5.5) and subsequently acidic atmospheric water (AAW, hydrochloric acid solution, pH 2) was performed. We found that regardless of the season or source, a monotonous decreasing pattern was observed in the dissolution of N, P and Si compounds in aerosols reacted with non-AAW, and the accumulated dissolved curves of P and Si fit a first-order kinetic model. No additional NO3- + NO2- dissolved out, while a small amount of NH4+ in Asian dust (AD) samples was released in AAW. The similar dissolution behaviour of P and Si from non-AAW to AAW can be explained by the Transition State Theory. The sources of aerosols related to various minerals were the natural reasons that affected the amounts of bioavailable phosphorus and silicon in aerosols (i.e., solubility), which can be explained by the dissolution rate constant of P and Si in non-AAW with lower values in mineral aerosols. The acid/particle ratio and particle/liquid ratio also have a large effect on the solubility of P and Si, which was implied by Pearson correlation analysis. Acid processing of aerosols may have great significance for marine areas with limited P and Si and post-acidification release increases of 1.1-10-fold for phosphorus and 1.2-29-fold for silicon. The decreasing mole ratio of P and Si in AAW indicates the possibility of shifting from a Si-limit to a P-limit in aerosols in the ocean, which promotes the growth of diatoms prior to other algal species.
Insecticide Resistance Reducing Effectiveness of Malaria Control
Centers for Disease Control (CDC) Podcasts
Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field.
Insecticide control of vector-borne diseases: when is insecticide resistance a problem?
Directory of Open Access Journals (Sweden)
Ana Rivero
Full Text Available Many of the most dangerous human diseases are transmitted by insect vectors. After decades of repeated insecticide use, all of these vector species have demonstrated the capacity to evolve resistance to insecticides. Insecticide resistance is generally considered to undermine control of vector-transmitted diseases because it increases the number of vectors that survive the insecticide treatment. Disease control failure, however, need not follow from vector control failure. Here, we review evidence that insecticide resistance may have an impact on the quality of vectors and, specifically, on three key determinants of parasite transmission: vector longevity, competence, and behaviour. We argue that, in some instances, insecticide resistance is likely to result in a decrease in vector longevity, a decrease in infectiousness, or in a change in behaviour, all of which will reduce the vectorial capacity of the insect. If this effect is sufficiently large, the impact of insecticide resistance on disease management may not be as detrimental as previously thought. In other instances, however, insecticide resistance may have the opposite effect, increasing the insect's vectorial capacity, which may lead to a dramatic increase in the transmission of the disease and even to a higher prevalence than in the absence of insecticides. Either way-and there may be no simple generality-the consequence of the evolution of insecticide resistance for disease ecology deserves additional attention.
Tri-trophic insecticidal effects of African plants against cabbage pests.
Directory of Open Access Journals (Sweden)
Blankson W Amoabeng
Full Text Available Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae, Siam weed, Chromolaena odorata (Asteraceae, Cinderella weed, Synedrella nodiflora (Asteraceae, chili pepper, Capsicum frutescens (Solanaceae, tobacco, Nicotiana tabacum (Solanaceae cassia, Cassia sophera (Leguminosae, physic nut, Jatropha curcas (Euphorbiaceae, castor oil plant, Ricinus communis (Euphorbiaceae and basil, Ocimum gratissimum (Lamiaceae. In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis, all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from
Tri-trophic insecticidal effects of African plants against cabbage pests.
Amoabeng, Blankson W; Gurr, Geoff M; Gitau, Catherine W; Nicol, Helen I; Munyakazi, Louis; Stevenson, Phil C
2013-01-01
Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily
Tri-Trophic Insecticidal Effects of African Plants against Cabbage Pests
Amoabeng, Blankson W.; Gurr, Geoff M.; Gitau, Catherine W.; Nicol, Helen I.; Stevenson, Phil C.
2013-01-01
Botanical insecticides are increasingly attracting research attention as they offer novel modes of action that may provide effective control of pests that have already developed resistance to conventional insecticides. They potentially offer cost-effective pest control to smallholder farmers in developing countries if highly active extracts can be prepared simply from readily available plants. Field cage and open field experiments were conducted to evaluate the insecticidal potential of nine common Ghanaian plants: goat weed, Ageratum conyzoides (Asteraceae), Siam weed, Chromolaena odorata (Asteraceae), Cinderella weed, Synedrella nodiflora (Asteraceae), chili pepper, Capsicum frutescens (Solanaceae), tobacco, Nicotiana tabacum (Solanaceae) cassia, Cassia sophera (Leguminosae), physic nut, Jatropha curcas (Euphorbiaceae), castor oil plant, Ricinus communis (Euphorbiaceae) and basil, Ocimum gratissimum (Lamiaceae). In field cage experiments, simple detergent and water extracts of all botanical treatments gave control of cabbage aphid, Brevicoryne brassicae and diamondback moth, Plutella xylostella, equivalent to the synthetic insecticide Attack® (emamectin benzoate) and superior to water or detergent solution. In open field experiments in the major and minor rainy seasons using a sub-set of plant extracts (A. conyzoides, C. odorata, S. nodiflora, N. tabacum and R. communis), all controlled B. brassicae and P. xylostella more effectively than water control and comparably with or better than Attack®. Botanical and water control treatments were more benign to third trophic level predators than Attack®. Effects cascaded to the first trophic level with all botanical treatments giving cabbage head weights, comparable to Attack® in the minor season. In the major season, R. communis and A conyzoides treatment gave lower head yields than Attack® but the remaining botanicals were equivalent or superior to this synthetic insecticide. Simply-prepared extracts from readily
Directory of Open Access Journals (Sweden)
Bingmiao Gao
2017-07-01
Full Text Available Most previous studies have focused on analgesic and anti-cancer activities for the conotoxins identified from piscivorous and molluscivorous cone snails, but little attention has been devoted to insecticidal activity of conotoxins from the dominant vermivorous species. As a representative vermivorous cone snail, the Chinese tubular cone snail (Conus betulinus is the dominant Conus species inhabiting the South China Sea. We sequenced related venom transcriptomes from C. betulinus using both the next-generation sequencing and traditional Sanger sequencing technologies, and a comprehensive library of 215 conotoxin transcripts was constructed. In our current study, six conotoxins with potential insecticidal activity were screened out from our conotoxin library by homologous search with a reported positive control (alpha-conotoxin ImI from C. imperialis as the query. Subsequently, these conotoxins were synthesized by chemical solid-phase and oxidative folding for further insecticidal activity validation, such as MTT assay, insect bioassay and homology modeling. The final results proved insecticidal activities of our achieved six conotoxins from the transcriptome-based dataset. Interestingly, two of them presented a lot of high insecticidal activity, which supports their usefulness for a trial as insecticides in field investigations. In summary, our present work provides a good example for high throughput development of biological insecticides on basis of the accumulated genomic resources.
International Nuclear Information System (INIS)
Alexander G Godizov; Alexander D Efanov; Alexander A Lukianov; Olga V Supotnitskaya
2005-01-01
Full text of publication follows: To describe the phenomena involving aerosol, the model in lumped parameters is used, which is based on the kinetic integral-differential equation for the function of particle distribution of size and content of soluble and insoluble impurities with sources and collision integrals. By the function of particle size distribution, the integral parameters of aerosol can be determined: water content (mass of condensed moisture in a unit of volume), dust content (mass of insoluble condensation nuclei in a unit of volume), calculational concentration and the mean radius of particles. In the aerosol transfer problem being considered, the thermodynamic fields are the external data obtained with a thermal-hydraulic computer code. For numerical simulation of the kinetic equation describing aerosol behavior in coagulation-condensation processes, a hybrid method is used, which combines the method of groups and the method of fractions. To solve the complete equation of aerosol transfer, the method of fractions is used. The integral equation describing aerosol coagulation is solved by means of the group method. The group method based on the representation of particle size distribution in terms of a linear combination of δ-functions with time-dependent arguments makes it possible to calculate the integral parameters of spectrum: the moments of distribution function at a small number of groups. The test calculations were performed by giving the particle spectrum as a lognormal distribution and Γ- function. The hybrid method combined with the thermal-hydraulic computer code enables one to simulate volume condensation of steam at varying thermal-hydraulic conditions. (authors)
International Nuclear Information System (INIS)
Powers, D.A.; Sprung, J.L.
1993-11-01
A classic model of aerosol scrubbing from bubbles rising through water is applied to the decontamination of gases produced during core debris interactions with concrete. The model, originally developed by Fuchs, describes aerosol capture by diffusion, sedimentation, and inertial impaction. This original model for spherical bubbles is modified to account for ellipsoidal distortion of the bubbles. Eighteen uncertain variables are identified in the application of the model to the decontamination of aerosols produced during core debris interactions with concrete by a water pool of specified depth and subcooling. These uncertain variables include properties of the aerosols, the bubbles, the water and the ambient pressure. Results are analyzed using a nonparametric, order statistical analysis that allows quantitative differentiation of stochastic and phenomenological uncertainty. The sampled values of the decontamination factors are used to construct estimated probability density functions for the decontamination factor at confidence levels of 50%, 90% and 95%. The decontamination factors for pools 30, 50, 100, 200, 300, and 500 cm deep and subcooling levels of 0, 2, 5, 10, 20, 30, 50, and 70 degrees C are correlated by simple polynomial regression. These polynomial equations can be used to estimate decontamination factors at prescribed confidence levels
Kim, D H; Lee, J M; Yeon, K H; Choi, S C
1998-01-01
A Raman lidar system has been developed for the measurement of the water-vapor mixing ratio and the aerosol backscatter and extinction coefficients. To suppress the elastic scattering from the XeCl excimer laser, an acetone edge filter and narrow-band interference filters are used. By using independently calculated backscatter and extinction coefficients, we calculate the lidar ratios (extinction coefficient divided by the backscatter coefficient). The obtained ratios between 30 and 50 sr explain the special characteristics of the aerosol existing in the atmosphere. These ratios are also used as important parameters in the lidar inversion program. We have also obtained the water-vapor mixing ratio and find that big differences exist between the ratios inside the boundary layer and those of other regions.
Sato, Yousuke; Goto, Daisuke; Michibata, Takuro; Suzuki, Kentaroh; Takemura, Toshihiko; Tomita, Hirofumi; Nakajima, Teruyuki
2018-03-07
Aerosols affect climate by modifying cloud properties through their role as cloud condensation nuclei or ice nuclei, called aerosol-cloud interactions. In most global climate models (GCMs), the aerosol-cloud interactions are represented by empirical parameterisations, in which the mass of cloud liquid water (LWP) is assumed to increase monotonically with increasing aerosol loading. Recent satellite observations, however, have yielded contradictory results: LWP can decrease with increasing aerosol loading. This difference implies that GCMs overestimate the aerosol effect, but the reasons for the difference are not obvious. Here, we reproduce satellite-observed LWP responses using a global simulation with explicit representations of cloud microphysics, instead of the parameterisations. Our analyses reveal that the decrease in LWP originates from the response of evaporation and condensation processes to aerosol perturbations, which are not represented in GCMs. The explicit representation of cloud microphysics in global scale modelling reduces the uncertainty of climate prediction.
International Nuclear Information System (INIS)
Fuhremann, T.W.; Lichtenstein, E.P.
1981-01-01
Full text: Two soil types and oat plants grown in these soils were incubated under identical environmental conditions. The insecticides used in order to increase the water solubility were 14 C-DDT, 14 C-lindane, 14 C-fonofos, 14 C-parathion, 14 C-phorate and 14 C-carbofuran. Total amounts of 14 C-residues recovered from insecticide-treated loam soils plus oats grown in these soils were similar with DDT and oarbofuran. They were also higher than those observed with the other insecticides. While most of the 14 C-DDT residues remained in the soils, most of the 14 C-carbofuran residues were recovered from oat leaves in the form of carbofuran and 3-hydroxycarbofuran. 14 C-residues of all insecticides were more persistent in loam than in sandy soil and sand-grown oats took up more 14 C-insecticide residues than loamgrown oats. The more water-soluble insecticides, 14 C-phorate and Ccarbofuran were more mobile and were metabolized to a greater extent than insecticides of lower water solubilities. Unextractable (bound) 14 C-residues in loam soil ranged from 2.8% to 29.1% of the applied doses of 14 C-DDT and 14 C-parathion, respectively. Bound 14 C-residues were lower in the sandy soil than in the loam soil, however, plant-bound 14 C-residues were higher in oats grown in the sandy soil than in loam grown oats. Insecticide metabolites recovered from soils and plants were identified and quantitated whenever possible. The oxygen analog metabolites of the organophosphorus insecticides were most abundant in the sandy soil and in oats grown therein. Data illustrate the importance of chemical structure, water solubility and soil type in predicting the comparative environmental behaviour of pesticides. (author)
DEFF Research Database (Denmark)
Lie, Aleksander; Pedersen, Lars Haastrup
2012-01-01
and Environmental Engineering, Aalborg University, Denmark Sugar fatty acid monoesters have been shown to possess antibiotic and insecticidal properties. The physical and chemical properties of sugar fatty acid esters depend on the saccharide moiety, fatty acid chain length, and both position and degree...... for sucrose caprate regioisomers. As a sensitive method based on mass detection, charged aerosol detection was used. The investigation was conducted using design-of-experiments (DOE) methodology for development and prediction of elution strategies. The elution profiles were described by a number of important......BIOCAT2012, Hamburg University of Technology Book of Abstracts, p290 ISBN 987-3-941492 L73) Multivariate analysis of elution parameters for RP-HPLC with charged aerosol detection of sucrose caprate regioisomers Aleksander Lie and Lars Haastrup Pedersen Department of Biotechnology, Chemistry...
Biomass burning aerosols characterization from ground based and profiling measurements
Marin, Cristina; Vasilescu, Jeni; Marmureanu, Luminita; Ene, Dragos; Preda, Liliana; Mihailescu, Mona
2018-04-01
The study goal is to assess the chemical and optical properties of aerosols present in the lofted layers and at the ground. The biomass burning aerosols were evaluated in low level layers from multi-wavelength lidar measurements, while chemical composition at ground was assessed using an Aerosol Chemical Speciation Monitor (ACSM) and an Aethalometer. Classification of aerosol type and specific organic markers were used to explore the potential to sense the particles from the same origin at ground base and on profiles.
International Nuclear Information System (INIS)
Marchand, Denis
2008-05-01
The study investigated the physical phenomena involved in the aerosols washout by water droplets for thermal hydraulic conditions representative of a severe accident in a PWR simulated into the TOSQAN vessel. A aerosols characterization (WELAS, turbidity-meter) coupled with the spray characteristics measurements (PDA, PIV), provided detailed information allowing to obtain reproducible results showing that aerosols collection dynamics has two phases characterized by two distinct removal rates. The average elementary collection efficiency per aerosols class was estimated according to the water flow rates and the droplets temperature injection. The comparison between the numerical approach (ASTEC's code) and the experimental results on the collected mass by the droplets showed a good agreement at the test beginning, then a light dissension after a certain time related on the experimental limits of measurement and the limits of the code. (author)
Pistone, Kristina; Redemann, Jens; Wood, Rob; Zuidema, Paquita; Flynn, Connor; LeBlanc, Samuel; Noone, David; Podolske, James; Segal Rozenhaimer, Michal; Shinozuka, Yohei;
2017-01-01
The quantification of radiative forcing due to the cumulative effects of aerosols, both directly and on cloud properties, remains the biggest source of uncertainty in our understanding of the physical climate. How the magnitude of these effects may be modified by meteorological conditions is an important aspect of this question. The Southeast Atlantic Ocean (SEA), with seasonal biomass burning (BB) smoke plumes overlying a persistent stratocumulus cloud deck, offers a perfect natural observatory in which to study the complexities of aerosol-cloud interactions. The NASA ORACLES (ObseRvations of Aerosols above CLouds and their intEractionS) campaign consists of three field deployments over three years (2016-2018) with the goal of gaining a better understanding of the complex processes (direct and indirect) by which BB aerosols affect clouds. We present results from the first ORACLES field deployment, which took place in September 2016 out of Walvis Bay, Namibia. Two NASA aircraft were flown with a suite of aerosol, cloud, radiation, and meteorological instruments for remote-sensing and in-situ observations. A strong correlation was observed between the aircraft-measured pollution indicators (carbon monoxide and aerosol properties) and atmospheric water vapor content, at all altitudes. Atmospheric reanalysis indicates that convective dynamics over the continent, near likely contribute to this elevated signal. Understanding the mechanisms by which water vapor covaries with plume strength is important to quantifying the magnitude of the aerosol direct and semi-direct effects in the region.
Directory of Open Access Journals (Sweden)
Samantha A. Radford
2018-02-01
Full Text Available Since urinary insecticide metabolites are commonly used as biomarkers of exposure, it is important that we quantify whether insecticides degrade in food and beverages in order to better perform risk assessment. This study was designed to quantify degradation of organophosphorus and pyrethroid insecticides in beverages. Purified water, white grape juice, orange juice, and red wine were fortified with 500 ng/mL diazinon, malathion, chlorpyrifos, permethrin, cyfluthrin, cypermethrin, and deltamethrin, and aliquots were extracted several times over a 15-day storage period at 2.5 °C. Overall, statistically significant loss of at least one insecticide was observed in each matrix, and at least five out of seven insecticides demonstrated a statistically significant loss in all matrices except orange juice. An investigation of an alternative mechanism of insecticide loss—adsorption onto the glass surface of the storage jars—was carried out, which indicated that this mechanism of loss is insignificant. Results of this work suggest that insecticides degrade in these beverages, and this degradation may lead to pre-existing insecticide degradates in the beverages, suggesting that caution should be exercised when using urinary insecticide metabolites to assess exposure and risk.
[The hygienic evaluation of an aerosol-gas mixture as a preservative of potable water].
Prokopov, V A; Gakal, R K; Mironets, N V; Byshovets, T F; Martyshchenko, N V; Teteneva, I A; Nadvornaia, Zh N
1993-01-01
Complex hygienic assessment of the aerosol-gas method for the drinking water conservation demonstrated no significant effects on white rats in toxicological and genetical experiments. The method was recommended for long-term conservation of the drinking water in steel tanks.
A high-flow humidograph for testing the water uptake by ambient aerosol
Energy Technology Data Exchange (ETDEWEB)
Ten Brink, H.M.; Khlystov, A.; Kos, G.P.A. [ECN Fuels Conversion and Environment, Petten (Netherlands); Tuch, T. [Institut of Medical Data Management, Biometrics and Epidemiology, Ludwig-Maximilian University, Muenich (Germany); Roth, C.; Kreyling, W. [Institute for Inhalation Biology, GSF National Research Center for Environment and Health, Neuherberg/Muenich (Germany)
1999-10-01
A scanning humidograph, with an air flow rate of 0.5 m{sup 3} s{sup -1} was built to investigate the uptake of water and its effect on sizing, collection and light-scattering of ambient aerosol. The performance of the system was assessed with laboratory particles of ammonium nitrate, ammonium sulfate and sodium chloride which are the major hygroscopic components of ambient aerosol. The increase in size at the deliquescence points, which ideally is a stepwise function of relative humidity, occurs over a range of 3% RH units. This is shown to be an optimum value in a system of such large dimensions. Because of the strong temperature increase of the vapor pressure of ammonium nitrate, its evaporative loss was investigated as a function of heating/drying temperature. The loss of pure test aerosol, with a mass distribution similar to that in the ambient atmosphere, was found to be acceptable for drying temperatures of up to 40C. The sizing of deliquesced aerosol by LAS-X monitors was tested and found to be a complex function of RH. In Berner low pressure impactors growth of hygroscopic aerosol was not observed, not even at an RH approaching saturation. 21 refs.
Weevil x Insecticide: Does 'Personality' Matter?
Morales, Juliana A; Cardoso, Danúbia G; Della Lucia, Terezinha Maria C; Guedes, Raul Narciso C
2013-01-01
An insect's behavior is the expression of its integrated physiology in response to external and internal stimuli, turning insect behavior into a potential determinant of insecticide exposure. Behavioral traits may therefore influence insecticide efficacy against insects, compromising the validity of standard bioassays of insecticide activity, which are fundamentally based on lethality alone. By extension, insect 'personality' (i.e., an individual's integrated set of behavioral tendencies that is inferred from multiple empirical measures) may also be an important determinant of insecticide exposure and activity. This has yet to be considered because the behavioral studies involving insects and insecticides focus on populations rather than on individuals. Even among studies of animal 'personality', the relative contributions of individual and population variation are usually neglected. Here, we assessed behavioral traits (within the categories: activity, boldness/shyness, and exploration/avoidance) of individuals from 15 populations of the maize weevil (Sitophilus zeamais), an important stored-grain pest with serious problems of insecticide resistance, and correlated the behavioral responses with the activity of the insecticide deltamethrin. This analysis was performed at both the population and individual levels. There was significant variation in weevil 'personality' among individuals and populations, but variation among individuals within populations accounted for most of the observed variation (92.57%). This result emphasizes the importance of individual variation in behavioral and 'personality' studies. When the behavioral traits assessed were correlated with median lethal time (LT50) at the population level and with the survival time under insecticide exposure, activity traits, particularly the distance walked, significantly increased survival time. Therefore, behavioral traits are important components of insecticide efficacy, and individual variation should be
Purification of waters and elimination of organochloric insecticides by means of active coal
Directory of Open Access Journals (Sweden)
DRAGAN MARINOVIĆ
2010-04-01
Full Text Available Pollution of water and the determination of the degree of its pollution with numerous physical, chemical and biological polluters have become general, ever increasing social and health related problems. Within this study, the concentrations of some most frequently used organochloric insecticides (OCI: a-hexachlorocyclohexane (a-HCH, γ-hexachlorocyclohexane (lindane, heptachlor, aldrin, dieldrin, endrin, dichlorodiphenyl trichlorethane (DDT were investigated. OCI are highly toxic substances for the human population and their effective elimination from the environment is of paramount interest. To determine the OCI concentration in water samples, the EPA–608 method and the liquid–liquid extraction principle were applied. A procedure for OCI elimination was realized by passing the water over four columns filled with various active coals: KRF, K-81/B, NORIT ROW-0.8 and AQUA SORB CS. These active coals are carbonized coconut shells activated by different procedures. The obtained results indicated that best purification of potable and waste water achieved using a column with Norit Row-0.8 filling. Research proved that small quantities of OCI can also be effectively removed using a Norit Row-0.8 active coal filled column, without altering the organoleptic properties of the water, which meets the requirements of water purification processes.
Aerosol typing - key information from aerosol studies
Mona, Lucia; Kahn, Ralph; Papagiannopoulos, Nikolaos; Holzer-Popp, Thomas; Pappalardo, Gelsomina
2016-04-01
Aerosol typing is a key source of aerosol information from ground-based and satellite-borne instruments. Depending on the specific measurement technique, aerosol typing can be used as input for retrievals or represents an output for other applications. Typically aerosol retrievals require some a priori or external aerosol type information. The accuracy of the derived aerosol products strongly depends on the reliability of these assumptions. Different sensors can make use of different aerosol type inputs. A critical review and harmonization of these procedures could significantly reduce related uncertainties. On the other hand, satellite measurements in recent years are providing valuable information about the global distribution of aerosol types, showing for example the main source regions and typical transport paths. Climatological studies of aerosol load at global and regional scales often rely on inferred aerosol type. There is still a high degree of inhomogeneity among satellite aerosol typing schemes, which makes the use different sensor datasets in a consistent way difficult. Knowledge of the 4d aerosol type distribution at these scales is essential for understanding the impact of different aerosol sources on climate, precipitation and air quality. All this information is needed for planning upcoming aerosol emissions policies. The exchange of expertise and the communication among satellite and ground-based measurement communities is fundamental for improving long-term dataset consistency, and for reducing aerosol type distribution uncertainties. Aerosol typing has been recognized as one of its high-priority activities of the AEROSAT (International Satellite Aerosol Science Network, http://aero-sat.org/) initiative. In the AEROSAT framework, a first critical review of aerosol typing procedures has been carried out. The review underlines the high heterogeneity in many aspects: approach, nomenclature, assumed number of components and parameters used for the
Microphysical and chemical characteristics of near-water aerosol over White and Kara Seas
Terpugova, S. A.; Polkin, V. V.; Panchenko, M. V.; Golobokova, L. P.; Kozlov, V. S.; Shmargunov, V. P.; Shevchenko, V. P.; Lisitzin, A. P.
2009-04-01
The results are presented of five-year-long (2003-2007) study of the spatial - temporal variability of the near-water aerosol in the water area of White and Kara Seas (55, 64, 71 and 80-th cruises of RV "Professor Shtockman"; 53 and 54-th cruises of RV "Akademik Mstislav Keldysh"). Measurements of aerosol microphysical characteristics were carried out by means of the automated mobile aerosol complex consisting of nephelometer, photoelectric counter and aethalometer. The aerosol disperse composition was studied with photoelectric counter in 256 size intervals from 0.4 to 10 m. About 1500 series of measurements were carried out in White Sea, and about 1400 series in Kara Sea. Chemical characteristics of aerosol were determined from samples collected on aerosol filters (92 samples were collected in White Sea and 48 in Kara Sea). The ion composition was determined under laboratory conditions. The H+, Na+, K+, Ca2+, Mg2+, NH4+, Cl-, NO3-, HCO3-, SO42- ions were under examination. Comparing aerosol characteristics of two seas, one can note that the mean values of the aerosol content parameters in Kara Sea are less than in White Sea. The ratio of the aerosol mass concentration are from 2 (Yamal Peninsula, northern part of Novaya Zemlya) to 9 times (Blagopoluchia Bay, Ob' Gulf). The differences in the concentration of black carbon vary from 3 (Yamal Peninsula) to 17 times (Blagopoluchia Bay). The differences in the aerosol number concentration NA are not so big. The values NA near Kara Gate, Yamal Peninsula and northern part of Novaya Zemlya are practically the same as in White Sea. The concentration NA at Ob' gulf is one order of magnitude less than in White sea. The obtained aerosol volume size distributions were approximated by the sums of two fractions, submicron and coarse, with lognormal size distributions. The mean volume size distribution of submicron fraction in White Sea is approximated by the distribution with the variance of the radius logarithm s=0.6 and modal
de Almeida, Luis Gustavo; de Moraes, Luiz Alberto Beraldo; Trigo, José Roberto; Omoto, Celso
2017-01-01
The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects. PMID:28358907
Directory of Open Access Journals (Sweden)
Luis Gustavo de Almeida
Full Text Available The exploration of new niches for microorganisms capable of degrading recalcitrant molecules is still required. We hypothesized the gut microbiota associated with insect-resistant lines carry pesticide degrading bacteria, and predicted they carry bacteria selected to degrade pesticides they were resistant to. We isolated and accessed the pesticide-degrading capacity of gut bacteria from the gut of fifth instars of Spodoptera frugiperda strains resistant to lambda-cyhalothrin, deltamethrin, chlorpyrifos ethyl, spinosad and lufenuron, using insecticide-selective media. Sixteen isolates belonging to 10 phylotypes were obtained, from which four were also associated with the susceptible strain. However, growth of gut bacteria associated with larvae from the susceptible strain was not obtained in any of the insecticide-based selective media tested. Growth of isolates was affected by the concentration of insecticides in the media, and all grew well up to 40 μg/ml. The insecticide-degrading capacity of selected isolates was assessed by GC or LC-MS/MS analyses. In conclusion, resistant strains of S. frugiperda are an excellent reservoir of insecticide-degrading bacteria with bioremediation potential. Moreover, gut-associated bacteria are subjected to the selection pressure imposed by insecticides on their hosts and may influence the metabolization of pesticides in insects.
Rice Production without Insecticide in Smallholder Farmer's Field
Directory of Open Access Journals (Sweden)
M. P. Ali
2017-05-01
Full Text Available Highlights:Use of perching, sweeping, and need based insecticide (IPM technique useage produce at par yields compared to prophylactic insecticide useage in rice fields.There exists a technique that can reduce 75% of insecticide useage in rice field.The results were obtained in cooperation between smallholder rice farmers and researchers of Bangladesh.Currently rice protection from insect pests solely depends on chemical pesticides which have tremendous impact on biodiversity, environment, animal, and human health. To reduce their impact from our society we need to cut pesticide use from agricultural practices. To address this issue, we did an experiment to identify realistic solutions that could help farmers build sustainable crop protection systems and minimize useage of insecticides and thus reduce the impact of pesticides in the environment. Innovations developed jointly by farmers and researchers and evaluated for their potential to be adopted by more farmers. In this paper we tested four management practices jointly with smallholder farmer fields in order to select the best one. Four management practices were used namely, T1 = Prophylactic use of insecticide where insecticide was applied in rice field at every 15 days interval without judging the infestation level; T2 = Perching (that is, placing roosting (perching sites for insectivorous birds within the rice field and concurrent sweep net samples along with need-based insecticide application; T3 = Perching only; and T4 = Farmer's own practices. The results revealed that routine application of insecticides for crop protection is not mandatory which is commonly found at use in rice farmers. In our experiment, where prophylactic method or farmers used 3–4 times insecticides without judging the insect pests infestation level, the similar pest population was found when compared to the field where insecticide was not applied. Our management system reduced by 75% the use of insecticides even
Gallon, Céline; Ranville, Mara A; Conaway, Christopher H; Landing, William M; Buck, Clifton S; Morton, Peter L; Flegal, A Russell
2011-12-01
Recent trends of atmospheric lead deposition to the North Pacific were investigated with analyses of lead in aerosols and surface waters collected on the fourth Intergovernmental Oceanographic Commission Contaminant Baseline Survey from May to June, 2002. Lead concentrations of the aerosols varied by 2 orders of magnitude (0.1-26.4 pmol/m(3)) due in part to variations in dust deposition during the cruise. The ranges in lead aerosol enrichment factors relative to iron (1-119) and aluminum (3-168) were similar, evidencing the transport of Asian industrial lead aerosols across the North Pacific. The oceanic deposition of some of those aerosols was substantiated by the gradient of lead concentrations of North Pacific waters, which varied 3-fold (32.7-103.5 pmol/kg), were highest along with the Asian margin of the basin, and decreased eastward. The hypothesized predominance of Asian industrial lead inputs to the North Pacific was further corroborated by the lead isotopic composition of ocean surface waters ((206)Pb/(207)Pb = 1.157-1.169; (208)Pb/(206)Pb = 2.093-2.118), which fell within the range of isotopic ratios reported in Asian aerosols that are primarily attributed to Chinese industrial lead emissions.
Reid, Molly C.; McKenzie, F. Ellis
2016-01-01
The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malari...
Energy Technology Data Exchange (ETDEWEB)
Di Biagio, C. [ENEA, Laboratory for Earth Observations and Analyses, Rome (Italy); University of Siena, Department of Earth Science, Siena (Italy); Di Sarra, A. [ENEA, Laboratory for Earth Observations and Analyses, Rome (Italy); Eriksen, P. [Danish Climate Centre, DMI, Danish Meteorological Institute, Copenhagen (Denmark); Ascanius, S.E. [DMI, Danish Meteorological Institute, Qaanaaq (Greenland); Muscari, G. [INGV, Istituto Nazionale di Geofisica e Vulcanologia, Rome (Italy); Holben, B. [NASA Goddard Space Flight Center, Greenbelt, MD (United States)
2012-08-15
This study is based on ground-based measurements of downward surface shortwave irradiance (SW), columnar water vapour (wv), and aerosol optical depth ({tau}) obtained at Thule Air Base (Greenland) in 2007-2010, together with MODIS observations of the surface shortwave albedo (A). Radiative transfer model calculations are used in combination with measurements to separate the radiative effect of A ({Delta}SW{sub A}), wv ({Delta}SW{sub wv}), and aerosols ({Delta}SW{sub {tau}}) in modulating SW in cloud-free conditions. The shortwave radiation at the surface is mainly affected by water vapour absorption, which produces a reduction of SW as low as -100 Wm{sup -2} (-18%). The seasonal change of A produces an increase of SW by up to +25 Wm{sup -2} (+4.5%). The annual mean radiative effect is estimated to be -(21-22) Wm{sup -2} for wv, and +(2-3) Wm{sup -2} for A. An increase by +0.065 cm in the annual mean wv, to which corresponds an absolute increase in {Delta}SW{sub wv} by 0.93 Wm{sup -2} (4.3%), has been observed to occur between 2007 and 2010. In the same period, the annual mean A has decreased by -0.027, with a corresponding decrease in {Delta}SW{sub A} by 0.41 Wm{sup -2} (-14.9%). Atmospheric aerosols produce a reduction of SW as low as -32 Wm{sup -2} (-6.7%). The instantaneous aerosol radiative forcing (RF{sub {tau}}) reaches values of -28 Wm{sup -2} and shows a strong dependency on surface albedo. The derived radiative forcing efficiency (FE{sub {tau}}) for solar zenith angles between 55 and 70 is estimated to be (-120.6 {+-} 4.3) for 0.1 < A < 0.2, and (-41.2 {+-} 1.6) Wm{sup -2} for 0.5 < A < 0.6. (orig.)
Directory of Open Access Journals (Sweden)
Yukari Hara
2018-06-01
Full Text Available We verified an algorithm using multi-wavelength Mie-Raman lidar (MMRL observations to retrieve four aerosol components (black carbon (BC, sea salt (SS, air pollution (AP, and mineral dust (DS with in-situ aerosol measurements, and determined the seasonal variation of aerosol components in Fukuoka, in the western region of Japan. PM2.5, PM10, and mass concentrations of BC and SS components are derived from in-situ measurements. MMRL provides the aerosol extinction coefficient (α, particle linear depolarization ratio (δ, backscatter coefficient (β, and lidar ratio (S at 355 and 532 nm, and the attenuated backscatter coefficient (βatt at 1064 nm. We retrieved vertical distributions of extinction coefficients at 532 nm for four aerosol components (BC, SS, AP, and DS using 1α532 + 1β532 + 1βatt,1064 + 1δ532 data of MMRL. The retrieved extinction coefficients of the four aerosol components at 532 nm were converted to mass concentrations using the theoretical computed conversion factor assuming the prescribed size distribution, particle shape, and refractive index for each aerosol component. MMRL and in-situ measurements confirmed that seasonal variation of aerosol optical properties was affected by internal/external mixing of various aerosol components, in addition to hygroscopic growth of water-soluble aerosols. MMRL overestimates BC mass concentration compared to in-situ observation using the pure BC model. This overestimation was reduced drastically by introducing the internal mixture model of BC and water-soluble substances (Core-Gray Shell (CGS model. This result suggests that considering the internal mixture of BC and water-soluble substances is essential for evaluating BC mass concentration in this area. Systematic overestimation of BC mass concentration was found during summer, even when we applied the CGS model. The observational facts based on in-situ and MMRL measurements suggested that misclassification of AP as CGS particles was
Contribution to the study of water-soluble ions in aerosols of the city of Antananarivo
International Nuclear Information System (INIS)
NASSUR, R.
2007-01-01
The urban environment characterized by concentration accumulated activities (industries-heating-transports) polluted emission (chimney, silencer...) concentration in atmosphere and especially people exposed in effects. All this elements make that the urban people are confronted in increasing sanitary risk, especially for the most susceptible subject. Three places in Antananarivo are chosen to value ions soluble in water, in aerosols of the town by human activities especially in road transport. Samples analysis are presented like collected aerosols in filters. In order to value these pollutions, we used ''dichotomous'' samples to collect the particles and analysis method by ionic chromatography to analysis ions. With sampling system, it is possible to carry out collect to be allowed the separation of breathed and inhaled particles in two filters of different diameter. The aerosol are to be deduct in advance to 1,40m of ground. The filters impregnated into water without ions are waged during 30 minutes, to obtain samples representative after filtration. Some ions NH4 + , Na + , Br - are lower in our detection limits. These are Ca 2+ and S0 4 2- that the majority is collected from Antananarivo aerosols. [fr
Bacci, Leandro; Crespo, André L B; Galvan, Tederson L; Pereira, Eliseu J G; Picanço, Marcelo C; Silva, Gerson A; Chediak, Mateus
2007-07-01
Efficient chemical control is achieved when insecticides are active against insect pests and safe to natural enemies. In this study, the toxicity of 17 insecticides to the sweetpotato whitefly, Bemisia tabaci (Gennadius), and the selectivity of seven insecticides to natural enemies of this insect pest were evaluated. To determine the insecticide toxicity, B. tabaci adults were exposed to abamectin, acephate, acetamiprid, cartap, imidacloprid, malathion, methamidophos, bifenthrin, cypermethrin, deltamethrin, esfenvalerate, fenitrothion, fenpropathrin, fenthion, phenthoate, permethrin and trichlorphon at 50 and 100% of the field rate (FR), and to water (untreated control). To determine the insecticide selectivity, adults of Encarsia sp., Acanthinus sp., Discodon sp. and Lasiochilus sp. were exposed to abamectin, acephate, acetamiprid, cartap, imidacloprid, malathion and methamidophos at 50 and 100% FR, and to water. Groups of each insect species were exposed to kale leaves preimmersed in each treatment under laboratory conditions. Mortality of exposed individuals was recorded 24 h after treatment. Cartap and imidacloprid at 50 and 100% FR and abamectin and acetamiprid at 100% FR showed insecticidal activity to B. tabaci adults. Abamectin at 50 and 100% FR was the least insecticidal compound to the natural enemies Acanthinus sp., Discodon sp. and Lasiochilus sp. The present results suggest that abamectin at 100% FR may decrease B. tabaci field populations but can still be harmless to predators. Implications of these results within an integrated pest management context are discussed. Copyright (c) 2007 Society of Chemical Industry.
Energy Technology Data Exchange (ETDEWEB)
Ismail, Hanafy M.; O' Neill, Paul M.; Hong, David; Finn, Robert; Henderson, Colin; Wright, Aaron T.; Cravatt, Benjamin; Hemingway, Janet; Paine, Mark J.
2014-01-18
Pyrethroid insecticides are used to control a diverse spectrum of diseases spread by arthropods. We have developed a suite of pyrethroid mimetic activity based probes (PyABPs) to selectively label and identify P450s associated with pyrethroid metabolism. The probes were screened against pyrethroid metabolizing and non-metabolizing mosquito P450s, as well as rodent microsomes to measure labeling specificity, plus CPR and b5 knockout mouse livers to validate P450 activation and establish the role for b5 in probe activation. Using a deltamethrin mimetic PyABP we were able to profile active enzymes in rat liver microsomes and identify pyrethroid metabolizing enzymes in the target tissue. The most reactive enzyme was a P450, CYP2C11, which is known to metabolize deltamethrin. Furthermore, several other pyrethroid metabolizers were identified (CYPs 2C6, 3A4, 2C13 and 2D1) along with related detoxification enzymes, notably UDP-g’s 2B1 - 5, suggesting a network of associated pyrethroid metabolizing enzymes, or ‘pyrethrome’. Considering the central role that P450s play in metabolizing insecticides, we anticipate that PyABPs will aid the identification and profiling of P450s associated with insecticide pharmacology in a wide range of species, improving understanding of P450-insecticide interactions and aiding the development of new tools for disease control.
Pretest aerosol code comparisons for LWR aerosol containment tests LA1 and LA2
International Nuclear Information System (INIS)
Wright, A.L.; Wilson, J.H.; Arwood, P.C.
1986-01-01
The Light-Water-Reactor (LWR) Aerosol Containment Experiments (LACE) are being performed in Richland, Washington, at the Hanford Engineering Development Laboratory (HEDL) under the leadership of an international project board and the Electric Power Research Institute. These tests have two objectives: (1) to investigate, at large scale, the inherent aerosol retention behavior in LWR containments under simulated severe accident conditions, and (2) to provide an experimental data base for validating aerosol behavior and thermal-hydraulic computer codes. Aerosol computer-code comparison activities are being coordinated at the Oak Ridge National Laboratory. For each of the six LACE tests, ''pretest'' calculations (for code-to-code comparisons) and ''posttest'' calculations (for code-to-test data comparisons) are being performed. The overall goals of the comparison effort are (1) to provide code users with experience in applying their codes to LWR accident-sequence conditions and (2) to evaluate and improve the code models
Mikuska, Pavel; Vecera, Zbynek
2005-09-01
A new type of aerosol collector employing a liquid at laboratory temperature for continuous sampling of atmospheric particles is described. The collector operates on the principle of a Venturi scrubber. Sampled air flows at high linear velocity through two Venturi nozzles "atomizing" the liquid to form two jets of a polydisperse aerosol of fine droplets situated against each other. Counterflow jets of droplets collide, and within this process, the aerosol particles are captured into dispersed liquid. Under optimum conditions (air flow rate of 5 L/min and water flow rate of 2 mL/min), aerosol particles down to 0.3 microm in diameter are quantitatively collected in the collector into deionized water while the collection efficiency of smaller particles decreases. There is very little loss of fine aerosol within the aerosol counterflow two-jets unit (ACTJU). Coupling of the aerosol collector with an annular diffusion denuder located upstream of the collector ensures an artifact-free sampling of atmospheric aerosols. Operation of the ACTJU in combination with on-line detection devices allows in situ automated analysis of water-soluble aerosol species (e.g., NO2-, NO3-)with high time resolution (as high as 1 s). Under the optimum conditions, the limit of detection for particulate nitrite and nitrate is 28 and 77 ng/m(3), respectively. The instrument is sufficiently rugged for its application at routine monitoring of aerosol composition in the real time.
Flores-Céspedes, Francisco; Martínez-Domínguez, Gerardo P; Villafranca-Sánchez, Matilde; Fernández-Pérez, Manuel
2015-09-30
The botanical insecticide azadirachtin was incorporated in alginate-based granules to obtain controlled release formulations (CRFs). The basic formulation [sodium alginate (1.47%) - azadirachtin (0.28%) - water] was modified by the addition of biosorbents, obtaining homogeneous hybrid hydrogels with high azadirachtin entrapment efficiency. The effect on azadirachtin release rate caused by the incorporation of biosorbents such as lignin, humic acid, and olive pomace in alginate formulation was studied by immersion of the granules in water under static conditions. The addition of the biosorbents to the basic alginate formulation reduces the rate of release because the lignin-based formulation produces a slower release. Photodegradation experiments showed the potential of the prepared formulations in protecting azadirachtin against simulated sunlight, thus improving its stability. The results showed that formulation prepared with lignin provided extended protection. Therefore, this study provides a new procedure to encapsulate the botanical insecticide azadirachtin, improving its delivery and photostability.
Gioda, Adriana; Mateus, Vinicius; Monteiro, Isabela; Taira, Fabio; Esteves, Veronica; Saint'Pierre, Tatiana
2013-04-01
On a global scale, the atmosphere is an important source of nutrients, as well as pollutants, because of its interfaces with soil and water. Important compounds in the gaseous phase are in both organic and inorganic forms, such as organic acids, nitrogen, sulfur and chloride. In spite of the species in gas form, a huge number of process, anthropogenic and natural, are able to form aerosols, which may be transported over long distances. Sulfates e nitrates are responsible for rain acidity; they may also increase the solubility of organic compounds and metals making them more bioavailable, and also can act as cloud condensation nuclei (CCN). Aerosol samples (PM2.5) were collected in a rural and industrial area in Rio de Janeiro, Brazil, in order to quantify chemical species and evaluate anthropogenic influences in secondary aerosol formation and organic compounds. Samples were collected during 24 h every six days using a high-volume sampler from August 2010 to July 2011. The aerosol mass was determined by Gravimetry. The water-soluble ionic composition (WSIC) was obtained by Ion Chromatography in order to determine the major anions (NO3-, SO4= and Cl-); total water-soluble carbon (TWSC) was determined by a TOC analyzer. The average aerosol (PM2.5) concentrations ranged from 1 to 43 ug/m3 in the industrial site and from 4 to 35 ug/m3 in the rural area. Regarding anions, the highest concentrations were measured for SO42- (10.6 μg/m3-12.6 μg/m3); where the lowest value was found in the rural site and the highest in the industrial. The concentrations for NO3- and Cl- ranged from 4.2 μg/m3 to 9.3 μg/m3 and 3.1 μg/m3 to 6.4 μg /m3, respectively. Sulfate was the major species and, like nitrate, it is related to photooxidation in the atmosphere. Interestingly sulfate concentrations were higher during the dry period and could be related to photochemistry activity. The correlations between nitrate and non-sea-salt sulfate were weak, suggesting different sources for these
Fate of the insecticide lambda-cyhalothrin in ditch enclosures differing in vegetation density
Leistra, M.; Zweers, A.J.; Warinton, J.S.; Crum, S.J.H.; Hand, L.H.; Beltman, W.H.J.; Maund, S.J.
2004-01-01
Use of the insecticide lambda-cyhalothrin in agriculture may result in the contamination of water bodies, for example by spray drift. Therefore, the possible exposure of aquatic organisms to this insecticide needs to be evaluated. The exposure of the organisms may be reduced by the strong sorption
Reid, Molly C; McKenzie, F Ellis
2016-02-19
The fight against malaria is increasingly threatened by failures in vector control due to growing insecticide resistance. This review examines the recent primary research that addresses the putative relationship between agricultural insecticide use and trends in insecticide resistance. To do so, descriptive evidence offered by the new research was categorized, and additional factors that impact the relationship between agricultural insecticide use and observed insecticide resistance in malaria vectors were identified. In 23 of the 25 relevant recent publications from across Africa, higher resistance in mosquito populations was associated with agricultural insecticide use. This association appears to be affected by crop type, farm pest management strategy and urban development.
Lace-Espana experimental programme on the retention of aerosols in water pools
Energy Technology Data Exchange (ETDEWEB)
Marcos, M. J.; Gomez, F. J.; Melches, I.; Martin, M.; Lopez, M.
1994-07-01
A matrix of eleven experiments on aerosol retention behaviour in submerged beds and suppression pools in water- cooled reactors under severe accident conditions has been performed, for these experiments, an intermediate scales, multi-purpose facility was set up at CIEMAT (Madrid). The facility includes various systems: aerosol generation (Csl), mixing section, injection line and pool-vessel (8 m{sup 3} ), as well as the corresponding aerosol instrumentation and a process control and data acquisition system. Some parameters have been varied in order to study their influence in the DF: steam/noncondensable ratio in the accidental mixture (0.1 to 0.9), particle size, flow rate (two regimes: bubble and jet) and injector geometry (mono orifice and multi orifice). On the other hand, some parameters have been kept constant along the experiments; pool geometry (diameter, water level), water temperature, pressure in the atmosphere above the water, submergence, injection temperature and injection time. A rapid decrease in the DF is observed as the proportion of particles measuring less than 1 {mu}m increases. Retention decreases in the case of smaller particles and considerably higher in the case of larger particles. It has been also possible to observe the influence of the injected steam fraction. Experiments with greater fraction than the saturation fraction have greater DF than those ones with smaller fractions. The jet regime with horizontal injection and the multi orifice geometry would appear to show a somewhat higher capacity of retention than those in the bubble regime under similar conditions. It would be necessary to confirm this greater capacity for retention by means of additional experimental data. This work, performed by the LACE-Espana Consortium, has been carried out in the frame of the European Commissions Shared Cost Action Programme on Reactor Safety 1988-91 on a contractual basis. (Author)18 refs.
Lace-Espana experimental programme on the retention of aerosols in water pools
International Nuclear Information System (INIS)
Marcos, M. J.; Gomez, F. J.; Melches, I.; Martin, M.; Lopez, M.
1994-01-01
A matrix of eleven experiments on aerosol retention behaviour in submerged beds and suppression pools in water- cooled reactors under severe accident conditions has been performed, for these experiments, an intermediate scales, multi-purpose facility was set up at CIEMAT (Madrid). The facility includes various systems: aerosol generation (Csl), mixing section, injection line and pool-vessel (8 m 3 ), as well as the corresponding aerosol instrumentation and a process control and data acquisition system. Some parameters have been varied in order to study their influence in the DF: steam/noncondensable ratio in the accidental mixture (0.1 to 0.9), particle size, flow rate (two regimes: bubble and jet) and injector geometry (mono orifice and multi orifice). On the other hand, some parameters have been kept constant along the experiments; pool geometry (diameter, water level), water temperature, pressure in the atmosphere above the water, submergence, injection temperature and injection time. A rapid decrease in the DF is observed as the proportion of particles measuring less than 1 μm increases. Retention decreases in the case of smaller particles and considerably higher in the case of larger particles. It has been also possible to observe the influence of the injected steam fraction. Experiments with greater fraction than the saturation fraction have greater DF than those ones with smaller fractions. The jet regime with horizontal injection and the multi orifice geometry would appear to show a somewhat higher capacity of retention than those in the bubble regime under similar conditions. It would be necessary to confirm this greater capacity for retention by means of additional experimental data. This work, performed by the LACE-Espana Consortium, has been carried out in the frame of the European Commissions Shared Cost Action Programme on Reactor Safety 1988-91 on a contractual basis. (Author)18 refs
Lace-Espana experimental programme on the retention of aerosols in water pools
International Nuclear Information System (INIS)
Marcos Crespo, M.J.; Gomez; Moreno, F. J.; Melches Serrano, I.; Martin Espigares, M.; Lopez Jimenez, J.
1994-01-01
A matrix of eleven experiments on aerosol retention behaviour in submerged beds and suppression pools in water-cooled reactors under severe accident conditions has been performed, for these experiments, an intermediate scale, multi-purpose facility was set up at CIEMAT (Madrid). The facility includes various systems: aerosol ageneration (CsI), mixing section, injection line and pool-vessel (8 m''3), as well as the corresponding aerosol instrumentation and a process control and data acquisition system. Some parameters have been varied in order to study their influence in the DF: steam/noncondensable ratio in the accidental mixture (0,1 to 0.9) particle size, flow rate (two regimes: bubble and jet) and injector geometry (monoorifice and multiorifice). On the other hand, some parameters have been kept constant along the experiments; pool geometry (diameter, water level), water temperature, pressure in the atmosphere above the water, submergence, injection temperature and injection time. A Rapid decrease in the DF is observed as the proportion of particles measuring les than 1 mum increases. Retention decreases in the case of smaller particles and considerably higher in the case of larger particles. It has been also possible to observe the influence of the injected steam fraction. Experiments with greater fraction than the saturation fraction have greater DF than those ones with smaller fractions. The jet regime with horizontal injection and the multiorifice geometry would appear to show a somewhat higher capacity of retention than those in the bubble regime under similar conditions. It would be necessary to confirm this greater capacity for retention by means of additional experimental data. This work, performed by the LACE-Espana Consortium, has been carried out in the frame of the European Commission's Shared Cost Action Programme on Reactor Safety 1988-91 on a contractual basis
Aerosol optical thickness retrieval over land and water using SCIAMACHY/GOME data
Kusmierczyk-Michulec, J.; Leeuw, G. de
2005-01-01
An algorithm for the retrieval of the aerosol optical thickness over land and over water from SCIAMACHY (SCanning Imaging Absorption SpectroMeter for Atmospheric ChartographY) is presented. Because calibrated data are not yet available for the SCIAMACHY channels used by the algorithm, the concepts
Insecticide Resistance Reducing Effectiveness of Malaria Control
Centers for Disease Control (CDC) Podcasts
2007-01-24
Malaria prevention is increasingly insecticide based. Dr. John Gimnig, an entomologist with the Division of Parasitic Diseases, CDC, discusses evidence that mosquito resistance to insecticides, which is measured in the laboratory, could compromise malaria prevention in the field. Created: 1/24/2007 by Emerging Infectious Diseases. Date Released: 3/13/2007.
Summary of aerosol code-comparison results for LWR aerosol containment tests LA1, LA2, and LA3
International Nuclear Information System (INIS)
Wright, A.L.; Wilson, J.H.; Arwood, P.C.
1987-01-01
The light-water reactor (LWR) aerosol containment experiments (LACE) are being performed in Richland, Washington, at the Hanford Engineering Development Laboratory under the leadership of an international project board and the Electric Power Research Institute. These tests have two objectives: (1) to investigate, at large scale, the inherent aerosol retention behavior in LWR containments under simulated severe accident conditions, and (2) to provide an experimental data base for validating aerosol behavior and thermal-hydraulic computer codes. Aerosol computer-code comparison activities for the LACE tests are being coordinated at the Oak Ridge National Laboratory. For each of the six experiments, pretest calculations (for code-to-code comparisons) and blind post-test calculations (for code-to-test data comparisons) are being performed. This paper presents a summary of the pretest aerosol-code results for tests LA1, LA2, and LA3
Satellite and Ground Based Monitoring of Aerosol Plumes
International Nuclear Information System (INIS)
Doyle, Martin; Dorling, Stephen
2002-01-01
Plumes of atmospheric aerosol have been studied using a range of satellite and ground-based techniques. The Sea-viewing WideField-of-view Sensor (SeaWiFS) has been used to observe plumes of sulphate aerosol and Saharan dust around the coast of the United Kingdom. Aerosol Optical Thickness (AOT) was retrieved from SeaWiFS for two events; a plume of Saharan dust transported over the United Kingdom from Western Africa and a period of elevated sulphate experienced over the Easternregion of the UK. Patterns of AOT are discussed and related to the synoptic and mesoscale weather conditions. Further observation of the sulphate aerosol event was undertaken using the Advanced Very High Resolution Radiometer instrument(AVHRR). Atmospheric back trajectories and weather conditions were studied in order to identify the meteorological conditions which led to this event. Co-located ground-based measurements of PM 10 and PM 2.5 were obtained for 4sites within the UK and PM 2.5/10 ratios were calculated in order to identify any unusually high or low ratios(indicating the dominant size fraction within the plume)during either of these events. Calculated percentiles ofPM 2.5/10 ratios during the 2 events examined show that these events were notable within the record, but were in noway unique or unusual in the context of a 3 yr monitoring record. Visibility measurements for both episodes have been examined and show that visibility degradation occurred during both the sulphate aerosol and Saharan dust episodes
Ecotoxicity of binary mixtures of Microcystis aeruginosa and insecticides to Daphnia pulex
International Nuclear Information System (INIS)
Asselman, J.; Janssen, C.R.; Smagghe, G.; De Schamphelaere, K.A.C.
2014-01-01
In aquatic ecosystems, mixtures of chemical and natural stressors can occur which may significantly complicate risk assessment approaches. Here, we show that effects of binary combinations of four different insecticides and Microcystis aeruginosa, a toxic cyanobacteria, on Daphnia pulex exhibited distinct interaction patterns. Combinations with chlorpyrifos and tetradifon caused non-interactive effects, tebufenpyrad caused an antagonistic interaction and fenoyxcarb yielded patterns that depended on the reference model used (i.e. synergistic with independent action, additive with concentration addition). Our results demonstrate that interactive effects cannot be generalised across different insecticides, not even for those targeting the same biological pathway (i.e. tebufenpyrad and tetradifon both target oxidative phosphorylation). Also, the concentration addition reference model provided conservative predictions of effects in all investigated combinations for risk assessment. These predictions could, in absence of a full mechanistic understanding, provide a meaningful solution for managing water quality in systems impacted by both insecticides and cyanobacterial blooms. - Highlights:: • 2 of 4 insecticide-Microcystis combinations showed no interactive effect on Daphnia. • One insecticide showed antagonistic deviation patterns. • For one other insecticide the results depended on the reference model used. • Interactive effects between insecticides and Microcystis cannot be generalized. • The concentration addition model provides conservative estimates of mixture effects. - Interactive effects between insecticides and cyanobacterial stressors cannot be generalized, not even for insecticides with closely related known modes of action
Daam, M.A.; Crum, S.J.H.; Brink, van den P.J.; Nogueira, A.J.A.
2008-01-01
The fate and effects of the insecticide chlorpyrifos were studied in plankton-dominated, freshwater microcosms in Thailand. Disappearance rates of chlorpyrifos from the water column in the present study were similar to those in temperate regions. Insecticide accumulation in the sediment was
Impact of Asian Aerosols on Precipitation Over California: An Observational and Model Based Approach
Naeger, Aaron R.; Molthan, Andrew L.; Zavodsky, Bradley T.; Creamean, Jessie M.
2015-01-01
Dust and pollution emissions from Asia are often transported across the Pacific Ocean to over the western United States. Therefore, it is essential to fully understand the impact of these aerosols on clouds and precipitation forming over the eastern Pacific and western United States, especially during atmospheric river events that account for up to half of California's annual precipitation and can lead to widespread flooding. In order for numerical modeling simulations to accurately represent the present and future regional climate of the western United States, we must account for the aerosol-cloud-precipitation interactions associated with Asian dust and pollution aerosols. Therefore, we have constructed a detailed study utilizing multi-sensor satellite observations, NOAA-led field campaign measurements, and targeted numerical modeling studies where Asian aerosols interacted with cloud and precipitation processes over the western United States. In particular, we utilize aerosol optical depth retrievals from the NASA Moderate Resolution Imaging Spectroradiometer (MODIS), NOAA Geostationary Operational Environmental Satellite (GOES-11), and Japan Meteorological Agency (JMA) Multi-functional Transport Satellite (MTSAT) to effectively detect and monitor the trans-Pacific transport of Asian dust and pollution. The aerosol optical depth (AOD) retrievals are used in assimilating the Weather Research and Forecasting model coupled with Chemistry (WRF-Chem) in order to provide the model with an accurate representation of the aerosol spatial distribution across the Pacific. We conduct WRF-Chem model simulations of several cold-season atmospheric river events that interacted with Asian aerosols and brought significant precipitation over California during February-March 2011 when the NOAA CalWater field campaign was ongoing. The CalWater field campaign consisted of aircraft and surface measurements of aerosol and precipitation processes that help extensively validate our WRF
A global space-based stratospheric aerosol climatology: 1979-2016
Thomason, Larry W.; Ernest, Nicholas; Millán, Luis; Rieger, Landon; Bourassa, Adam; Vernier, Jean-Paul; Manney, Gloria; Luo, Beiping; Arfeuille, Florian; Peter, Thomas
2018-03-01
We describe the construction of a continuous 38-year record of stratospheric aerosol optical properties. The Global Space-based Stratospheric Aerosol Climatology, or GloSSAC, provided the input data to the construction of the Climate Model Intercomparison Project stratospheric aerosol forcing data set (1979-2014) and we have extended it through 2016 following an identical process. GloSSAC focuses on the Stratospheric Aerosol and Gas Experiment (SAGE) series of instruments through mid-2005, and on the Optical Spectrograph and InfraRed Imager System (OSIRIS) and the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO) data thereafter. We also use data from other space instruments and from ground-based, air, and balloon borne instruments to fill in key gaps in the data set. The end result is a global and gap-free data set focused on aerosol extinction coefficient at 525 and 1020 nm and other parameters on an "as available" basis. For the primary data sets, we developed a new method for filling the post-Pinatubo eruption data gap for 1991-1993 based on data from the Cryogenic Limb Array Etalon Spectrometer. In addition, we developed a new method for populating wintertime high latitudes during the SAGE period employing a latitude-equivalent latitude conversion process that greatly improves the depiction of aerosol at high latitudes compared to earlier similar efforts. We report data in the troposphere only when and where it is available. This is primarily during the SAGE II period except for the most enhanced part of the Pinatubo period. It is likely that the upper troposphere during Pinatubo was greatly enhanced over non-volcanic periods and that domain remains substantially under-characterized. We note that aerosol levels during the OSIRIS/CALIPSO period in the lower stratosphere at mid- and high latitudes is routinely higher than what we observed during the SAGE II period. While this period had nearly continuous low-level volcanic activity, it
Godfray, H Charles J; Blacquière, Tjeerd; Field, Linda M; Hails, Rosemary S; Petrokofsky, Gillian; Potts, Simon G; Raine, Nigel E; Vanbergen, Adam J; McLean, Angela R
2014-07-07
There is evidence that in Europe and North America many species of pollinators are in decline, both in abundance and distribution. Although there is a long list of potential causes of this decline, there is concern that neonicotinoid insecticides, in particular through their use as seed treatments are, at least in part, responsible. This paper describes a project that set out to summarize the natural science evidence base relevant to neonicotinoid insecticides and insect pollinators in as policy-neutral terms as possible. A series of evidence statements are listed and categorized according to the nature of the underlying information. The evidence summary forms the appendix to this paper and an annotated bibliography is provided in the electronic supplementary material.
Hazra, Montu K; Francisco, Joseph S; Sinha, Amitabha
2014-06-12
The hydrolysis of glyoxal involving one to three water molecules and also in the presence of a water molecule and formic acid has been investigated. Our results show that glyoxal-diol is the major product of the hydrolysis and that formic acid, through its ability to facilitate intermolecular hydrogen atom transfer, is considerably more efficient than water as a catalyst in the hydrolysis process. Additionally, once the glyoxal-diol is formed, the barrier for further hydrolysis to form the glyoxal-tetrol is effectively reduced to zero in the presence of a single water and formic acid molecule. There are two important implications arising from these findings. First, the results suggest that under the catalytic influence of formic acid, glyoxal hydrolysis can impact the growth of atmospheric aerosols. As a result of enhanced hydrogen bonding, mediated through their polar OH functional groups, the diol and tetrol products are expected to have significantly lower vapor pressure than the parent glyoxal molecule; hence they can more readily partition into the particle phase and contribute to the growth of secondary organic aerosols. In addition, our findings provide insight into how glyoxal-diol and glyoxal-tetrol might be formed under atmospheric conditions associated with water-restricted environments and strongly suggest that the formation of these precursors for secondary organic aerosol growth is not likely restricted solely to the bulk aqueous phase as is currently assumed.
Khan, Hafiz Azhar Ali; Akram, Waseem; Shad, Sarfraz Ali; Lee, Jong-Jin
2013-01-01
House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-“A” and LC50: LC50-“B”) significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies. PMID:23613758
Fate of the insecticide lambda-cyhalothrin in ditch enclosures differing in vegetation density.
Leistra, Minze; Zweers, Anton J; Warinton, Jacqui S; Crum, Steven J H; Hand, Laurence H; Beltman, Wim H J; Maund, Stephen J
2004-01-01
Use of the insecticide lambda-cyhalothrin in agriculture may result in the contamination of water bodies, for example by spray drift. Therefore, the possible exposure of aquatic organisms to this insecticide needs to be evaluated. The exposure of the organisms may be reduced by the strong sorption of the insecticide to organic materials and its susceptibility to hydrolysis at the high pH values in the natural range. In experiments done in May and August, formulated lambda-cyhalothrin was mixed with the water body of enclosures in experimental ditches containing a bottom layer and macrophytes (at different densities) or phytoplankton. Concentrations of lambda-cyhalothrin in the water body and in the sediment layer, and contents in the plant compartment, were measured by gas-liquid chromatography at various times up to 1 week after application. Various water quality parameters were also measured. Concentrations of lambda-cyhalothrin decreased rapidly in the water column: 1 day after application, 24-40% of the dose remained in the water, and by 3 days it had declined to 1.8-6.5%. At the highest plant density, lambda-cyhalothrin residue in the plant compartment reached a maximum of 50% of the dose after 1 day; at intermediate and low plant densities, this maximum was only 3-11% of the dose (after 1-2 days). The percentage of the insecticide in the ditch sediment was 12% or less of the dose and tended to be lower at higher plant densities. Alkaline hydrolysis in the water near the surface of macrophytes and phytoplankton is considered to be the main dissipation process for lambda-cyhalothrin.
Vacuum FTIR study on the hygroscopicity of magnesium acetate aerosols
Wang, Na; Cai, Chen; He, Xiang; Pang, Shu-Feng; Zhang, Yun-Hong
2018-03-01
Hygroscopicity and volatility of secondary organic aerosol (SOA) are two important properties, which determine the composition, concentration, size, phase state of SOA and thus chemical and optical properties for SOA. In this work, magnesium acetate (Mg(Ac)2) aerosol was used as a simple SOA model in order to reveal relationship between hygroscopicity and volatility. A novel approach was set up based on a combination of a vacuum FTIR spectrometer and a home-made relative humidity (RH) controlling system. The striking advantage of this approach was that the RH and the compositions of aerosols could be obtained from a same IR spectrum, which guaranteed the synchronism between RH and spectral features on a sub-second scale. At the constant RH of 90% and 80% for 3000 s, the water content within Mg(Ac)2 aerosol particles decreased about 19.0% and 9.4% while there were 13.4% and 6.0% of acetate loss. This was attributed to a cooperation between volatile of acetic acid and Mg2 + hydrolysis in Mg(Ac)2 aerosols, which greatly suppressed the hygroscopicity of Mg(Ac)2 aerosols. When the RH changed with pulsed mode between 70% and 90%, hygroscopicity relaxation was observed for Mg(Ac)2 aerosols. Diffuse coefficient of water in the relaxation process was estimated to be 5 × 10- 12 m2·s- 1 for the Mg(Ac)2 aerosols. Combining the IR spectra analysis, the decrease in the diffuse coefficient of water was due to the formation of magnesium hydroxide accompanying acetic acid evaporation in the aerosols.
Yang, Yajun; Dong, Biqin; Xu, Hongxing; Zheng, Xusong; Tian, Junce; Heong, Kongleun; Lu, Zhongxian
2014-08-01
The brown planthopper, Nilaparvata lugens (Stål), is one of the most important insect pests on paddy rice in tropical and temperate Asia. Overuse and misuse of insecticides have resulted in the development of high resistance to many different insecticides in this pest. Studies were conducted to evaluate the change of resistance level to four insecticides over 15 generations without any exposure to insecticides in brown planthopper. After 15 generations' rearing without exposure to insecticide, brown planthopper could reverse the resistance to imidacloprid, chlorpyrifos, fipronil, and fenobucarb. The range and style of resistance reversal of brown planthopper differed when treated with four different insecticides. To monitor potential changes in insect physiological responses, we measured the activity of each of the three selected enzymes, including acetylcholinesterases (AChE), general esterases (EST), and glutathione S-transferases. After multiple generations' rearing without exposure to insecticide, AChE and EST activities of brown planthopper declined with the increased generations, suggesting that the brown planthopper population adjusted activities of EST and AChE to adapt to the non-insecticide environment. These findings suggest that the reducing, temporary stop, or rotation of insecticide application could be incorporated into the brown planthopper management.
Efficacy of insecticides in fruit borer control and residues on sugar apple fruit
Directory of Open Access Journals (Sweden)
Alessandro da Silva Oliveira
Full Text Available ABSTRACT Bahia is the Brazilian state with the largest production of sugar apple fruits (Annona squamosa L., and fruit borer (Cerconota anonella, Sepp. 1830 is a key crop pest. Insecticides are the main strategy for pest control even though there are no pesticides registered for this crop. This study aimed to assess the efficacy of insecticides to control fruit borer and determine the levels of insecticide residues in sugar apple fruits aiming at requesting the extension of authorization to use insecticide products in this crop. The experiment was conducted in an eight-year-old irrigated orchard (2 × 4 m located in Anagé, Bahia, Brazil. The experimental design was a randomized block design with 10 treatments (three insecticides with three doses and a control with water and 5 replications. Each plot was composed of four plants but only the two central ones were assessed. Insecticides and doses (g a.i. 100 L−1 water were Bacillus thuringiensis: 0.8, 1.7, and 2.5; triflumuron: 2.4, 3.6, and 4.8; and imidacloprid: 4.0, 10.0, and 16.0. Nine sprayings were carried out at fortnightly intervals with a costal sprayer with constant pressure, JA-2 nozzle, and with jet directed to the fruits. Ten assessments were performed in order to observe fruit borer presence in 30 previously marked fruits per plot. Imidacloprid, at the highest studied dose, was the only effective treatment. Analyses of imidacloprid residues, at 21 and 30 days after the highest dose application, indicated levels higher than the maximum limit allowed. Insecticides under the conditions tested do not meet the norms for requesting the extension of authorization to use insecticides for citrus in sugar apple fruits.
Modification of Local Urban Aerosol Properties by Long-Range Transport of Biomass Burning Aerosol
Directory of Open Access Journals (Sweden)
Iwona S. Stachlewska
2018-03-01
Full Text Available During August 2016, a quasi-stationary high-pressure system spreading over Central and North-Eastern Europe, caused weather conditions that allowed for 24/7 observations of aerosol optical properties by using a complex multi-wavelength PollyXT lidar system with Raman, polarization and water vapour capabilities, based at the European Aerosol Research Lidar Network (EARLINET network urban site in Warsaw, Poland. During 24–30 August 2016, the lidar-derived products (boundary layer height, aerosol optical depth, Ångström exponent, lidar ratio, depolarization ratio were analysed in terms of air mass transport (HYSPLIT model, aerosol load (CAMS data and type (NAAPS model and confronted with active and passive remote sensing at the ground level (PolandAOD, AERONET, WIOS-AQ networks and aboard satellites (SEVIRI, MODIS, CATS sensors. Optical properties for less than a day-old fresh biomass burning aerosol, advected into Warsaw’s boundary layer from over Ukraine, were compared with the properties of long-range transported 3–5 day-old aged biomass burning aerosol detected in the free troposphere over Warsaw. Analyses of temporal changes of aerosol properties within the boundary layer, revealed an increase of aerosol optical depth and Ångström exponent accompanied by an increase of surface PM10 and PM2.5. Intrusions of advected biomass burning particles into the urban boundary layer seem to affect not only the optical properties observed but also the top height of the boundary layer, by moderating its increase.
Pugliese, Massimo; Rettori, Andrea Alberto; Martinis, Roberto; Al-Rohily, Khalid; Velate, Suresh; Moideen, Mohamed Ashraf; Al-Maashi, Ali
2017-08-01
The date palm (Phoenix dactylifera L.), an important economic resource for many nations worldwide, has recently been threatened by the presence of different insect pests, like the red palm weevil (RPW) Rhynchophorus ferrugineus. Two products, a glue (polyvinyl acetate) and an oil (raw linseed oil) were used as coatings and applied together with a repellent and two insecticides (teflutrin and chlorpyrifos) at different dosages on two species of palm (P. dactylifera and P. canariensis). Phytotoxic effects of the treatments were evaluated in a greenhouse on 260 potted palms (130 P. dactylifera and 130 P. canariensis) and no negative effects were observed. Afterwards, a trial lasting 400 days was carried out in a nursery located in Sicily (south Italy), treating 572 potted palm trees (286 P. dactylifera and 286 P. canariensis) with an average diameter at the base of 18-20 cm. After 400 days, 48% of the untreated palms were infested, while only 3% of date palms and 7% of Canary palms treated with insecticide at lower dosages were infested. The application of an insecticide-based coating is a good strategy to control and prevent the red palm weevil infestation, in particular on date palms. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Aerosol insecticides (also known as ULV or fogging treatments) delivered through an ultra-low volume application system, are available commercially to control insect pests such as Plodia interpunctella Hübner, the Indianmeal moth. However, little is known about the susceptibility of eggs of P. inter...
Irrigation runoff insecticide pollution of rivers in the Imperial Valley, California (USA)
Energy Technology Data Exchange (ETDEWEB)
Vlaming, V. de [Aquatic Toxicology Laboratory, VM: APC, 1321 Haring Hall, University of California, Davis, CA 95616 (United States)]. E-mail: vldevlaming@ucdavis.edu; DiGiorgio, C. [Department of Water Resources, P.O. Box 942836, Sacramento, CA 94236 (United States); Fong, S. [Aquatic Toxicology Laboratory, VM: APC, 1321 Haring Hall, University of California, Davis, CA 95616 (United States); Deanovic, L.A. [Aquatic Toxicology Laboratory, VM: APC, 1321 Haring Hall, University of California, Davis, CA 95616 (United States); Paz Carpio-Obeso, M. de la [Colorado River Basin Region Water Quality Control Board, 73-720 Fred Waring Drive, Suite 100, Palm Desert, CA 92260 (United States); Miller, J.L. [AQUA-Science, 17 Arboretum Drive, Davis, CA 95616 (United States); Miller, M.J. [AQUA-Science, 17 Arboretum Drive, Davis, CA 95616 (United States); Richard, N.J. [Division of Water Quality, State Water Resources Control Board, 1001 I Street, Sacramento, CA 95814 (United States)
2004-11-01
The Alamo and New Rivers located in the Imperial Valley, California receive large volumes of irrigation runoff and discharge into the ecologically sensitive Salton Sea. Between 1993 and 2002 we conducted a series of studies to assess water quality using three aquatic species: a cladoceran (Ceriodaphnia dubia), a mysid (Neomysis mercedis), and a larval fish (Pimephales promelas). Although no mortality was observed with the P. promelas, high-level toxicity to the invertebrate species was documented in samples from both rivers during many months of each year. Toxicity identifications and chemical analyses identified the organophosphorus insecticides (OP), chlorpyrifos and diazinon, as the cause of C. dubia toxicity. The extent of the C. dubia mortality was highly correlated with quantities of these OPs applied in the river watersheds. C. dubia mortality occurred during more months of our 2001/2002 study than in the 1990s investigations. During 2001/2002, the extensive C. dubia mortality observed in New River samples was caused by OP insecticide pollution that originated from Mexico. Mortality to N. mercedis in New River samples was likely caused by contaminants other than OP insecticides. Our studies document OP insecticide-caused pollution of the Alamo River over a 10-year period and provide the necessary information for remediation efforts. - Capsule: Organophosphorous insecticides in runoff water from the USA and Mexico have impacted rivers in the Imperial Valley, California.
Irrigation runoff insecticide pollution of rivers in the Imperial Valley, California (USA)
International Nuclear Information System (INIS)
Vlaming, V. de; DiGiorgio, C.; Fong, S.; Deanovic, L.A.; Paz Carpio-Obeso, M. de la; Miller, J.L.; Miller, M.J.; Richard, N.J.
2004-01-01
The Alamo and New Rivers located in the Imperial Valley, California receive large volumes of irrigation runoff and discharge into the ecologically sensitive Salton Sea. Between 1993 and 2002 we conducted a series of studies to assess water quality using three aquatic species: a cladoceran (Ceriodaphnia dubia), a mysid (Neomysis mercedis), and a larval fish (Pimephales promelas). Although no mortality was observed with the P. promelas, high-level toxicity to the invertebrate species was documented in samples from both rivers during many months of each year. Toxicity identifications and chemical analyses identified the organophosphorus insecticides (OP), chlorpyrifos and diazinon, as the cause of C. dubia toxicity. The extent of the C. dubia mortality was highly correlated with quantities of these OPs applied in the river watersheds. C. dubia mortality occurred during more months of our 2001/2002 study than in the 1990s investigations. During 2001/2002, the extensive C. dubia mortality observed in New River samples was caused by OP insecticide pollution that originated from Mexico. Mortality to N. mercedis in New River samples was likely caused by contaminants other than OP insecticides. Our studies document OP insecticide-caused pollution of the Alamo River over a 10-year period and provide the necessary information for remediation efforts. - Capsule: Organophosphorous insecticides in runoff water from the USA and Mexico have impacted rivers in the Imperial Valley, California
Beelen, A.J. van; Roelofs, G.J.H.; Hasekamp, O.P.; Henzing, J.S.; Röckmann, T.
2013-01-01
This study is of our particular interest as the quality of our chemical transport model Lotos-Euros can be improved by our understanding of the aerosol-light interaction. In this study we derive aerosol water and chemical composition by a modeling approach that combines in situ measured and remotely
Gao, Song; Hegg, Dean A.; Hobbs, Peter V.; Kirchstetter, Thomas W.; Magi, Brian I.; Sadilek, Martin
2003-01-01
During the SAFARI 2000 field campaign, both smoke aerosols from savanna fires and haze aerosols in the boundary layer and in the free troposphere were collected from an aircraft in southern Africa. These aerosol samples were analyzed for their water-soluble chemical components, particularly the organic species. A novel technique, electrospray ionization-ion trap mass spectrometry, was used concurrently with an ion chromatography system to analyze for carbohydrate species. Seven carbohydrates, seven organic acids, five metallic elements, and three inorganic anions were identified and quantified. On the average, these 22 species comprised 36% and 27% of the total aerosol mass in haze and smoke aerosols, respectively. For the smoke aerosols, levoglucosan was the most abundant carbohydrate species, while gluconic acid was tentatively identified as the most abundant organic acid. The mass abundance and possible source of each class of identified species are discussed, along with their possible formation pathways. The combustion phase of a fire had an impact on the chemical composition of the emitted aerosols. Secondary formation of sulfate, nitrate, levoglucosan, and several organic acids occurred during the initial aging of smoke aerosols. It is likely that under certain conditions, some carbohydrate species in smoke aerosols, such as levoglucosan, were converted to organic acids during upward transport.
Pollution Of Insecticide Residues In PPTN Pasar Jumat Area
International Nuclear Information System (INIS)
Syahrir, Ulfa T.; Chairul, Sofnie M.
2000-01-01
Measurement of insecticide residue pollution from some organochlorin and organo-phosphat in soil and water samples were carried out 1999-2000 periode. The aim of the measurement was to get information about impact of laboratorium activity on insecticide contents in PPTN PASAR JUMAT. Gas chromatograph with electron capture and flame ionization detector were used to measure the pesticide content. Result of the measurement in PPTN area showed that organo-chlorin were alpha BHC, endosulfan band DDT and organo-phosphat were klorphyriphos and malation and were lower than tolerance level
Environmental insecticide residues from tsetse fly control measures in Uganda
International Nuclear Information System (INIS)
Sserunjoji-Sebalija, J.
1976-01-01
Up to June 1974 areas in Uganda totalling 8600km 2 have been successfully reclaimed from tsetse fly infestation by ground spray of 3% dieldrin water emulsions. A search for equally effective but less persistent and toxic compounds against tsetse flies has been unsuccessful. Fourteen insecticide formulations have been tested for their persistence on tree bark surfaces and, therefore, their availability and toxicity to the target tsetse flies. Only those compounds with a high immediate insecticidal activity (some higher than dieldrin) like endosulfan, Chlorfenvinphos and propoxur could merit further consideration in tsetse control. While some were toxic to tsetse as fresh deposits, they lacked sufficient persistence. A study of the environmental implication from the continued use of the highly persistent and toxic dieldrin has provided useful data on residues likely to be found both in terrestrial and aquatic fauna and flora. These are generally low. Moreover, there is evidence of degradation in some fish species (Protopterus aethiopicus and Clarias). Also, dilution factors and adsorption involving the muddy nature of water run-off, etc., and controlled burning of grasses after tsetse eradication would tend to inactivate the residual insecticide and protect aquatic systems. The general findings have indicated less risk than anticipated of the environmental contamination from tsetse control by application of persistent and toxic insecticides. (author)
Ji, Hongzhu; Zhang, Yinchao; Chen, Siying; Chen, He; Guo, Pan
2018-06-01
An iterative method, based on a derived inverse relationship between atmospheric backscatter coefficient and aerosol lidar ratio, is proposed to invert the lidar ratio profile and aerosol extinction coefficient. The feasibility of this method is investigated theoretically and experimentally. Simulation results show the inversion accuracy of aerosol optical properties for iterative method can be improved in the near-surface aerosol layer and the optical thick layer. Experimentally, as a result of the reduced insufficiency error and incoherence error, the aerosol optical properties with higher accuracy can be obtained in the near-surface region and the region of numerical derivative distortion. In addition, the particle component can be distinguished roughly based on this improved lidar ratio profile.
Asiimwe, Peter; Naranjo, Steven E; Ellsworth, Peter C
2014-04-01
Variation in plant quality and natural enemy abundance plays an important role in insect population dynamics. In manipulative field studies, we evaluated the impact of varying irrigation levels and insecticide type on densities of Lygus hesperus Knight and the arthropod predator community in cotton. Three watering levels were established via irrigations timed according to three levels of percent soil water depletion (SWD): 20, 40, or 60, where 40% SWD is considered standard grower practice, 60% represents a deficit condition likely to impose plant productivity losses, and 20% represents surplus conditions with likely consequences on excessive vegetative plant production. The two key L. hesperus insecticides used were the broad-spectrum insecticide acephate and the selective insecticide flonicamid, along with an untreated check. We hypothesized that densities of L. hesperus and its associated predators would be elevated at higher irrigation levels and that insecticides would differentially impact L. hesperus and predator dynamics depending on their selectivity. L. hesperus were more abundant at the higher irrigation level (20% SWD) but the predator densities were unaffected by irrigation levels. Both L. hesperus and its predators were affected by the selectivity of the insecticide with highest L. hesperus densities and lowest predator abundance where the broad spectrum insecticide (acephate) was used. There were no direct interactions between irrigation level and insecticides, indicating that insecticide effects on L. hesperus and its predators were not influenced by the irrigation levels used here. The implications of these findings on the overall ecology of insect-plant dynamics and yield in cotton are discussed.
Hladik, Michelle; Calhoun, Daniel L.
2012-01-01
A method for the determination of the widely used herbicide diuron, three degradates of diuron, and six neonicotinoid insecticides in environmental water samples is described. Filtered water samples were extracted by using solid-phase extraction (SPE) with no additional cleanup steps. Quantification of the pesticides from the extracted water samples was done by using liquid chromatography with tandem mass spectrometry (LC/MS/MS). Recoveries in test water samples fortified at 20 nanograms per liter (ng/L) for each compound ranged from 75 to 97 percent; relative standard deviations ranged from 5 to 10 percent. Method detection limits (MDLs) in water ranged from 3.0 to 6.2 ng/L using LC/MS/MS. The method was applied to water samples from two streams in Georgia, Sope Creek and the Chattahoochee River. Diuron and 3,4-dichloroaniline (3,4-DCA) were detected in 100 and 80 percent, respectively, of the samples from the Chattahoochee River, whereas Sope creek had detection frequencies of 15 percent for diuron and 31 percent for 3,4-DCA. Detection frequencies for the neonicotinoid insecticide, imidacloprid, were 60 percent for the Chattahoochee River and 85 percent for Sope Creek. Field matrix-spike recoveries for each compound, when averaged over four water samples, ranged from 79 to 100 percent. The average percentage difference between replicate pairs for all compounds detected in the field samples was 10.1 (± 4.5) percent.
Liu, Matthew J; Wiegel, Aaron A; Wilson, Kevin R; Houle, Frances A
2017-08-10
A key uncertainty in the heterogeneous oxidation of carboxylic acids by hydroxyl radicals (OH) in aqueous-phase aerosol is how the free-radical reaction pathways might be altered by acid-base chemistry. In particular, if acid-base reactions occur concurrently with acyloxy radical formation and unimolecular decomposition of alkoxy radicals, there is a possibility that differences in reaction pathways impact the partitioning of organic carbon between the gas and aqueous phases. To examine these questions, a kinetic model is developed for the OH-initiated oxidation of citric acid aerosol at high relative humidity. The reaction scheme, containing both free-radical and acid-base elementary reaction steps with physically validated rate coefficients, accurately predicts the experimentally observed molecular composition, particle size, and average elemental composition of the aerosol upon oxidation. The difference between the two reaction channels centers on the reactivity of carboxylic acid groups. Free-radical reactions mainly add functional groups to the carbon skeleton of neutral citric acid, because carboxylic acid moieties deactivate the unimolecular fragmentation of alkoxy radicals. In contrast, the conjugate carboxylate groups originating from acid-base equilibria activate both acyloxy radical formation and carbon-carbon bond scission of alkoxy radicals, leading to the formation of low molecular weight, highly oxidized products such as oxalic and mesoxalic acid. Subsequent hydration of carbonyl groups in the oxidized products increases the aerosol hygroscopicity and accelerates the substantial water uptake and volume growth that accompany oxidation. These results frame the oxidative lifecycle of atmospheric aerosol: it is governed by feedbacks between reactions that first increase the particle oxidation state, then eventually promote water uptake and acid-base chemistry. When coupled to free-radical reactions, acid-base channels lead to formation of low molecular
Aerosol Extinction Profile Mapping with Lognormal Distribution Based on MPL Data
Lin, T. H.; Lee, T. T.; Chang, K. E.; Lien, W. H.; Liu, G. R.; Liu, C. Y.
2017-12-01
This study intends to challenge the profile mapping of aerosol vertical distribution by mathematical function. With the similarity in distribution pattern, lognormal distribution is examined for mapping the aerosol extinction profile based on MPL (Micro Pulse LiDAR) in situ measurements. The variables of lognormal distribution are log mean (μ) and log standard deviation (σ), which will be correlated with the parameters of aerosol optical depht (AOD) and planetary boundary layer height (PBLH) associated with the altitude of extinction peak (Mode) defined in this study. On the base of 10 years MPL data with single peak, the mapping results showed that the mean error of Mode and σ retrievals are 16.1% and 25.3%, respectively. The mean error of σ retrieval can be reduced to 16.5% under the cases of larger distance between PBLH and Mode. The proposed method is further applied to MODIS AOD product in mapping extinction profile for the retrieval of PM2.5 in terms of satellite observations. The results indicated well agreement between retrievals and ground measurements when aerosols under 525 meters are well-mixed. The feasibility of proposed method to satellite remote sensing is also suggested by the case study. Keyword: Aerosol extinction profile, Lognormal distribution, MPL, Planetary boundary layer height (PBLH), Aerosol optical depth (AOD), Mode
Directory of Open Access Journals (Sweden)
Hafiz Azhar Ali Khan
Full Text Available House flies, Musca domestica L., are important pests of dairy operations worldwide, with the ability to adapt wide range of environmental conditions. There are a number of insecticides used for their management, but development of resistance is a serious problem. Insecticide mixtures could enhance the toxicity of insecticides in resistant insect pests, thus resulting as a potential resistance management tool. The toxicity of bifenthrin, cypermethrin, deltamethrin, chlorpyrifos, profenofos, emamectin benzoate and fipronil were assessed separately, and in mixtures against house flies. A field-collected population was significantly resistant to all the insecticides under investigation when compared with a laboratory susceptible strain. Most of the insecticide mixtures like one pyrethroid with other compounds evaluated under two conditions (1∶1-"A" and LC50: LC50-"B" significantly increased the toxicity of pyrethroids in the field population. Under both conditions, the combination indices of pyrethroids with other compounds, in most of the cases, were significantly below 1, suggesting synergism. The enzyme inhibitors, PBO and DEF, when used in combination with insecticides against the resistant population, toxicities of bifenthrin, cypermethrin, deltamethrin and emamectin were significantly increased, suggesting esterase and monooxygenase based resistance mechanism. The toxicities of bifenthrin, cypermethrin and deltamethrin in the resistant population of house flies could be enhanced by the combination with chlorpyrifos, profenofos, emamectin and fipronil. The findings of the present study might have practical significance for resistance management in house flies.
Bakas, Idriss; Hayat, Akhtar; Piletsky, Sergey; Piletska, Elena; Chehimi, Mohamed M; Noguer, Thierry; Rouillon, Régis
2014-12-01
We report here a novel method to detect methidathion organophosphorous insecticides. The sensing platform was architected by the combination of molecularly imprinted polymers and sol-gel technique on inexpensive, portable and disposable screen printed carbon electrodes. Electrochemical impedimetric detection technique was employed to perform the label free detection of the target analyte on the designed MIP/sol-gel integrated platform. The selection of the target specific monomer by electrochemical impedimetric methods was consistent with the results obtained by the computational modelling method. The prepared electrochemical MIP/sol-gel based sensor exhibited a high recognition capability toward methidathion, as well as a broad linear range and a low detection limit under the optimized conditions. Satisfactory results were also obtained for the methidathion determination in waste water samples. Copyright © 2014 Elsevier B.V. All rights reserved.
International Nuclear Information System (INIS)
Davari, B.; Vatandoost, H.
2009-01-01
Using of insecticides depends on the knowledge of the susceptibility levels of malaria vectors to these chemical. In this study, the chemical quality of water in the larval breeding habitats and the susceptibility levels of Anopheles stephensi to DDT 4% dieldrin 0.4% permethrin 0.75, cyfluthrin 0.15 deltamethrin 0.05% and lambdacyhalothrin 0.05% were investigated according to WHO method in south eastern of Iran. (Author)
Steam condensation modelling in aerosol codes
International Nuclear Information System (INIS)
Dunbar, I.H.
1986-01-01
The principal subject of this study is the modelling of the condensation of steam into and evaporation of water from aerosol particles. These processes introduce a new type of term into the equation for the development of the aerosol particle size distribution. This new term faces the code developer with three major problems: the physical modelling of the condensation/evaporation process, the discretisation of the new term and the separate accounting for the masses of the water and of the other components. This study has considered four codes which model the condensation of steam into and its evaporation from aerosol particles: AEROSYM-M (UK), AEROSOLS/B1 (France), NAUA (Federal Republic of Germany) and CONTAIN (USA). The modelling in the codes has been addressed under three headings. These are the physical modelling of condensation, the mathematics of the discretisation of the equations, and the methods for modelling the separate behaviour of different chemical components of the aerosol. The codes are least advanced in area of solute effect modelling. At present only AEROSOLS/B1 includes the effect. The effect is greater for more concentrated solutions. Codes without the effect will be more in error (underestimating the total airborne mass) the less condensation they predict. Data are needed on the water vapour pressure above concentrated solutions of the substances of interest (especially CsOH and CsI) if the extent to which aerosols retain water under superheated conditions is to be modelled. 15 refs
Botanical Insecticides in Plant Protection
Grdiša, Martina; Gršić, Kristina
2013-01-01
Botanical insecticides are natural compounds with insecticidal properties and their use in crop protection is as old as agricultural practice. Although they have been in use for over one hundred years, the advent of synthetic insecticides has unfortunately displaced their use today. Due to fast action, low cost, easy application and efficiency against a wide range of harmful species, synthetic insecticides have become an important part of pest management in modern agricultural systems....
Handa, Daishi; Somada, Yuka; Ijyu, Moriaki; Azechi, Sotaro; Nakaema, Fumiya; Arakaki, Takemitsu; Tanahara, Akira
2010-05-01
The economic development and population growth in recent Asia spread air pollution. Emission rate of air pollutants from Asia, in particular oxides of nitrogen, surpassed those from North America and Europe and should continue to exceed them for decades. The study of the long-range transported air pollution from Asian continent has gained a special attention in Japan because of increase in photochemical oxidants in relatively remote islands. Okinawa Island is situated approximately 1500 km south of Tokyo, Japan, 2000 km southeast of Beijing, China, and 1000 km south of South Korea. Its location in Asia is well suited for studying long-range transport of air pollutants in East Asia because maritime air mass prevails during summer, while continental air mass dominates during fall, winter, and spring. The maritime air mass data can be seen as background and can be compared with continental air masses which have been affected by anthropogenic activities. Bulk aerosol samples were collected on quartz filters by using a high volume air sampler. Sampling duration was one week for each sample. We determined the concentrations of water-soluble anions, cations and dissolved organic carbon (DOC) in the bulk aerosols collected at the Cape Hedo Atmosphere and Aerosol Monitoring Station (CHAAMS) using ion chromatography, atomic absorption spectrometry, and total organic carbon analyzer, respectively. We will report water-soluble chemical components data of anions, cations and DOC in bulk atmospheric aerosols collected at CHAAMS during August, 2005 to April, 2010. Seasonal variation of water-soluble chemical components showed that the concentrations were relatively low in summer, higher in fall and winter, and the highest in spring. When air mass came from Asian Continent, the concentrations of water-soluble chemical components were much higher compared to the other directions. In addition, we calculated background concentration of water-soluble chemical components at Okinawa
Larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus ...
African Journals Online (AJOL)
Purpose: To evaluate the larvicidal, pupicidal and insecticidal activities of Cosmos bipinnatus, Foenuculum vulgare and Tagetes minuta leaf extracts against Culex quinquefasciatus mosquitoes. Methods: The leaves of the plants were extracted with distilled water, ethanol (95 %), and hexane and the extracts screened for ...
Meher, Prabina Kumar; Sahu, Tanmaya Kumar; Banchariya, Anjali; Rao, Atmakuri Ramakrishna
2017-03-24
Insecticide resistance is a major challenge for the control program of insect pests in the fields of crop protection, human and animal health etc. Resistance to different insecticides is conferred by the proteins encoded from certain class of genes of the insects. To distinguish the insecticide resistant proteins from non-resistant proteins, no computational tool is available till date. Thus, development of such a computational tool will be helpful in predicting the insecticide resistant proteins, which can be targeted for developing appropriate insecticides. Five different sets of feature viz., amino acid composition (AAC), di-peptide composition (DPC), pseudo amino acid composition (PAAC), composition-transition-distribution (CTD) and auto-correlation function (ACF) were used to map the protein sequences into numeric feature vectors. The encoded numeric vectors were then used as input in support vector machine (SVM) for classification of insecticide resistant and non-resistant proteins. Higher accuracies were obtained under RBF kernel than that of other kernels. Further, accuracies were observed to be higher for DPC feature set as compared to others. The proposed approach achieved an overall accuracy of >90% in discriminating resistant from non-resistant proteins. Further, the two classes of resistant proteins i.e., detoxification-based and target-based were discriminated from non-resistant proteins with >95% accuracy. Besides, >95% accuracy was also observed for discrimination of proteins involved in detoxification- and target-based resistance mechanisms. The proposed approach not only outperformed Blastp, PSI-Blast and Delta-Blast algorithms, but also achieved >92% accuracy while assessed using an independent dataset of 75 insecticide resistant proteins. This paper presents the first computational approach for discriminating the insecticide resistant proteins from non-resistant proteins. Based on the proposed approach, an online prediction server DIRProt has
International Nuclear Information System (INIS)
Rosen, J.; Ivanov, V.A.
1993-01-01
Stratospheric aerosol measurements can provide both spatial and temporal data of sufficient resolution to be of use in climate models. Relatively recent results from a wide range of instrument techniques for measuring stratospheric aerosol parameters are described. Such techniques include impactor sampling, lidar system sensing, filter sampling, photoelectric particle counting, satellite extinction-sensing using the sun as a source, and optical depth probing, at sites mainly removed from tropospheric aerosol sources. Some of these techniques have also had correlative and intercomparison studies. The main methods for determining the vertical profiles of stratospheric aerosols are outlined: lidar extinction measurements from satellites; impactor measurements from balloons and aircraft; and photoelectric particle counter measurements from balloons, aircraft, and rockets. The conversion of the lidar backscatter to stratospheric aerosol mass loading is referred to. Absolute measurements of total solar extinction from satellite orbits can be used to extract the aerosol extinction, and several examples of vertical profiles of extinction obtained with the SAGE satellite are given. Stratospheric mass loading can be inferred from extinction using approximate linear relationships but under restrictive conditions. Impactor sampling is essentially the only method in which the physical nature of the stratospheric aerosol is observed visually. Vertical profiles of stratospheric aerosol number concentration using impactor data are presented. Typical profiles using a dual-size-range photoelectric dustsonde particle counter are given for volcanically disturbed and inactive periods. Some measurements of the global distribution of stratospheric aerosols are also presented. Volatility measurements are described, indicating that stratospheric aerosols are composed primarily of about 75% sulfuric acid and 25% water
Duarte, Regina M B O; Matos, João T V; Paula, Andreia S; Lopes, Sónia P; Pereira, Guilherme; Vasconcellos, Pérola; Gioda, Adriana; Carreira, Renato; Silva, Artur M S; Duarte, Armando C; Smichowski, Patricia; Rojas, Nestor; Sanchez-Ccoyllo, Odon
2017-08-01
This study describes and compares the key structural units present in water-soluble organic carbon (WSOC) fraction of atmospheric aerosols collected in different South American (Colombia - Medellín and Bogotá, Peru - Lima, Argentina - Buenos Aires, and Brazil - Rio de Janeiro, São Paulo, and Porto Velho, during moderate (MBB) and intense (IBB) biomass burning) and Western European (Portugal - Aveiro and Lisbon) locations. Proton nuclear magnetic resonance ( 1 H NMR) spectroscopy was employed to assess the relative distribution of non-exchangeable proton functional groups in aerosol WSOC of diverse origin, for the first time to the authors' knowledge in South America. The relative contribution of the proton functional groups was in the order H-C > H-C-C= > H-C-O > Ar-H, except in Porto Velho during MBB, Medellín, Bogotá, and Buenos Aires, for which the relative contribution of H-C-O was higher than that of H-C-C=. The 1 H NMR source attribution confirmed differences in aging processes or regional sources between the two geographic regions, allowing the differentiation between urban combustion-related aerosol and biological particles. The aerosol WSOC in Aveiro, Lisbon, and Rio de Janeiro during summer are more oxidized than those from the remaining locations, indicating the predominance of secondary organic aerosols. Fresh emissions, namely of smoke particles, becomes important during winter in Aveiro and São Paulo, and in Porto Velho during IBB. The biosphere is an important source altering the chemical composition of aerosol WSOC in South America locations. The source attribution in Medellín, Bogotá, Buenos Aires, and Lima confirmed the mixed contributions of biological material, secondary formation, as well as urban and biomass burning emissions. Overall, the information and knowledge acquired in this study provide important diagnostic tools for future studies aiming at understanding the water-soluble organic aerosol problem, their sources and
A global space-based stratospheric aerosol climatology: 1979–2016
Directory of Open Access Journals (Sweden)
L. W. Thomason
2018-03-01
Full Text Available We describe the construction of a continuous 38-year record of stratospheric aerosol optical properties. The Global Space-based Stratospheric Aerosol Climatology, or GloSSAC, provided the input data to the construction of the Climate Model Intercomparison Project stratospheric aerosol forcing data set (1979–2014 and we have extended it through 2016 following an identical process. GloSSAC focuses on the Stratospheric Aerosol and Gas Experiment (SAGE series of instruments through mid-2005, and on the Optical Spectrograph and InfraRed Imager System (OSIRIS and the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO data thereafter. We also use data from other space instruments and from ground-based, air, and balloon borne instruments to fill in key gaps in the data set. The end result is a global and gap-free data set focused on aerosol extinction coefficient at 525 and 1020 nm and other parameters on an "as available" basis. For the primary data sets, we developed a new method for filling the post-Pinatubo eruption data gap for 1991–1993 based on data from the Cryogenic Limb Array Etalon Spectrometer. In addition, we developed a new method for populating wintertime high latitudes during the SAGE period employing a latitude-equivalent latitude conversion process that greatly improves the depiction of aerosol at high latitudes compared to earlier similar efforts. We report data in the troposphere only when and where it is available. This is primarily during the SAGE II period except for the most enhanced part of the Pinatubo period. It is likely that the upper troposphere during Pinatubo was greatly enhanced over non-volcanic periods and that domain remains substantially under-characterized. We note that aerosol levels during the OSIRIS/CALIPSO period in the lower stratosphere at mid- and high latitudes is routinely higher than what we observed during the SAGE II period. While this period had nearly continuous low
Enhanced Iron Solubility at Low pH in Global Aerosols
Directory of Open Access Journals (Sweden)
Ellery D. Ingall
2018-05-01
Full Text Available The composition and oxidation state of aerosol iron were examined using synchrotron-based iron near-edge X-ray absorption spectroscopy. By combining synchrotron-based techniques with water leachate analysis, impacts of oxidation state and mineralogy on aerosol iron solubility were assessed for samples taken from multiple locations in the Southern and the Atlantic Oceans; and also from Noida (India, Bermuda, and the Eastern Mediterranean (Crete. These sampling locations capture iron-containing aerosols from different source regions with varying marine, mineral dust, and anthropogenic influences. Across all locations, pH had the dominating influence on aerosol iron solubility. When aerosol samples were approximately neutral pH, iron solubility was on average 3.4%; when samples were below pH 4, the iron solubility increased to 35%. This observed aerosol iron solubility profile is consistent with thermodynamic predictions for the solubility of Fe(III oxides, the major iron containing phase in the aerosol samples. Source regions and transport paths were also important factors affecting iron solubility, as samples originating from or passing over populated regions tended to contain more soluble iron. Although the acidity appears to affect aerosol iron solubility globally, a direct relationship for all samples is confounded by factors such as anthropogenic influence, aerosol buffer capacity, mineralogy and physical processes.
Characterizing the insecticide resistance of Anopheles gambiae in Mali.
Cisse, Moussa B M; Keita, Chitan; Dicko, Abdourhamane; Dengela, Dereje; Coleman, Jane; Lucas, Bradford; Mihigo, Jules; Sadou, Aboubacar; Belemvire, Allison; George, Kristen; Fornadel, Christen; Beach, Raymond
2015-08-22
The impact of indoor residual spraying (IRS) and long-lasting insecticide nets (LLINs), key components of the national malaria control strategy of Mali, is threatened by vector insecticide resistance. The objective of this study was to assess the level of insecticide resistance in Anopheles gambiae sensu lato populations from Mali against four classes of insecticide recommended for IRS: organochlorines (OCs), pyrethroids (PYs), carbamates (CAs) and organophosphates (OPs). Characterization of resistance was done in 13 sites across southern Mali and assessed presence and distribution of physiological mechanisms that included target-site modifications: knockdown resistance (kdr) and altered acetycholinesterase (AChE), and/or metabolic mechanisms: elevated esterases, glutathione S-transferases (GSTs), and monooxygenases. The World Health Organization (WHO) tube test was used to determine phenotypic resistance of An. gambiae s.l. to: dichlorodiphenyltrichloroethane (DDT) (OC), deltamethrin (PY), lambda-cyhalothrin (PY), bendiocarb (CA), and fenitrothion (OP). Identification of sibling species and presence of the ace-1 (R) and Leu-Phe kdr, resistance-associated mutations, were determined using polymerase chain reaction (PCR) technology. Biochemical assays were conducted to detect increased activity of GSTs, oxidases and esterases. Populations tested showed high levels of resistance to DDT in all 13 sites, as well as increased resistance to deltamethrin and lambda-cyhalothrin in 12 out of 13 sites. Resistance to fenitrothion and bendiocarb was detected in 1 and 4 out of 13 sites, respectively. Anopheles coluzzii, An. gambiae sensu stricto and Anopheles arabiensis were identified with high allelic frequencies of kdr in all sites where each of the species were found (13, 12 and 10 sites, respectively). Relatively low allelic frequencies of ace-1 (R) were detected in four sites where this assessment was conducted. Evidence of elevated insecticide metabolism, based on oxidase
Ntwali, Didier; Chen, Hongbin
2018-06-01
The diurnal spatial distribution of both natural and anthropogenic aerosols, as well as liquid and ice cloud micro-macrophysics have been evaluated over Africa using Terra and Aqua MODIS collection 6 products. The variability of aerosol optical depth (AOD), Ångström exponent (AE), liquid and ice cloud microphysics (Liquid cloud effective radius LCER, Ice cloud effective radius ICER) and cloud macrophysics (Liquid cloud optical thickness LCOT, Liquid cloud water path LCWP, Ice cloud optical thickness ICOT, Ice cloud water path ICWP) parameters were investigated from the morning to afternoon over Africa from 2010 to 2014. In both the morning (Terra) and afternoon (Aqua) heavy pollution (AOD ≥ 0.6) occurs in the coastal and central areas (between 120 N-170 N and 100 E-150 E) of West of Africa (WA), Central of Africa (CA) (0.50 S-70S and 100 E-250 E),. Moderate pollution (0.3 1.2) aerosols. The mixture of dust and biomass burning aerosols (0.7 improve aerosol and cloud remote sensing retrieval.
Limonene--A Natural Insecticide.
Beatty, Joseph H.
1986-01-01
Describes a high school chemistry student's research project in which limonene was isolated from the oil of lemons and oranges. Outlines the students' tests on the use of this chemical as an insecticide. Discusses possible extensions of the exercises based on questions generated by the students. (TW)
BACILLUS THURINGIENSIS ELASTASES WITH INSECTICIDE ACTIVITY
Directory of Open Access Journals (Sweden)
E. V. Matseliukh
2015-10-01
Full Text Available The purpose of the research was a screening of proteases with elastase activity among Bacillus thuringiensis strains, their isolation, partially purification, study of physicochemical properties and insecticide activity in relation to the larvae of the Colorado beetle. The objects of the investigation were 18 strains of B. thuringiensis, isolated from different sources: sea water, dry biological product "Bitoksibatsillin" and also from natural populations of Colorado beetles of the Crimea, Kherson, Odesa, Mykolaiv and Zaporizhiia regions of Ukraine. Purification of enzymes with elastase activity isolated from above mentioned strains was performed by gel-chromatography and insecticide activity was studied on the 3–4 larvae instar of Colorado beetle. The ability of a number of B. thuringiensis strains to synthesize the proteases with elastase activity has been established. The most active were enzymes obtained from strains IMV B-7465, IMV B-7324 isolated from sea water, and strains 9, 902, Bt-H and 0-239 isolated from Colorado beetles. The study of the physicochemical properties of the partially purified proteases of these strains showed that they belonged to enzymes of the serine type. Peptidases of a number of B. thuringiensis strains (IMV B-7324, IMV B-7465, 902, 0-239, 9 are metal-dependent enzymes. Optimal conditions of action of all tested enzymes are the neutral and alkaline рН values and the temperatures of 30–40 °С. The studies of influence of the complex enzyme preparations and partially purified ones of B. thuringiensis strains on the larvae instar of Colorado beetles indicated that enzymes with elastase activity could be responsible for insecticide action of the tested strains.
Interference of Heavy Aerosol Loading on the VIIRS Aerosol Optical Depth (AOD Retrieval Algorithm
Directory of Open Access Journals (Sweden)
Yang Wang
2017-04-01
Full Text Available Aerosol optical depth (AOD has been widely used in climate research, atmospheric environmental observations, and other applications. However, high AOD retrieval remains challenging over heavily polluted regions, such as the North China Plain (NCP. The Visible Infrared Imaging Radiometer Suite (VIIRS, which was designed as a successor to the Moderate Resolution Imaging Spectroradiometer (MODIS, will undertake the aerosol observations mission in the coming years. Using the VIIRS AOD retrieval algorithm as an example, we analyzed the influence of heavy aerosol loading through the 6SV radiative transfer model (RTM with a focus on three aspects: cloud masking, ephemeral water body tests, and data quality estimation. First, certain pixels were mistakenly screened out as clouds and ephemeral water bodies because of heavy aerosols, resulting in the loss of AOD retrievals. Second, the greenness of the surface could not be accurately identified by the top of atmosphere (TOA index, and the quality of the aggregation data may be artificially high. Thus, the AOD retrieval algorithm did not perform satisfactorily, indicated by the low availability of data coverage (at least 37.97% of all data records were missing according to ground-based observations and overestimation of the data quality (high-quality data increased from 63.42% to 80.97% according to radiative simulations. To resolve these problems, the implementation of a spatial variability cloud mask method and surficial index are suggested in order to improve the algorithm.
Wu, Longtao; Gu, Yu; Jiang, Jonathan H.; Su, Hui; Yu, Nanpeng; Zhao, Chun; Qian, Yun; Zhao, Bin; Liou, Kuo-Nan; Choi, Yong-Sang
2018-04-01
A version of the WRF-Chem model with fully coupled aerosol-meteorology-snowpack is employed to investigate the impacts of various aerosol sources on precipitation and snowpack in California. In particular, the impacts of locally emitted anthropogenic and dust aerosols, and aerosols transported from outside California are studied. We differentiate three pathways of aerosol effects: aerosol-radiation interaction (ARI), aerosol-snow interaction (ASI), and aerosol-cloud interaction (ACI). The convection-permitting model simulations show that precipitation, snow water equivalent (SWE), and surface air temperature averaged over the whole domain (34-42° N, 117-124° W, not including ocean points) are reduced when aerosols are included, therefore reducing large biases in these variables due to the absence of aerosol effects in the model. Aerosols affect California water resources through the warming of mountaintops and the reduction of precipitation; however, different aerosol sources play different roles in changing surface temperature, precipitation, and snowpack in California by means of various weights of the three pathways. ARI by all aerosols mainly cools the surface, leading to slightly increased SWE over the mountains. Locally emitted dust aerosols warm the surface of mountaintops through ASI, in which the reduced snow albedo associated with dusty snow leads to more surface absorption of solar radiation and reduced SWE. Transported aerosols and local anthropogenic aerosols play a dominant role in increasing nonprecipitating clouds but reducing precipitation through ACI, leading to reduced SWE and runoff on the Sierra Nevada, as well as the warming of mountaintops associated with decreased SWE and hence lower surface albedo. The average changes in surface temperature from October 2012 to June 2013 are about -0.19 and 0.22 K for the whole domain and over mountaintops, respectively. Overall, the averaged reduction during October to June is about 7 % for precipitation
Kroll, Jay A.; Donaldson, D. J.; Vaida, Veronica
2016-06-01
Sulfur compounds have been observed in a number of planetary atmospheres throughout our solar system. Our current understanding of sulfur chemistry explains much of what we observe in Earth's atmosphere. However, several discrepancies between modeling and observations of the Venusian atmosphere show there are still problems in our fundamental understanding of sulfur chemistry. This is of particular concern due to the important role sulfur compounds play in the formation of aerosols, which have a direct impact on planetary climates, including Earth's. We investigate the role of water complexes in the hydration of sulfur oxides and dehydration of sulfur acids and will present spectroscopic studies to document such effects. I will present recent work investigating mixtures of SO_2 and water that generate large quantities of aerosol when irradiated with solar UV light, even in the absence of traditional OH chemistry. I will discuss a proposed mechanism for the formation of sulfurous acid (H_2SO_3) and present recent experimental work that supports this proposed mechanism. Additionally, the implications that photon-induced hydration of SO_2 has for aerosol formation in the atmosphere of earth as well as other planetary atmospheres will be discussed.
Physical metrology of aerosols; Metrologie physique des aerosols
Energy Technology Data Exchange (ETDEWEB)
Boulaud, D.; Vendel, J. [CEA Saclay, 91 - Gif-sur-Yvette (France). Inst. de Protection et de Surete Nucleaire
1996-12-31
The various detection and measuring methods for aerosols are presented, and their selection is related to aerosol characteristics (size range, concentration or mass range), thermo-hydraulic conditions (carrier fluid temperature, pressure and flow rate) and to the measuring system conditions (measuring frequency, data collection speed, cost...). Methods based on aerosol dynamic properties (inertial, diffusional and electrical methods) and aerosol optical properties (localized and integral methods) are described and their performances and applications are compared
Biological efficacy of the ecotoxically favourable insecticides and ...
African Journals Online (AJOL)
The high biologic efficacy, mechanism of action, resistance to water rinsing, high selectivity, and small quantities of application, anticipated a bright future for them. Since results of researches of biological efficacy of insecticides in laboratory and field conditions are statistically different, studies done in natural conditions ...
A global, space-based stratospheric aerosol climatology: 1979 to 2014
Thomason, L. W.; Vernier, J. P.; Bourassa, A. E.; Millan, L.; Manney, G. L.
2016-12-01
Herein, we report on a global space-based stratospheric aerosol climatology (GloSSAC) that has been developed to support Coupled Model Intercomparison Project Phase 6 (CMIP6) (REF to CMIP6 and ETH work). GloSSAC is most closely related to the ASAP[SPARC, 2006] and CCMI data sets and follows a similar approach used to produce those data sets. It is primarily built using space-based measurements by a number of instruments including the SAGE series, OSIRIS, CALIPSO, CLAES and HALOE. The data set is presented as monthly depictions for 80S to 80N and from at least the tropopause to 40 km. The data set consists primarily of measurements by the instruments at their native wavelength and measurement type (e.g., extinction coefficient). However, every bin in these monthly grids receives measured or indirectly inferred values for aerosol extinction coefficient at 525 and 1020 nm. Generally, bins where no data are available are filled via simple linear interpolation in time only. The exceptions are in the SAGE I/II gap from 1982 to 1984 where data from SAM II and ground-based and airborne lidar data sets are used to span the 3 years between the end of the SAGE I mission in November 1981 and the beginning of the SAGE II mission in October 1984. Ground-based lidar also supplements space-based data in the months following the Pinatubo eruption when much of the lower stratosphere is too optically opaque for occultation measurements. This data set includes total aerosol surface area density and volume estimates based on Thomason et al.[2008] though these should be interpreted as bounding values (low and high) rather than functional aerosol parameters that are generally produced from this and predecessor data sets by other parties. Unlike previous versions of this data set, GloSSAC has been permanently archived at NASA's Atmospheric Science Data Center and a digital object identifier (doi) for GloSSAC is available. SPARC (2006), Assessment of Stratospheric Aerosol Properties (ASAP
Directory of Open Access Journals (Sweden)
Han Zhang
Full Text Available Oilseed rape (Brassica napus is an important combinable break crop in the UK, which is largely protected from arthropod pests by insecticidal chemicals. Despite ongoing debate regarding the use of neonicotinoids, the dominant seed treatment ingredients used for this crop, there is little publicly available data comparing the efficacy of insecticides in controlling key arthropod pests or comparing the impacts on non-target species and the wider environment. To provide an insight into these matters, a UK-wide expert survey targeting agronomists and entomologists was conducted from March to June 2015. Based on the opinions of 90 respondents, an average of 20% yield loss caused by the key arthropod pests was expected to have occurred in the absence of insecticide treatments. Relatively older chemical groups were perceived to have lower efficacy for target pests than newer ones, partly due to the development of insecticide resistance. Without neonicotinoid seed treatments, a lack of good control for cabbage stem flea beetle was perceived. Wide spectrum foliar insecticide sprays were perceived to have significantly greater negative impacts than seed treatments on users' health, natural enemies, pollinators, soil and water, and many foliar active ingredients have had potential risks for non-target arthropod species in UK oilseed rape fields for the past 25 years. Overall, 72% of respondents opposed the neonicotinoid restriction, while 10% supported it. Opposition and support of the restriction were largely based on concerns for pollinators and the wider environment, highlighting the uncertainty over the side effects of neonicotinoid use. More people from the government and research institutes leaned towards neutrality over the issue, compared to those directly involved in growing the crop. Neonicotinoid restriction was expected to result in greater effort and expenditure on pest control and lower production (0-1 t/ha less. Alternatives for future
Development of an aerosol decontamination factor evaluation method using an aerosol spectrometer
International Nuclear Information System (INIS)
Kanai, Taizo; Furuya, Masahiro; Arai, Takahiro; Nishi, Yoshihisa
2016-01-01
Highlights: • Aerosol DF of each diameter is evaluable by using optical scattering method. • Outlet aerosol concentration shows exponential decay by the submergence. • This decay constant depends on the aerosol diameter. • Aerosol DF at water scrubber is described by simple equation. - Abstract: During a severe nuclear power plant accident, the release of fission products into containment and an increase in containment pressure are assumed to be possible. When the containment is damaged by excess pressure or temperature, radioactive materials are released. Pressure suppression pools, containment spray systems and a filtered containment venting system (FCVS) reduce containment pressure and reduce the radioactive release into the environment. These devices remove radioactive materials via various mechanisms. Pressure suppression pools remove radioactive materials by pool scrubbing. Spray systems remove radioactive materials by droplet−aerosol interaction. FCVS, which is installed in the exhaust system, comprises multi-scrubbers (venturi-scrubber, pool scrubbing, static mixer, metal−fiber filter and molecular sieve). For the particulate radioactive materials, its size affects the removal performance and a number of studies have been performed on the removal effect of radioactive materials. This study has developed a new means of evaluating aerosol removal efficiency. The aerosol number density of each effective diameter (light scattering equivalent diameter) is measured using an optical method, while the decontamination factor (DF) of each effective diameter is evaluated by the inlet outlet number density ratio. While the applicable scope is limited to several conditions (geometry of test section: inner diameter 500 mm × height 8.0 m, nozzle shape and air-water ambient pressure conditions), this study has developed a numerical model which defines aerosol DF as a function of aerosol diameter (d) and submergences (x).
Development of an aerosol decontamination factor evaluation method using an aerosol spectrometer
Energy Technology Data Exchange (ETDEWEB)
Kanai, Taizo, E-mail: t-kanai@criepi.denken.or.jp; Furuya, Masahiro, E-mail: furuya@criepi.denken.or.jp; Arai, Takahiro, E-mail: t-arai@criepi.denken.or.jp; Nishi, Yoshihisa, E-mail: y-nishi@criepi.denken.or.jp
2016-07-15
Highlights: • Aerosol DF of each diameter is evaluable by using optical scattering method. • Outlet aerosol concentration shows exponential decay by the submergence. • This decay constant depends on the aerosol diameter. • Aerosol DF at water scrubber is described by simple equation. - Abstract: During a severe nuclear power plant accident, the release of fission products into containment and an increase in containment pressure are assumed to be possible. When the containment is damaged by excess pressure or temperature, radioactive materials are released. Pressure suppression pools, containment spray systems and a filtered containment venting system (FCVS) reduce containment pressure and reduce the radioactive release into the environment. These devices remove radioactive materials via various mechanisms. Pressure suppression pools remove radioactive materials by pool scrubbing. Spray systems remove radioactive materials by droplet−aerosol interaction. FCVS, which is installed in the exhaust system, comprises multi-scrubbers (venturi-scrubber, pool scrubbing, static mixer, metal−fiber filter and molecular sieve). For the particulate radioactive materials, its size affects the removal performance and a number of studies have been performed on the removal effect of radioactive materials. This study has developed a new means of evaluating aerosol removal efficiency. The aerosol number density of each effective diameter (light scattering equivalent diameter) is measured using an optical method, while the decontamination factor (DF) of each effective diameter is evaluated by the inlet outlet number density ratio. While the applicable scope is limited to several conditions (geometry of test section: inner diameter 500 mm × height 8.0 m, nozzle shape and air-water ambient pressure conditions), this study has developed a numerical model which defines aerosol DF as a function of aerosol diameter (d) and submergences (x).
Characteristics of regional aerosols: Southern Arizona and eastern Pacific Ocean
Prabhakar, Gouri
Atmospheric aerosols impact the quality of our life in many direct and indirect ways. Inhalation of aerosols can have harmful effects on human health. Aerosols also have climatic impacts by absorbing or scattering solar radiation, or more indirectly through their interactions with clouds. Despite a better understanding of several relevant aerosol properties and processes in the past years, they remain the largest uncertainty in the estimate of global radiative forcing. The uncertainties arise because although aerosols are ubiquitous in the Earth's atmosphere they are highly variable in space, time and their physicochemical properties. This makes in-situ measurements of aerosols vital in our effort towards reducing uncertainties in the estimate of global radiative forcing due to aerosols. This study is an effort to characterize atmospheric aerosols at a regional scale, in southern Arizona and eastern Pacific Ocean, based on ground and airborne observations of aerosols. Metals and metalloids in particles with aerodynamic diameter (Dp) smaller than 2.5 μm are found to be ubiquitous in southern Arizona. The major sources of the elements considered in the study are identified to be crustal dust, smelting/mining activities and fuel combustion. The spatial and temporal variability in the mass concentrations of these elements depend both on the source strength and meteorological conditions. Aircraft measurements of aerosol and cloud properties collected during various field campaigns over the eastern Pacific Ocean are used to study the sources of nitrate in stratocumulus cloud water and the relevant processes. The major sources of nitrate in cloud water in the region are emissions from ships and wildfires. Different pathways for nitrate to enter cloud water and the role of meteorology in these processes are examined. Observations of microphysical properties of ambient aerosols in ship plumes are examined. The study shows that there is an enhancement in the number
Observation-based estimation of aerosol-induced reduction of planetary boundary layer height
Zou, Jun; Sun, Jianning; Ding, Aijun; Wang, Minghuai; Guo, Weidong; Fu, Congbin
2017-09-01
Radiative aerosols are known to influence the surface energy budget and hence the evolution of the planetary boundary layer. In this study, we develop a method to estimate the aerosol-induced reduction in the planetary boundary layer height (PBLH) based on two years of ground-based measurements at a site, the Station for Observing Regional Processes of the Earth System (SORPES), at Nanjing University, China, and radiosonde data from the meteorological station of Nanjing. The observations show that increased aerosol loads lead to a mean decrease of 67.1 W m-2 for downward shortwave radiation (DSR) and a mean increase of 19.2 W m-2 for downward longwave radiation (DLR), as well as a mean decrease of 9.6 Wm-2 for the surface sensible heat flux (SHF) in the daytime. The relative variations of DSR, DLR and SHF are shown as a function of the increment of column mass concentration of particulate matter (PM2.5). High aerosol loading can significantly increase the atmospheric stability in the planetary boundary layer during both daytime and nighttime. Based on the statistical relationship between SHF and PM2.5 column mass concentrations, the SHF under clean atmospheric conditions (same as the background days) is derived. In this case, the derived SHF, together with observed SHF, are then used to estimate changes in the PBLH related to aerosols. Our results suggest that the PBLH decreases more rapidly with increasing aerosol loading at high aerosol loading. When the daytime mean column mass concentration of PM2.5 reaches 200 mg m-2, the decrease in the PBLH at 1600 LST (local standard time) is about 450 m.
Directory of Open Access Journals (Sweden)
B. Ervens
2010-09-01
Full Text Available This study presents a modeling framework based on laboratory data to describe the kinetics of glyoxal reactions that form secondary organic aerosol (SOA in aqueous aerosol particles. Recent laboratory results on glyoxal reactions are reviewed and a consistent set of empirical reaction rate constants is derived that captures the kinetics of glyoxal hydration and subsequent reversible and irreversible reactions in aqueous inorganic and water-soluble organic aerosol seeds. Products of these processes include (a oligomers, (b nitrogen-containing products, (c photochemical oxidation products with high molecular weight. These additional aqueous phase processes enhance the SOA formation rate in particles and yield two to three orders of magnitude more SOA than predicted based on reaction schemes for dilute aqueous phase (cloud chemistry for the same conditions (liquid water content, particle size.
The application of the new module including detailed chemical processes in a box model demonstrates that both the time scale to reach aqueous phase equilibria and the choice of rate constants of irreversible reactions have a pronounced effect on the predicted atmospheric relevance of SOA formation from glyoxal. During day time, a photochemical (most likely radical-initiated process is the major SOA formation pathway forming ∼5 μg m−3 SOA over 12 h (assuming a constant glyoxal mixing ratio of 300 ppt. During night time, reactions of nitrogen-containing compounds (ammonium, amines, amino acids contribute most to the predicted SOA mass; however, the absolute predicted SOA masses are reduced by an order of magnitude as compared to day time production. The contribution of the ammonium reaction significantly increases in moderately acidic or neutral particles (5 < pH < 7.
Glyoxal uptake into ammonium sulfate seed under dark conditions can be represented with a single reaction parameter keffupt that does not depend
Zhao, B.; Gu, Y.; Liou, K. N.; Jiang, J. H.; Li, Q.; Liu, X.; Huang, L.; Wang, Y.; Su, H.
2017-12-01
The interactions between aerosols and ice clouds (consisting only of ice) represent one of the largest uncertainties in global radiative forcing from pre-industrial time to the present. The observational evidence for the aerosol impact on ice cloud properties has been quite limited and showed conflicting results, partly because previous observational studies did not consider the distinct features of different ice cloud and aerosol types. Using 9-year satellite observations, we find that, for ice clouds generated from deep convection, cloud thickness, cloud optical thickness (COT), and ice cloud fraction increase and decrease with small-to-moderate and high aerosol loadings, respectively. For in-situ formed ice clouds, however, the preceding cloud properties increase monotonically and more sharply with aerosol loadings. The case is more complicated for ice crystal effective radius (Rei). For both convection-generated and in-situ ice clouds, the responses of Rei to aerosol loadings are modulated by water vapor amount in conjunction with several other meteorological parameters, but the sensitivities of Rei to aerosols under the same water vapor amount differ remarkably between the two ice cloud types. As a result, overall Rei slightly increases with aerosol loading for convection-generated ice clouds, but decreases for in-situ ice clouds. When aerosols are decomposed into different types, an increase in the loading of smoke aerosols generally leads to a decrease in COT of convection-generated ice clouds, while the reverse is true for dust and anthropogenic pollution. In contrast, an increase in the loading of any aerosol type can significantly enhance COT of in-situ ice clouds. The modulation of the aerosol impacts by cloud/aerosol types is demonstrated and reproduced by simulations using the Weather Research and Forecasting (WRF) model. Adequate and accurate representations of the impact of different cloud/aerosol types in climate models are crucial for reducing the
Smirnov, A.; Sayer, A. M.; Holben, B. N.; Hsu, N. C.; Sakerin, S. M.; Macke, A.; Nelson, N. B.; Courcoux, Y.; Smyth, T. J.; Croot, P.;
2012-01-01
The Maritime Aerosol Network (MAN) has been collecting data over the oceans since November 2006. The MAN archive provides a valuable resource for aerosol studies in maritime environments. In the current paper we investigate correlations between ship-borne aerosol optical depth (AOD) and near-surface wind speed, either measured (onboard or from satellite) or modeled (NCEP). According to our analysis, wind speed influences columnar aerosol optical depth, although the slope of the linear regression between AOD and wind speed is not steep (approx. 0.004 - 0.005), even for strong winds over 10m/s. The relationships show significant scatter (correlation coefficients typically in the range 0.3 - 0.5); the majority of this scatter can be explained by the uncertainty on the input data. The various wind speed sources considered yield similar patterns. Results are in good agreement with the majority of previously published relationships between surface wind speed and ship-based or satellite-based AOD measurements. The basic relationships are similar for all the wind speed sources considered; however, the gradient of the relationship varies by around a factor of two depending on the wind data used
Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland.
Moore, M T; Cooper, C M; Smith, S; Cullum, R F; Knight, S S; Locke, M A; Bennett, E R
2009-01-01
Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides.
Hamilton, Kerry A; Hamilton, Mark T; Johnson, William; Jjemba, Patrick; Bukhari, Zia; LeChevallier, Mark; Haas, Charles N
2018-05-01
The use of reclaimed water brings new challenges for the water industry in terms of maintaining water quality while increasing sustainability. Increased attention has been devoted to opportunistic pathogens, especially Legionella pneumophila, due to its growing importance as a portion of the waterborne disease burden in the United States. Infection occurs when a person inhales a mist containing Legionella bacteria. The top three uses for reclaimed water (cooling towers, spray irrigation, and toilet flushing) that generate aerosols were evaluated for Legionella health risks in reclaimed water using quantitative microbial risk assessment (QMRA). Risks are compared using data from nineteen United States reclaimed water utilities measured with culture-based methods, quantitative PCR (qPCR), and ethidium-monoazide-qPCR. Median toilet flushing annual infection risks exceeded 10 -4 considering multiple toilet types, while median clinical severity infection risks did not exceed this value. Sprinkler and cooling tower risks varied depending on meteorological conditions and operational characteristics such as drift eliminator performance. However, the greatest differences between risk scenarios were due to 1) the dose response model used (infection or clinical severity infection) 2) population at risk considered (residential or occupational) and 3) differences in laboratory analytical method. Theoretical setback distances necessary to achieve a median annual infection risk level of 10 -4 are proposed for spray irrigation and cooling towers. In both cooling tower and sprinkler cases, Legionella infection risks were non-trivial at potentially large setback distances, and indicate other simultaneous management practices could be needed to manage risks. The sensitivity analysis indicated that the most influential factors for variability in risks were the concentration of Legionella and aerosol partitioning and/or efficiency across all models, highlighting the importance of
Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun
2014-01-01
Abstract Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC 50 values were higher for Lab-Q than for Lab-B; avermectin LC 50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. PMID:25434040
Trebs, I.
2005-01-01
This dissertation investigates the behavior of water-soluble inorganic trace gases and related aerosol species in the tropical boundary layer. Mixing ratios of ammonia (NH3), nitric acid (HNO3), nitrous acid (HONO), hydrochloric acid (HCl), sulfur dioxide (SO;,) and the corresponding water-soluble
A review of measurement-based assessments of the aerosol direct radiative effect and forcing
Directory of Open Access Journals (Sweden)
H. Yu
2006-01-01
Full Text Available Aerosols affect the Earth's energy budget directly by scattering and absorbing radiation and indirectly by acting as cloud condensation nuclei and, thereby, affecting cloud properties. However, large uncertainties exist in current estimates of aerosol forcing because of incomplete knowledge concerning the distribution and the physical and chemical properties of aerosols as well as aerosol-cloud interactions. In recent years, a great deal of effort has gone into improving measurements and datasets. It is thus feasible to shift the estimates of aerosol forcing from largely model-based to increasingly measurement-based. Our goal is to assess current observational capabilities and identify uncertainties in the aerosol direct forcing through comparisons of different methods with independent sources of uncertainties. Here we assess the aerosol optical depth (τ, direct radiative effect (DRE by natural and anthropogenic aerosols, and direct climate forcing (DCF by anthropogenic aerosols, focusing on satellite and ground-based measurements supplemented by global chemical transport model (CTM simulations. The multi-spectral MODIS measures global distributions of aerosol optical depth (τ on a daily scale, with a high accuracy of ±0.03±0.05τ over ocean. The annual average τ is about 0.14 over global ocean, of which about 21%±7% is contributed by human activities, as estimated by MODIS fine-mode fraction. The multi-angle MISR derives an annual average AOD of 0.23 over global land with an uncertainty of ~20% or ±0.05. These high-accuracy aerosol products and broadband flux measurements from CERES make it feasible to obtain observational constraints for the aerosol direct effect, especially over global the ocean. A number of measurement-based approaches estimate the clear-sky DRE (on solar radiation at the top-of-atmosphere (TOA to be about -5.5±0.2 Wm-2 (median ± standard error from various methods over the global ocean. Accounting for thin cirrus
Palanivelu, V; Vijayavel, K; Balasubramanian, S Ezhilarasi; Balasubramanian, M P
2005-04-01
The activities of phosphatases and transaminases were studied in muscle and liver of the fresh water fish, Oreochromis mossambicus on exposure to different sublethal concentrations (0.25, 0.5, 0.75 and 1 mgl(-1)) of cartap hydrochloride (insecticidal derivative from marine polycheate) for 96 h. There was an overall decrease in phosphatases and transaminases activity in muscle and liver of the fish subjected to cartap hydrochloride.
DEFF Research Database (Denmark)
Butcher, Andrew Charles
emissions produced directly from bubble bursting as the result of air entrainment from breaking waves and particles generated from secondary emissions of volatile organic compounds. In the first paper, we study the chemical properties of particles produced from several sea water proxies with the use...... of a cloud condensation nuclei ounter. Proxy solutions with high inorganic salt concentrations and some organics produce sea spray aerosol particles with little change in cloud condensation activity relative to pure salts. Comparison is made between a frit based method for bubble production and a plunging...... a relationship between plunging jet particle ux, oceanic particle ux, and energy dissipation rate in both systems. Previous sea spray aerosol studies dissipate an order of magnitude more energy for the same particle ux production as the open ocean. A scaling factor related to the energy expended in air...
Salim, Hasber; Rawi, Che Salmah Md; Ahmad, Abu Hassan; Al-Shami, Salman Abdo
2015-12-01
The effectiveness of the synthetic insecticides trichlorfon, lambda-cyhalothrin, cypermethrin emulsion concentrated (EC) and cypermethrin emulsion water based (EW) and a bio-insecticide, Bacillus thuringiensis subsp. kurstaki (Btk), was evaluated at 3, 7, 14 and 30 days after treatment (DAT) for the control of Metisa plana larvae in an oil palm (Elaeis guineensis) plantation in Malaysia. Although all synthetic insecticides effectively reduced the larval population of M. plana, trichlorfon, lambda-cyhalothrin and cypermethrin EC were the fastest-acting. The larval population dropped below the economic threshold level (ETL) 30 days after a single application of the synthetic insecticides. Application of Btk, however, gave poor results, with the larval population remaining above the ETL post treatment. In terms of operational productivity, ground spraying using power spray equipment was time-consuming and resulted in poor coverage. Power spraying may not be appropriate for controlling M. plana infestations in large fields. Using a power sprayer, one man could cover 2-3 ha per day. Hence, power spraying is recommended during outbreaks of infestation in areas smaller than 50 ha.
Design, Synthesis and Insecticidal Activity of Novel Phenylurea Derivatives
Directory of Open Access Journals (Sweden)
Jialong Sun
2015-03-01
Full Text Available A series of novel phenylurea derivatives were designed and synthesized according to the method of active groups linkage and the principle of aromatic groups bioisosterism in this study. The structures of the novel phenylurea derivatives were confirmed based on ESI-MS, IR and 1H-NMR spectral data. All of the compounds were evaluated for the insecticidal activity against the third instars larvae of Spodoptera exigua Hiibner, Plutella xyllostella Linnaeus, Helicoverpa armigera Hubner and Pieris rapae Linne respectively, at the concentration of 10 mg/L. The results showed that all of the derivatives displayed strong insecticidal activity. Most of the compounds presented higher insecticidal activity against S. exigua than the reference compounds tebufenozide, chlorbenzuron and metaflumizone. Among the synthesized compounds, 3b, 3d, 3f, 4b and 4g displayed broad spectrum insecticidal activity.
Directory of Open Access Journals (Sweden)
Hayam M. Lofty
2013-12-01
Full Text Available A sensitive gas chromatographic method has been developed for the determination of malathion and lambda-cyhalothrin (λ-cyhalothrin insecticide residues in zucchini. The developed method consists of extraction with acetone, purification and partitioning with methylene chloride, column chromatographic clean-up, and finally capillary gas chromatographic determination of the insecticides. The recoveries of method were greater than 90% and limit of determination was 0.001 ppm for both insecticides. The method was applied to determine residues and the rate of disappearance of malathion and λ-cyhalothrin from fruits of zucchini (open field treatment, 50 cc of Malason/Cormandel 57% EC (emulsifiable concentrate for 100 L of water, 20 cc of LAMBDA SUPER FOG 5% liquid for 100 L of water. The insecticide incorporated into the plants decreased rapidly with a half-life time around 0.77 day (18.5h for malathion and 4 days for λ-cyhalothrin. It is not recommended to use zucchini before 12 h of malathion application. For λ-cyhalothrin, the preharvest interval is 5 days. Four market samples were chosen from different regions from A.R.E. and all of them showed no residues of malathion or λ-cyhalothrin.
Neubauer, David; Christensen, Matthew W.; Poulsen, Caroline A.; Lohmann, Ulrike
2017-11-01
Aerosol-cloud interactions (ACIs) are uncertain and the estimates of the ACI effective radiative forcing (ERFaci) magnitude show a large variability. Within the Aerosol_cci project the susceptibility of cloud properties to changes in aerosol properties is derived from the high-resolution AATSR (Advanced Along-Track Scanning Radiometer) data set using the Cloud-Aerosol Pairing Algorithm (CAPA) (as described in our companion paper) and compared to susceptibilities from the global aerosol climate model ECHAM6-HAM2 and MODIS-CERES (Moderate Resolution Imaging Spectroradiometer - Clouds and the Earth's Radiant Energy System) data. For ECHAM6-HAM2 the dry aerosol is analysed to mimic the effect of CAPA. Furthermore the analysis is done for different environmental regimes. The aerosol-liquid water path relationship in ECHAM6-HAM2 is systematically stronger than in AATSR-CAPA data and cannot be explained by an overestimation of autoconversion when using diagnostic precipitation but rather by aerosol swelling in regions where humidity is high and clouds are present. When aerosol water is removed from the analysis in ECHAM6-HAM2 the strength of the susceptibilities of liquid water path, cloud droplet number concentration and cloud albedo as well as ERFaci agree much better with those of AATSR-CAPA or MODIS-CERES. When comparing satellite-derived to model-derived susceptibilities, this study finds it more appropriate to use dry aerosol in the computation of model susceptibilities. We further find that the statistical relationships inferred from different satellite sensors (AATSR-CAPA vs. MODIS-CERES) as well as from ECHAM6-HAM2 are not always of the same sign for the tested environmental conditions. In particular the susceptibility of the liquid water path is negative in non-raining scenes for MODIS-CERES but positive for AATSR-CAPA and ECHAM6-HAM2. Feedback processes like cloud-top entrainment that are missing or not well represented in the model are therefore not well
Calbó, Josep; Long, Charles N.; González, Josep-Abel; Augustine, John; McComiskey, Allison
2017-11-01
Cloud and aerosol are two manifestations of what it is essentially the same physical phenomenon: a suspension of particles in the air. The differences between the two come from the different composition (e.g., much higher amount of condensed water in particles constituting a cloud) and/or particle size, and also from the different number of such particles (10-10,000 particles per cubic centimeter depending on conditions). However, there exist situations in which the distinction is far from obvious, and even when broken or scattered clouds are present in the sky, the borders between cloud/not cloud are not always well defined, a transition area that has been coined as the ;twilight zone;. The current paper presents a discussion on the definition of cloud and aerosol, the need for distinguishing or for considering the continuum between the two, and suggests a quantification of the importance and frequency of such ambiguous situations, founded on several ground-based observing techniques. Specifically, sensitivity analyses are applied on sky camera images and broadband and spectral radiometric measurements taken at Girona (Spain) and Boulder (Co, USA). Results indicate that, at these sites, in more than 5% of the daytime hours the sky may be considered cloudless (but containing aerosols) or cloudy (with some kind of optically thin clouds) depending on the observing system and the thresholds applied. Similarly, at least 10% of the time the extension of scattered or broken clouds into clear areas is problematic to establish, and depends on where the limit is put between cloud and aerosol. These findings are relevant to both technical approaches for cloud screening and sky cover categorization algorithms and radiative transfer studies, given the different effect of clouds and aerosols (and the different treatment in models) on the Earth's radiation balance.
Directory of Open Access Journals (Sweden)
Changlu Wang
2016-01-01
Full Text Available We evaluated the residual efficacy of four liquid sprays and four ready-to-use aerosols that are commonly used in the U.S. against a field-collected bed bug, Cimex lectularius L., strain with moderate resistance level to pyrethroids. The four liquid sprays were: Tandem (0.1% thiamethoxam, 0.03% lambda-cyhalothrin, Temprid SC (0.05% imidacloprid, 0.025% cyfluthrin, Transport GHP (0.05% acetamiprid, 0.06% bifenthrin, and Demand CS (0.03% lambda-cyhalothrin. The four aerosols were: Alpine (0.5% dinotefuran, Bedlam (0.4% sumithrin, 1.6% MGK 264, Bedlam Plus (0.4% sumithrin, 1% MGK 264, 0.05% imidacloprid, and Phantom (0.5% chlorfenapyr. Bed bugs were confined for 4 h to treated substrates (aged 24 h. Four substrates were tested: fabric, unpainted wood, painted wood, and vinyl. Bedlam, Demand CS, and Temprid SC resulted in ≤70% mortality on all tested substrates. Among the other five products, substrate type significantly affected their residual efficacy, except for Transport GHP, which caused ≥89.7% mortality regardless of the substrate. The effect of exposure time (5 min, 4 h, and 24 h on the efficacy of Transport GHP and Phantom aerosol also was evaluated. A 4 h continuous exposure to Phantom aerosol or Transport GHP residue caused similar mortality to 24 h exposure and higher mortality than 5 min exposure.
Ding, Jing; Zhang, Yufen; Han, Suqin; Xiao, Zhimei; Wang, Jiao; Feng, Yinchang
2018-05-01
Aerosol and water vapor radiative forcings, shortwave atmospheric heating rates and longwave atmospheric cooling rates were determined based on in situ physical and chemical measurements of aerosol, associated with the Mie theory and a radiative transfer model, LOWTRAN7, during the two haze episodes in the winter of 2013 in Tianjin, China. The aerosol types considered in LOWTRAN7 included rural, urban, marine, desert and custom aerosols. The default ratio of the absorption coefficient to the extinction coefficient for urban aerosol in LOWTRAN7 was approximately double of those found in this work, implying the weaker absorption ability of aerosols in the North China Plain (NCP). Moreover, the aerosol is assumed to be evenly distributed below 1 km of planetary boundary layer (PBL) on hazy days in LOWTRAN7. If the default urban aerosol optical properties and extinction profile in LOWTRAN7 is employed directly, a larger energy imbalance between the atmosphere and surface is generated and the warming effect of the aerosol is magnified. Hence, modified urban aerosol optical properties were established to replace the corresponding parameters' database in LOWTRAN7. The aerosol extinction profiles were obtained based on a 255-m meteorological tower and observed results from the studies about Tianjin. In the NCP, the aerosol had little impact on atmospheric counter radiation. The water vapor is the crucial factor that affects atmospheric counter radiation. Both modified high shortwave heating rates and longwave cooling rates occur near the surface due to the abundance of aerosol and water vapor. The modified net atmospheric heating rate near the surface is 1.2 K d-1 on hazy days and 0.3 K d-1 on non-hazy days. Compared with the default urban aerosol optical properties and its vertical distribution in LOWTRAN7, the feedback effect of the modified urban aerosol on the boundary layer may not necessarily result in a stable lower atmosphere, but depends on the aerosol light
Sayer, A. M.; Hsu, N. C.; Lee, J.; Bettenhausen, C.; Kim, W. V.; Smirnov, A.
2018-01-01
The Suomi National Polar-Orbiting Partnership (S-NPP) satellite, launched in late 2011, carries the Visible Infrared Imaging Radiometer Suite (VIIRS) and several other instruments. VIIRS has similar characteristics to prior satellite sensors used for aerosol optical depth (AOD) retrieval, allowing the continuation of space-based aerosol data records. The Deep Blue algorithm has previously been applied to retrieve AOD from Sea-viewing Wide Field-of-view Sensor (SeaWiFS) and Moderate Resolution Imaging Spectroradiometer (MODIS) measurements over land. The SeaWiFS Deep Blue data set also included a SeaWiFS Ocean Aerosol Retrieval (SOAR) algorithm to cover water surfaces. As part of NASA's VIIRS data processing, Deep Blue is being applied to VIIRS data over land, and SOAR has been adapted from SeaWiFS to VIIRS for use over water surfaces. This study describes SOAR as applied in version 1 of NASA's S-NPP VIIRS Deep Blue data product suite. Several advances have been made since the SeaWiFS application, as well as changes to make use of the broader spectral range of VIIRS. A preliminary validation against Maritime Aerosol Network (MAN) measurements suggests a typical uncertainty on retrieved 550 nm AOD of order ±(0.03+10%), comparable to existing SeaWiFS/MODIS aerosol data products. Retrieved Ångström exponent and fine-mode AOD fraction are also well correlated with MAN data, with small biases and uncertainty similar to or better than SeaWiFS/MODIS products.
Xie, Wen; Liu, Yang; Wang, Shaoli; Wu, Qingjun; Pan, Huipeng; Yang, Xin; Guo, Litao; Zhang, Youjun
2014-01-01
Whitefly biotypes B and Q are the two most damaging members of the Bemisia tabaci (Hemiptera: Aleyrodidae) species complex. Control of B. tabaci (and especially of Q) has been impaired by resistance to commonly used insecticides. To find new insecticides for B. tabaci management in China, we investigated the sensitivity of eggs, larvae, and adults of laboratory strains of B and Q (named Lab-B and Lab-Q) and field strains of Q to several insecticides. For eggs, larvae, and adults of B. tabaci and for six insecticides (cyantraniliprole, chlorantraniliprole, pyriproxyfen, buprofezin, acetamiprid, and thiamethoxam), LC50 values were higher for Lab-Q than for Lab-B; avermectin LC50 values, however, were low for adults of both Lab-Q and Lab-B. Based on the laboratory results, insecticides were selected to test against eggs, larvae, and adults of four field strains of B. tabaci Q. Although the field strains differed in their sensitivity to the insecticides, the eggs and larvae of all strains were highly sensitive to cyantraniliprole, and the adults of all strains were highly sensitive to avermectin. The eggs, larvae, and adults of B. tabaci Q were generally more resistant than those of B. tabaci B to the tested insecticides. B. tabaci Q eggs and larvae were sensitive to cyantraniliprole and pyriproxyfen, whereas B. tabaci Q adults were sensitive to avermectin. Field trials should be conducted with cyantraniliprole, pyriproxyfen, and avermectin for control of B. tabaci Q and B in China. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.
Wu, Z.; Liu, Y.; Tan, T.; Wang, Y.; Shang, D.; Xiao, Y.; Li, M.; Zeng, L.; Hu, M.
2017-12-01
Aerosol liquid water influences ambient particulate matter mass concentrations and aerosol optical properties, and can serve as a reactor for multiphase reactions that perturb local photochemistry1. Our observations revealed that ambient relative humidity, inorganic fraction (sulfate, ammonium, nitrate), and PM2.5 mass concentration generally simultaneously elevated during haze episodes, resulting in the abundant anthropogenic aerosol water in the atmosphere of Beijing. The enrichment of aerosol liquid water may significantly affect the particle phase, which plays a key role in determining the reactive uptake, gas-particle partitioning, and heterogeneous chemical reactivity2. A newly-built three-arm impactor was used to detect the particle rebound fraction. The observations showed the increased RH and inorganic-rich particulate matter led to an increased aerosol liquid water content, and thus a liquid phase state during haze episode during wintertime. Here, we proposed that the transition to a liquid phase state marked the beginning of the haze episode and kicked off a positive feedback loop, wherein the liquid particles readily uptake pollutants that could react to form inorganics which could then uptake more water. The strict controlling strategy of sulfur emissions in China might lead to a decreased sulfate fraction and increased nitrate fraction in PM1. As a result, due to the lower deliquescence RH of nitrate, the feedback loop proposed could start at an even lower RH in the future. Reference1 Herrmann, H., T. Schaefer, A. Tilgner, S. A. Styler, C. Weller, M. Teich, and T. Otto (2015), Tropospheric Aqueous-Phase Chemistry: Kinetics, Mechanisms, and Its Coupling to a Changing Gas Phase, Chemical Reviews, 115(10), 4259-4334.2 M. Kuwata, S. T. Martin (2012), Phase of atmospheric secondary organic material affects its reactivity, Proceedings of the National Academy of Sciences of the United States of America, 109(43):17354-17359
Kim, Mijin; Kim, Jhoon; Yoon, Jongmin; Chung, Chu-Yong; Chung, Sung-Rae
2017-04-01
In 2010, the Korean geostationary earth orbit (GEO) satellite, the Communication, Ocean, and Meteorological Satellite (COMS), was launched including the Meteorological Imager (MI). The MI measures atmospheric condition over Northeast Asia (NEA) using a single visible channel centered at 0.675 μm and four IR channels at 3.75, 6.75, 10.8, 12.0 μm. The visible measurement can also be utilized for the retrieval of aerosol optical properties (AOPs). Since the GEO satellite measurement has an advantage for continuous monitoring of AOPs, we can analyze the spatiotemporal variation of the aerosol using the MI observations over NEA. Therefore, we developed an algorithm to retrieve aerosol optical depth (AOD) using the visible observation of MI, and named as MI Yonsei Aerosol Retrieval Algorithm (YAER). In this study, we investigated the accuracy of MI YAER AOD by comparing the values with the long-term products of AERONET sun-photometer. The result showed that the MI AODs were significantly overestimated than the AERONET values over bright surface in low AOD case. Because the MI visible channel centered at red color range, contribution of aerosol signal to the measured reflectance is relatively lower than the surface contribution. Therefore, the AOD error in low AOD case over bright surface can be a fundamental limitation of the algorithm. Meanwhile, an assumption of background aerosol optical depth (BAOD) could result in the retrieval uncertainty, also. To estimate the surface reflectance by considering polluted air condition over the NEA, we estimated the BAOD from the MODIS dark target (DT) aerosol products by pixel. The satellite-based AOD retrieval, however, largely depends on the accuracy of the surface reflectance estimation especially in low AOD case, and thus, the BAOD could include the uncertainty in surface reflectance estimation of the satellite-based retrieval. Therefore, we re-estimated the BAOD using the ground-based sun-photometer measurement, and
Insecticidal and Nematicidal Activities of Novel Mimosine Derivatives
Directory of Open Access Journals (Sweden)
Binh Cao Quan Nguyen
2015-09-01
Full Text Available Mimosine, a non-protein amino acid, is found in several tropical and subtropical plants, which has high value for medicine and agricultural chemicals. Here, in continuation of works aimed to development of natural product-based pesticidal agents, we present the first significant findings for insecticidal and nematicidal activities of novel mimosine derivatives. Interestingly, mimosinol and deuterated mimosinol (D-mimosinol from mimosine had strong insecticidal activity which could be a result of tyrosinase inhibition (IC50 = 31.4 and 46.1 μM, respectively. Of synthesized phosphoramidothionate derivatives from two these amino alcohols, two compounds (1a and 1b showed high insecticidal activity (LD50 = 0.5 and 0.7 μg/insect, respectively with 50%–60% mortality at 50 μg/mL which may be attributed to acetylcholinesterase inhibition. Compounds 1a and 1b also had strong nematicidal activity with IC50 = 31.8 and 50.2 μM, respectively. Our results suggest that the length of the alkyl chain and the functional group at the C5-position of phosphoramidothionates derived from mimosinol and d-mimosinol are essential for the insecticidal and nematicidal activities. These results reveal an unexplored scaffold as new insecticide and nematicide.
Use of water by eastern hemlock: implications for systemic insecticide application
Chelcy R. Ford; James M. Vose; Michael Daley; Nathan Phillips
2007-01-01
The hemlock woolly adelgid (HWA, Adelges tsugae Annand) is causing widespread decline and mortality of eastern hemlock (Tsuga canadensis (L.) Carr.) throughout most of the range of eastern hemlock. Stem injection of insecticide is widely used as a chemical control measure, but the effectiveness of this method depends on the...
Characteristics and Composition of Atmospheric Aerosols in Phimai, Central Thailand During BASE-ASIA
Li, Can; Tsay, Si-Chee; Hsu, N. Christina; Kim, Jin Young; Howell, Steven G.; Huebert, Barry J.; Ji, Qiang; Jeong, Myeong-Jae; Wang, Sheng-Hsiang; Hansell, Richard A.;
2012-01-01
Popular summary: Atmospheric aerosols play an important role in the Earth's climate system, and can also have adverse effects on air quality and human health. The environmental impacts of aerosols, on the other hand, are highly regional, since their temporal/spatial distribution is inhomogeneous and highly depends on the regional emission sources. To better understand the effects of aerosols, intensive field experiments are necessary to characterize the chemical and physical properties on a region-by-region basis. From late February to early May in 2006, NASA/GSFC's SMARTLabs facility was deployed at a rural site in central Thailand, Southeast Asia, to conduct a field experiment dubbed BASE-ASIA (Biomass-burning Aerosols in South East-Asia: Smoke Impact Assessment). The group was joined by scientists from the University of Hawaii and other regional institutes. Comprehensive measurements were made during the experiment, including aerosol chemical composition, optical and microphysical properties, as well as surface energetics and local . meteorology. This study analyzes part of the data from the BASE-ASIA experiment. It was found that, even for the relatively remote rural site, the aerosol loading was still substantial. Besides agricultural burning in the area, industrial pollution near the Bangkok metropolitan area, about 200 km southeast of the site, and even long-range transport from China, also contribute to the area's aerosol loading. The results indicate that aerosol pollution has developed into a regional problem for northern Indochina, and may become more severe as the region's population and economy continue to grow. Abstract: Comprehensive measurements of atmospheric aerosols were made in Phimai, central Thailand (15.l83 N, 102.565 E, elevation: 206 m) during the BASE-ASIA field experiment from late February to early May in 2006. The observed aerosol loading was sizable for this rural site (mean aerosol scattering: 108 +/- 64 Mm(exp -1); absorption: 15
Country-level operational implementation of the Global Plan for Insecticide Resistance Management.
Hemingway, Janet; Vontas, John; Poupardin, Rodolphe; Raman, Jaishree; Lines, Jo; Schwabe, Chris; Matias, Abrahan; Kleinschmidt, Immo
2013-06-04
Malaria control is reliant on the use of long-lasting pyrethroid-impregnated nets and/or indoor residual spraying (IRS) of insecticide. The rapid selection and spread of operationally significant pyrethroid resistance in African malaria vectors threatens our ability to sustain malaria control. Establishing whether resistance is operationally significant is technically challenging. Routine monitoring by bioassay is inadequate, and there are limited data linking resistance selection with changes in disease transmission. The default is to switch insecticides when resistance is detected, but limited insecticide options and resistance to multiple insecticides in numerous locations make this approach unsustainable. Detailed analysis of the resistance situation in Anopheles gambiae on Bioko Island after pyrethroid resistance was detected in this species in 2004, and the IRS program switched to carbamate bendiocarb, has now been undertaken. The pyrethroid resistance selected is a target-site knock-down resistance kdr-form, on a background of generally elevated metabolic activity, compared with insecticide-susceptible A. gambiae, but the major cytochrome P450-based metabolic pyrethroid resistance mechanisms are not present. The available evidence from bioassays and infection data suggests that the pyrethroid resistance mechanisms in Bioko malaria vectors are not operationally significant, and on this basis, a different, long-lasting pyrethroid formulation is now being reintroduced for IRS in a rotational insecticide resistance management program. This will allow control efforts to be sustained in a cost-effective manner while reducing the selection pressure for resistance to nonpyrethroid insecticides. The methods used provide a template for evidence-based insecticide resistance management by malaria control programs.
Directory of Open Access Journals (Sweden)
W. T. Morgan
2010-09-01
Full Text Available A case study of atmospheric aerosol measurements exploring the impact of the vertical distribution of aerosol chemical composition upon the radiative budget in North-Western Europe is presented. Sub-micron aerosol chemical composition was measured by an Aerodyne Aerosol Mass Spectrometer (AMS on both an airborne platform and a ground-based site at Cabauw in the Netherlands. The examined period in May 2008 was characterised by enhanced pollution loadings in North-Western Europe and was dominated by ammonium nitrate and Organic Matter (OM. Both ammonium nitrate and OM were observed to increase with altitude in the atmospheric boundary layer. This is primarily attributed to partitioning of semi-volatile gas phase species to the particle phase at reduced temperature and enhanced relative humidity. Increased ammonium nitrate concentrations in particular were found to strongly increase the ambient scattering potential of the aerosol burden, which was a consequence of the large amount of associated water as well as the enhanced mass. During particularly polluted conditions, increases in aerosol optical depth of 50–100% were estimated to occur due to the observed increase in secondary aerosol mass and associated water uptake. Furthermore, the single scattering albedo was also shown to increase with height in the boundary layer. These enhancements combined to increase the negative direct aerosol radiative forcing by close to a factor of two at the median percentile level. Such increases have major ramifications for regional climate predictions as semi-volatile components are often not included in aerosol models.
The results presented here provide an ideal opportunity to test regional and global representations of both the aerosol vertical distribution and subsequent impacts in North-Western Europe. North-Western Europe can be viewed as an analogue for the possible future air quality over other polluted regions of the Northern Hemisphere, where
Handa, D.; Nakajima, H.; Nakaema, F.; Arakaki, T.; Tanahara, A.
2008-12-01
The economic development and population growth in recent Asia spread air pollution. Emission rate of air pollutants from Asia, in particular oxides of nitrogen, surpassed those from North America and Europe and should continue to exceed them for decades. The study of the air pollution transported from Asian continent has gained a special attention in Japan. Okinawa Island is situated approximately 1500 km south of Tokyo, Japan, 2000 km southeast of Beijing, China, and 1000 km south of South Korea. Its location is ideal in observing East Asian atmospheric aerosols because maritime air mass prevails during summer, while continental air mass dominates during fall, winter, and spring. The maritime air mass data can be seen as background and can be compared with continental air masses which have been affected by anthropogenic activities. In 2005, Cape Hedo Atmosphere and Aerosol Monitoring Station (CHAAMS) was established by the National Institute for Environmental Studies (NIES) at the northern tip of Okinawa Island, Japan to monitor the air quality of Asia. Bulk aerosol samples were collected on quartz filters by using a high volume air sampler. Sampling duration was one week for each sample. We determined the concentrations of water-soluble anions, cations and dissolved organic carbon in the bulk aerosols collected at the CHAAMS, using ion chromatography, atomic absorption spectrometry, and total organic carbon analyzer, respectively. Seasonal variation of water-soluble chemical components showed that the concentrations were relatively low in summer, higher in fall and winter, and the highest in spring. When air mass came from Asian Continent, the concentrations of water-soluble chemical components were much higher compared to the other directions.
Insecticides -a cure or curse and rational use of integrated pest management in Pakistan
International Nuclear Information System (INIS)
Irshad, M.
2005-01-01
Chemical based control in crops has increased the pest problem, disturbed the agro ecosystem and has killed the non-target and environmentally friendly organisms and misuse of insecticides has led to resistance to insecticides, resurgence of secondary pests, polluting soil, water and food with contaminates. In addition to this, irrigation and drinking water, cottonseed oil, lint and cattle feed and animal milk are also contaminated having deleterious effects on human life. To reduce chemical control, Integrated Pest Management (IPM) emerged. Its emphasis is on non-disturbance of ecosystem but to manage the insect pest populations with all the available means on economic basis. IPM approach is knowledge based with in-depth information. In spite of IPM studies and work unfortunately reliance on pesticides has not been reduced in Pakistan. Conservation/augmentation, releases of new biotic agents may disturb the ecosystem. The stress on IPM is made in the developed countries primarily due to human health factor. These societies even risk the reduction in yield in the IPM fields. Successful stories of IPM in Pakistan has not been cashed to due merits. The bottlenecks must be removed so that better results can be obtained. The main reason seems to be lack of in depth involvement of the growers in this activity. (author)
Glassmeier, F.; Lohmann, U.
2016-12-01
Orographic precipitation is prone to strong aerosol-cloud-precipitation interactions because the time for precipitation development is limited to the ascending section of mountain flow. At the same time, cloud microphysical development is constraint by the strong dynamical forcing of the orography. In this contribution, we discuss how changes in the amount and composition of droplet- and ice-forming aerosols influence precipitation in idealized simulations of stratiform orographic mixed-phase clouds. We find that aerosol perturbations trigger compensating responses of different precipitation formation pathways. The effect of aerosols is thus buffered. We explain this buffering by the requirement to fulfill aerosol-independent dynamical constraints. For our simulations, we use the regional atmospheric model COSMO-ART-M7 in a 2D setup with a bell-shaped mountain. The model is coupled to a 2-moment warm and cold cloud microphysics scheme. Activation and freezing rates are parameterized based on prescribed aerosol fields that are varied in number, size and composition. Our analysis is based on the budget of droplet water along trajectories of cloud parcels. The budget equates condensation as source term with precipitation formation from autoconversion, accretion, riming and the Wegener-Bergeron-Findeisen process as sink terms. Condensation, and consequently precipitation formation, is determined by dynamics and largely independent of the aerosol conditions. An aerosol-induced change in the number of droplets or crystals perturbs the droplet budget by affecting precipitation formation processes. We observe that this perturbation triggers adjustments in liquid and ice water content that re-equilibrate the budget. As an example, an increase in crystal number triggers a stronger glaciation of the cloud and redistributes precipitation formation from collision-coalescence to riming and from riming to vapor deposition. We theoretically confirm the dominant effect of water
Schaefer, J.R.; Scott, W.E.; Evans, William C.; Jorgenson, J.; McGimsey, R.G.; Wang, B.
2008-01-01
A mass of snow and ice 400-m-wide and 105-m-thick began melting in the summit crater of Mount Chiginagak volcano sometime between November 2004 and early May 2005, presumably owing to increased heat flux from the hydrothermal system, or possibly from magma intrusion and degassing. In early May 2005, an estimated 3.8??106 m3 of sulfurous, clay-rich debris and acidic water, with an accompanying acidic aerosol component, exited the crater through a tunnel at the base of a glacier that breaches the south crater rim. Over 27 km downstream, the acidic waters of the flood inundated an important salmon spawning drainage, acidifying Mother Goose Lake from surface to depth (approximately 0.5 km3 in volume at a pH of 2.9 to 3.1), killing all aquatic life, and preventing the annual salmon run. Over 2 months later, crater lake water sampled 8 km downstream of the outlet after considerable dilution from glacial meltwater was a weak sulfuric acid solution (pH = 3.2, SO4 = 504 mg/L, Cl = 53.6 mg/L, and F = 7.92 mg/L). The acid flood waters caused severe vegetation damage, including plant death and leaf kill along the flood path. The crater lake drainage was accompanied by an ambioructic flow of acidic aerosols that followed the flood path, contributing to defoliation and necrotic leaf damage to vegetation in a 29 km2 area along and above affected streams, in areas to heights of over 150 m above stream level. Moss species killed in the event contained high levels of sulfur, indicating extremely elevated atmospheric sulfurcontent. The most abundant airborne phytotoxic constituent was likely sulfuric acid aerosols that were generated during the catastrophic partial crater lake drainage event. Two mechanisms of acidic aerosol formation are proposed: (1) generation of aerosol mist through turbulent flow of acidic water and (2) catastrophic gas exsolution. This previously undocumented phenomenon of simultaneous vegetationdamaging acidic aerosols accompanying drainage of an acidic crater
Killeen, Gerry F; Masalu, John P; Chinula, Dingani; Fotakis, Emmanouil A; Kavishe, Deogratius R; Malone, David; Okumu, Fredros
2017-05-01
We assessed window screens and eave baffles (WSEBs), which enable mosquitoes to enter but not exit houses, as an alternative to indoor residual spraying (IRS) for malaria vector control. WSEBs treated with water, the pyrethroid lambda-cyhalothrin, or the organophosphate pirimiphos-methyl, with and without a binding agent for increasing insecticide persistence on netting, were compared with IRS in experimental huts. Compared with IRS containing the same insecticide, WSEBs killed similar proportions of Anopheles funestus mosquitoes that were resistant to pyrethroids, carbamates and organochlorines and greater proportions of pyrethroid-resistant, early exiting An. arabiensis mosquitoes. WSEBs with pirimiphos-methyl killed greater proportions of both vectors than lambda-cyhalothrin or lambda-cyhalothrin plus pirimiphos-methyl and were equally efficacious when combined with binding agent. WSEBs required far less insecticide than IRS, and binding agents might enhance durability. WSEBs might enable affordable deployment of insecticide combinations to mitigate against physiologic insecticide resistance and improve control of behaviorally resistant, early exiting vectors.
Naik, P K; Singh, T; Singh, H
2009-07-01
Quantitative structure-activity relationship (QSAR) analyses were performed independently on data sets belonging to two groups of insecticides, namely the organophosphates and carbamates. Several types of descriptors including topological, spatial, thermodynamic, information content, lead likeness and E-state indices were used to derive quantitative relationships between insecticide activities and structural properties of chemicals. A systematic search approach based on missing value, zero value, simple correlation and multi-collinearity tests as well as the use of a genetic algorithm allowed the optimal selection of the descriptors used to generate the models. The QSAR models developed for both organophosphate and carbamate groups revealed good predictability with r(2) values of 0.949 and 0.838 as well as [image omitted] values of 0.890 and 0.765, respectively. In addition, a linear correlation was observed between the predicted and experimental LD(50) values for the test set data with r(2) of 0.871 and 0.788 for both the organophosphate and carbamate groups, indicating that the prediction accuracy of the QSAR models was acceptable. The models were also tested successfully from external validation criteria. QSAR models developed in this study should help further design of novel potent insecticides.
Impact of reduced-risk insecticides on soybean aphid and associated natural enemies.
Ohnesorg, Wayne J; Johnson, Kevin D; O'Neal, Matthew E
2009-10-01
Insect predators in North America suppress Aphis glycines Matsumura (Hemiptera: Aphididae) populations; however, insecticides are required when populations reach economically damaging levels. Currently, insecticides used to manage A. glycines are broad-spectrum (pyrethroids and organophosphates), and probably reduce beneficial insect abundance in soybean, Glycine max (L.) Merr. Our goal was to determine whether insecticides considered reduced-risk by the Environmental Protection Agency could protect soybean yield from A. glycines herbivory while having a limited impact on the aphid's natural enemies. We compared three insecticides (imidacloprid, thiamethoxam, and pymetrozine,) to a broad-spectrum insecticide (lamda-cyhalothrin) and an untreated control using two application methods. We applied neonicotinoid insecticides to seeds (imidacloprid and thiamethoxam) as well as foliage (imidacloprid); pymetrozine and lamda-cyhalothrin were applied only to foliage. Foliage-applied insecticides had lower A. glycines populations and higher yields than the seed-applied insecticides. Among foliage-applied insecticides, pymetrozine and imidacloprid had an intermediate level of A. glycines population and yield protection compared with lamda-cyhalothrin and the untreated control. We monitored natural enemies with yellow sticky cards, sweep-nets, and direct observation. Before foliar insecticides were applied (i.e., before aphid populations developed) seed treatments had no observable effect on the abundance of natural enemies. After foliar insecticides were applied, differences in natural enemy abundance were observed when sampled with sweep-nets and direct observation but not with yellow sticky cards. Based on the first two sampling methods, pymetrozine and the foliage-applied imidacloprid had intermediate abundances of natural enemies compared with the untreated control and lamda-cyhalothrin.
Directory of Open Access Journals (Sweden)
Čolović Mirjana B.
2013-01-01
Full Text Available Organophosphorus insecticides have been the most applied group of insecticides for the last two decades. Their main toxic effects are related to irreversible inactivation of acetylcholinesterase (AChE. Actually, they covalently bind to serine OH group in the enzyme active site forming phosphorylated enzyme that cannot hydrolyze acetylcholine. Organophosphorus insecticides in the environment undergo the natural degradation pathway including mainly homogeneous and heterogeneous hydrolysis (especially at high pH generating non-inhibiting products. Additionally, thio organophosphates are easily oxidized by naturally present oxidants and UV light, forming more toxic and stable oxons. Thus, oxidative degradation procedures, generally referred as advanced oxidation processes (AOP, have been applied for their efficient removal from contaminated waters. The most applied bioassays to monitor the organophosphate toxicity i.e. the detoxification degree during AOP are Vibrio fischeri and AChE bioassays. Vibrio fischeri toxicity test exploits bioluminescence as the measure of luciferase activity of this marine bacterium, whereas AChE bioassay is based on AChE activity inhibition. Both bioanalytical techniques are rapid (several minutes, simple, sensitive and reproducible. Vibrio fischeri test seems to be a versatile indicator of toxic compounds generated in AOP for organophosphorus insecticides degradation. However, detection of neurotoxic AChE inhibitors, which can be formed in AOP of some organophosphates, requires AChE bioassays. Therefore, AChE toxicity test is more appropriate for monitoring the degradation processes of thio organophosphates, because more toxic oxo organophosphates might be formed and overlooked by Vibrio fischeri bioluminescence inhibition. In addition, during organophosphates removal by AOP, compounds with strong genotoxic potential may be formed, which cannot be detected by standard toxicity tests. For this reason, determination of
MODIS/Terra Aerosol Cloud Water Vapor Ozone Monthly L3 Global 1Deg CMG V006
National Aeronautics and Space Administration — MODIS/Terra Aerosol Cloud Water Vapor Ozone Monthly L3 Global 1Deg CMG (MOD08_M3). MODIS was launched aboard the Terra satellite on December 18, 1999 (10:30 am...
Vacuum FTIR Observation on the Dynamic Hygroscopicity of Aerosols under Pulsed Relative Humidity.
Leng, Chun-Bo; Pang, Shu-Feng; Zhang, Yun; Cai, Chen; Liu, Yong; Zhang, Yun-Hong
2015-08-04
A novel approach based on a combination of a pulse RH controlling system and a rapid scan vacuum FTIR spectrometer (PRHCS-RSVFTIR) was utilized to investigate dynamic hygroscopicity of two atmospheric aerosols: ammonium sulfate ((NH4)2SO4) and magnesium sulfate (MgSO4). In this approach, rapid-scan infrared spectra of water vapor and aerosols were obtained to determine relative humidity (RH) in sample cell and hygroscopic property of aerosols with a subsecond time resolution. Heterogeneous nucleation rates of (NH4)2SO4 were, for the first time, measured under low RH conditions (nucleation kinetics of liquid aerosols.
Gogoi, Mukunda M.; Babu, S. Suresh
2016-05-01
In view of the increasing anthropogenic presence and influence of aerosols in the northern polar regions, long-term continuous measurements of aerosol optical parameters have been investigated over the Svalbard region of Norwegian Arctic (Ny-Ålesund, 79°N, 12°E, 8 m ASL). This study has shown a consistent enhancement in the aerosol scattering and absorption coefficients during spring. The relative dominance of absorbing aerosols is more near the surface (lower single scattering albedo), compared to that at the higher altitude. This is indicative of the presence of local anthropogenic activities. In addition, long-range transported biomass burning aerosols (inferred from the spectral variation of absorption coefficient) also contribute significantly to the higher aerosol absorption in the Arctic spring. Aerosol optical depth (AOD) estimates from ground based Microtop sun-photometer measurements reveals that the columnar abundance of aerosols reaches the peak during spring season. Comparison of AODs between ground based and satellite remote sensing indicates that deep blue algorithm of Moderate Resolution Imaging Spectroradiometer (MODIS) retrievals over Arctic snow surfaces overestimate the columnar AOD.
Directory of Open Access Journals (Sweden)
P. J. Gallimore
2011-12-01
Full Text Available Many important atmospheric aerosol processes depend on the chemical composition of the aerosol, e.g. water uptake and particle cloud interactions. Atmospheric ageing processes, such as oxidation reactions, significantly and continuously change the chemical composition of aerosol particles throughout their lifetime. These ageing processes are often poorly understood. In this study we utilize an aerosol flow tube set up and an ultra-high resolution mass spectrometer to explore the effect of relative humidity (RH in the range of <5–90% on the ozonolysis of maleic acid aerosol which is employed as model organic aerosol system. Due to the slow reaction kinetics relatively high ozone concentrations of 160–200 ppm were used to achieve an appreciable degree of oxidation of maleic acid. The effect of oxidative ageing on the hygroscopicity of maleic acid particles is also investigated using an electrodynamic balance and thermodynamic modelling. RH has a profound effect on the oxidation of maleic acid particles. Very little oxidation is observed at RH < 50% and the only observed reaction products are glyoxylic acid and formic acid. In comparison, when RH > 50% there are about 15 oxidation products identified. This increased oxidation was observed even when the particles were exposed to high humidities long after a low RH ozonolysis reaction. This result might have negative implications for the use of water as an extraction solvent for the analysis of oxidized organic aerosols. These humidity-dependent differences in the composition of the ozonolyzed aerosol demonstrate that water is both a key reactant in the oxidation scheme and a determinant of particle phase and hence diffusivity. The measured chemical composition of the processed aerosol is used to model the hygroscopic growth, which compares favourably with water uptake results from the electrodynamic balance measurements. A reaction mechanism is presented which takes into account the RH dependent
Lahr, J.; Gadji, B.; Dia, D.
2000-01-01
To estimate safe downwind distances (i.e. buffer zone widths) for temporary ponds from ULV-treatments with current locust insecticides, experimental trials with two ground-based sprayers, the hand-held Micro-Ulva® and the vehicle-mounted Ulva-Mast® X15 Mark I, were conducted with fenitrothion
MODIS/Terra Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG V006
National Aeronautics and Space Administration — MODIS/Terra Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG (MOD08_D3). MODIS was launched aboard the Terra satellite on December 18, 1999 (10:30 am equator...
MODIS/Aqua Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG V006
National Aeronautics and Space Administration — MODIS/Aqua Aerosol Cloud Water Vapor Ozone Daily L3 Global 1Deg CMG (MYD08_D3). MODIS was launched aboard the Aqua satellite on May 04, 2002 (1:30 pm equator...
Aerosols and fission product transport
International Nuclear Information System (INIS)
Megaw, W.J.
1987-12-01
A survey is presented of current knowledge of the possible role of aerosols in the consequences of in- and out-of-core LOCAs and of end fitting failures in CANDU reactors. An extensive literature search has been made of research on the behaviour of aerosols in possible accidents in water moderated and cooled reactors and the results of various studies compared. It is recommended that further work should be undertaken on the formation of aerosols during these possible accidents and to study their subsequent behaviour. It is also recommended that the fission products behaviour computer code FISSCON II should be re-examined to determine whether it reflects the advances incorporated in other codes developed for light water reactors which have been extensively compared. 47 refs
Neural network-based QSAR and insecticide discovery: spinetoram
Sparks, Thomas C.; Crouse, Gary D.; Dripps, James E.; Anzeveno, Peter; Martynow, Jacek; DeAmicis, Carl V.; Gifford, James
2008-06-01
Improvements in the efficacy and spectrum of the spinosyns, novel fermentation derived insecticide, has long been a goal within Dow AgroSciences. As large and complex fermentation products identifying specific modifications to the spinosyns likely to result in improved activity was a difficult process, since most modifications decreased the activity. A variety of approaches were investigated to identify new synthetic directions for the spinosyn chemistry including several explorations of the quantitative structure activity relationships (QSAR) of spinosyns, which initially were unsuccessful. However, application of artificial neural networks (ANN) to the spinosyn QSAR problem identified new directions for improved activity in the chemistry, which subsequent synthesis and testing confirmed. The ANN-based analogs coupled with other information on substitution effects resulting from spinosyn structure activity relationships lead to the discovery of spinetoram (XDE-175). Launched in late 2007, spinetoram provides both improved efficacy and an expanded spectrum while maintaining the exceptional environmental and toxicological profile already established for the spinosyn chemistry.
Insecticide-induced hormesis and arthropod pest management.
Guedes, Raul Narciso C; Cutler, G Christopher
2014-05-01
Ecological backlashes such as insecticide resistance, resurgence and secondary pest outbreaks are frequent problems associated with insecticide use against arthropod pest species. The last two have been particularly important in sparking interest in the phenomenon of insecticide-induced hormesis within entomology and acarology. Hormesis describes a biphasic dose-response relationship that is characterized by a reversal of response between low and high doses of a stressor (e.g. insecticides). Although the concept of insecticide-induced hormesis often does not receive sufficient attention, or has been subject to semantic confusion, it has been reported in many arthropod pest species and natural enemies, and has been linked to pest outbreaks and potential problems with insecticide resistance. The study of hormesis remains largely neglected in entomology and acarology. Here, we examined the concept of insecticide-induced hormesis in arthropods, its functional basis and potential fitness consequences, and its importance in arthropod pest management and other areas. © 2013 Society of Chemical Industry.
First surface-based estimation of the aerosol indirect effect over a site in southeastern China
Liu, Jianjun; Li, Zhanqing
2018-02-01
The deployment of the U.S. Atmospheric Radiation Measurement mobile facility in Shouxian from May to December 2008 amassed the most comprehensive set of measurements of atmospheric, surface, aerosol, and cloud variables in China. This deployment provided a unique opportunity to investigate the aerosol-cloud interactions, which are most challenging and, to date, have not been examined to any great degree in China. The relationship between cloud droplet effective radius (CER) and aerosol index (AI) is very weak in summer because the cloud droplet growth is least affected by the competition for water vapor. Mean cloud liquid water path (LWP) and cloud optical depth (COD) significantly increase with increasing AI in fall. The sensitivities of CER and LWP to aerosol loading increases are not significantly different under different air mass conditions. There is a significant correlation between the changes in hourly mean AI and the changes in hourly mean CER, LWP, and COD. The aerosol first indirect effect (FIE) is estimated in terms of relative changes in both CER (FIECER) and COD (FIECOD) with changes in AI for different seasons and air masses. FIECOD and FIECER are similar in magnitude and close to the typical FIE value of ˜ 0.23, and do not change much between summer and fall or between the two different air mass conditions. Similar analyses were done using spaceborne Moderate Resolution Imaging Spectroradiometer data. The satellite-derived FIE is contrary to the FIE estimated from surface retrievals and may have large uncertainties due to some inherent limitations.
Digital Repository Service at National Institute of Oceanography (India)
Menon, H.B.; Sangekar, N.; Lotliker, A.; Moorthy, K.K.; Vethamony, P.
for water-leaving radiance and sun glint to the NIR bands. The aerosol size distribution parameter (alpha) was derived from a relationship between two NIR bands. The Angstrom turbidity parameter (beta) was obtained using an algorithm relating in situ hand...
International Nuclear Information System (INIS)
Wang Hai-Hua; Sun Xian-Ming
2012-01-01
The mixture of water cloud droplets with black carbon impurities is modeled by external and internal mixing models. The internal mixing model is modeled with a two-layered sphere (water cloud droplets containing black carbon (BC) inclusions), and the single scattering and absorption characteristics are calculated at the visible wavelength of 0.55 μm by using the Lorenz—Mie theory. The external mixing model is developed assuming that the same amount of BC particles are mixed with the water droplets externally. The multiple scattering characteristics are computed by using the Monte Carlo method. The results show that when the size of the BC aerosol is small, the reflection intensity of the internal mixing model is bigger than that of the external mixing model. However, if the size of the BC aerosol is big, the absorption of the internal mixing model will be larger than that of the external mixing model. (electromagnetism, optics, acoustics, heat transfer, classical mechanics, and fluid dynamics)
Energy Technology Data Exchange (ETDEWEB)
Wu, Longtao; Gu, Yu; Jiang, Jonathan; Su, Hui; Yu, Nanpeng; Zhao, Chun; Qian, Yun; Zhao, Bin; Liou, K. N.; Choi, Yong-Sang
2018-04-23
A version of the WRF-Chem model with fully coupled aerosol–meteorology–snowpack is employed to investigate the impacts of various aerosol sources on precipitation and snowpack in California. In particular, the impacts of locally emitted anthropogenic and dust aerosols, and aerosols transported from outside California are studied. We differentiate three pathways of aerosol effects: aerosol–radiation interaction (ARI), aerosol–snow interaction (ASI), and aerosol–cloud interaction (ACI). The convection-permitting model simulations show that precipitation, snow water equivalent (SWE), and surface air temperature averaged over the whole domain (34–42° N, 117–124° W, not including ocean points) are reduced when aerosols are included, therefore reducing large biases in these variables due to the absence of aerosol effects in the model. Aerosols affect California water resources through the warming of mountaintops and the reduction of precipitation; however, different aerosol sources play different roles in changing surface temperature, precipitation, and snowpack in California by means of various weights of the three pathways. ARI by all aerosols mainly cools the surface, leading to slightly increased SWE over the mountains. Locally emitted dust aerosols warm the surface of mountaintops through ASI, in which the reduced snow albedo associated with dusty snow leads to more surface absorption of solar radiation and reduced SWE. Transported aerosols and local anthropogenic aerosols play a dominant role in increasing nonprecipitating clouds but reducing precipitation through ACI, leading to reduced SWE and runoff on the Sierra Nevada, as well as the warming of mountaintops associated with decreased SWE and hence lower surface albedo. The average changes in surface temperature from October 2012 to June 2013 are about −0.19 and 0.22 K for the whole domain and over mountaintops, respectively. Overall, the averaged reduction during October to June is about
Taylor, Nathan F.; Collins, Don R.; Lowenthal, Douglas H.; McCubbin, Ian B.; Gannet Hallar, A.; Samburova, Vera; Zielinska, Barbara; Kumar, Naresh; Mazzoleni, Lynn R.
2017-02-01
Due to the atmospheric abundance and chemical complexity of water soluble organic carbon (WSOC), its contribution to the hydration behavior of atmospheric aerosol is both significant and difficult to assess. For the present study, the hygroscopicity and CCN activity of isolated atmospheric WSOC particulate matter was measured without the compounding effects of common, soluble inorganic aerosol constituents. WSOC was extracted with high purity water from daily high-volume PM2.5 filter samples and separated from water soluble inorganic constituents using solid-phase extraction. The WSOC filter extracts were concentrated and combined to provide sufficient mass for continuous generation of the WSOC-only aerosol over the combined measurement time of the tandem differential mobility analyzer and coupled scanning mobility particle sizer-CCN counter used for the analysis. Aerosol samples were taken at Great Smoky Mountains National Park during the summer of 2006 and fall-winter of 2007-2008; Mount Rainier National Park during the summer of 2009; Storm Peak Laboratory (SPL) near Steamboat Springs, Colorado, during the summer of 2010; and Acadia National Park during the summer of 2011. Across all sampling locations and seasons, the hygroscopic growth of WSOC samples at 90 % RH, expressed in terms of the hygroscopicity parameter, κ, ranged from 0.05 to 0.15. Comparisons between the hygroscopicity of WSOC and that of samples containing all soluble materials extracted from the filters implied a significant modification of the hydration behavior of inorganic components, including decreased hysteresis separating efflorescence and deliquescence and enhanced water uptake between 30 and 70 % RH.
Directory of Open Access Journals (Sweden)
H. Jethva
2011-10-01
Full Text Available We provide satellite-based evidence of the spectral dependence of absorption in biomass burning aerosols over South America using near-UV measurements made by the Ozone Monitoring Instrument (OMI during 2005–2007. In the current near-UV OMI aerosol algorithm (OMAERUV, it is implicitly assumed that the only absorbing component in carbonaceous aerosols is black carbon whose imaginary component of the refractive index is wavelength independent. With this assumption, OMI-derived aerosol optical depth (AOD is found to be significantly over-estimated compared to that of AERONET at several sites during intense biomass burning events (August-September. Other well-known sources of error affecting the near-UV method of aerosol retrieval do not explain the large observed AOD discrepancies between the satellite and the ground-based observations. A number of studies have revealed strong spectral dependence in carbonaceous aerosol absorption in the near-UV region suggesting the presence of organic carbon in biomass burning generated aerosols. A sensitivity analysis examining the importance of accounting for the presence of wavelength-dependent aerosol absorption in carbonaceous particles in satellite-based remote sensing was carried out in this work. The results convincingly show that the inclusion of spectrally-dependent aerosol absorption in the radiative transfer calculations leads to a more accurate characterization of the atmospheric load of carbonaceous aerosols. The use of a new set of aerosol models assuming wavelength-dependent aerosol absorption in the near-UV region (Absorption Angstrom Exponent λ−2.5 to −3.0 improved the OMAERUV retrieval results by significantly reducing the AOD bias observed when gray aerosols were assumed. In addition, the new retrieval of single-scattering albedo is in better agreement with those of AERONET within the uncertainties (ΔSSA = ±0.03. The new colored carbonaceous aerosol model was also found to
Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland
Energy Technology Data Exchange (ETDEWEB)
Moore, M.T. [USDA Agricultural Research Service National Sedimentation Laboratory, Water Quality and Ecology Research Unit, PO Box 1157, 598 McElroy Drive, Oxford, MS 38655 (United States)], E-mail: matt.moore@ars.usda.gov; Cooper, C.M.; Smith, S.; Cullum, R.F.; Knight, S.S.; Locke, M.A.; Bennett, E.R. [USDA Agricultural Research Service National Sedimentation Laboratory, Water Quality and Ecology Research Unit, PO Box 1157, 598 McElroy Drive, Oxford, MS 38655 (United States)
2009-01-15
Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides. - A wetland length of 215 m x 30 m mitigated pyrethroid runoff from a 14 ha field.
Mitigation of two pyrethroid insecticides in a Mississippi Delta constructed wetland
International Nuclear Information System (INIS)
Moore, M.T.; Cooper, C.M.; Smith, S.; Cullum, R.F.; Knight, S.S.; Locke, M.A.; Bennett, E.R.
2009-01-01
Constructed wetlands are a suggested best management practice to help mitigate agricultural runoff before entering receiving aquatic ecosystems. A constructed wetland system (180 m x 30 m), comprising a sediment retention basin and two treatment cells, was used to determine the fate and transport of simulated runoff containing the pyrethroid insecticides lambda-cyhalothrin and cyfluthrin, as well as suspended sediment. Wetland water, sediment, and plant samples were collected spatially and temporally over 55 d. Results showed 49 and 76% of the study's measured lambda-cyhalothrin and cyfluthrin masses were associated with vegetation, respectively. Based on conservative effects concentrations for invertebrates and regression analyses of maximum observed wetland aqueous concentrations, a wetland length of 215 m x 30 m width would be required to adequately mitigate 1% pesticide runoff from a 14 ha contributing area. Results of this experiment can be used to model future design specifications for constructed wetland mitigation of pyrethroid insecticides. - A wetland length of 215 m x 30 m mitigated pyrethroid runoff from a 14 ha field
Kusmierczyk-Michulec, J.; Leeuw, G. de
2005-01-01
An algorithm for the retrieval of the aerosol optical thickness over land and over water from Global Ozone Monitoring Experiment (GOME) data is presented. The cloud fraction in the GOME pixels is determined using the Fast Retrieval Scheme for Clouds From the Oxygen A Band (FRESCO) algorithm. Surface
Directory of Open Access Journals (Sweden)
Y. Gu
2012-02-01
Full Text Available The climatic effects of dust aerosols in North Africa have been investigated using the atmospheric general circulation model (AGCM developed at the University of California, Los Angeles (UCLA. The model includes an efficient and physically based radiation parameterization scheme developed specifically for application to clouds and aerosols. Parameterization of the effective ice particle size in association with the aerosol first indirect effect based on ice cloud and aerosol data retrieved from A-Train satellite observations have been employed in climate model simulations. Offline simulations reveal that the direct solar, IR, and net forcings by dust aerosols at the top of the atmosphere (TOA generally increase with increasing aerosol optical depth. When the dust semi-direct effect is included with the presence of ice clouds, positive IR radiative forcing is enhanced since ice clouds trap substantial IR radiation, while the positive solar forcing with dust aerosols alone has been changed to negative values due to the strong reflection of solar radiation by clouds, indicating that cloud forcing associated with aerosol semi-direct effect could exceed direct aerosol forcing. With the aerosol first indirect effect, the net cloud forcing is generally reduced in the case for an ice water path (IWP larger than 20 g m−2. The magnitude of the reduction increases with IWP.
AGCM simulations show that the reduced ice crystal mean effective size due to the aerosol first indirect effect results in less OLR and net solar flux at TOA over the cloudy area of the North Africa region because ice clouds with smaller size trap more IR radiation and reflect more solar radiation. The precipitation in the same area, however, increases due to the aerosol indirect effect on ice clouds, corresponding to the enhanced convection as indicated by reduced OLR. Adding the aerosol direct effect into the model simulation reduces the precipitation in the
Monsoon sensitivity to aerosol direct radiative forcing in the ...
Indian Academy of Sciences (India)
to the total, scattering aerosols and black carbon aerosols. ... acts as an internal damping mechanism spinning down the regional hydrological cycle and leading to sig- ... tion and emission of longwave radiation. ... effect of aerosols over India, where the emission of .... that aerosol effects on monsoon water cycle dynam-.
International Nuclear Information System (INIS)
Lanza, S.; Mariotti, P.
1986-01-01
The US program LACE (LWR Aerosol Containment Experiments), in which Italy participates together with several European countries, Canada and Japan, aims at evaluating by means of a large scale experimental activity at HEDL the retention in the pipings and primary container of the radioactive aerosol released following severe accidents in light water reactors. At the same time these experiences will make available data through which the codes used to analyse the behaviour of the aerosol in the containment and to verify whether by means of the codes of thermohydraulic computation it is possible to evaluate with sufficient accuracy variable influencing the aerosol behaviour, can be validated. This report shows and compares the results obtained by the participants in the LACE program with the aerosol containment codes NAVA 5 and CONTAIN for the pre-test computations of the test LA 1, in which an accident called containment by pass is simulated
Insecticide resistance in two Aedes aegypti (Diptera: Culicidae) strains from Costa Rica.
Bisset, J A; Marín, R; Rodríguez, M M; Severson, D W; Ricardo, Y; French, L; Díaz, M; Pérez, O
2013-03-01
Dengue (family Flaviridae, genus Flavivirus, DENV) and dengue hemorrhagic fever (DHF) are presently important public health problems in Costa Rica. The primary strategy for disease control is based on reducing population densities of the main mosquito vector Aedes aegypti (L.) (Diptera: Culicidae). This is heavily dependent on use of chemical insecticides, thus the development of resistance is a frequent threat to control program effectiveness. The objective of this study was to determine the levels of insecticide resistance and the metabolic resistance mechanisms involved in two Ae. aegypti strains collected from two provinces (Puntarenas and Limon) in Costa Rica. Bioassays with larvae were performed according to World Health Organization guidelines and resistance in adults was measured through standard bottle assays. The activities of beta-esterases, cytochrome P450 monooxygenases, and glutathione S-transferases (GST), were assayed through synergists and biochemical tests, wherein the threshold criteria for each enzyme was established using the susceptible Rockefeller strain. The results showed higher resistance levels to the organophosphate (OP) temephos and the pyrethroid deltamethrin in larvae. The efficacy of commercial formulations of temephos in controlling Ae. aegypti populations was 100% mortality up to 11 and 12 d posttreatment with daily water replacements in test containers. Temephos and deltamethrin resistance in larvae were associated with high esterase activity, but not to cytochrome P450 monooxygenase or GST activities. Adult mosquitoes were resistant to deltamethrin, and susceptible to bendiocarb, chlorpyrifos, and cypermethrin. Because temephos and deltamethrin resistance are emerging at the studied sites, alternative insecticides should be considered. The insecticides chlorpyrifos and cypermethrin could be good candidates to use as alternatives for Ae. aegypti control.
Godfray, H.C.J.; Blacquière, Tjeerd; Field, L.M.; Hails, R.S.; Potts, S.G.; Raine, N.E.; Vanbergen, A.J.; McLean, A.R.
2015-01-01
Asummary is provided of recent advances in the natural science evidence base concerning the effects of neonicotinoid insecticides on insect pollinators in a format (a ‘restatement’) intended to be accessible to informed but not expert policymakers and stakeholders. Important new studies have been
Dhungana, Sanjeev Kumar; Kim, Il-Doo; Kwak, Hwa-Sook; Shin, Dong-Hyun
2016-06-01
Although a considerable number of studies about the effect of different insecticides on plant physiology and metabolism have been carried out, research work about the comparative action of structurally different classes of insecticide on physiological and biochemical properties of soybean seed germination and early growth has not been found. The objective of this study was to investigate the effect of different classes of insecticides on soybean seed germination and early plant growth. Soybean seeds of Bosuk cultivar were soaked for 24h in distilled water or recommended dose (2mLL(-1), 1mLL(-1), 0.5gL(-1), and 0.5gL(-1) water for insecticides Mepthion, Myungtaja, Actara, and Stonate, respectively) of pesticide solutions of four structurally different classes of insecticides - Mepthion (fenitrothion; organophosphate), Myungtaja (etofenprox; pyrethroid), Actara (thiamethoxam; neonicotinoid), and Stonate (lambda-cyhalothrin cum thiamethoxam; pyrethroid cum neonicotinoid) - which are used for controlling stink bugs in soybean crop. Insecticides containing thiamethoxam and lamda-cyhalothrin cum thiamethoxam showed positive effects on seedling biomass and content of polyphenol and flavonoid, however fenitrothion insecticide reduced the seed germination, seed and seedling vigor, and polyphenol and flavonoid contents in soybean. Results of this study reveal that different classes of insecticide have differential influence on physiologic and metabolic actions like germination, early growth, and antioxidant activities of soybean and this implies that yield and nutrient content also might be affected with the application of different types of insecticide. Copyright © 2015 Elsevier B.V. All rights reserved.
Field evaluation of non-synthetic insecticides for the management of ...
African Journals Online (AJOL)
/l and B.thurigiensis was applied at the rate 1.0 g/l of water. Actellic 25 EC, a synthetic insecticide, was applied at the rate of 2 ml/l as standard check. Arthropod fauna on okra were sampled using traps, sweep nets, aspirators and handpicking.
A new stochastic algorithm for inversion of dust aerosol size distribution
Wang, Li; Li, Feng; Yang, Ma-ying
2015-08-01
Dust aerosol size distribution is an important source of information about atmospheric aerosols, and it can be determined from multiwavelength extinction measurements. This paper describes a stochastic inverse technique based on artificial bee colony (ABC) algorithm to invert the dust aerosol size distribution by light extinction method. The direct problems for the size distribution of water drop and dust particle, which are the main elements of atmospheric aerosols, are solved by the Mie theory and the Lambert-Beer Law in multispectral region. And then, the parameters of three widely used functions, i.e. the log normal distribution (L-N), the Junge distribution (J-J), and the normal distribution (N-N), which can provide the most useful representation of aerosol size distributions, are inversed by the ABC algorithm in the dependent model. Numerical results show that the ABC algorithm can be successfully applied to recover the aerosol size distribution with high feasibility and reliability even in the presence of random noise.
Influence of cosmic radiation on aerosol and cloud formation over short time periods
DEFF Research Database (Denmark)
Bondo, Torsten
in the atmosphere affect aerosol and cloud creation and whether it is realistic to observe Forbush decrease events in climate data. The thesis involves a theoretical examination of the ionization caused by Forbush decreases based on studies of hourly neutron monitor data and muon telescope data as proxies...... distribution of stable nucleated clusters, the model takes condensation and coagulation into account and includes various loss mechanisms. This model is used to investigate the growth of aerosols into cloud condensation nuclei size particles and to study the influence of nucleation rates and background vapour...... resolution satellite data and aerosol ground based measurements are presented. Here it is observed that significant decreases in the angstrom exponent from AERONET aerosols and cloud liquid water from satellites take place after the largest Forbush decreases. The timescales of this indicate...
Photothermal spectroscopy of aerosols
International Nuclear Information System (INIS)
Campillo, A.J.; Lin, H.B.
1981-04-01
In situ aerosol absorption spectroscopy was performed using two novel photothermal detection schemes. The first, based on a photorefractive effect and coherent detection, called phase fluctuation optical heterodyne (PFLOH) spectroscopy, could, depending on the geometry employed, yield particle specific or particle and gas absorption data. Single particles of graphite as small as 1 μm were detected in the particle specific mode. In another geometrical configuration, the total absorption (both gas and particle) of submicron sized aerosols of ammonium sulfate particles in equilibrium with gaseous ammonia and water vapor were measured at varying CO 2 laser frequencies. The specific absorption coefficient for the sulfate ion was measured to be 0.5 m 2 /g at 1087 cm -1 . The absorption coefficient sensitivity of this scheme was less than or equal to 10 -8 cm -1 . The second scheme is a hybrid visible Mie scattering scheme incorporating photothermal modulation. Particle specific data on ammonium sulfate droplets were obtained. For chemically identical species, the relative absorption spectrum versus laser frequency can be obtained for polydisperse aerosol distributions directly from the data without the need for complex inverse scattering calculations
Aerosol entrainment from a sparged non-Newtonian slurry.
Fritz, Brad G
2006-08-01
Previous bench-scale experiments have provided data necessary for the development of empirical models that describe aerosol entrainment from bubble bursting. However, previous work has not been extended to non-Newtonian liquid slurries. Design of a waste treatment plant on the Hanford Site in Washington required an evaluation of the applicability of these models outside of their intended range. For this evaluation, aerosol measurements were conducted above an air-sparged mixing tank filled with simulated waste slurry possessing Bingham plastic rheological properties. Three aerosol-size fractions were measured at three sampling heights and for three different sparging rates. The measured entrainment was compared with entrainment models. One model developed based on bench-scale air-water experiments agreed well with measured entrainment. Another model did not agree well with the measured entrainment. It appeared that the source of discrepancy between measured and modeled entrainment stemmed from application beyond the range of data used to develop the model. A possible separation in entrainment coefficients between air-water and steam-water systems was identified. A third entrainment model was adapted to match experimental conditions and fit a posteri to the experimental data, resulting in a modified version that resulted in estimated entrainment rates similar to the first model.
Tillman, P Glynn
2006-06-01
Susceptibility of the southern green stink bug, Nezara viridula (L.) (Heteroptera: Pentatomidae), and its endoparasitoid Trichopoda pennipes (F.) (Diptera: Tachinidae) to acetamiprid, cyfluthrin, dicrotophos, indoxacarb, oxamyl, and thiamethoxam was compared in residual and oral toxicity tests. In the residual toxicity test, cyfluthrin, dicrotophos, and oxamyl were highly toxic to N. viridula. Thiamethoxam was moderately toxic to these insects. Each of the four insecticides was highly toxic to T. pennipes after prolonged tarsal contact with dried residues of these chemicals. In the oral toxicity test, where N. viridula fed on food covered with insecticide residues, none of the insecticides were toxic to adults of this stink bug, but acetamiprid, dicrotophos, and thiamethoxam were moderately toxic to the nymphs. In the oral toxicity test, where N. viridula fed on a gel-food containing insecticides, cyfluthrin, dicrotophos, oxamyl, and thiamethoxam were highly toxic to this stink bug. In an oral toxicity test using contaminated sugar water, all of the insecticides were highly toxic to T. pennipes. Because insecticides were as toxic, or more toxic, to T. pennipes than to N. viridula, it is extremely important to conserve this parasitoid by applying these insecticides for control of southern green stink bugs only when the pest reaches economic threshold.
Directory of Open Access Journals (Sweden)
Wenhao Zhang
2017-01-01
Full Text Available Classification of Beijing aerosol is carried out based on clustering optical properties obtained from three Aerosol Robotic Network (AERONET sites. The fuzzy c-mean (FCM clustering algorithm is used to classify fourteen-year (2001–2014 observations, totally of 6,732 records, into six aerosol types. They are identified as fine particle nonabsorbing, two kinds of fine particle moderately absorbing (fine-MA1 and fine-MA2, fine particle highly absorbing, polluted dust, and desert dust aerosol. These aerosol types exhibit obvious optical characteristics difference. While five of them show similarities with aerosol types identified elsewhere, the polluted dust aerosol has no comparable prototype. Then the membership degree, a significant parameter provided by fuzzy clustering, is used to analyze internal variation of optical properties of each aerosol type. Finally, temporal variations of aerosol types are investigated. The dominant aerosol types are polluted dust and desert dust in spring, fine particle nonabsorbing aerosol in summer, and fine particle highly absorbing aerosol in winter. The fine particle moderately absorbing aerosol occurs during the whole year. Optical properties of the six types can also be used for radiative forcing estimation and satellite aerosol retrieval. Additionally, methodology of this study can be applied to identify aerosol types on a global scale.
Evaluation of Environmental Risks in the Use of Insecticide in Hashtgerd Area using EIQ
Directory of Open Access Journals (Sweden)
seyae jala yadollahi Nooshabadi
2018-02-01
Full Text Available Introduction Recently, there is an increasing concern about the effects of pesticides on non-target organisms. Residual of pesticides cause environmental pollution and put in danger the human health. The problem is always in contact with pesticides, there are numerous risks related to the environmental and human health threat at different levels of their cycle, including production, sale, use in the field and ultimately for residue in food occurs. This study consider the harmful effects of pesticides in Hashtgerd study area and their potential and environmental risks using EIQ index. Environmental Impact Quotient (EIQ is a model based on algebraic equations which by it can be classification chemical pesticides based on environmental hazards and risks to human health and toxins that cause minimal risk are selected. The ultimate purpose of this study was to determine 5 insecticide have been the highest consumption in the region Hashtgerd and then determine the potential environmental risks of them by EIQ index, so that eventually we can identify and eliminate hazardous insecticides. Materials and Methods Hashtgerd study area is one of 609 countries study area that is located in the Alborz province. This area with an extent of about 1170 square km because of the proximity to the metropolis of Tehran and focus a large number of agricultural, industrial and service units has an important economic and political position. The numerical value of the EIQ is average of the three main components include of the potential damage to the health of farm workers, the potential damage to consumers through the direct effect of toxic residues in food products or through ground water contamination and potential negative effects on the environment, including aquatic and terrestrial organisms show. The describes components of the EIQ are contains 11 variables. All input data for the impact of low, medium and high are judged to be harmful than, the one, three or five
Do atmospheric aerosols form glasses?
Directory of Open Access Journals (Sweden)
D. A. Pedernera
2008-09-01
Full Text Available A new process is presented by which water soluble organics might influence ice nucleation, ice growth, chemical reactions and water uptake of aerosols in the upper troposphere: the formation of glassy aerosol particles. Glasses are disordered amorphous (non-crystalline solids that form when a liquid is cooled without crystallization until the viscosity increases exponentially and molecular diffusion practically ceases. The glass transition temperatures, Tg, homogeneous ice nucleation temperatures, Thom, and ice melting temperatures, Tm, of various aqueous inorganic, organic and multi-component solutions are investigated with a differential scanning calorimeter. The investigated solutes are: various polyols, glucose, raffinose, levoglucosan, an aromatic compound, sulfuric acid, ammonium bisulfate and mixtures of dicarboxylic acids (M5, of dicarboxylic acids and ammonium sulfate (M5AS, of two polyols, of glucose and ammonium nitrate, and of raffinose and M5AS. The results indicate that aqueous solutions of the investigated inorganic solutes show Tg values that are too low to be of atmospheric importance. In contrast, aqueous organic and multi-component solutions readily form glasses at low but atmospherically relevant temperatures (≤230 K. To apply the laboratory data to the atmospheric situation, the measured phase transition temperatures were transformed from a concentration to a water activity scale by extrapolating water activities determined between 252 K and 313 K to lower temperatures. The obtained state diagrams reveal that the higher the molar mass of the aqueous organic or multi-component solutes, the higher Tg of their respective solutions at a given water activity. To a lesser extent, Tg also depends on the hydrophilicity of the organic solutes. Therefore, aerosol particles containing larger (≳150 g mol−1 and
Relative humidity impact on aerosol parameters in a Paris suburban area
Directory of Open Access Journals (Sweden)
H. Randriamiarisoa
2006-01-01
Full Text Available Measurements of relative humidity (RH and aerosol parameters (scattering cross section, size distributions and chemical composition, performed in ambient atmospheric conditions, have been used to study the influence of relative humidity on aerosol properties. The data were acquired in a suburban area south of Paris, between 18 and 24 July 2000, in the framework of the 'Etude et Simulation de la Qualité de l'air en Ile-de-France' (ESQUIF program. According to the origin of the air masses arriving over the Paris area, the aerosol hygroscopicity is more or less pronounced. The aerosol chemical composition data were used as input of a thermodynamic model to simulate the variation of the aerosol water mass content with ambient RH and to determine the main inorganic salt compounds. The coupling of observations and modelling reveals the presence of deliquescence processes with hysteresis phenomenon in the hygroscopic growth cycle. Based on the Hänel model, parameterisations of the scattering cross section, the modal radius of the accumulation mode of the size distribution and the aerosol water mass content, as a function of increasing RH, have been assessed. For the first time, a crosscheck of these parameterisations has been performed and shows that the hygroscopic behaviour of the accumulation mode can be coherently characterized by combined optical, size distribution and chemical measurements.
Insights from agriculture for the management of insecticide resistance in disease vectors.
Sternberg, Eleanore D; Thomas, Matthew B
2018-04-01
Key to contemporary management of diseases such as malaria, dengue, and filariasis is control of the insect vectors responsible for transmission. Insecticide-based interventions have contributed to declines in disease burdens in many areas, but this progress could be threatened by the emergence of insecticide resistance in vector populations. Insecticide resistance is likewise a major concern in agriculture, where insect pests can cause substantial yield losses. Here, we explore overlaps between understanding and managing insecticide resistance in agriculture and in public health. We have used the Global Plan for Insecticide Resistance Management in malaria vectors, developed under the auspices of the World Health Organization Global Malaria Program, as a framework for this exploration because it serves as one of the few cohesive documents for managing a global insecticide resistance crisis. Generally, this comparison highlights some fundamental differences between insect control in agriculture and in public health. Moreover, we emphasize that the success of insecticide resistance management strategies is strongly dependent on the biological specifics of each system. We suggest that the biological, operational, and regulatory differences between agriculture and public health limit the wholesale transfer of knowledge and practices from one system to the other. Nonetheless, there are some valuable insights from agriculture that could assist in advancing the existing Global Plan for Insecticide Resistance Management framework.
Malaria Vector Control Still Matters despite Insecticide Resistance.
Alout, Haoues; Labbé, Pierrick; Chandre, Fabrice; Cohuet, Anna
2017-08-01
Mosquito vectors' resistance to insecticides is usually considered a major threat to the recent progresses in malaria control. However, studies measuring the impact of interventions and insecticide resistance reveal inconsistencies when using entomological versus epidemiological indices. First, evaluation tests that do not reflect the susceptibility of mosquitoes when they are infectious may underestimate insecticide efficacy. Moreover, interactions between insecticide resistance and vectorial capacity reveal nonintuitive outcomes of interventions. Therefore, considering ecological interactions between vector, parasite, and environment highlights that the impact of insecticide resistance on the malaria burden is not straightforward and we suggest that vector control still matters despite insecticide resistance. Copyright © 2017 Elsevier Ltd. All rights reserved.
A renaissance for botanical insecticides?
Isman, Murray B
2015-12-01
Botanical insecticides continue to be a subject of keen interest among the international research community, reflected in the steady growth in scientific publications devoted to the subject. Until very recently though, the translation of that theory to practice, i.e. the commercialisation and adoption of new botanical insecticides in the marketplace, has seriously lagged behind. Strict regulatory regimes, long the bane of small pesticide producers, are beginning to relax some of the data requirements for 'low-risk' pesticide products, facilitating movement of more botanicals into the commercial arena. In this paper I discuss some of the jurisdictions where botanicals are increasingly finding favour, some of the newer botanical insecticides in the plant and animal health arsenal and some of the specific sectors where botanicals are most likely to compete effectively with other types of insecticidal product. © 2015 Society of Chemical Industry.
HOT AEROSOL FIRE EXTINGUISHING AGENTS AND THE ASSOCIATED TECHNOLOGIES: A REVIEW
Directory of Open Access Journals (Sweden)
Xiaotian Zhang
2015-09-01
Full Text Available AbstractSince the phase out of Halon extinguishers in the 1980s, hot aerosol fire suppression technology has gained much attention. Unlike traditional inert gas, foam, water mist and Halon fire suppression agents, hot aerosol fire extinguishing agents do not need to be driven out by pressurized gases and can extinguish class A, B, C, D and K fires at 30 to 200 g/m3. Generally, hot aerosol fire extinguishing technology has developed from a generation I oil tank suppression system to a generation III strontium salt based S-type system. S-type hot aerosol fire extinguishing technology greatly solves the corrosion problem of electrical devices and electronics compared to potassium salt based generation I & II hot aerosol fire extinguishing technology. As substitutes for Halon agents, the ODP and GWP values of hot fire extinguishing aerosols are nearly zero, but those fine aerosol particles can cause adverse health effects once inhaled by human. As for configurations of hot aerosol fire extinguishing devices, fixed or portable cylindrical canisters are the most common among generation II & III hot aerosol fire extinguishers across the world, while generation I hot aerosol fire suppression systems are integrated with the oil tank as a whole. Some countries like the U.S., Australia, Russia and China, etc. have already developed standards for manufacturing and quality control of hot aerosol fire extinguishing agents and norms for hot aerosol fire extinguishing system design under different fire protection scenarios. Coolants in hot aerosol fire suppression systems, which are responsible for reducing hot aerosol temperature to avoid secondary fire risk are reviewed for the first time. Cooling effects are generally achieved through vaporization and endothermic chemical decomposition of coolants. Finally, this review discussed areas applying generation I, II or III hot aerosol fire suppression technologies. The generation III hot aerosol fire extinguishing
Al-Ayedh, Hassan; Rizwan-Ul-Haq, Muhammad; Hussain, Abid; Aljabr, Ahmed M
2016-11-01
Palm trees around the world are prone to notorious Rhynchophorus ferrugineus, which causes heavy losses of palm plantations. In Middle Eastern countries, this pest is a major threat to date palm orchards. Conventional pest control measures with the major share of synthetic insecticides have resulted in insect resistance and environmental issues. Therefore, in order to explore better alternatives, the RNAi approach was employed to knock down the catalase gene in fifth and tenth larval instars with different dsRNA application methods, and their insecticidal potency was studied. dsRNA of 444 bp was prepared to knock down catalase in R. ferrugineus. Out of the three dsRNA application methods, dsRNA injection into larvae was the most effective, followed by dsRNA application by artificial feeding. Both methods resulted in significant catalase knockdown in various tissues, especially the midgut. As a result, the highest growth inhibition of 123.49 and 103.47% and larval mortality of 80 and 40% were observed in fifth-instar larvae, whereas larval growth inhibition remained at 86.83 and 69.08% with larval mortality at 30 and 10% in tenth-instar larvae after dsRNA injection and artificial diet treatment. The topical application method was the least efficient, with the lowest larval growth inhibition of 57.23 and 45.61% and 0% mortality in fifth- and tenth-instar larvae. Generally, better results were noted at the high dsRNA dose of 5 µL. Catalase enzyme is found in most insect body tissues, and thus its dsRNA can cause broad-scale gene knockdown within the insect body, depending upon the application method. Significant larval mortality and growth inhibition after catalase knockdown in R. ferrugineus confirms its insecticidal potency and suggests a bright future for RNAi-based bioinsecticides in pest control. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
D. M. Lienhard
2015-12-01
secondary organic aerosol (SOA material produced by oxidation of α-pinene and in a number of organic/inorganic model mixtures (3-methylbutane-1,2,3-tricarboxylic acid (3-MBTCA, levoglucosan, levoglucosan/NH4HSO4, raffinose are presented. These indicate that water diffusion coefficients are determined by several properties of the aerosol substance and cannot be inferred from the glass transition temperature or bouncing properties. Our results suggest that water diffusion in SOA particles is faster than often assumed and imposes no significant kinetic limitation on water uptake and release at temperatures above 220 K. The fast diffusion of water suggests that heterogeneous ice nucleation on a glassy core is very unlikely in these systems. At temperatures below 220 K, model simulations of SOA particles suggest that heterogeneous ice nucleation may occur in the immersion mode on glassy cores which remain embedded in a liquid shell when experiencing fast updraft velocities. The particles absorb significant quantities of water during these updrafts which plasticize their outer layers such that these layers equilibrate readily with the gas phase humidity before the homogeneous ice nucleation threshold is reached. Glass formation is thus unlikely to restrict homogeneous ice nucleation. Only under most extreme conditions near the very high tropical tropopause may the homogeneous ice nucleation rate coefficient be reduced as a consequence of slow condensed-phase water diffusion. Since the differences between the behavior limited or non limited by diffusion are small even at the very high tropical tropopause, condensed-phase water diffusivity is unlikely to have significant consequences on the direct climatic effects of SOA particles under tropospheric conditions.
Lopalco, M; Proia, A R; Fraioli, A; Serio, A; Cammarella, I; Petraccia, L; Grassi, M
2004-04-01
Our research evaluates the efficacy of the inalation therapy by mineral sulphureous water in patients suffering from cronic bronchopneumopathy. From August to October 2002, two groups of patients, randomly selected, suffering from cronic bronchopneumonopathy, were studied at spa center "Pompeo" in Ferentino (FR). Every patient was treated daily during a cycle of twelve days. The first group was treated by pneumonic mechanical ventilation associated to sulphureous water aerosolinalation, the second by mechanical pulmonary ventilation associated to sulphureous water aerosol-inalation medicated with flunisolide. Every patient carried out spirometry, before and after treatment, and the measurement of FEV1 was considered a good parameter to evaluate the respiratory function. All patients reported an improvement in symptoms as dyspnea and cough. Results obtained show a significant functional improvement of respiratory function in both groups, evaluated by FEV1. Equal efficacy treating the patients by medicated and not medicated treatments stress the therapeutic role of mineral sulphureous waters in chronic bronchopneumopathies. Our research points out the usefullness of pneumonic ventilation associated with sulphureous water aerosol-inalation in patients suffering from chronic bronchopneumopathies.
Effect of natural and chemical insecticides on Hyalopterus pruni and ...
African Journals Online (AJOL)
Experiments were carried out to evaluate the effect of water extracts of Fagonia arabica, Salix alba and Anthmis pseudocotula and their mixtures with chemical insecticide (Malathion) on growth of. Hyalopterus pruni and characters of Armeniaca vulgaris plants and their soils. The data revealed that F.arabica extract at 20% ...
MODIS/Aqua Aerosol Cloud Water Vapor Ozone 8-Day L3 Global 1Deg CMG V006
National Aeronautics and Space Administration — MODIS/Aqua Aerosol Cloud Water Vapor Ozone 8-Day L3 Global 1Deg CMG (MYD08_E3). MODIS was launched aboard the Aqua satellite on May 04, 2002 (1:30 pm equator...
A six year satellite-based assessment of the regional variations in aerosol indirect effects
Directory of Open Access Journals (Sweden)
T. A. Jones
2009-06-01
Full Text Available Aerosols act as cloud condensation nuclei (CCN for cloud water droplets, and changes in aerosol concentrations have significant microphysical impacts on the corresponding cloud properties. Moderate Resolution Imaging Spectroradiometer (MODIS aerosol and cloud properties are combined with NCEP Reanalysis data for six different regions around the globe between March 2000 and December 2005 to study the effects of different aerosol, cloud, and atmospheric conditions on the aerosol indirect effect (AIE. Emphasis is placed in examining the relative importance of aerosol concentration, type, and atmospheric conditions (mainly vertical motion to AIE from region to region.
Results show that in most regions, AIE has a distinct seasonal cycle, though the cycle varies in significance and period from region to region. In the Arabian Sea (AS, the six-year mean anthropogenic + dust AIE is −0.27 Wm−2 and is greatest during the summer months (<−2.0 Wm−2 during which aerosol concentrations (from both dust and anthropogenic sources are greatest. Comparing AIE as a function of thin (LWP<20 gm−2 vs. thick (LWP≥20 gm−2 clouds under conditions of large scale ascent or decent at 850 hPa showed that AIE is greatest for thick clouds during periods of upward vertical motion. In the Bay of Bengal, AIE is negligible owing to less favorable atmospheric conditions, a lower concentration of aerosols, and a non-alignment of aerosol and cloud layers. In the eastern North Atlantic, AIE is weakly positive (+0.1 Wm−2 with dust aerosol concentration being much greater than the anthropogenic or sea salt components. However, elevated dust in this region exists above the maritime cloud layers and does not have a hygroscopic coating, which occurs in AS, preventing the dust from acting as CCN and limiting AIE. The Western Atlantic has a large anthropogenic aerosol concentration transported from the eastern
Burton, S. P.; Ferrare, R. A.; Hostetler, C. A.; Hair, J. W.; Kittaka, C.; Vaughn, M. A.; Remer, L. A.
2010-01-01
We derive aerosol extinction profiles from airborne and space-based lidar backscatter signals by constraining the retrieval with column aerosol optical thickness (AOT), with no need to rely on assumptions about aerosol type or lidar ratio. The backscatter data were acquired by the NASA Langley Research Center airborne High Spectral Resolution Lidar (HSRL) and by the Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) instrument on the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO) satellite. The HSRL also simultaneously measures aerosol extinction coefficients independently using the high spectral resolution lidar technique, thereby providing an ideal data set for evaluating the retrieval. We retrieve aerosol extinction profiles from both HSRL and CALIOP attenuated backscatter data constrained with HSRL, Moderate-Resolution Imaging Spectroradiometer (MODIS), and Multiangle Imaging Spectroradiometer column AOT. The resulting profiles are compared with the aerosol extinction measured by HSRL. Retrievals are limited to cases where the column aerosol thickness is greater than 0.2 over land and 0.15 over water. In the case of large AOT, the results using the Aqua MODIS constraint over water are poorer than Aqua MODIS over land or Terra MODIS. The poorer results relate to an apparent bias in Aqua MODIS AOT over water observed in August 2007. This apparent bias is still under investigation. Finally, aerosol extinction coefficients are derived from CALIPSO backscatter data using AOT from Aqua MODIS for 28 profiles over land and 9 over water. They agree with coincident measurements by the airborne HSRL to within +/-0.016/km +/- 20% for at least two-thirds of land points and within +/-0.028/km +/- 20% for at least two-thirds of ocean points.
Buchard, V.; da Silva, A. M.; Colarco, P. R.; Darmenov, A.; Randles, C. A.; Govindaraju, R.; Torres, O.; Campbell, J.; Spurr, R.
2015-05-01
A radiative transfer interface has been developed to simulate the UV aerosol index (AI) from the NASA Goddard Earth Observing System version 5 (GEOS-5) aerosol assimilated fields. The purpose of this work is to use the AI and aerosol absorption optical depth (AAOD) derived from the Ozone Monitoring Instrument (OMI) measurements as independent validation for the Modern Era Retrospective analysis for Research and Applications Aerosol Reanalysis (MERRAero). MERRAero is based on a version of the GEOS-5 model that is radiatively coupled to the Goddard Chemistry, Aerosol, Radiation, and Transport (GOCART) aerosol module and includes assimilation of aerosol optical depth (AOD) from the Moderate Resolution Imaging Spectroradiometer (MODIS) sensor. Since AI is dependent on aerosol concentration, optical properties and altitude of the aerosol layer, we make use of complementary observations to fully diagnose the model, including AOD from the Multi-angle Imaging SpectroRadiometer (MISR), aerosol retrievals from the AErosol RObotic NETwork (AERONET) and attenuated backscatter coefficients from the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observation (CALIPSO) mission to ascertain potential misplacement of plume height by the model. By sampling dust, biomass burning and pollution events in 2007 we have compared model-produced AI and AAOD with the corresponding OMI products, identifying regions where the model representation of absorbing aerosols was deficient. As a result of this study over the Saharan dust region, we have obtained a new set of dust aerosol optical properties that retains consistency with the MODIS AOD data that were assimilated, while resulting in better agreement with aerosol absorption measurements from OMI. The analysis conducted over the southern African and South American biomass burning regions indicates that revising the spectrally dependent aerosol absorption properties in the near-UV region improves the modeled-observed AI comparisons
Directory of Open Access Journals (Sweden)
Marisa Narciso Fernandes
2013-05-01
Full Text Available Natural insecticides derived from plant extracts have been used as an alternative to synthetic products in order to reduce environmental contamination. The present study aimed to examine the effects of Fumydro®, a natural insecticide based in the tobacco plant Nicotiana tabacum, on the Nile tilapia (Oreochromis niloticus by determining the 48-h LC50 and evaluating their effects on hematological variables. Adult specimens of O. niloticus were exposed to four Fumydro® concentrations (200, 300, 400 and 500 μL L-1. The 48-h LC50 of Fumydro® was determined as 370 ± 50 μL L-1. Surviving fish showed increasing in the red blood cells, hemoglobin concentration, mean corpuscular hemoglobin and mean corpuscular hemoglobin concentration. The thrombocytes did not change but the percentage of neutrophils increased. These results indicated that the insecticide Fumydro® is toxic to Nile tilapia and the changes of the erythrocyte variables suggested hypoxemia induction with low effect on the immune system.Natural insecticides from plant extracts represent an alternative to the highly toxic synthetic products in order to reduce environmental contamination; however some might also be toxic for non-target organisms. The present study determined the 50% lethal concentration (48h; LC50 for adults Nile tilapia (Oreochromis niloticus exposed to the natural insecticide Fumydro®, based on the tobacco plant (Nicotiana tabacum, and evaluated its effect on hematological variables. After preliminary tests, adult specimens of O. niloticus were exposed to four Fumydro® concentrations (200, 300, 400 and 500 μL L-1. The 48h; LC50 of Fumydro® was determined at 370 ± 50 μL L-1. The surviving fish after exposure to Fumydro® showed an increase in the number of red blood cells, hemoglobin concentration, mean corpuscular hemoglobin and mean corpuscular hemoglobin concentration. The number of thrombocytes and leukocytes has not changed, unlike the differential leukocyte
Nighttime Aerosol Optical Depth Measurements Using a Ground-based Lunar Photometer
Berkoff, Tim; Omar, Ali; Haggard, Charles; Pippin, Margaret; Tasaddaq, Aasam; Stone, Tom; Rodriguez, Jon; Slutsker, Ilya; Eck, Tom; Holben, Brent;
2015-01-01
In recent years it was proposed to combine AERONET network photometer capabilities with a high precision lunar model used for satellite calibration to retrieve columnar nighttime AODs. The USGS lunar model can continuously provide pre-atmosphere high precision lunar irradiance determinations for multiple wavelengths at ground sensor locations. When combined with measured irradiances from a ground-based AERONET photometer, atmospheric column transmissions can determined yielding nighttime column aerosol AOD and Angstrom coefficients. Additional demonstrations have utilized this approach to further develop calibration methods and to obtain data in polar regions where extended periods of darkness occur. This new capability enables more complete studies of the diurnal behavior of aerosols, and feedback for models and satellite retrievals for the nighttime behavior of aerosols. It is anticipated that the nighttime capability of these sensors will be useful for comparisons with satellite lidars such as CALIOP and CATS in additional to ground-based lidars in MPLNET at night, when the signal-to-noise ratio is higher than daytime and more precise AOD comparisons can be made.
Mass spectrometric analyses of organophosphate insecticide oxon protein adducts.
Thompson, Charles M; Prins, John M; George, Kathleen M
2010-01-01
Organophosphate (OP) insecticides continue to be used to control insect pests. Acute and chronic exposures to OP insecticides have been documented to cause adverse health effects, but few OP-adducted proteins have been correlated with these illnesses at the molecular level. Our aim was to review the literature covering the current state of the art in mass spectrometry (MS) used to identify OP protein biomarkers. We identified general and specific research reports related to OP insecticides, OP toxicity, OP structure, and protein MS by searching PubMed and Chemical Abstracts for articles published before December 2008. A number of OP-based insecticides share common structural elements that result in predictable OP-protein adducts. The resultant OP-protein adducts show an increase in molecular mass that can be identified by MS and correlated with the OP agent. Customized OP-containing probes have also been used to tag and identify protein targets that can be identified by MS. MS is a useful and emerging tool for the identification of proteins that are modified by activated organophosphate insecticides. MS can characterize the structure of the OP adduct and also the specific amino acid residue that forms the key bond with the OP. Each protein that is modified in a unique way by an OP represents a unique molecular biomarker that with further research can lead to new correlations with exposure.
Che, Huizheng; Qi, Bing; Zhao, Hujia; Xia, Xiangao; Eck, Thomas F.; Goloub, Philippe; Dubovik, Oleg; Estelles, Victor; Cuevas-Agulló, Emilio; Blarel, Luc; Wu, Yunfei; Zhu, Jun; Du, Rongguang; Wang, Yaqiang; Wang, Hong; Gui, Ke; Yu, Jie; Zheng, Yu; Sun, Tianze; Chen, Quanliang; Shi, Guangyu; Zhang, Xiaoye
2018-01-01
Aerosol pollution in eastern China is an unfortunate consequence of the region's rapid economic and industrial growth. Here, sun photometer measurements from seven sites in the Yangtze River Delta (YRD) from 2011 to 2015 were used to characterize the climatology of aerosol microphysical and optical properties, calculate direct aerosol radiative forcing (DARF) and classify the aerosols based on size and absorption. Bimodal size distributions were found throughout the year, but larger volumes and effective radii of fine-mode particles occurred in June and September due to hygroscopic growth and/or cloud processing. Increases in the fine-mode particles in June and September caused AOD440 nm > 1.00 at most sites, and annual mean AOD440 nm values of 0.71-0.76 were found at the urban sites and 0.68 at the rural site. Unlike northern China, the AOD440 nm was lower in July and August (˜ 0.40-0.60) than in January and February (0.71-0.89) due to particle dispersion associated with subtropical anticyclones in summer. Low volumes and large bandwidths of both fine-mode and coarse-mode aerosol size distributions occurred in July and August because of biomass burning. Single-scattering albedos at 440 nm (SSA440 nm) from 0.91 to 0.94 indicated particles with relatively strong to moderate absorption. Strongly absorbing particles from biomass burning with a significant SSA wavelength dependence were found in July and August at most sites, while coarse particles in March to May were mineral dust. Absorbing aerosols were distributed more or less homogeneously throughout the region with absorption aerosol optical depths at 440 nm ˜ 0.04-0.06, but inter-site differences in the absorption Angström exponent indicate a degree of spatial heterogeneity in particle composition. The annual mean DARF was -93 ± 44 to -79 ± 39 W m-2 at the Earth's surface and ˜ -40 W m-2 at the top of the atmosphere (for the solar zenith angle range of 50 to 80°) under cloud-free conditions. The fine mode
Radiative Importance of Aerosol-Cloud Interaction
Tsay, Si-Chee
1999-01-01
Aerosol particles are input into the troposphere by biomass burning, among other sources. These aerosol palls cover large expanses of the earth's surface. Aerosols may directly scatter solar radiation back to space, thus increasing the earth's albedo and act to cool the earth's surface and atmosphere. Aerosols also contribute to the earth's energy balance indirectly. Hygroscopic aerosol act as cloud condensation nuclei (CCN) and thus affects cloud properties. In 1977, Twomey theorized that additional available CCN would create smaller but more numerous cloud droplets in a cloud with a given amount of liquid water. This in turn would increase the cloud albedo which would scatter additional radiation back to space and create a similar cooling pattern as the direct aerosol effect. Estimates of the magnitude of the aerosol indirect effect on a global scale range from 0.0 to -4.8 W/sq m. Thus the indirect effect can be of comparable magnitude and opposite in sign to the estimates of global greenhouse gas forcing Aerosol-cloud interaction is not a one-way process. Just as aerosols have an influence on clouds through the cloud microphysics, clouds have an influence on aerosols. Cloud droplets are solutions of liquid water and CCN, now dissolved. When the cloud droplet evaporates it leaves behind an aerosol particle. This new particle does not have to have the same properties as the original CCN. In fact, studies show that aerosol particles that result from cloud processing are larger in size than the original CCN. Optical properties of aerosol particles are dependent on the size of the particles. Larger particles have a smaller backscattering fraction, and thus less incoming solar radiation will be backscattered to space if the aerosol particles are larger. Therefore, we see that aerosols and clouds modify each other to influence the radiative balance of the earth. Understanding and quantifying the spatial and seasonal patterns of the aerosol indirect forcing may have
Aerosol-cirrus interactions: a number based phenomenon at all?
Directory of Open Access Journals (Sweden)
M. Seifert
2004-01-01
Full Text Available In situ measurements of the partitioning of aerosol particles within cirrus clouds were used to investigate aerosol-cloud interactions in ice clouds. The number density of interstitial aerosol particles (non-activated particles in between the cirrus crystals was compared to the number density of cirrus crystal residuals. The data was obtained during the two INCA (Interhemispheric Differences in Cirrus Properties from Anthropogenic Emissions campaigns, performed in the Southern Hemisphere (SH and Northern Hemisphere (NH midlatitudes. Different aerosol-cirrus interactions can be linked to the different stages of the cirrus lifecycle. Cloud formation is linked to positive correlations between the number density of interstitial aerosol (Nint and crystal residuals (Ncvi, whereas the correlations are smaller or even negative in a dissolving cloud. Unlike warm clouds, where the number density of cloud droplets is positively related to the aerosol number density, we observed a rather complex relationship when expressing Ncvi as a function of Nint for forming clouds. The data sets are similar in that they both show local maxima in the Nint range 100 to 200cm, where the SH- maximum is shifted towards the higher value. For lower number densities Nint and Ncvi are positively related. The slopes emerging from the data suggest that a tenfold increase in the aerosol number density corresponds to a 3 to 4 times increase in the crystal number density. As Nint increases beyond the ca. 100 to 200cm, the mean crystal number density decreases at about the same rate for both data sets. For much higher aerosol number densities, only present in the NH data set, the mean Ncvi remains low. The situation for dissolving clouds allows us to offer two possible, but at this point only speculative, alternative interactions between aerosols and cirrus: evaporating clouds might be associated with a source of aerosol particles, or air pollution (high aerosol number density might
Reduction of neonicotinoid insecticide residues in Prairie wetlands by common wetland plants.
Main, Anson R; Fehr, Jessica; Liber, Karsten; Headley, John V; Peru, Kerry M; Morrissey, Christy A
2017-02-01
Neonicotinoid insecticides are frequently detected in wetlands during the early to mid-growing period of the Canadian Prairie cropping season. These detections also overlap with the growth of macrophytes that commonly surround agricultural wetlands which we hypothesized may reduce neonicotinoid transport and retention in wetlands. We sampled 20 agricultural wetlands and 11 macrophyte species in central Saskatchewan, Canada, over eight weeks to investigate whether macrophytes were capable of reducing movement of neonicotinoids from cultivated fields and/or reducing concentrations in surface water by accumulating insecticide residues into their tissues. Study wetlands were surrounded by clothianidin-treated canola and selected based on the presence (n=10) or absence (n=10) of a zonal plant community. Neonicotinoids were positively detected in 43% of wetland plants, and quantified in 8% of all plant tissues sampled. Three plant species showed high rates of detection: 78% Equisetum arvense (clothianidin, range: wetlands had higher detection frequency and water concentrations of clothianidin (β±S.E.: -0.77±0.26, P=0.003) and thiamethoxam (β±S.E.: -0.69±0.35, P=0.049) than vegetated wetlands. We assessed the importance of wetland characteristics (e.g. vegetative zone width, emergent plant height, water depth) on neonicotinoid concentrations in Prairie wetlands over time using linear mixed-effects models. Clothianidin concentrations were significantly lower in wetlands surrounded by taller plants (β±S.E.: -0.57±0.12, P≤0.001). The results of this study suggest that macrophytes can play an important role in mitigating water contamination by accumulating neonicotinoids and possibly slowing transport to wetlands during the growing season. Copyright © 2016 Elsevier B.V. All rights reserved.
Use of Multiangle Satellite Observations to Retrieve Aerosol Properties and Ocean Color
Martonchik, John V.; Diner, David; Khan, Ralph
2005-01-01
A new technique is described for retrieving aerosol over ocean water and the associated ocean color using multiangle satellite observations. Unlike current satellite aerosol retrieval algorithms which only utilize observations at red wavelengths and longer, with the assumption that these wavelengths have a negligible ocean (water-leaving radiance), this new algorithm uses all available spectral bands and simultaneously retrieves both aerosol properties and the spectral ocean color. We show some results of case studies using MISR data, performed over different water conditions (coastal water, blooms, and open water).
DARE : Dedicated Aerosols Retrieval Experiment
Smorenburg, K.; Courrèges-Lacoste, G.B.; Decae, R.; Court, A.J.; Leeuw, G. de; Visser, H.
2004-01-01
At present there is an increasing interest in remote sensing of aerosols from space because of the large impact of aerosols on climate, earth observation and health. TNO has performed a study aimed at improving aerosol characterisation using a space based instrument and state-of-the-art aerosol
Anticholinesterase insecticide retrospective.
Casida, John E; Durkin, Kathleen A
2013-03-25
The anticholinesterase (antiChE) organophosphorus (OP) and methylcarbamate (MC) insecticides have been used very effectively as contact and systemic plant protectants for seven decades. About 90 of these compounds are still in use - the largest number for any insecticide chemotype or mode of action. In both insects and mammals, AChE inhibition and acetylcholine accumulation leads to excitation and death. The cholinergic system of insects is located centrally (where it is protected from ionized OPs and MCs) but not at the neuromuscular junction. Structural differences between insect and mammalian AChE are also evident in their genomics, amino acid sequences and active site conformations. Species selectivity is determined in part by inhibitor and target site specificity. Pest population selection with OPs and MCs has resulted in a multitude of modified AChEs of altered inhibitor specificity some conferring insecticide resistance and others enhancing sensitivity. Much of the success of antiChE insecticides results from a suitable balance of bioactivation and detoxification by families of CYP450 oxidases, hydrolases, glutathione S-transferases and others. Known inhibitors for these enzymes block detoxification and enhance potency which is particularly important in resistant strains. The current market for OPs and MCs of 19% of worldwide insecticide sales is only half of that of 10 years ago for several reasons: there have been no major new compounds for 30 years; resistance has eroded their effectiveness; human toxicity problems are still encountered; the patents have expired reducing the incentive to update registration packages; alternative chemotypes or control methods have been developed. Despite this decline, they still play a major role in pest control and the increasing knowledge on their target sites and metabolism may make it possible to redesign the inhibitors for insensitive AChEs and to target new sites in the cholinergic system. The OPs and MCs are down
Diagnostic Doses of Insecticides for Adult Aedes aegypti to Assess Insecticide Resistance in Cuba.
Rodríguez, María Magdalena; Crespo, Ariel; Hurtado, Daymi; Fuentes, Ilario; Rey, Jorge; Bisset, Juan Andrés
2017-06-01
The objective of this study was to determine diagnostic doses (DDs) of 5 insecticides for the Rockefeller susceptible strain of Aedes aegypti , using the Centers for Disease Control and Prevention (CDC) bottle bioassay as a tool for monitoring insecticide resistance in the Cuban vector control program. The 30-min DD values determined in this study were 13.5 μg/ml, 6.5 μg/ml, 6 μg/ml, 90.0 μg/ml, and 15.0 μg/ml for cypermethrin, deltamethrin, lambda-cyhalothrin, chlorpyrifos, and propoxur, respectively. To compare the reliability of CDC bottle bioassay with the World Health Organization susceptible test, 3 insecticide-resistant strains were evaluated for deltamethrin and lambda-cyhalothrin. Results showed that the bottles can be used effectively from 21 to 25 days after treatment and reused up to 4 times, depending on the storage time. The CDC bottle bioassay is an effective tool to assess insecticide resistance in field populations of Ae. aegypti in Cuba and can be incorporated into vector management programs using the diagnostic doses determined in this study.
Wang, Dongli; Weston, Donald P; Lydy, Michael J
2009-06-15
In the current study, organophosphate and pyrethroid insecticides including diazinon, chlorpyrifos, bifenthrin, fenpropathrin, permethrin, lambda-cyhalothrin, cyfluthrin, cypermethrin, esfenvalerate and deltamethrin were analyzed in laboratory and field-collected water samples. Water samples were extracted and analyzed by gas chromatography/electron capture detector (GC/ECD) and gas chromatography/nitrogen-phosphorous detector (GC/NPD). Comparison of results from liquid-liquid extraction and subsequent normal phase solid-phase extraction cleanup (LLE-NPSPE), and reversed phase solid-phase extraction (RPSPE) showed that LLE-NPSPE was the better choice to extract trace amounts of pesticides from water. Pesticide recoveries from four spiked water samples using LLE-NPSPE ranged from 63.2 to 148.8% at four spiking concentrations. Method detection limits were 0.72-1.69 ng/L using four different water sources. The stability of the target pesticides in lake water was investigated at 4 degrees C for 1h, 1d, 4d, and 7d under three conditions: (1) water samples only; (2) with 20 mL hexane used as a keeper solvent; and (3) with acidification to pH 2 with HCl. Results showed that water storage without treatment resulted in slow degradation of some pesticides with storage time, storage using water acidification led to significant degradation and loss of diazinon and chlorpyrifos, while water storage with hexane as a keeper solvent showed good stability for all of the target pesticides over the 7d storage period.
A Simple Model of Global Aerosol Indirect Effects
Ghan, Steven J.; Smith, Steven J.; Wang, Minghuai; Zhang, Kai; Pringle, Kirsty; Carslaw, Kenneth; Pierce, Jeffrey; Bauer, Susanne; Adams, Peter
2013-01-01
Most estimates of the global mean indirect effect of anthropogenic aerosol on the Earth's energy balance are from simulations by global models of the aerosol lifecycle coupled with global models of clouds and the hydrologic cycle. Extremely simple models have been developed for integrated assessment models, but lack the flexibility to distinguish between primary and secondary sources of aerosol. Here a simple but more physically based model expresses the aerosol indirect effect (AIE) using analytic representations of cloud and aerosol distributions and processes. Although the simple model is able to produce estimates of AIEs that are comparable to those from some global aerosol models using the same global mean aerosol properties, the estimates by the simple model are sensitive to preindustrial cloud condensation nuclei concentration, preindustrial accumulation mode radius, width of the accumulation mode, size of primary particles, cloud thickness, primary and secondary anthropogenic emissions, the fraction of the secondary anthropogenic emissions that accumulates on the coarse mode, the fraction of the secondary mass that forms new particles, and the sensitivity of liquid water path to droplet number concentration. Estimates of present-day AIEs as low as 5 W/sq m and as high as 0.3 W/sq m are obtained for plausible sets of parameter values. Estimates are surprisingly linear in emissions. The estimates depend on parameter values in ways that are consistent with results from detailed global aerosol-climate simulation models, which adds to understanding of the dependence on AIE uncertainty on uncertainty in parameter values.
Chemical Thermodynamics of Aqueous Atmospheric Aerosols: Modeling and Microfluidic Measurements
Nandy, L.; Dutcher, C. S.
2017-12-01
Accurate predictions of gas-liquid-solid equilibrium phase partitioning of atmospheric aerosols by thermodynamic modeling and measurements is critical for determining particle composition and internal structure at conditions relevant to the atmosphere. Organic acids that originate from biomass burning, and direct biogenic emission make up a significant fraction of the organic mass in atmospheric aerosol particles. In addition, inorganic compounds like ammonium sulfate and sea salt also exist in atmospheric aerosols, that results in a mixture of single, double or triple charged ions, and non-dissociated and partially dissociated organic acids. Statistical mechanics based on a multilayer adsorption isotherm model can be applied to these complex aqueous environments for predictions of thermodynamic properties. In this work, thermodynamic analytic predictive models are developed for multicomponent aqueous solutions (consisting of partially dissociating organic and inorganic acids, fully dissociating symmetric and asymmetric electrolytes, and neutral organic compounds) over the entire relative humidity range, that represent a significant advancement towards a fully predictive model. The model is also developed at varied temperatures for electrolytes and organic compounds the data for which are available at different temperatures. In addition to the modeling approach, water loss of multicomponent aerosol particles is measured by microfluidic experiments to parameterize and validate the model. In the experimental microfluidic measurements, atmospheric aerosol droplet chemical mimics (organic acids and secondary organic aerosol (SOA) samples) are generated in microfluidic channels and stored and imaged in passive traps until dehydration to study the influence of relative humidity and water loss on phase behavior.
Seasonal dependence of aerosol processing in urban Philadelphia
Avery, A. M.; Waring, M. S.; DeCarlo, P. F.
2017-12-01
Urban aerosols pose an important threat to human health due to the conflation of emissions and concentrated population exposed. Winter and summer aerosol and trace gas measurements were taken in downtown Philadelphia in 2016. Measurements included aerosol composition and size with an Aerodyne Aerosol Mass Spectrometer (AMS), particle size distributions with an SMPS, and an aethalometer. Trace gas measurements of O3, NO, CH4, CO, and CO2 were taken concurrently. Sampling in seasonal extremes provided contrast in aerosol and trace gas composition, aerosol processing, and emission factors. Inorganic aerosol components contributed approximately 60% of the submicron aerosol mass, while summertime aerosol composition was roughly 70% organic matter. Positive Matrix Factorization (PMF) on the organic aerosol (OA) matrix revealed three factors in common in each season, including an oxygenated organic aerosol (OOA) factor with different temporal behavior in each season. In summertime, OOA varied diurnally with ozone and daytime temperature, but in the wintertime, it was anti-correlated with ozone and temperature, and instead trended with calculated liquid water, indicating a seasonally-dependent processing of organic aerosol in Philadelphia's urban environment. Due to the inorganic dominant winter aerosol, liquid water much higher (2.65 μg/m3) in winter than in summer (1.54 μg/m3). Diurnally varying concentrations of background gas phase species (CH4, CO2) were higher in winter and varied less as a result of boundary layer conditions; ozone was also higher in background in winter than summer. Winter stagnation events with low windspeed showed large buildup of trace gases CH4, CO, CO2, and NO. Traffic related aerosol was also elevated with black carbon and hydrocarbon-like OA (HOA) plumes of each at 3-5 times higher than the winter the average value for each. Winter ratios of HOA to black carbon were significantly higher in the winter than the summer due to lower
Müller, Astrid; Miyazaki, Yuzo; Tachibana, Eri; Kawamura, Kimitaka; Hiura, Tsutom
2017-08-16
Biogenic organic aerosols can affect cloud condensation nuclei (CCN) properties, and subsequently impact climate change. Large uncertainties exist in how the difference in the types of terrestrial biogenic sources and the abundance of organics relative to sulfate affect CCN properties. For the submicron water-soluble aerosols collected for two years in a cool-temperate forest in northern Japan, we show that the hygroscopicity parameter κ CCN (0.44 ± 0.07) exhibited a distinct seasonal trend with a minimum in autumn (κ CCN = 0.32-0.37); these κ CCN values were generally larger than that of ambient particles, including water-insoluble fractions. The temporal variability of κ CCN was controlled by the water-soluble organic matter (WSOM)-to-sulfate ratio (R 2 > 0.60), where the significant reduction of κ CCN in autumn was linked to the increased WSOM/sulfate ratio. Positive matrix factorization analysis indicates that α-pinene-derived secondary organic aerosol (SOA) substantially contributed to the WSOM mass (~75%) in autumn, the majority of which was attributable to emissions from litter/soil microbial activity near the forest floor. These findings suggest that WSOM, most likely α-pinene SOA, originated from the forest floor can significantly suppress the aerosol CCN activity in cool-temperate forests, which have implications for predicting climate effects by changes in biogenic emissions in future.
Is the aerosol emission detectable in the thermal infrared?
Hollweg, H.-D.; Bakan, S.; Taylor, J. P.
2006-08-01
The impact of aerosols on the thermal infrared radiation can be assessed by combining observations and radiative transfer calculations. Both have uncertainties, which are discussed in this paper. Observational uncertainties are obtained for two FTIR instruments operated side by side on the ground during the LACE 1998 field campaign. Radiative transfer uncertainties are assessed using a line-by-line model taking into account the uncertainties of the HITRAN 2004 spectroscopic database, uncertainties in the determination of the atmospheric profiles of water vapor and ozone, and differences in the treatment of the water vapor continuum absorption by the CKD 2.4.1 and MT_CKD 1.0 algorithms. The software package OPAC was used to describe the optical properties of aerosols for climate modeling. The corresponding radiative signature is a guideline to the assessment of the uncertainty ranges of observations and models. We found that the detection of aerosols depends strongly on the measurement accuracy of atmospheric profiles of water vapor and ozone and is easier for drier conditions. Within the atmospheric window, only the forcing of downward radiation at the surface by desert aerosol emerges clearly from the uncertainties of modeling and FTIR measurement. Urban and polluted continental aerosols are only partially detectable depending on the wave number and on the atmospheric water vapor amount. Simulations for the space-borne interferometer IASI show that only upward radiation above transported mineral dust aloft emerges out of the uncertainties. The detection of aerosols with weak radiative impact by FTIR instruments like ARIES and OASIS is made difficult by noise as demonstrated by the signal to noise ratio for clean continental aerosols. Altogether, the uncertainties found suggest that it is difficult to detect the optical depths of nonmineral and unpolluted aerosols.
Directory of Open Access Journals (Sweden)
S. Moinoddini
2016-05-01
Full Text Available In the last decades, pesticides have been used extensively, in order to control pests and plant diseases, but negative impacts of pesticides caused several environmental problems and put human health in danger. In order to decrease environmental hazards of pesticide, risk of pesticide application should be measured briefly and precisely. In this study environmental impacts of registered insecticides in Iran which applied in 2001-2002, 2003-2004, 2004-2005, are considered using environmental impact quotient (EIQ index. Results showed that among considered insecticides, Imidacloprid, Fipronil and Tiodicarb, potentially (EIQ were the most hazardous insecticides, respectively. Taking rate of application and active ingredient of insecticide in to account, environmental impact (practical toxicity per cultivated hectare (EIQ Field of each provinces were investigated. In this regard, among different province of Iran, Kerman, Mazandaran and Golestan were in danger more than the others, respectively. Besides, considering the amount of agricultural production in provinces, environmental impact per ton of production were calculated for each provinces which three northern provinces of Mazandaran, Golestan and Guilan, respectively endure the most environmental impact per ton of production. Eventually based on environmental impact quotient, results demonstrated that majority of environmental impacts of insecticide in Iran were due to inadequate knowledge and also overuse of a few number of insecticides. Therefore, by improving knowledge about environmental impact of pesticides and also developing environmental friendly and ecological based methods, negative environmental impacts of insecticides will be reduced significantly.
Singh, A. K.; Toshniwal, D.
2017-12-01
The MODIS Joint Atmosphere product, MODATML2 and MYDATML2 L2/3 provided by LAADS DAAC (Level-1 and Atmosphere Archive & Distribution System Distributed Active Archive Center) re-sampled from medium resolution MODIS Terra /Aqua Satellites data at 5km scale, contains Cloud Reflectance, Cloud Top Temperature, Water Vapor, Aerosol Optical Depth/Thickness, Humidity data. These re-sampled data, when used for deriving climatic effects of aerosols (particularly in case of cooling effect) still exposes limitations in presence of uncertainty measures in atmospheric artifacts such as aerosol, cloud, cirrus cloud etc. The effect of uncertainty measures in these artifacts imposes an important challenge for estimation of aerosol effects, adequately affecting precise regional weather modeling and predictions: Forecasting and recommendation applications developed largely depend on these short-term local conditions (e.g. City/Locality based recommendations to citizens/farmers based on local weather models). Our approach inculcates artificial intelligence technique for representing heterogeneous data(satellite data along with air quality data from local weather stations (i.e. in situ data)) to learn, correct and predict aerosol effects in the presence of cloud and other atmospheric artifacts, defusing Spatio-temporal correlations and regressions. The Big Data process pipeline consisting correlation and regression techniques developed on Apache Spark platform can easily scale for large data sets including many tiles (scenes) and over widened time-scale. Keywords: Climatic Effects of Aerosols, Situation-Aware, Big Data, Apache Spark, MODIS Terra /Aqua, Time Series
International Nuclear Information System (INIS)
Ligotke, M.W.; Eschbach, E.J.; Winegardner, W.K.
1991-09-01
This report presents the results of an experimental investigation of aerosol particle transport and capture using a full-scale height and reduced-scale cross section test facility based on the design of the ice compartment of a pressurized water reactor (PWR) ice-condenser containment system. Results of 38 tests included thermal-hydraulic as well as aerosol particle data. Particle retention in the test section was greatly influenced by thermal-hydraulic and aerosol test parameters. Test-average decontamination factor (DF) ranged between 1.0 and 36 (retentions between ∼0 and 97.2%). The measured test-average particle retentions for tests without and with ice and steam ranged between DF = 1.0 and 2.2 and DF = 2.4 and 36, respectively. In order to apparent importance, parameters that caused particle retention in the test section in the presence of ice were steam mole fraction (SMF), noncondensible gas flow rate (residence time), particle solubility, and inlet particle size. Ice-basket section noncondensible flows greater than 0.1 m 3 /s resulted in stable thermal stratification whereas flows less than 0.1 m 3 /s resulted in thermal behavior termed meandering with frequent temperature crossovers between flow channels. 10 refs., 66 figs., 16 tabs
Ecotoxicity of binary mixtures of Microcystis aeruginosa and insecticides to Daphnia pulex.
Asselman, J; Janssen, C R; Smagghe, G; De Schamphelaere, K A C
2014-05-01
In aquatic ecosystems, mixtures of chemical and natural stressors can occur which may significantly complicate risk assessment approaches. Here, we show that effects of binary combinations of four different insecticides and Microcystis aeruginosa, a toxic cyanobacteria, on Daphnia pulex exhibited distinct interaction patterns. Combinations with chlorpyrifos and tetradifon caused non-interactive effects, tebufenpyrad caused an antagonistic interaction and fenoyxcarb yielded patterns that depended on the reference model used (i.e. synergistic with independent action, additive with concentration addition). Our results demonstrate that interactive effects cannot be generalised across different insecticides, not even for those targeting the same biological pathway (i.e. tebufenpyrad and tetradifon both target oxidative phosphorylation). Also, the concentration addition reference model provided conservative predictions of effects in all investigated combinations for risk assessment. These predictions could, in absence of a full mechanistic understanding, provide a meaningful solution for managing water quality in systems impacted by both insecticides and cyanobacterial blooms. Copyright © 2014 Elsevier Ltd. All rights reserved.
The Impact of Aerosol Particle Mixing State on the Hygroscopicity of Sea Spray Aerosol.
Schill, Steven R; Collins, Douglas B; Lee, Christopher; Morris, Holly S; Novak, Gordon A; Prather, Kimberly A; Quinn, Patricia K; Sultana, Camille M; Tivanski, Alexei V; Zimmermann, Kathryn; Cappa, Christopher D; Bertram, Timothy H
2015-06-24
Aerosol particles influence global climate by determining cloud droplet number concentrations, brightness, and lifetime. Primary aerosol particles, such as those produced from breaking waves in the ocean, display large particle-particle variability in chemical composition, morphology, and physical phase state, all of which affect the ability of individual particles to accommodate water and grow into cloud droplets. Despite such diversity in molecular composition, there is a paucity of methods available to assess how particle-particle variability in chemistry translates to corresponding differences in aerosol hygroscopicity. Here, an approach has been developed that allows for characterization of the distribution of aerosol hygroscopicity within a chemically complex population of atmospheric particles. This methodology, when applied to the interpretation of nascent sea spray aerosol, provides a quantitative framework for connecting results obtained using molecular mimics generated in the laboratory with chemically complex ambient aerosol. We show that nascent sea spray aerosol, generated in situ in the Atlantic Ocean, displays a broad distribution of particle hygroscopicities, indicative of a correspondingly broad distribution of particle chemical compositions. Molecular mimics of sea spray aerosol organic material were used in the laboratory to assess the volume fractions and molecular functionality required to suppress sea spray aerosol hygroscopicity to the extent indicated by field observations. We show that proper accounting for the distribution and diversity in particle hygroscopicity and composition are important to the assessment of particle impacts on clouds and global climate.
Directory of Open Access Journals (Sweden)
Maria Cristina PONEPAL
2010-05-01
Full Text Available Talstar insecticide is labeled for numerous bugs and many other household pests and lawn pests. Bifenthrin is highly toxic to fish and aquatic arthropods. Bifenhrin LC50 values range from 0.0038 to17.8 μg/L and is only slightly toxic to both waterfowl and upland game birds (LD50 values range from 1.800 mg/kg to > 2.150 mg/kg. Bifenthrin had no effect on mollusks at its limit of water solubility. This study was carried out to analyze the effects of sublethal and lethal concentrations – from 0.000625 to 0.005 ml Talstar/l water on some physiological parameters (oxygen consumption, breathing frequency, number of erythrocytes on fish belonging to three species: prussian carp (Carassius auratus gibelio Bloch, bleak (Alburnus alburnus L. and perch (Perca fluviatilis L.. The acute and subacute toxicity of Talstar insecticide was evaluated in glass aquaria under semystatic conditions. The Tlastar product, under the concentrations from 0.000625 to 0.005 ml/l water, produces, after one week of immersion, a significant decrease of the fish oxygen consumption. The insecticide has changed the fish respiratory rhythm in all investigated concentrations after seven days of exposure. The number of erythrocytes has significantly decrease after seven days of immersion at insecticide concentrations of 0.000625 ml Talstar/l water (bleak and perch and 0.00125 (prussian carp ml Talstar/l water. From the three investigated fish species, the perch proved to be the most sensitive to the action of the toxic substance, followed by the bleak and the prussian carp.
Xu, Feng; van Harten, Gerard; Diner, David J.; Davis, Anthony B.; Seidel, Felix C.; Rheingans, Brian; Tosca, Mika; Alexandrov, Mikhail D.; Cairns, Brian; Ferrare, Richard A.; Burton, Sharon P.; Fenn, Marta A.; Hostetler, Chris A.; Wood, Robert; Redemann, Jens
2018-03-01
An optimization algorithm is developed to retrieve liquid water cloud properties including cloud optical depth (COD), droplet size distribution and cloud top height (CTH), and above-cloud aerosol properties including aerosol optical depth (AOD), single-scattering albedo, and microphysical properties from sweep-mode observations by Jet Propulsion Laboratory's Airborne Multiangle SpectroPolarimetric Imager (AirMSPI) instrument. The retrieval is composed of three major steps: (1) initial estimate of the mean droplet size distribution across the entire image of 80-100 km along track by 10-25 km across track from polarimetric cloudbow observations, (2) coupled retrieval of image-scale cloud and above-cloud aerosol properties by fitting the polarimetric data at all observation angles, and (3) iterative retrieval of 1-D radiative transfer-based COD and droplet size distribution at pixel scale (25 m) by establishing relationships between COD and droplet size and fitting the total radiance measurements. Our retrieval is tested using 134 AirMSPI data sets acquired during the National Aeronautics and Space Administration (NASA) field campaign ObseRvations of Aerosols above CLouds and their intEractionS. The retrieved above-cloud AOD and CTH are compared to coincident HSRL-2 (HSRL-2, NASA Langley Research Center) data, and COD and droplet size distribution parameters (effective radius reff and effective variance veff) are compared to coincident Research Scanning Polarimeter (RSP) (NASA Goddard Institute for Space Studies) data. Mean absolute differences between AirMSPI and HSRL-2 retrievals of above-cloud AOD at 532 nm and CTH are 0.03 and mean absolute differences between RSP and AirMSPI retrievals of COD, reff, and veff in the cloudbow area are 2.33, 0.69 μm, and 0.020, respectively. Neglect of smoke aerosols above cloud leads to an underestimate of image-averaged COD by 15%.
Potential influences of neglecting aerosol effects on the NCEP GFS precipitation forecast
Jiang, Mengjiao; Feng, Jinqin; Li, Zhanqing; Sun, Ruiyu; Hou, Yu-Tai; Zhu, Yuejian; Wan, Bingcheng; Guo, Jianping; Cribb, Maureen
2017-11-01
Aerosol-cloud interactions (ACIs) have been widely recognized as a factor affecting precipitation. However, they have not been considered in the operational National Centers for Environmental Predictions Global Forecast System model. We evaluated the potential impact of neglecting ACI on the operational rainfall forecast using ground-based and satellite observations and model reanalysis. The Climate Prediction Center unified gauge-based precipitation analysis and the Modern-Era Retrospective analysis for Research and Applications Version 2 aerosol reanalysis were used to evaluate the forecast in three countries for the year 2015. The overestimation of light rain (47.84 %) and underestimation of heavier rain (31.83, 52.94, and 65.74 % for moderate rain, heavy rain, and very heavy rain, respectively) from the model are qualitatively consistent with the potential errors arising from not accounting for ACI, although other factors cannot be totally ruled out. The standard deviation of the forecast bias was significantly correlated with aerosol optical depth in Australia, the US, and China. To gain further insight, we chose the province of Fujian in China to pursue a more insightful investigation using a suite of variables from gauge-based observations of precipitation, visibility, water vapor, convective available potential energy (CAPE), and satellite datasets. Similar forecast biases were found: over-forecasted light rain and under-forecasted heavy rain. Long-term analyses revealed an increasing trend in heavy rain in summer and a decreasing trend in light rain in other seasons, accompanied by a decreasing trend in visibility, no trend in water vapor, and a slight increasing trend in summertime CAPE. More aerosols decreased cloud effective radii for cases where the liquid water path was greater than 100 g m-2. All findings are consistent with the effects of ACI, i.e., where aerosols inhibit the development of shallow liquid clouds and invigorate warm-base mixed
Study of photolytic aerosols at stratospheric pressures
International Nuclear Information System (INIS)
Delattre, Patrick.
1975-07-01
An experimental study of photolytic aerosol formation at stratospheric pressure (60 Torr) and laboratory temperature, was carried out previous to the exact simulation of photolytic aerosol formation in real stratospheric conditions. An experimental simulation device, techniques of generation of known mixtures of inert gases with SO 2 and NOsub(x) traces at low concentration (below 1 ppm volume) and H 2 O traces (a few ppm), and techniques for the determination and counting of aerosol particles at low pressures were perfected. The following results were achieved: the rate of vapor condensation on nuclei was reduced when total pressure decreased. At low pressure the working of condensation nuclei counters and the formation of photolytic aerosols is influenced by this phenomenon. An explanation is proposed, as well as means to avoid this unpleasant effect on the working of nuclei counters at low pressure. No photolytic aerosol production was ascertained at 60 Torr when water concentration was below 100 ppm whatever the concentration of SO 2 or NOsub(x) traces. With water concentration below 1200ppm and SO 2 trace concentration below 1ppm, the aerosol particles produced could not consist of sulfuric acid drops but probably of nitrosyl sulfate acide crystals [fr
Modelling aerosol behavior in reactor cooling systems
International Nuclear Information System (INIS)
McDonald, B.H.
1990-01-01
This paper presents an overview of some of the areas of concern in using computer codes to model fission-product aerosol behavior in the reactor cooling system (RCS) of a water-cooled nuclear reactor during a loss-of-coolant accident. The basic physical processes that require modelling include: fission product release and aerosol formation in the reactor core, aerosol transport and deposition in the reactor core and throughout the rest of the RCS, and the interaction between aerosol transport processes and the thermalhydraulics. In addition to these basic physical processes, chemical reactions can have a large influence on the nature of the aerosol and its behavior in the RCS. The focus is on the physics and the implications of numerical methods used in the computer codes to model aerosol behavior in the RCS
Campbell, James; Hyer, Edward; Zhang, Jianglong; Reid, Jeffrey; Westphal, Douglas; Xian, Peng; Vaughan, Mark
2010-05-01
Modeling the instantaneous three-dimensional aerosol field and its downwind transport represents an endeavor with many practical benefits foreseeable to air quality, aviation, military and science agencies. The recent proliferation of multi-spectral active and passive satellite-based instruments measuring aerosol physical properties has served as an opportunity to develop and refine the techniques necessary to make such numerical modeling applications possible. Spurred by high-resolution global mapping of aerosol source regions, and combined with novel multivariate data assimilation techniques designed to consider these new data streams, operational forecasts of visibility and aerosol optical depths are now available in near real-time1. Active satellite-based aerosol profiling, accomplished using lidar instruments, represents a critical element for accurate analysis and transport modeling. Aerosol source functions, alone, can be limited in representing the macrophysical structure of injection scenarios within a model. Two-dimensional variational (2D-VAR; x, y) assimilation of aerosol optical depth from passive satellite observations significantly improves the analysis of the initial state. However, this procedure can not fully compensate for any potential vertical redistribution of mass required at the innovation step. The expense of an inaccurate vertical analysis of aerosol structure is corresponding errors downwind, since trajectory paths within successive forecast runs will likely diverge with height. In this paper, the application of a newly-designed system for 3D-VAR (x,y,z) assimilation of vertical aerosol extinction profiles derived from elastic-scattering lidar measurements is described [Campbell et al., 2009]. Performance is evaluated for use with the U. S. Navy Aerosol Analysis and Prediction System (NAAPS) by assimilating NASA/CNES satellite-borne Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) 0.532 μm measurements [Winker et al., 2009
The Finokalia Aerosol Measurement Experiment – 2008 (FAME-08: an overview
Directory of Open Access Journals (Sweden)
M. Pikridas
2010-07-01
Full Text Available A month (4 May to 8 June 2008 of ambient aerosol, air ion and gas phase sampling (Finokalia Aerosol Measurement Experiment 2008, FAME-08 was conducted at Finokalia, on the island of Crete, Greece. The purpose of the study was to characterize the physical and chemical properties of aged aerosol and to investigate new particle formation. Measurements included aerosol and air ion size distributions, size-resolved chemical composition, organic aerosol thermal volatility, water uptake and particle optical properties (light scattering and absorption. Statistical analysis of the aerosol mass concentration variations revealed the absence of diurnal patterns suggesting the lack of strong local sources. Sulfates accounted for approximately half of the particulate matter less than 1 micrometer in diameter (PM1 and organics for 28%. The PM1 organic aerosol fraction was highly oxidized with 80% water soluble. The supermicrometer particles were dominated by crustal components (50%, sea salt (24% and nitrates (16%. The organic carbon to elemental carbon (OC/EC ratio correlated with ozone measurements but with a one-day lag. The average OC/EC ratio for the study period was equal to 5.4. For three days air masses from North Africa resulted in a 6-fold increase of particulate matter less than 10 micrometers in diameter (PM10 and a decrease of the OC/EC ratio by a factor of 2. Back trajectory analysis, based on FLEXPART footprint plots, identified five source regions (Athens, Greece, Africa, other continental and marine, each of which influenced the PM1 aerosol composition and properties. Marine air masses had the lowest PM1 concentrations and air masses from the Balkans, Turkey and Eastern Europe the highest.
CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Detailed Conceptual Diagram
Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.
CADDIS Volume 2. Sources, Stressors and Responses: Insecticides - Simple Conceptual Diagram
Introduction to the insecticides module, when to list insecticides as a candidate cause, ways to measure insecticides, simple and detailed conceptual diagrams for insecticides, insecticides module references and literature reviews.
Osmoregulatory function in ducks following ingestion of the organophosphorus insecticide fenthion
Rattner, B.A.; Fleming, W.J.; Murray, H.C.
1983-01-01
Salt gland function and osmoregulation in aquatic birds drinking hyperosmotic water has been suggested to be impaired by organophosphorus insecticides. To test this hypothesis, adult black ducks (Anas rubripes) were provided various regimens of fresh or salt (1.5% NaCl) water before, during, and after ingestion of mash containing 21 ppm fenthion. Ducks were bled by jugular venipuncture after I, 7. and 12 days of treatment, and were then killed. Brain and salt gland acetylcholinesterase activities were substantially inhibited (44-61% and 14-36%) by fenthion. However, salt gland weight and Na + -K + -ATPase activity, and plasma Na + , CI- , and osmolality, were uniformly elevated in all groups receiving salt water including those ingesting fenthion. In a second study, salt gland Na + -K + -ATPase activity in mallards (A. platyrhynchos) was not affected after in vitro incubation with either fenthion or fenthion oxon at concentrations ranging from 0.04 to 400 ?M, but was reduced in the presence of 40 and 400 ?M DDE (positive control). These findings suggest that environmentally realistic concentrations of organophosphorus insecticides do not markedly affect osmoregulatory function in adult black ducks.
The global status of insect resistance to neonicotinoid insecticides.
Bass, Chris; Denholm, Ian; Williamson, Martin S; Nauen, Ralf
2015-06-01
The first neonicotinoid insecticide, imidacloprid, was launched in 1991. Today this class of insecticides comprises at least seven major compounds with a market share of more than 25% of total global insecticide sales. Neonicotinoid insecticides are highly selective agonists of insect nicotinic acetylcholine receptors and provide farmers with invaluable, highly effective tools against some of the world's most destructive crop pests. These include sucking pests such as aphids, whiteflies, and planthoppers, and also some coleopteran, dipteran and lepidopteran species. Although many insect species are still successfully controlled by neonicotinoids, their popularity has imposed a mounting selection pressure for resistance, and in several species resistance has now reached levels that compromise the efficacy of these insecticides. Research to understand the molecular basis of neonicotinoid resistance has revealed both target-site and metabolic mechanisms conferring resistance. For target-site resistance, field-evolved mutations have only been characterized in two aphid species. Metabolic resistance appears much more common, with the enhanced expression of one or more cytochrome P450s frequently reported in resistant strains. Despite the current scale of resistance, neonicotinoids remain a major component of many pest control programmes, and resistance management strategies, based on mode of action rotation, are of crucial importance in preventing resistance becoming more widespread. In this review we summarize the current status of neonicotinoid resistance, the biochemical and molecular mechanisms involved, and the implications for resistance management. Copyright © 2015 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
G.-J. Roelofs
2010-08-01
Full Text Available In May 2008, the measurement campaign IMPACT for observation of atmospheric aerosol and cloud properties was conducted in Cabauw, The Netherlands. With a nudged version of the coupled aerosol-climate model ECHAM5-HAM we simulate the size distribution and chemical composition of the aerosol and the associated aerosol optical thickness (AOT for the campaign period. Synoptic scale meteorology is represented realistically through nudging of the vorticity, the divergence, the temperature and the surface pressure. Simulated concentrations of aerosol sulfate and organics at the surface are generally within a factor of two from observed values. The monthly averaged AOT from the model is 0.33, about 20% larger than observed. For selected periods of the month with relatively dry and moist conditions discrepancies are approximately −30% and +15%, respectively. Discrepancies during the dry period are partly caused by inaccurate representation of boundary layer (BL dynamics by the model affecting the simulated AOT. The model simulates too strong exchange between the BL and the free troposphere, resulting in weaker concentration gradients at the BL top than observed for aerosol and humidity, while upward mixing from the surface layers into the BL appears to be underestimated. The results indicate that beside aerosol sulfate and organics also aerosol ammonium and nitrate significantly contribute to aerosol water uptake. The simulated day-to-day variability of AOT follows synoptic scale advection of humidity rather than particle concentration. Even for relatively dry conditions AOT appears to be strongly influenced by the diurnal cycle of RH in the lower boundary layer, further enhanced by uptake and release of nitric acid and ammonia by aerosol water.
MELCOR aerosol transport module modification for NSSR-1
International Nuclear Information System (INIS)
Merrill, B.J.; Hagrman, D.L.
1996-03-01
This report describes modifications of the MELCOR computer code aerosol transport module that will increase the accuracy of calculations for safety analysis of the International Thermonuclear Experimental Reactor (ITER). The modifications generalize aerosol deposition models to consider gases other than air, add specialized models for aerosol deposition during high speed gas flows in ducts, and add models for resuspension of aerosols that are entrained in coolants when these coolants flash. Particular attention has been paid to the adhesion of aerosol particles once they are transported to duct walls. The results of calculations with the modified models have been successfully compared to data from Light Water Reactor Aerosol Containment Experiments (LACE) conducted by an international consortium at Hanford, Washington
Holben, B. N.; Tanre, D.; Reagan, J. A.; Eck, T. F.; Setzer, A.; Kaufman, Y. A.; Vermote, E.; Vassiliou, G. D.; Lavenu, F.
1992-01-01
A new generation of automatic sunphotometers is used to systematically monitor clear sky total column aerosol concentration and optical properties, precipitable water and total column ozone diurnally and annually in West Africa and South America. The instruments are designed to measure direct beam sun, solar aureole and sky radiances in nine narrow spectral bands from the UV to the near infrared on an hourly basis. The instrumentation and the algorithms required to reduce the data for subsequent analysis are described.
Elucidating determinants of aerosol composition through particle-type-based receptor modeling
McGuire, M. L.; Jeong, C.-H.; Slowik, J. G.; Chang, R. Y.-W.; Corbin, J. C.; Lu, G.; Mihele, C.; Rehbein, P. J. G.; Sills, D. M. L.; Abbatt, J. P. D.; Brook, J. R.; Evans, G. J.
2011-08-01
An aerosol time-of-flight mass spectrometer (ATOFMS) was deployed at a semi-rural site in southern Ontario to characterize the size and chemical composition of individual particles. Particle-type-based receptor modelling of these data was used to investigate the determinants of aerosol chemical composition in this region. Individual particles were classified into particle-types and positive matrix factorization (PMF) was applied to their temporal trends to separate and cross-apportion particle-types to factors. The extent of chemical processing for each factor was assessed by evaluating the internal and external mixing state of the characteristic particle-types. The nine factors identified helped to elucidate the coupled interactions of these determinants. Nitrate-laden dust was found to be the dominant type of locally emitted particles measured by ATOFMS. Several factors associated with aerosol transported to the site from intermediate local-to-regional distances were identified: the Organic factor was associated with a combustion source to the north-west; the ECOC Day factor was characterized by nearby local-to-regional carbonaceous emissions transported from the south-west during the daytime; and the Fireworks factor consisted of pyrotechnic particles from the Detroit region following holiday fireworks displays. Regional aerosol from farther emissions sources was reflected through three factors: two Biomass Burning factors and a highly chemically processed Long Range Transport factor. The Biomass Burning factors were separated by PMF due to differences in chemical processing which were in part elucidated by the passage of two thunderstorm gust fronts with different air mass histories. The remaining two factors, ECOC Night and Nitrate Background, represented the night-time partitioning of nitrate to pre-existing particles of different origins. The distinct meteorological conditions observed during this month-long study in the summer of 2007 provided a unique
Directory of Open Access Journals (Sweden)
H. Che
2018-01-01
Full Text Available Aerosol pollution in eastern China is an unfortunate consequence of the region's rapid economic and industrial growth. Here, sun photometer measurements from seven sites in the Yangtze River Delta (YRD from 2011 to 2015 were used to characterize the climatology of aerosol microphysical and optical properties, calculate direct aerosol radiative forcing (DARF and classify the aerosols based on size and absorption. Bimodal size distributions were found throughout the year, but larger volumes and effective radii of fine-mode particles occurred in June and September due to hygroscopic growth and/or cloud processing. Increases in the fine-mode particles in June and September caused AOD440 nm > 1.00 at most sites, and annual mean AOD440 nm values of 0.71–0.76 were found at the urban sites and 0.68 at the rural site. Unlike northern China, the AOD440 nm was lower in July and August (∼ 0.40–0.60 than in January and February (0.71–0.89 due to particle dispersion associated with subtropical anticyclones in summer. Low volumes and large bandwidths of both fine-mode and coarse-mode aerosol size distributions occurred in July and August because of biomass burning. Single-scattering albedos at 440 nm (SSA440 nm from 0.91 to 0.94 indicated particles with relatively strong to moderate absorption. Strongly absorbing particles from biomass burning with a significant SSA wavelength dependence were found in July and August at most sites, while coarse particles in March to May were mineral dust. Absorbing aerosols were distributed more or less homogeneously throughout the region with absorption aerosol optical depths at 440 nm ∼ 0.04–0.06, but inter-site differences in the absorption Angström exponent indicate a degree of spatial heterogeneity in particle composition. The annual mean DARF was −93 ± 44 to −79 ± 39 W m−2 at the Earth's surface and ∼ −40 W m−2 at the top of the atmosphere (for
An Operational Framework for Insecticide Resistance Management Planning.
Chanda, Emmanuel; Thomsen, Edward K; Musapa, Mulenga; Kamuliwo, Mulakwa; Brogdon, William G; Norris, Douglas E; Masaninga, Freddie; Wirtz, Robert; Sikaala, Chadwick H; Muleba, Mbanga; Craig, Allen; Govere, John M; Ranson, Hilary; Hemingway, Janet; Seyoum, Aklilu; Macdonald, Michael B; Coleman, Michael
2016-05-01
Arthropod vectors transmit organisms that cause many emerging and reemerging diseases, and their control is reliant mainly on the use of chemical insecticides. Only a few classes of insecticides are available for public health use, and the increased spread of insecticide resistance is a major threat to sustainable disease control. The primary strategy for mitigating the detrimental effects of insecticide resistance is the development of an insecticide resistance management plan. However, few examples exist to show how to implement such plans programmatically. We describe the formulation and implementation of a resistance management plan for mosquito vectors of human disease in Zambia. We also discuss challenges, steps taken to address the challenges, and directions for the future.
Knodel, Janet J; Olson, Denise L; Hanson, Bryan K; Henson, Robert A
2008-06-01
Integration of cultural practices, such as planting date with insecticide-based strategies, was investigated to determine best management strategy for flea beetles (Phyllotreta spp.) (Coleoptera: Chrysomelidae) in canola (Brassica napus L.). We studied the effect of two spring planting dates of B. napus and different insecticide-based management strategies on the feeding injury caused by fleabeetles in North Dakota during 2002-2003. Adult beetle peak emergence usually coincided with the emergence of the early planted canola, and this resulted in greater feeding injury in the early planted canola than later planted canola. Use of late-planted canola may have limited potential for cultural control of flea beetle, because late-planted canola is at risk for yield loss due to heat stress during flowering. Flea beetle injury ratings declined when 1) the high rate of insecticide seed treatment plus a foliar insecticide applied 21 d after planting was used, 2) the high rate of insecticide seed treatment only was used, or 3) two foliar insecticide sprays were applied. These insecticide strategies provided better protection than the low rates of insecticide seed treatments or a single foliar spray, especially in areas with moderate-to-high flea beetle populations. The foliar spray on top of the seed treatment controlled later-emerging flea beetles as the seed treatment residual was diminishing and the crop became vulnerable to feeding injury. The best insecticide strategy for management of flea beetle was the high rate of insecticide seed treatment plus a foliar insecticide applied at 21 d after planting, regardless of planting date.
Energy Technology Data Exchange (ETDEWEB)
Marty, J C; Saliot, A; Tissier, M J
1978-03-20
Hydrocarbons have been analyzed in several samples from ''Midlante'' cruise, Cape Verde islands-Canary islands, in the Eastern tropical Atlantic: subsurface water, sea surface microlayer collected by a metallic screen and aerosols collected by filtration of large air volumes at about 12 m. above the sea surface. Detailed analysis of aliphatic and polyaromatic hydrocarbons has been made by computerized gas chromatography/mass spectrometry. This study of the air/sea interface indicates a discontinuity in hydrocarbon composition between the underlying water and the microlayer and a similarity between the surface microlayer and the aerosols. The origin of the collected aerosols is essentially marine with a minor terrestrial contribution. The hydrocarbon pattern shows that, superimposed on the typical marine components, a contribution from smokes of natural and industrial origin and/or from pollution associated with crude oil sea slicks is present.
Insecticide susceptibility status of human biting mosquitoes in ...
African Journals Online (AJOL)
Background: There has been a rapid emergence in insecticide resistance among mosquito population to commonly used public health insecticides. This situation presents a challenge to chemicals that are currently used to control mosquitoes in sub-Saharan African. Furthermore, there is limited information on insecticide ...
Estimation of Uncertainty in Aerosol Concentration Measured by Aerosol Sampling System
Energy Technology Data Exchange (ETDEWEB)
Lee, Jong Chan; Song, Yong Jae; Jung, Woo Young; Lee, Hyun Chul; Kim, Gyu Tae; Lee, Doo Yong [FNC Technology Co., Yongin (Korea, Republic of)
2016-10-15
FNC Technology Co., Ltd has been developed test facilities for the aerosol generation, mixing, sampling and measurement under high pressure and high temperature conditions. The aerosol generation system is connected to the aerosol mixing system which injects SiO{sub 2}/ethanol mixture. In the sampling system, glass fiber membrane filter has been used to measure average mass concentration. Based on the experimental results using main carrier gas of steam and air mixture, the uncertainty estimation of the sampled aerosol concentration was performed by applying Gaussian error propagation law. FNC Technology Co., Ltd. has been developed the experimental facilities for the aerosol measurement under high pressure and high temperature. The purpose of the tests is to develop commercial test module for aerosol generation, mixing and sampling system applicable to environmental industry and safety related system in nuclear power plant. For the uncertainty calculation of aerosol concentration, the value of the sampled aerosol concentration is not measured directly, but must be calculated from other quantities. The uncertainty of the sampled aerosol concentration is a function of flow rates of air and steam, sampled mass, sampling time, condensed steam mass and its absolute errors. These variables propagate to the combination of variables in the function. Using operating parameters and its single errors from the aerosol test cases performed at FNC, the uncertainty of aerosol concentration evaluated by Gaussian error propagation law is less than 1%. The results of uncertainty estimation in the aerosol sampling system will be utilized for the system performance data.
Nunes, G S; Lins, J A P; Silva, F G S; Araujo, L C; Silva, F E P S; Mendonça, C D; Badea, M; Hayat, A; Marty, J-L
2014-09-01
The immobilization of enzymes onto transducer support is a mature technology and has been successfully implemented to improve biocatalytic processes for diverse applications. However, there exists still need to design more sophisticated and specialized strategies to enhance the functional properties of the biosensors. In this work, a biosensor platform based on innovative fabrication strategy was designed, and employed for the detection of organophosphate (OP) in natural waters. The biosensor was prepared by incorporating acetylcholinesterase enzyme (AChE) to the graphite paste modified with tetracyanoquinodimethane (TCNQ) mediator, along with the use of a macroalgae (Cladaphropsis membranous) as a functional immobilization support. The novel immobilization design resulted in a synergic effect, and led to enhanced stability and sensitivity of the biosensor. The designed biosensor was used to analyze methyl parathion OP insecticide in water samples collected from a demonstrably contaminated lake of São Luis Island, Maranhão, Northeast of Brazil. Water analysis revealed that the aquatic ecosystem was polluted by sub-ppm concentrations of the OP insecticide, and a good correlation was found between values obtained through biosensor and GC-MS techniques. Our results demonstrated that macroalgae-biosensor could be used as a low-cost and sensitive screening method to detect target analyte. Copyright © 2014 Elsevier Ltd. All rights reserved.
Kleinschmidt, Immo; Bradley, John; Knox, Tessa Bellamy; Mnzava, Abraham Peter; Kafy, Hmooda Toto; Mbogo, Charles; Ismail, Bashir Adam; Bigoga, Jude D; Adechoubou, Alioun; Raghavendra, Kamaraju; Cook, Jackie; Malik, Elfatih M; Nkuni, Zinga José; Macdonald, Michael; Bayoh, Nabie; Ochomo, Eric; Fondjo, Etienne; Awono-Ambene, Herman Parfait; Etang, Josiane; Akogbeto, Martin; Bhatt, Rajendra M; Chourasia, Mehul Kumar; Swain, Dipak K; Kinyari, Teresa; Subramaniam, Krishanthi; Massougbodji, Achille; Okê-Sopoh, Mariam; Ogouyemi-Hounto, Aurore; Kouambeng, Celestin; Abdin, Mujahid Sheikhedin; West, Philippa; Elmardi, Khalid; Cornelie, Sylvie; Corbel, Vincent; Valecha, Neena; Mathenge, Evan; Kamau, Luna; Lines, Jonathan; Donnelly, Martin James
2018-04-09
Scale-up of insecticide-based interventions has averted more than 500 million malaria cases since 2000. Increasing insecticide resistance could herald a rebound in disease and mortality. We aimed to investigate whether insecticide resistance was associated with loss of effectiveness of long-lasting insecticidal nets and increased malaria disease burden. This WHO-coordinated, prospective, observational cohort study was done at 279 clusters (villages or groups of villages in which phenotypic resistance was measurable) in Benin, Cameroon, India, Kenya, and Sudan. Pyrethroid long-lasting insecticidal nets were the principal form of malaria vector control in all study areas; in Sudan this approach was supplemented by indoor residual spraying. Cohorts of children from randomly selected households in each cluster were recruited and followed up by community health workers to measure incidence of clinical malaria and prevalence of infection. Mosquitoes were assessed for susceptibility to pyrethroids using the standard WHO bioassay test. Country-specific results were combined using meta-analysis. Between June 2, 2012, and Nov 4, 2016, 40 000 children were enrolled and assessed for clinical incidence during 1·4 million follow-up visits. 80 000 mosquitoes were assessed for insecticide resistance. Long-lasting insecticidal net users had lower infection prevalence (adjusted odds ratio [OR] 0·63, 95% CI 0·51-0·78) and disease incidence (adjusted rate ratio [RR] 0·62, 0·41-0·94) than did non-users across a range of resistance levels. We found no evidence of an association between insecticide resistance and infection prevalence (adjusted OR 0·86, 0·70-1·06) or incidence (adjusted RR 0·89, 0·72-1·10). Users of nets, although significantly better protected than non-users, were nevertheless subject to high malaria infection risk (ranging from an average incidence in net users of 0·023, [95% CI 0·016-0·033] per person-year in India, to 0·80 [0·65-0·97] per person
Ocko, Ilissa B.; Ginoux, Paul A.
2017-04-01
Anthropogenic aerosols are a key factor governing Earth's climate and play a central role in human-caused climate change. However, because of aerosols' complex physical, optical, and dynamical properties, aerosols are one of the most uncertain aspects of climate modeling. Fortunately, aerosol measurement networks over the past few decades have led to the establishment of long-term observations for numerous locations worldwide. Further, the availability of datasets from several different measurement techniques (such as ground-based and satellite instruments) can help scientists increasingly improve modeling efforts. This study explores the value of evaluating several model-simulated aerosol properties with data from spatially collocated instruments. We compare aerosol optical depth (AOD; total, scattering, and absorption), single-scattering albedo (SSA), Ångström exponent (α), and extinction vertical profiles in two prominent global climate models (Geophysical Fluid Dynamics Laboratory, GFDL, CM2.1 and CM3) to seasonal observations from collocated instruments (AErosol RObotic NETwork, AERONET, and Cloud-Aerosol Lidar with Orthogonal Polarization, CALIOP) at seven polluted and biomass burning regions worldwide. We find that a multi-parameter evaluation provides key insights on model biases, data from collocated instruments can reveal underlying aerosol-governing physics, column properties wash out important vertical distinctions, and improved models does not mean all aspects are improved. We conclude that it is important to make use of all available data (parameters and instruments) when evaluating aerosol properties derived by models.
Characteristics and composition of atmospheric aerosols in Phimai, central Thailand during BASE-ASIA
Li, Can; Tsay, Si-Chee; Hsu, N. Christina; Kim, Jin Young; Howell, Steven G.; Huebert, Barry J.; Ji, Qiang; Jeong, Myeong-Jae; Wang, Sheng-Hsiang; Hansell, Richard A.; Bell, Shaun W.
2013-10-01
Comprehensive measurements of atmospheric aerosols were made in Phimai, central Thailand (15.183°N, 102.565°E, elevation: 206 m) during the BASE-ASIA field experiment from late February to early May in 2006. The observed aerosol loading was sizable for this rural site (mean aerosol scattering: 108 ± 64 Mm-1; absorption: 15 ± 8 Mm-1; PM10 concentration: 33 ± 17 μg m-3), and dominated by submicron particles. Major aerosol compounds included carbonaceous (OC: 9.5 ± 3.6 μg m-3; EC: 2.0 ± 2.3 μg m-3) and secondary species (SO42-: 6.4 ± 3.7 μg m-3, NH4+: 2.2 ± 1.3 μg m-3). While the site was seldom under the direct influence of large forest fires to its north, agricultural fires were ubiquitous during the experiment, as suggested by the substantial concentration of K+ (0.56 ± 0.33 μg m-3). Besides biomass burning, aerosols in Phimai during the experiment were also strongly influenced by industrial and vehicular emissions from the Bangkok metropolitan region and long-range transport from southern China. High humidity played an important role in determining the aerosol composition and properties in the region. Sulfate was primarily formed via aqueous phase reactions, and hygroscopic growth could enhance the aerosol light scattering by up to 60%, at the typical morning RH level of 85%. The aerosol single scattering albedo demonstrated distinct diurnal variation, ranging from 0.86 ± 0.04 in the evening to 0.92 ± 0.02 in the morning. This experiment marks the first time such comprehensive characterization of aerosols was made for rural central Thailand. Our results indicate that aerosol pollution has developed into a regional problem for northern Indochina, and may become more severe as the region's population and economy continue to grow.
Bisset, Juan Andrés; Rodríguez, María Magdalena; French, Leydis; Severson, David W; Gutiérrez, Gladys; Hurtado, Daymi; Fuentes, Ilario
2014-12-01
Studies were conducted to compare levels of insecticide resistance and to determine the metabolic resistance mechanisms in larval and adult stages of Aedes aegypti from Cuba. Three insecticide-resistant reference strains of Ae. aegypti from Cuba were examined. These strains were derived from a Santiago de Cuba strain isolated in 1997; it was previously subjected to a strong selection for resistance to temephos (SAN-F6), deltamethrin (SAN-F12), and propoxur (SAN-F13) and routinely maintained in the laboratory under selection pressure up to the present time, when the study was carried out. In addition, an insecticide-susceptible strain was used for comparison. The insecticide resistance in larvae and adults was determined using standard World Health Organization methodologies. Insecticide resistance mechanisms were determined by biochemical assays. The esterases (α EST and β EST) and mixed function oxidase (MFO) activities were significantly higher in adults than in the larvae of the three resistant strains studied. The association of resistance level with the biochemical mechanism for each insecticide was established for each stage. The observed differences between larval and adult stages of Ae. aegypti in their levels of insecticide resistance and the biochemical mechanisms involved should be included as part of monitoring and surveillance activities in Ae. aegypti vector control programs.
Is Apis mellifera more sensitive to insecticides than other insects?
Hardstone, Melissa C; Scott, Jeffrey G
2010-11-01
Honey bees (Apis mellifera L.) are among the most important pollinators in natural and agricultural settings. They commonly encounter insecticides, and the effects of insecticides on honey bees have been frequently noted. It has been suggested that honey bees may be (as a species) uniquely sensitive to insecticides, although no comparative toxicology study has been undertaken to examine this claim. An extensive literature review was conducted, using data in which adult insects were topically treated with insecticides. The goal of this review was to summarize insecticide toxicity data between A. mellifera and other insects to determine the relative sensitivity of honey bees to insecticides. It was found that, in general, honey bees were no more sensitive than other insect species across the 62 insecticides examined. In addition, honey bees were not more sensitive to any of the six classes of insecticides (carbamates, nicotinoids, organochlorines, organophosphates, pyrethroids and miscellaneous) examined. While honey bees can be sensitive to individual insecticides, they are not a highly sensitive species to insecticides overall, or even to specific classes of insecticides. However, all pesticides should be used in a way that minimizes honey bee exposure, so as to minimize possible declines in the number of bees and/or honey contamination. Copyright © 2010 Society of Chemical Industry.
International Nuclear Information System (INIS)
Duarte, Regina M.B.O.; Pio, Casimiro A.; Duarte, Armando C.
2005-01-01
The composition of the water-soluble organic matter from fine aerosols collected in a rural location during two different meteorological conditions (summer and autumn) was investigated by UV-vis, synchronous fluorescence (with Δλ = 20 nm), FT-IR and CPMAS- 13 C NMR spectroscopies. A seasonal variation in the concentration of total carbon, organic carbon and water-soluble organic carbon was confirmed, with higher values during the autumn and lower values during the summer season. The chemical characterisation of the water-soluble organic matter showed that both samples are dominated by a high content of aliphatic structures, carboxyl groups and aliphatic carbons single bonded to one oxygen or nitrogen atom. However, the autumn sample exhibits a higher aromatic content than the summer sample, plus signals due to carbons of phenol, ketones and methoxyl groups. These signals were attributed to lignin breakdown products which are likely to be released during wood combustion processes. The obtained results put into evidence the major contribution of biomass burning processes in domestic fireplaces during low temperature conditions into both the concentration and the bulk chemical properties of the WSOC from fine aerosols
Optimal Cotton Insecticide Application Termination Timing: A Meta-Analysis.
Griffin, T W; Zapata, S D
2016-08-01
The concept of insecticide termination timing is generally accepted among cotton (Gossypium hirsutum) researchers; however, exact timings are often disputed. Specifically, there is uncertainty regarding the last economic insecticide application to control fruit-feeding pests including tarnished plant bug (Lygus lineolaris (Palisot de Beauvois)), boll weevil (Anthonomus grandis), bollworm (Helicoverpa zea), tobacco budworm (Heliothis virescens), and cotton fleahopper (Pseudatomoscelis seriatus). A systematic review of prior studies was conducted within a meta-analytic framework. Nine publicly available articles were amalgamated to develop an optimal timing principle. These prior studies reported 53 independent multiple means comparison field experiments for a total of 247 trial observations. Stochastic plateau theory integrated with econometric meta-analysis methodology was applied to the meta-database to determine the shape of the functional form of both the agronomic optimal insecticide termination timing and corresponding yield potential. Results indicated that current university insecticide termination timing recommendations are later than overall estimated timing suggested. The estimated 159 heat units (HU) after the fifth position above white flower (NAWF5) was found to be statistically different than the 194 HU termination used as the status quo recommended termination timing. Insecticides applied after 159 HU may have been applied in excess, resulting in unnecessary economic and environmental costs. Empirical results also suggested that extending the insecticide termination time by one unit resulted in a cotton lint yield increase of 0.27 kilograms per hectare up to the timing where the plateau began. Based on economic analyses, profit-maximizing producers may cease application as soon as 124 HU after NAWF5. These results provided insights useful to improve production systems by applying inputs only when benefits were expected to be in excess of the
Aerosol and monsoon climate interactions over Asia: AEROSOL AND MONSOON CLIMATE INTERACTIONS
Energy Technology Data Exchange (ETDEWEB)
Li, Zhanqing [State Key Laboratory of Earth Surface Processes and Resource Ecology and College of Global Change and Earth System Science, Beijing Normal University, Beijing China; Department of Atmospheric and Oceanic Science and ESSIC, University of Maryland, College Park Maryland USA; Lau, W. K. -M. [Department of Atmospheric and Oceanic Science and ESSIC, University of Maryland, College Park Maryland USA; Ramanathan, V. [Department of Atmospheric and Climate Sciences, University of California, San Diego California USA; Wu, G. [Institute of Atmospheric Physics, Chinese Academy of Sciences, Beijing China; Ding, Y. [National Climate Center, China Meteorological Administration, Beijing China; Manoj, M. G. [Department of Atmospheric and Oceanic Science and ESSIC, University of Maryland, College Park Maryland USA; Liu, J. [Department of Atmospheric and Oceanic Science and ESSIC, University of Maryland, College Park Maryland USA; Qian, Y. [Pacific Northwest National Laboratory, Richland Washington USA; Li, J. [State Key Laboratory of Earth Surface Processes and Resource Ecology and College of Global Change and Earth System Science, Beijing Normal University, Beijing China; Zhou, T. [Institute of Atmospheric Physics, Chinese Academy of Sciences, Beijing China; Fan, J. [Pacific Northwest National Laboratory, Richland Washington USA; Rosenfeld, D. [Institute of Earth Sciences, Hebrew University, Jerusalem Israel; Ming, Y. [Geophysical Fluid Dynamic Laboratory, NOAA, Princeton New Jersey USA; Wang, Y. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena California USA; Huang, J. [College of Atmospheric Sciences, Lanzhou University, Lanzhou China; Wang, B. [Department of Atmospheric Sciences, University of Hawaii, Honolulu Hawaii USA; School of Atmospheric Physics, Nanjing University of Information Science and Technology, Nanjing China; Xu, X. [Chinese Academy of Meteorological Sciences, Beijing China; Lee, S. -S. [Department of Atmospheric and Oceanic Science and ESSIC, University of Maryland, College Park Maryland USA; Cribb, M. [Department of Atmospheric and Oceanic Science and ESSIC, University of Maryland, College Park Maryland USA; Zhang, F. [State Key Laboratory of Earth Surface Processes and Resource Ecology and College of Global Change and Earth System Science, Beijing Normal University, Beijing China; Yang, X. [State Key Laboratory of Earth Surface Processes and Resource Ecology and College of Global Change and Earth System Science, Beijing Normal University, Beijing China; Zhao, C. [State Key Laboratory of Earth Surface Processes and Resource Ecology and College of Global Change and Earth System Science, Beijing Normal University, Beijing China; Takemura, T. [Research Institute for Applied Mechanics, Kyushu University, Fukuoka Japan; Wang, K. [State Key Laboratory of Earth Surface Processes and Resource Ecology and College of Global Change and Earth System Science, Beijing Normal University, Beijing China; Xia, X. [Institute of Atmospheric Physics, Chinese Academy of Sciences, Beijing China; Yin, Y. [School of Atmospheric Physics, Nanjing University of Information Science and Technology, Nanjing China; Zhang, H. [National Climate Center, China Meteorological Administration, Beijing China; Guo, J. [Chinese Academy of Meteorological Sciences, Beijing China; Zhai, P. M. [Chinese Academy of Meteorological Sciences, Beijing China; Sugimoto, N. [National Institute for Environmental Studies, Tsukuba Japan; Babu, S. S. [Space Physics Laboratory, Vikram Sarabhai Space Centre, Thiruvananthapuram India; Brasseur, G. P. [Max Planck Institute for Meteorology, Hamburg Germany
2016-11-15
Asian monsoons and aerosols have been studied extensively which are intertwined in influencing the climate of Asia. This paper provides a comprehensive review of ample studies on Asian aerosol, monsoon and their interactions. The region is the primary source of aerosol emissions of varies species, influenced by distinct weather and climatic regimes. On continental scale, aerosols reduce surface insolation and weaken the land-ocean thermal contrast, thus inhibiting the development of monsoons. Locally, aerosol radiative effects alter the thermodynamic stability and convective potential of the lower atmosphere leading to reduced temperatures, increased atmospheric stability, and weakened wind and atmospheric circulation. The atmospheric thermodynamic state may also be altered by the aerosol serving as cloud condensation nuclei or ice nuclei. Many mechanisms have been put forth regarding how aerosols modulate the amplitude, frequency, intensity, and phase of numerous monsoon climate variables. A wide range of theoretical, observational, and modeling findings on the Asian monsoon, aerosols, and their interactions are synthesized. A new paradigm is proposed on investigating aerosol-monsoon interactions, in which natural aerosols such as desert dust, black carbon from biomass burning, and biogenic aerosols from vegetation are considered integral components of an intrinsic aerosol-monsoon climate system, subject to external forcings of global warming, anthropogenic aerosols, and land use and change. Future research on aerosol-monsoon interactions calls for an integrated approach and international collaborations based on long-term sustained observations, process measurements, and improved models, as well as using observations to constrain model simulations and projections.
Warsito; Utomo, EP; Ulfa, SM; Kholila, BN; Nindyasiwi, P.
2018-01-01
Sustainable agricultural applications in green chemistry was associated with the development of insecticide production based on secondary metabolites, such as essential oils. This research used In Silico modeling for insecticide formulation based on essential oils. The insecticidal formula was made on the basis of the Ki value of multiple docking results between the major components of essential oils as ligand with Spodotera litura receptor (2DJC) studied using Autodock Tools software. Insecticide formula activity test was done by contact method of toxic and leaf contact with essential oils concentration at level 0% - 1%. The results of the in silico study showed that the inhibition constants (Ki) of citronellal and anethol ligands combination were 1.6 mM however of citronellal and eugenol as ligands were 1.75 mM and formulated rasio (v/v), respectively 5 : 1 and 4 : 1. In addition, in vitro activity of insecticide formula with the ratio of 5: 1 possess LC50 value 0.10% (toxic contact) and 0.35% (leaf contact). While the formula with a ratio of 4: 1 possess LC50 value 0.05% (toxic contacts) and 0.31% (leaf contact).
Global simulations of aerosol processing in clouds
Directory of Open Access Journals (Sweden)
C. Hoose
2008-12-01
Full Text Available An explicit and detailed representation of in-droplet and in-crystal aerosol particles in stratiform clouds has been introduced in the global aerosol-climate model ECHAM5-HAM. The new scheme allows an evaluation of the cloud cycling of aerosols and an estimation of the relative contributions of nucleation and collision scavenging, as opposed to evaporation of hydrometeors in the global aerosol processing by clouds. On average an aerosol particle is cycled through stratiform clouds 0.5 times. The new scheme leads to important changes in the simulated fraction of aerosol scavenged in clouds, and consequently in the aerosol wet deposition. In general, less aerosol is scavenged into clouds with the new prognostic treatment than what is prescribed in standard ECHAM5-HAM. Aerosol concentrations, size distributions, scavenged fractions and cloud droplet concentrations are evaluated and compared to different observations. While the scavenged fraction and the aerosol number concentrations in the marine boundary layer are well represented in the new model, aerosol optical thickness, cloud droplet number concentrations in the marine boundary layer and the aerosol volume in the accumulation and coarse modes over the oceans are overestimated. Sensitivity studies suggest that a better representation of below-cloud scavenging, higher in-cloud collision coefficients, or a reduced water uptake by seasalt aerosols could reduce these biases.
Behavior of aerosols in a steam-air environment
International Nuclear Information System (INIS)
Adams, R.E.; Tobias, M.L.; Longest, A.W.
1985-01-01
The behavior of aerosols assumed to be characteristic of those generated during light water reactor (LWR) accident sequences and released into containment is being studied in the Nuclear Safety Pilot Plant (NSPP) which is located at the Oak Ridge National Laboratory (ORNL). The program plan for the NSPP aerosol project provides for the study of the behavior, within containment, of simulated LWR accident aerosols emanating from fuel, reactor core structural materials, and from concrete-molten core materials interactions. The aerodynamic behavior of each of these aerosols was studied individually to establish its characteristics; current experiments involve mixtures of these aerosols to establish their interaction and collective behavior within containment. Tests have been conducted with U 3 O 8 aerosols, Fe 2 O 3 aerosols, and concrete aerosols in an environment of either dry air [relative humidity (RH) less than 20%] or steam-air [relative humidity (RH) approximately 100%] with aerosol mass concentration being the primary experimental variable
Ahmad, Ziauddin; Franz, Bryan A.; McClain, Charles R.; Kwiatkowska, Ewa J.; Werdell, Jeremy; Shettle, Eric P.; Holben, Brent N.
2010-01-01
We describe the development of a new suite of aerosol models for the retrieval of atmospheric and oceanic optical properties from the SeaWiFs and MODIS sensors, including aerosol optical thickness (tau), angstrom coefficient (alpha), and water-leaving radiance (L(sub w)). The new aerosol models are derived from Aerosol Robotic Network (AERONET) observations and have bimodal lognormal distributions that are narrower than previous models used by the Ocean Biology Processing Group. We analyzed AERONET data over open ocean and coastal regions and found that the seasonal variability in the modal radii, particularly in the coastal region, was related to the relative humidity, These findings were incorporated into the models by making the modal radii, as well as the refractive indices, explicitly dependent on relative humidity, From those findings, we constructed a new suite of aerosol models. We considered eight relative humidity values (30%, 50%, 70%, 75%, 80%, 85%, 90%. and 95%) and, for each relative humidity value, we constructed ten distributions by varying the fine-mode fraction from zero to 1. In all. 80 distributions (8Rh x 10 fine-mode fractions) were created to process the satellite data. We. also assumed that the coarse-mode particles were nonabsorbing (sea salt) and that all observed absorptions were entirely due to fine-mode particles. The composition of fine mode was varied to ensure that the new models exhibited the same spectral dependence of single scattering albedo as observed in the AERONET data,
ARM Cloud-Aerosol-Precipitation Experiment (ACAPEX) Field Campaign Report
Energy Technology Data Exchange (ETDEWEB)
Leung, L Ruby [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2016-03-01
The U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility’s ARM Cloud-Aerosol-Precipitation Experiment (ACAPEX) field campaign contributes to CalWater 2015, a multi-agency field campaign that aims to improve understanding of atmospheric rivers and aerosol sources and transport that influence cloud and precipitation processes. The ultimate goal is to reduce uncertainties in weather predictions and climate projections of droughts and floods in California. With the DOE G-1 aircraft and ARM Mobile Facility 2 (AMF2) well equipped for making aerosol and cloud measurements, ACAPEX focuses specifically on understanding how aerosols from local pollution and long-range transport affect the amount and phase of precipitation associated with atmospheric rivers. ACAPEX took place between January 12, 2015 and March 8, 2015 as part of CalWater 2015, which included four aircraft (DOE G-1, National Oceanic and Atmospheric Administration [NOAA] G-IV and P-3, and National Aeronautics and Space Administration [NASA] ER-2), the NOAA research ship Ron Brown, carrying onboard the AMF2, National Science Foundation (NSF)-sponsored aerosol and precipitation measurements at Bodega Bay, and the California Department of Water Resources extreme precipitation network.
A simplified model of aerosol removal by natural processes in reactor containments
Energy Technology Data Exchange (ETDEWEB)
Powers, D.A.; Washington, K.E.; Sprung, J.L. [Sandia National Labs., Albuquerque, NM (United States); Burson, S.B. [Nuclear Regulatory Commission, Washington, DC (United States)
1996-07-01
Simplified formulae are developed for estimating the aerosol decontamination that can be achieved by natural processes in the containments of pressurized water reactors and in the drywells of boiling water reactors under severe accident conditions. These simplified formulae were derived by correlation of results of Monte Carlo uncertainty analyses of detailed models of aerosol behavior under accident conditions. Monte Carlo uncertainty analyses of decontamination by natural aerosol processes are reported for 1,000, 2,000, 3,000, and 4,000 MW(th) pressurized water reactors and for 1,500, 2,500, and 3,500 MW(th) boiling water reactors. Uncertainty distributions for the decontamination factors and decontamination coefficients as functions of time were developed in the Monte Carlo analyses by considering uncertainties in aerosol processes, material properties, reactor geometry and severe accident progression. Phenomenological uncertainties examined in this work included uncertainties in aerosol coagulation by gravitational collision, Brownian diffusion, turbulent diffusion and turbulent inertia. Uncertainties in aerosol deposition by gravitational settling, thermophoresis, diffusiophoresis, and turbulent diffusion were examined. Electrostatic charging of aerosol particles in severe accidents is discussed. Such charging could affect both the coagulation and deposition of aerosol particles. Electrostatic effects are not considered in most available models of aerosol behavior during severe accidents and cause uncertainties in predicted natural decontamination processes that could not be taken in to account in this work. Median (50%), 90 and 10% values of the uncertainty distributions for effective decontamination coefficients were correlated with time and reactor thermal power. These correlations constitute a simplified model that can be used to estimate the decontamination by natural aerosol processes at 3 levels of conservatism. Applications of the model are described.
Hoffmann, Fabian
2017-07-01
Activation is necessary to form a cloud droplet from an aerosol, and it is widely accepted that it occurs as soon as a wetted aerosol grows beyond its critical radius. Traditional Köhler theory assumes that this growth is driven by the diffusion of water vapor. However, if the wetted aerosols are large enough, the coalescence of two or more particles is an additional process for accumulating sufficient water for activation. This transition from diffusional to collectional growth marks the limit of traditional Köhler theory and it is studied using a Lagrangian cloud model in which aerosols and cloud droplets are represented by individually simulated particles within large-eddy simulations of shallow cumuli. It is shown that the activation of aerosols larger than 0. 1 µm in dry radius can be affected by collision and coalescence, and its contribution increases with a power-law relation toward larger radii and becomes the only process for the activation of aerosols larger than 0. 4-0. 8 µm depending on aerosol concentration. Due to the natural scarcity of the affected aerosols, the amount of aerosols that are activated by collection is small, with a maximum of 1 in 10 000 activations. The fraction increases as the aerosol concentration increases, but decreases again as the number of aerosols becomes too high and the particles too small to cause collections. Moreover, activation by collection is found to affect primarily aerosols that have been entrained above the cloud base.
Uchigashima, Mikiko; Watanabe, Eiki; Ito, Shigekazu; Iwasa, Seiji; Miyake, Shiro
2012-01-01
Enzyme-linked immunosorbent assay (ELISA) based on a monoclonal antibody (MoAb) was developed for the neonicotinoid insecticide clothianidin. A new clothianidin hapten (3-[5-(3-methyl-2-nitroguanidinomethyl)-1,3-thiazol-2-ylthio] propionic acid) was synthesized and conjugated to keyhole limpet hemocyanin, and was used for monoclonal antibody preparation. The resulting MoAb CTN-16A3-13 was characterized by a direct competitive ELISA (dc-ELISA). The 50% of inhibition concentration value with cl...
Identification of aerosol types over an urban site based on air-mass trajectory classification
Pawar, G. V.; Devara, P. C. S.; Aher, G. R.
2015-10-01
Columnar aerosol properties retrieved from MICROTOPS II Sun Photometer measurements during 2010-2013 over Pune (18°32‧N; 73°49‧E, 559 m amsl), a tropical urban station in India, are analyzed to identify aerosol types in the atmospheric column. Identification/classification is carried out on the basis of dominant airflow patterns, and the method of discrimination of aerosol types on the basis of relation between aerosol optical depth (AOD500 nm) and Ångström exponent (AE, α). Five potential advection pathways viz., NW/N, SW/S, N, SE/E and L have been identified over the observing site by employing the NOAA-HYSPLIT air mass back trajectory analysis. Based on AE against AOD500 nm scatter plot and advection pathways followed five major aerosol types viz., continental average (CA), marine continental average (MCA), urban/industrial and biomass burning (UB), desert dust (DD) and indeterminate or mixed type (MT) have been identified. In winter, sector SE/E, a representative of air masses traversed over Bay of Bengal and Eastern continental Indian region has relatively small AOD (τpλ = 0.43 ± 0.13) and high AE (α = 1.19 ± 0.15). These values imply the presence of accumulation/sub-micron size anthropogenic aerosols. During pre-monsoon, aerosols from the NW/N sector have high AOD (τpλ = 0.61 ± 0.21), and low AE (α = 0.54 ± 0.14) indicating an increase in the loading of coarse-mode particles over Pune. Dominance of UB type in winter season for all the years (i.e. 2010-2013) may be attributed to both local/transported aerosols. During pre-monsoon seasons, MT is the dominant aerosol type followed by UB and DD, while the background aerosols are insignificant.
Hernández, Ricardo; Harris, Marvin; Liu, Tong-Xian
2011-01-01
Liriomyza leafminers (Diptera: Agromyzidae) are cosmopolitan, polyphagous pests of horticultural plants and many are resistant to insecticides. Producers in South Texas rely on insecticides as the primary management tool for leafminers, and several compounds are available. The objective of this study is to address the efficacy of these compounds for controlling Liriomyza while minimizing their effects against natural enemies. Research plots were established at Texas AgriLife research center at Weslaco, Texas in fall 2007 and spring 2008 seasons, and peppers were used as a model crop. Plots were sprayed with novaluron, abamectin, spinetoram, lambda-cyhalothrin and water as treatments according to leafminer infestation; insecticide efficacy was monitored by collecting leaves and infested foliage. Plant phenology was also monitored. Novaluron was the most effective insecticide and lambda-cyhalothrin showed resurgence in leafminer density in fall 2007 and no reduction in spring 2008. Other compounds varied in efficacy. Novaluron showed the least number of parasitoids per leafminer larva and the lowest parasitoid diversity index among treatments followed by spinetoram. Liriomyza trifolii (Burgess) was the sole leafminer species on peppers, and 19 parasitoid species were found associated with this leafminer. Application of these insecticides for management of leafminers with conservation of natural enemies is discussed.
Conifer flavonoid compounds inhibit detoxification enzymes and synergize insecticides.
Wang, Zhiling; Zhao, Zhong; Cheng, Xiaofei; Liu, Suqi; Wei, Qin; Scott, Ian M
2016-02-01
Detoxification by glutathione S-transferases (GSTs) and esterases are important mechanisms associated with insecticide resistance. Discovery of novel GST and esterase inhibitors from phytochemicals could provide potential new insecticide synergists. Conifer tree species contain flavonoids, such as taxifolin, that inhibit in vitro GST activity. The objectives were to test the relative effectiveness of taxifolin as an enzyme inhibitor and as an insecticide synergist in combination with the organophosphorous insecticide, Guthion (50% azinphos-methyl), and the botanical insecticide, pyrethrum, using an insecticide-resistant Colorado potato beetle (CPB) Leptinotarsa decemlineata (Say) strain. Both taxifolin and its isomer, quercetin, increased the mortality of 1(st) instar CPB larvae after 48h when combined with Guthion, but not pyrethrum. Taxifolin had greater in vitro esterase inhibition compared with the commonly used esterase inhibitor, S, S, S-tributyl phosphorotrithioate (DEF). An in vivo esterase and GST inhibition effect after ingestion of taxifolin was measured, however DEF caused a greater suppression of esterase activity. This study demonstrated that flavonoid compounds have both in vitro and in vivo esterase inhibition, which is likely responsible for the insecticide synergism observed in insecticide-resistant CPB. Crown Copyright © 2015. Published by Elsevier Inc. All rights reserved.
Boiyo, Richard; Kumar, K. Raghavendra; Zhao, Tianliang
2018-03-01
A better understanding of aerosol optical, microphysical and radiative properties is a crucial challenge for climate change studies. In the present study, column-integrated aerosol optical and radiative properties observed at a rural site, Mbita (0.42°S, 34.20 °E, and 1125 m above sea level) located in Kenya, East Africa (EA) are investigated using ground-based Aerosol Robotic Network (AERONET) data retrieved during January, 2007 to December, 2015. The annual mean aerosol optical depth (AOD500 nm), Ångström exponent (AE440-870 nm), fine mode fraction of AOD500 nm (FMF500 nm), and columnar water vapor (CWV, cm) were found to be 0.23 ± 0.08, 1.01 ± 0.16, 0.60 ± 0.07, and 2.72 ± 0.20, respectively. The aerosol optical properties exhibited a unimodal distribution with substantial seasonal heterogeneity in their peak values being low (high) during the local wet (dry) seasons. The observed data showed that Mbita and its environs are significantly influenced by various types of aerosols, with biomass burning and/or urban-industrial (BUI), mixed (MXD), and desert dust (DDT) aerosol types contributing to 37.72%, 32.81%, and 1.40%, respectively during the local dry season (JJA). The aerosol volume size distribution (VSD) exhibited bimodal lognormal structure with a geometric mean radius of 0.15 μm and 3.86-5.06 μm for fine- and coarse-mode aerosols, respectively. Further, analysis of single scattering albedo (SSA), asymmetry parameter (ASY) and refractive index (RI) revealed dominance of fine-mode absorbing aerosols during JJA. The averaged aerosol direct radiative forcing (ARF) retrieved from the AERONET showed a strong cooling effect at the bottom of the atmosphere (BOA) and significant warming within the atmosphere (ATM), representing the important role of aerosols played in this rural site of Kenya. Finally, the Hybrid Single Particle Lagrangian Integrated Trajectory (HYSPLIT) model revealed that aerosols from distinct sources resulted in enhanced loading
Accumulated grain dust and flour residues in flour mills can potentially decrease the efficacy of contact insecticides used for control of adult and immature stages of stored product insects. A study was conducted to evaluate the effects of flour residues on the efficacy of synergized pyrethrin aero...
Mixture for Controlling Insecticide-Resistant Malaria Vectors
Pennetier, Cédric; Costantini, Carlo; Corbel, Vincent; Licciardi, Séverine; Dabire, R. K.; Lapied, B.; Chandre, Fabrice; Hougard, Jean-Marc
2008-01-01
The spread of resistance to pyrethroids in the major Afrotropical malaria vectors Anopheles gambiae s.s. necessitates the development of new strategies to control resistant mosquito populations. To test the efficacy of nets treated with repellent and insecticide against susceptible and insecticide-resistant An. gambiae mosquito populations, we impregnated mosquito bed nets with an insect repellent mixed with a low dose of organophosphorous insecticide and tested them in a rice-growing area ne...
A multi-model evaluation of aerosols over South Asia: common problems and possible causes
Pan, X.; Chin, M.; Gautam, R.; Bian, H.; Kim, D.; Colarco, P. R.; Diehl, T. L.; Takemura, T.; Pozzoli, L.; Tsigaridis, K.; Bauer, S.; Bellouin, N.
2015-05-01
Atmospheric pollution over South Asia attracts special attention due to its effects on regional climate, water cycle and human health. These effects are potentially growing owing to rising trends of anthropogenic aerosol emissions. In this study, the spatio-temporal aerosol distributions over South Asia from seven global aerosol models are evaluated against aerosol retrievals from NASA satellite sensors and ground-based measurements for the period of 2000-2007. Overall, substantial underestimations of aerosol loading over South Asia are found systematically in most model simulations. Averaged over the entire South Asia, the annual mean aerosol optical depth (AOD) is underestimated by a range 15 to 44% across models compared to MISR (Multi-angle Imaging SpectroRadiometer), which is the lowest bound among various satellite AOD retrievals (from MISR, SeaWiFS (Sea-Viewing Wide Field-of-View Sensor), MODIS (Moderate Resolution Imaging Spectroradiometer) Aqua and Terra). In particular during the post-monsoon and wintertime periods (i.e., October-January), when agricultural waste burning and anthropogenic emissions dominate, models fail to capture AOD and aerosol absorption optical depth (AAOD) over the Indo-Gangetic Plain (IGP) compared to ground-based Aerosol Robotic Network (AERONET) sunphotometer measurements. The underestimations of aerosol loading in models generally occur in the lower troposphere (below 2 km) based on the comparisons of aerosol extinction profiles calculated by the models with those from Cloud-Aerosol Lidar with Orthogonal Polarization (CALIOP) data. Furthermore, surface concentrations of all aerosol components (sulfate, nitrate, organic aerosol (OA) and black carbon (BC)) from the models are found much lower than in situ measurements in winter. Several possible causes for these common problems of underestimating aerosols in models during the post-monsoon and wintertime periods are identified: the aerosol hygroscopic growth and formation of
Glyoxal contribution to aerosols over Los Angeles
Balcerak, Ernie
2012-01-01
Laboratory and field studies have indicated that glyoxal (chemical formula OCHCHO), an atmospheric oxidation product of isoprene and aromatic compounds, may contribute to secondary organic aerosols in the atmosphere, which can block sunlight and affect atmospheric chemistry. Some aerosols are primary aerosols, emitted directly into the atmosphere, while others are secondary, formed through chemical reactions in the atmosphere. Washenfelder et al. describe in situ glyoxal measurements from Pasadena, Calif., near Los Angeles, made during summer 2010. They used three different methods to calculate the contribution of glyoxal to secondary atmospheric aerosol and found that it is responsible for 0-0.2 microgram per cubic meter, or 0-4%, of the secondary organic aerosol mass. The researchers also compared their results to those of a previous study that calculated the glyoxal contribution to aerosol for Mexico City. Mexico City had higher levels of organic aerosol mass from glyoxal. They suggest that the lower contribution of glyoxal to aerosol concentrations for Los Angeles may be due to differences in the composition or water content of the aerosols above the two cities. (Journal of Geophysical Research-Atmospheres, doi:10.1029/2011JD016314, 2011)
Effects of SO2 oxidation on ambient aerosol growth in water and ethanol vapours
Directory of Open Access Journals (Sweden)
T. Petäjä
2005-01-01
Full Text Available Hygroscopicity (i.e. water vapour affinity of atmospheric aerosol particles is one of the key factors in defining their impacts on climate. Condensation of sulphuric acid onto less hygroscopic particles is expected to increase their hygrocopicity and hence their cloud condensation nuclei formation potential. In this study, differences in the hygroscopic and ethanol uptake properties of ultrafine aerosol particles in the Arctic air masses with a different exposure to anthropogenic sulfur pollution were examined. The main discovery was that Aitken mode particles having been exposed to polluted air were more hygroscopic and less soluble to ethanol than after transport in clean air. This aging process was attributed to sulphur dioxide oxidation and subsequent condensation during the transport of these particle to our measurement site. The hygroscopicity of nucleation mode aerosol particles, on the other hand, was approximately the same in all the cases, being indicative of a relatively similar chemical composition despite the differences in air mass transport routes. These particles had also been produced closer to the observation site typically 3–8 h prior to sampling. Apparently, these particles did not have an opportunity to accumulate sulphuric acid on their way to the site, but instead their chemical composition (hygroscopicity and ethanol solubility resembled that of particles produced in the local or semi-regional ambient conditions.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
This french congress on the aerosols took place in Paris the 8 and 9 december 1998. It was presented in four main themes: the aerosols in the environment; the bio-aerosols, filtering and purifying; the aerosols metrology; the aerosols physic and application. Seven papers have been analyzed in INIS data base for their specific interest in nuclear industry. Eight other ones are analyzed in ETDE data base. (A.L.B.)
The first estimates of global nucleation mode aerosol concentrations based on satellite measurements
Directory of Open Access Journals (Sweden)
M. Kulmala
2011-11-01
Full Text Available Atmospheric aerosols play a key role in the Earth's climate system by scattering and absorbing solar radiation and by acting as cloud condensation nuclei. Satellites are increasingly used to obtain information on properties of aerosol particles with a diameter larger than about 100 nm. However, new aerosol particles formed by nucleation are initially much smaller and grow into the optically active size range on time scales of many hours. In this paper we derive proxies, based on process understanding and ground-based observations, to determine the concentrations of these new particles and their spatial distribution using satellite data. The results are applied to provide seasonal variation of nucleation mode concentration. The proxies describe the concentration of nucleation mode particles over continents. The source rates are related to both regional nucleation and nucleation associated with more restricted sources. The global pattern of nucleation mode particle number concentration predicted by satellite data using our proxies is compared qualitatively against both observations and global model simulations.
Radioligand Recognition of Insecticide Targets.
Casida, John E
2018-04-04
Insecticide radioligands allow the direct recognition and analysis of the targets and mechanisms of toxic action critical to effective and safe pest control. These radioligands are either the insecticides themselves or analogs that bind at the same or coupled sites. Preferred radioligands and their targets, often in both insects and mammals, are trioxabicyclooctanes for the γ-aminobutyric acid (GABA) receptor, avermectin for the glutamate receptor, imidacloprid for the nicotinic receptor, ryanodine and chlorantraniliprole for the ryanodine receptor, and rotenone or pyridaben for NADH + ubiquinone oxidoreductase. Pyrethroids and other Na + channel modulator insecticides are generally poor radioligands due to lipophilicity and high nonspecific binding. For target site validation, the structure-activity relationships competing with the radioligand in the binding assays should be the same as that for insecticidal activity or toxicity except for rapidly detoxified or proinsecticide analogs. Once the radioligand assay is validated for relevance, it will often help define target site modifications on selection of resistant pest strains, selectivity between insects and mammals, and interaction with antidotes and other chemicals at modulator sites. Binding assays also serve for receptor isolation and photoaffinity labeling to characterize the interactions involved.
Botanical insecticides inspired by plant-herbivore chemical interactions.
Miresmailli, Saber; Isman, Murray B
2014-01-01
Plants have evolved a plethora of secondary chemicals to protect themselves against herbivores and pathogens, some of which have been used historically for pest management. The extraction methods used by industry render many phytochemicals ineffective as insecticides despite their bioactivity in the natural context. In this review, we examine how plants use their secondary chemicals in nature and compare this with how they are used as insecticides to understand why the efficacy of botanical insecticides can be so variable. If the commercial production of botanical insecticides is to become a viable pest management option, factors such as production cost, resource availability, and extraction and formulation techniques need be considered alongside innovative application technologies to ensure consistent efficacy of botanical insecticides. Copyright © 2013 Elsevier Ltd. All rights reserved.
Ong, Song-Quan; Ab Majid, Abdul Hafiz; Ahmad, Hamdan
2016-04-01
It is crucial to understand the degradation pattern of insecticides when designing a sustainable control program for the house fly, Musca domestica (L.), on poultry farms. The aim of this study was to determine the half-life and degradation rates of cyromazine, chlorpyrifos, and cypermethrin by spiking these insecticides into poultry manure, and then quantitatively analyzing the insecticide residue using ultra-performance liquid chromatography. The insecticides were later tested in the field in order to study the appropriate insecticidal treatment intervals. Bio-assays on manure samples were later tested at 3, 7, 10, and 15 d for bio-efficacy on susceptible house fly larvae. Degradation analysis demonstrated that cyromazine has the shortest half-life (3.01 d) compared with chlorpyrifos (4.36 d) and cypermethrin (3.75 d). Cyromazine also had a significantly greater degradation rate compared with chlorpyrifos and cypermethrin. For the field insecticidal treatment interval study, 10 d was the interval that had been determined for cyromazine due to its significantly lower residue; for ChCy (a mixture of chlorpyrifos and cypermethrin), the suggested interval was 7 d. Future work should focus on the effects of insecticide metabolites on targeted pests and the poultry manure environment.
Vivan, L M; Torres, J B; Fernandes, P L S
2017-02-01
This work studied 17 insecticides belonging to nucleopolyhedrovirus (NPV), Bacillus thuringiensis (Bt kurstaki and Bt aizawai), benzoylureas (insect growth regulators [IGRs]), carbamates, organophosphates, spinosyns, and diamides against larvae of Helicoverpa armigera (Hübner), invasive species in the South American continent. Larvae of different instars were fed for 7 d with untreated or insecticide-treated diets. Mortality was recorded daily for 7 d, and surviving larvae were individually weighed on the seventh day. The NPV and Bt insecticides caused 100% mortality of first-instar larvae and first-instar and second-instar larvae, respectively. However, both NPV and Bt-based products caused low mortality of third-instar larvae and did not kill older larvae. The IGR lufenuron was highly effective against all three ages of larvae tested, whereas teflubenzuron and triflumuron produced maximum 60% mortality of second-instar larvae and lower than 50% to older larvae. Thiodicarb, chlorantraniliprole, indoxacarb, chlorpyrifos, and chlorfenapyr, irrespective of tested age, caused 100% mortality of larvae, with the last two insecticides reaching 100% mortality within 2 d of feeding on the treated diet. Flubendiamide caused lower mortality but significantly affected the weight of surviving larvae, whereas neither spinosad nor methomyl produced significant mortality or affected the weight of larvae. Based on the results, the age of H. armigera larvae plays an important role in the recommendation of NPV and Bt insecticides. Furthermore, there are potential options between biological and synthetic insecticides tested against H. armigera, and recording larval size during monitoring, in addition to the infestation level, should be considered when recommending biological-based insecticides to control this pest. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
The Dependence of Cloud Particle Size on Non-Aerosol-Loading Related Variables
Energy Technology Data Exchange (ETDEWEB)
Shao, H.; Liu, G.
2005-03-18
An enhanced concentration of aerosol may increase the number of cloud drops by providing more cloud condensation nuclei (CCN), which in turn results in a higher cloud albedo at a constant cloud liquid water path. This process is often referred to as the aerosol indirect effect (AIE). Many in situ and remote sensing observations support this hypothesis (Ramanathan et al. 2001). However, satellite observed relations between aerosol concentration and cloud drop size are not always in agreement with the AIE. Based on global analysis of cloud effective radius (r{sub e}) and aerosol number concentration (N{sub a}) derived from satellite data, Sekiguchi et al. (2003) found that the correlations between the two variables can be either negative, or positive, or none, depending on the location of the clouds. They discovered that significantly negative r{sub e} - N{sub a} correlation can only be identified along coastal regions of the continents where abundant continental aerosols inflow from land, whereas Feingold et al. (2001) found that the response of r{sub e} to aerosol loading is the greatest in the region where aerosol optical depth ({tau}{sub a}) is the smallest. The reason for the discrepancy is likely due to the variations in cloud macroscopic properties such as geometrical thickness (Brenguier et al. 2003). Since r{sub e} is modified not only by aerosol but also by cloud geometrical thickness (H), the correlation between re and {tau}{sub a} actually reflects both the aerosol indirect effect and dependence of H. Therefore, discussing AIE based on the r{sub e}-{tau}{sub a} correlation without taking into account variations in cloud geometrical thickness may be misleading. This paper is motivated to extract aerosols' effect from overall effects using the independent measurements of cloud geometrical thickness, {tau}{sub a} and r{sub e}.
Radioactive aerosols. [In Russian
Energy Technology Data Exchange (ETDEWEB)
Natanson, G L
1956-01-01
Tabulations are given presenting various published data on safe atmospheric concentrations of various radioactive and non-radioactive aerosols. Methods of determination of active aerosol concentrations and dispersion as well as the technical applications of labeled aerosols are discussed. The effect of atomic explosions are analyzed considering the nominal atomic bomb based on /sup 235/U and /sup 232/Pu equivalent to 20,000 tons of TNT.
Chemical character and probable origin of aerosols at the BARC site, Trombay
International Nuclear Information System (INIS)
Sequeira, R.; Kelkar, D.N.
1975-01-01
Measurements carried out on the dustload and concentration of sodium, potassium, ammonium, calcium, magnesium, iron, aluminium, silicon, chloride and sulphate in atmospheric air at the Bhabha Atomic Research Centre site, Trombay, the period November 1971-April 1972 have been reported. The average dustload is around 200μg/M 3 . About 50 percent of this could be accounted for, by the present analytical estimatioon of the individual chemical constituents : the water-soluble fraction obtained being 20 percent and the water-insoluble fraction accounting for the rest. Marine contribution to aerosol mass, calculated on the basis of water-soluble sodium concentration indicated that the sea is minor source of aerosols contributing 5 percent of the total aerosol mass. It was observed that the organic matter was about 20 percent of the total aerosol mass. If the local soil and fly-ash are the soil contributors to water-insoluble iron and potassium in aerosols, the respective contributions by these two sources were seen to be 13 percent and 48 percents. If all the organics and the non-marine fraction of the water-soluble mass are of industrial origin, the man-made fraction aerosols would constitute a maximum of 80 percent of the dustload in the Trombay air. The remaining 20 percent would be of natural origin, amounting to about 45 μg/M 3 , a value that represents unpolluted atmospheres. (author)
Lee, Y.; Alexander, L.; Newburn, M.; Jayne, J.; Hubbe, J.; Springston, S.; Senum, G.; Andrews, B.; Ogren, J.; Kleinman, L.; Daum, P.; Berg, L.; Berkowitz, C.
2007-12-01
Chemical composition of submicron aerosol particles was determined using an Aerodyne Time-of-Flight Aerosol Mass Spectrometer (AMS) outfitted on the DOE G-1 aircraft during the Cumulus Humilis Aerosol Processing Study (CHAPS) conducted in Oklahoma City area in June 2007. The primary objective of CHAPS was to investigate the effects of urban emissions on cloud aerosol interactions as a function of processing of the emissions. Aerosol composition was typically determined at three different altitudes: below, in, and above cloud, in both upwind and downwind regions of the urban area. Aerosols were sampled from an isokinetic inlet with an upper size cut-off of ~1.5 micrometer. During cloud passages, the AMS also sampled particles that were dried from cloud droplets collected using a counter-flow virtual impactor (CVI) sampler. The aerosol mass concentrations were typically below 10 microgram per cubic meter, and were dominated by organics and sulfate. Ammonium was often less than required for complete neutralization of sulfate. Aerosol nitrate levels were very low. We noted that nitrate levels were significantly enhanced in cloud droplets compared to aerosols, most likely resulting from dissolution of gaseous nitric acid. Organic to sulfate ratios appeared to be lower in cloud droplets than in aerosols, suggesting cloud condensation nuclei properties of aerosol particles might be affected by loading and nature of the organic components in aerosols. In-cloud formation of sulfate was considered unimportant because of the very low SO2 concentration in the region. A detailed examination of the sources of the aerosol organic components (based on hydrocarbons determined using a proton transfer reaction mass spectrometer) and their effects on cloud formation as a function of atmospheric processing (based on the degree of oxidation of the organic components) will be presented.
Estimating marine aerosol particle volume and number from Maritime Aerosol Network data
Directory of Open Access Journals (Sweden)
A. M. Sayer
2012-09-01
Full Text Available As well as spectral aerosol optical depth (AOD, aerosol composition and concentration (number, volume, or mass are of interest for a variety of applications. However, remote sensing of these quantities is more difficult than for AOD, as it is more sensitive to assumptions relating to aerosol composition. This study uses spectral AOD measured on Maritime Aerosol Network (MAN cruises, with the additional constraint of a microphysical model for unpolluted maritime aerosol based on analysis of Aerosol Robotic Network (AERONET inversions, to estimate these quantities over open ocean. When the MAN data are subset to those likely to be comprised of maritime aerosol, number and volume concentrations obtained are physically reasonable. Attempts to estimate surface concentration from columnar abundance, however, are shown to be limited by uncertainties in vertical distribution. Columnar AOD at 550 nm and aerosol number for unpolluted maritime cases are also compared with Moderate Resolution Imaging Spectroradiometer (MODIS data, for both the present Collection 5.1 and forthcoming Collection 6. MODIS provides a best-fitting retrieval solution, as well as the average for several different solutions, with different aerosol microphysical models. The "average solution" MODIS dataset agrees more closely with MAN than the "best solution" dataset. Terra tends to retrieve lower aerosol number than MAN, and Aqua higher, linked with differences in the aerosol models commonly chosen. Collection 6 AOD is likely to agree more closely with MAN over open ocean than Collection 5.1. In situations where spectral AOD is measured accurately, and aerosol microphysical properties are reasonably well-constrained, estimates of aerosol number and volume using MAN or similar data would provide for a greater variety of potential comparisons with aerosol properties derived from satellite or chemistry transport model data. However, without accurate AOD data and prior knowledge of
Fan, J.; Leung, L. R.; DeMott, P. J.; Comstock, J. M.; Singh, B.; Rosenfeld, D.; Tomlinson, J. M.; White, A.; Prather, K. A.; Minnis, P.; Ayers, J. K.; Min, Q.
2013-07-01
Mineral dust aerosols often observed over California in winter/spring, associated with long-range transport from Asia and Sahara, have been linked to enhanced precipitation based on observations. Local anthropogenic pollution, on the other hand, was shown in previous observational and modeling studies to reduce precipitation. Here we incorporate recent developments in ice nucleation parameterizations to link aerosols with ice crystal formation in a spectral-bin cloud microphysical model coupled with the Weather Research and Forecasting (WRF) model, to examine the relative and combined impacts of dust and local pollution particles on cloud properties and precipitation type and intensity. Simulations are carried out for two cloud cases with contrasting meteorology and cloud dynamics that occurred on 16 February (FEB16) and 2 March (MAR02) from the CalWater 2011 field campaign. In both cases, observations show the presence of dust or dust/biological particles in a relative pristine environment. The simulated cloud microphysical properties and precipitation show reasonable agreement with aircraft and surface measurements. Model sensitivity experiments indicate that in the pristine environment, the dust/biological aerosol layers increase the accumulated precipitation by 10-20% from the Central Valley to the Sierra Nevada Mountains for both FEB16 and MAR02 due to a 40% increase in snow formation, validating the observational hypothesis. Model results show that local pollution increases precipitation over the windward slope of the mountains by few percent due to increased snow formation when dust is present but reduces precipitation by 5-8% if dust is removed on FEB16. The effects of local pollution on cloud microphysics and precipitation strongly depend on meteorology including the strength of the Sierra Barrier Jet, and cloud dynamics. This study further underscores the importance of the interactions between local pollution, dust, and environmental conditions for
Fan, J.; Leung, L. R.; DeMott, P. J.; Comstock, J. M.; Singh, B.; Rosenfeld, D.; Tomlinson, J. M.; White, A.; Prather, K. A.; Minnis, P.; Ayers, J. K.; Min, Q.
2014-01-01
Mineral dust aerosols often observed over California in winter and spring, associated with long-range transport from Asia and the Sahara, have been linked to enhanced precipitation based on observations. Local anthropogenic pollution, on the other hand, was shown in previous observational and modeling studies to reduce precipitation. Here we incorporate recent developments in ice nucleation parameterizations to link aerosols with ice crystal formation in a spectral-bin cloud microphysical model coupled with the Weather Research and Forecasting (WRF) model in order to examine the relative and combined impacts of dust and local pollution particles on cloud properties and precipitation type and intensity. Simulations are carried out for two cloud cases (from the CalWater 2011 field campaign) with contrasting meteorology and cloud dynamics that occurred on 16 February (FEB16) and 2 March (MAR02). In both cases, observations show the presence of dust and biological particles in a relative pristine environment. The simulated cloud microphysical properties and precipitation show reasonable agreement with aircraft and surface measurements. Model sensitivity experiments indicate that in the pristine environment, the dust and biological aerosol layers increase the accumulated precipitation by 10-20% from the Central Valley to the Sierra Nevada for both FEB16 and MAR02 due to a ~40% increase in snow formation, validating the observational hypothesis. Model results show that local pollution increases precipitation over the windward slope of the mountains by a few percent due to increased snow formation when dust is present, but reduces precipitation by 5-8% if dust is removed on FEB16. The effects of local pollution on cloud microphysics and precipitation strongly depend on meteorology, including cloud dynamics and the strength of the Sierra Barrier Jet. This study further underscores the importance of the interactions between local pollution, dust, and environmental
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
This french congress on the aerosols took place in Paris the 8 and 9 december 1998. It was presented in four main themes: the aerosols in the environment; the bio-aerosols, filtering and purifying; the aerosols metrology; the aerosols physic and application. Eight papers have been analyzed in ETDE data base showing the importance of the aerosols physic knowledge in the air quality and seven other in the INIS data base for their specific interest in the nuclear industry. (A.L.B.)
Influence of moisture on the behavior of aerosols
International Nuclear Information System (INIS)
Adams, R.E.; Longest, A.W.; Tobias, M.L.
1987-01-01
The behavior of aerosols assumed to be characteristic of those generated during light water reactor accident sequences and released into containment has been studied in the Nuclear Safety Pilot Plant located at the Oak Ridge National Laboratory. It has been observed that in a saturated steam-air environment a change occurs in the shape of aerosol agglomerates of U 3 O 8 aerosol, Fe 2 O 3 aerosol, and mixed U 3 O 8 -Fe 2 O 3 aerosol from branched-chain to spherical, and that the rate of reduction in the airborne aerosol mass concentration is increased relative to the rate observed in a dry atmosphere. The effect of a steam-air environment on the behavior of concrete aerosol is different. The shape of the agglomerated concrete aerosol is intermediate between branched-chain and spherical and the effect on the rate of reduction in airborne mass concentration appears to be slight. In a related project the shape of an agglomerated Fe 2 O 3 aerosol was observed to change from branched-chain to spherical at, or near, 100% relative humidity
Directory of Open Access Journals (Sweden)
K. Zhang
2012-10-01
Full Text Available This paper introduces and evaluates the second version of the global aerosol-climate model ECHAM-HAM. Major changes have been brought into the model, including new parameterizations for aerosol nucleation and water uptake, an explicit treatment of secondary organic aerosols, modified emission calculations for sea salt and mineral dust, the coupling of aerosol microphysics to a two-moment stratiform cloud microphysics scheme, and alternative wet scavenging parameterizations. These revisions extend the model's capability to represent details of the aerosol lifecycle and its interaction with climate. Nudged simulations of the year 2000 are carried out to compare the aerosol properties and global distribution in HAM1 and HAM2, and to evaluate them against various observations. Sensitivity experiments are performed to help identify the impact of each individual update in model formulation.
Results indicate that from HAM1 to HAM2 there is a marked weakening of aerosol water uptake in the lower troposphere, reducing the total aerosol water burden from 75 Tg to 51 Tg. The main reason is the newly introduced κ-Köhler-theory-based water uptake scheme uses a lower value for the maximum relative humidity cutoff. Particulate organic matter loading in HAM2 is considerably higher in the upper troposphere, because the explicit treatment of secondary organic aerosols allows highly volatile oxidation products of the precursors to be vertically transported to regions of very low temperature and to form aerosols there. Sulfate, black carbon, particulate organic matter and mineral dust in HAM2 have longer lifetimes than in HAM1 because of weaker in-cloud scavenging, which is in turn related to lower autoconversion efficiency in the newly introduced two-moment cloud microphysics scheme. Modification in the sea salt emission scheme causes a significant increase in the ratio (from 1.6 to 7.7 between accumulation mode and coarse mode emission fluxes of
Chuang, Ming-Tung; Lee, Chung-Te; Chou, Charles C.-K.; Engling, Guenter; Chang, Shih-Yu; Chang, Shuenn-Chin; Sheu, Guey-Rong; Lin, Neng-Huei; Sopajaree, Khajornsak; Chang, You-Jia; Hong, Guo-Jun
2016-07-01
The transport of biomass burning (BB) aerosol from Indochina may cause a potential effect on climate change in Southeast Asia, East Asia, and the Western Pacific. Up to now, the understanding of BB aerosol composition modification during long-range transport (LRT) is still very limited due to the lack of observational data. In this study, atmospheric aerosols were collected at the Suthep/Doi Ang Khang (DAK) mountain sites in Chiang Mai, Thailand and the Lulin Atmospheric Background Station (Mt. Lulin) in central Taiwan from March to April 2010 and from February to April 2013, respectively. During the study period, an upwind and downwind relationship between the Suthep/DAK and Lulin sites (2400 km apart) was validated by backward trajectories. Comprehensive aerosol properties were resolved for PM2.5 water-soluble inorganic ions, carbonaceous content, water-soluble/insoluble organic carbon (WSOC/WIOC), dicarboxylic acids and their salts (DCAS), and anhydrosugars. A Modification Factor (MF) is proposed by employing non-sea-salt potassium ion (nss-K+) or fractionalized elemental carbon evolved at 580 °C after pyrolized OC correction (EC1-OP) as a BB aerosol tracer to evaluate the mass fraction changes of aerosol components from source to receptor regions during LRT. The MF values of nss-SO42-, NH4+, NO3-, OC1 (fractionalized organic carbon evolved from room temperature to 140 °C), OP (pyrolized OC fraction), DCAS, and WSOC were above unity, which indicated that these aerosol components were enhanced during LRT as compared with those in the near-source region. In contrast, the MF values of anhydrosugars ranged from 0.1 to 0.3, indicating anhydrosugars have degraded during LRT.
Directory of Open Access Journals (Sweden)
Wei Chen
2016-02-01
Full Text Available Aerosol particles are the major contributor to the deterioration of air quality in China’s capital, Beijing. Using ground-based sun photometer observations from 2005 to 2014, the long-term variations in optical properties and microphysical properties of aerosol in and around Beijing were investigated in this study. The results indicated little inter-annual variations in aerosol optic depth (AOD but an increase in the fine mode AODs both in and outside Beijing. Furthermore, the single scattering albedo in urban Beijing is larger, while observations at the site that is southeast of Beijing suggested that the aerosol there has become more absorbing. The intra-annual aspects were as follow: The largest AOD and high amount of fine mode aerosols are observed in the summer. However, the result of air pollution index (API that mainly affected by the dry density of near-surface aerosol indicated that the air quality has been improving since 2006. Winter and spring were the most polluted seasons considering only the API values. The inconsistency between AOD and API suggested that fine aerosol particles may have a more important role in the deterioration of air quality and that neglecting particulate matter with aerodynamic diameter less than 2.5 μm (PM2.5 in the calculation of API might not be appropriate in air quality evaluation. Through analysis of the aerosol properties in high API days, the results suggested that the fine mode aerosol, especially PM2.5 has become a major contributor to the aerosol pollution in Beijing.
Directory of Open Access Journals (Sweden)
Seiji Iwasa
2012-11-01
Full Text Available Enzyme-linked immunosorbent assay (ELISA based on a monoclonal antibody (MoAb was developed for the neonicotinoid insecticide clothianidin. A new clothianidin hapten (3-[5-(3-methyl-2-nitroguanidinomethyl-1,3-thiazol-2-ylthio] propionic acid was synthesized and conjugated to keyhole limpet hemocyanin, and was used for monoclonal antibody preparation. The resulting MoAb CTN-16A3-13 was characterized by a direct competitive ELISA (dc-ELISA. The 50% of inhibition concentration value with clothianidin was 4.4 ng/mL, and the working range was 1.5–15 ng/mL. The antibody showed high cross-reactivity (64% to dinotefuran among the structurally related neonicotinoid insecticides. The recovery examinations of clothianidin for cucumber, tomato and apple showed highly agreement with the spiked concentrations; the recovery rate was between 104% and 124% and the coefficient of variation value was between 1.8% and 15%. Although the recovery rate of the dc-ELISA was slightly higher than that of HPLC analysis, the difference was small enough to accept the dc-ELISA as a useful method for residue analysis of clothianidin in garden crops.
Uchigashima, Mikiko; Watanabe, Eiki; Ito, Shigekazu; Iwasa, Seiji; Miyake, Shiro
2012-11-15
Enzyme-linked immunosorbent assay (ELISA) based on a monoclonal antibody (MoAb) was developed for the neonicotinoid insecticide clothianidin. A new clothianidin hapten (3-[5-(3-methyl-2-nitroguanidinomethyl)-1,3-thiazol-2-ylthio] propionic acid) was synthesized and conjugated to keyhole limpet hemocyanin, and was used for monoclonal antibody preparation. The resulting MoAb CTN-16A3-13 was characterized by a direct competitive ELISA (dc-ELISA). The 50% of inhibition concentration value with clothianidin was 4.4 ng/mL, and the working range was 1.5–15 ng/mL. The antibody showed high cross-reactivity (64%) to dinotefuran among the structurally related neonicotinoid insecticides. The recovery examinations of clothianidin for cucumber, tomato and apple showed highly agreement with the spiked concentrations; the recovery rate was between 104% and 124% and the coefficient of variation value was between 1.8% and 15%. Although the recovery rate of the dc-ELISA was slightly higher than that of HPLC analysis, the difference was small enough to accept the dc-ELISA as a useful method for residue analysis of clothianidin in garden crops.
Faber, Peter; Drewnick, Frank; Bierl, Reinhard; Borrmann, Stephan
2017-10-01
The aerosol mass spectrometer (AMS) is well established in investigating highly time-resolved dynamics of submicron aerosol chemical composition including organic aerosol (OA). However, interpretation of mass spectra on molecular level is limited due to strong fragmentation of organic substances and potential reactions inside the AMS ion chamber. Results from complementary filter-based FT-IR absorption measurements were used to explain features in high-resolution AMS mass spectra of different types of OA (e.g. cooking OA, cigarette smoking OA, wood burning OA). Using this approach some AMS fragment ions were validated in this study as appropriate and rather specific markers for a certain class of organic compounds for all particle types under investigation. These markers can therefore be used to get deeper insights in the chemical composition of OA based on AMS mass spectra in upcoming studies. However, the specificity of other fragment ions such as C2H4O2+ (m/z 60.02114) remains ambiguous. In such cases, complementary FT-IR measurements allow the interpretation of highly time-resolved AMS mass spectra at the level of molecular functional groups. Furthermore, this study discusses the challenges in reducing inorganic interferences (e.g. from water and ammonium salts) in FT-IR spectra of atmospheric aerosols to decrease spectral uncertainties for better comparisons and, thus, to get more robust results.
Cloud albedo increase from carbonaceous aerosol
Directory of Open Access Journals (Sweden)
W. R. Leaitch
2010-08-01
Full Text Available Airborne measurements from two consecutive days, analysed with the aid of an aerosol-adiabatic cloud parcel model, are used to study the effect of carbonaceous aerosol particles on the reflectivity of sunlight by water clouds. The measurements, including aerosol chemistry, aerosol microphysics, cloud microphysics, cloud gust velocities and cloud light extinction, were made below, in and above stratocumulus over the northwest Atlantic Ocean. On the first day, the history of the below-cloud fine particle aerosol was marine and the fine particle sulphate and organic carbon mass concentrations measured at cloud base were 2.4 μg m−3 and 0.9 μg m−3 respectively. On the second day, the below-cloud aerosol was continentally influenced and the fine particle sulphate and organic carbon mass concentrations were 2.3 μg m−3 and 2.6 μg m−3 respectively. Over the range 0.06–0.8 μm diameter, the shapes of the below-cloud size distributions were similar on both days and the number concentrations were approximately a factor of two higher on the second day. The cloud droplet number concentrations (CDNC on the second day were approximately three times higher than the CDNC measured on the first day. Using the parcel model to separate the influence of the differences in gust velocities, we estimate from the vertically integrated cloud light scattering measurements a 6% increase in the cloud albedo principally due to the increase in the carbonaceous components on the second day. Assuming no additional absorption by this aerosol, a 6% albedo increase translates to a local daytime radiative cooling of ∼12 W m−2. This result provides observational evidence that the role of anthropogenic carbonaceous components in the cloud albedo effect can be much larger than that of anthropogenic sulphate, as some global simulations have indicated.
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-07-01
This french congress on the aerosols took place in Paris the 8 and 9 december 1999. It was presented in four main themes: bio-aerosols and filtering; the aerosols metrology; the aerosols in the environment; aerosols physic and applications. Seven papers have been analyzed in INIS data base for their specific interest in the nuclear industry. They concern the aerosol capture simulation, the aerosols sampling in workplace environment, a ring-effect ion generator development for the charge and the neutralization of an aerosol cloud, the radon 222 characterization in a house, a particle re-entrainment, the electrical charge process of beta emitter radioactive aerosols, the simulation of air flows in many filters. The other ones are analyzed in the ETDE data base. (A.L.B.)
Aerosol retrieval experiments in the ESA Aerosol_cci project
Directory of Open Access Journals (Sweden)
T. Holzer-Popp
2013-08-01
Full Text Available Within the ESA Climate Change Initiative (CCI project Aerosol_cci (2010–2013, algorithms for the production of long-term total column aerosol optical depth (AOD datasets from European Earth Observation sensors are developed. Starting with eight existing pre-cursor algorithms three analysis steps are conducted to improve and qualify the algorithms: (1 a series of experiments applied to one month of global data to understand several major sensitivities to assumptions needed due to the ill-posed nature of the underlying inversion problem, (2 a round robin exercise of "best" versions of each of these algorithms (defined using the step 1 outcome applied to four months of global data to identify mature algorithms, and (3 a comprehensive validation exercise applied to one complete year of global data produced by the algorithms selected as mature based on the round robin exercise. The algorithms tested included four using AATSR, three using MERIS and one using PARASOL. This paper summarizes the first step. Three experiments were conducted to assess the potential impact of major assumptions in the various aerosol retrieval algorithms. In the first experiment a common set of four aerosol components was used to provide all algorithms with the same assumptions. The second experiment introduced an aerosol property climatology, derived from a combination of model and sun photometer observations, as a priori information in the retrievals on the occurrence of the common aerosol components. The third experiment assessed the impact of using a common nadir cloud mask for AATSR and MERIS algorithms in order to characterize the sensitivity to remaining cloud contamination in the retrievals against the baseline dataset versions. The impact of the algorithm changes was assessed for one month (September 2008 of data: qualitatively by inspection of monthly mean AOD maps and quantitatively by comparing daily gridded satellite data against daily averaged AERONET sun
Tibetan Plateau glacier and hydrological change under stratospheric aerosol injection
Ji, D.
2017-12-01
As an important inland freshwater resource, mountain glaciers are highly related to human life, they provide water for many large rivers and play a very important role in regional water cycles. The response of mountain glaciers to future climate change is a topic of concern especially to the many people who rely on glacier-fed rivers for purposes such as irrigation. Geoengineering by stratospheric aerosol injection is a method of offsetting the global temperature rise from greenhouse gases. How the geoengineering by stratospheric aerosol injection affects the mass balance of mountain glaciers and adjacent river discharge is little understood. In this study, we use regional climate model WRF and catchment-based river model CaMa-Flood to study the impacts of stratospheric aerosol injection to Tibetan Plateau glacier mass balance and adjacent river discharge. To facilitate mountain glacier mass balance study, we improve the description of mountain glacier in the land surface scheme of WRF. The improvements include: (1) a fine mesh nested in WRF horizontal grid to match the highly non-uniform spatial distribution of the mountain glaciers, (2) revising the radiation flux at the glacier surface considering the surrounding terrain. We use the projections of five Earth system models for CMIP5 rcp45 and GeoMIP G4 scenarios to drive the WRF and CaMa-Flood models. The G4 scenario, which uses stratospheric aerosols to reduce the incoming shortwave while applying the rcp4.5 greenhouse gas forcing, starts stratospheric sulfate aerosol injection at a rate of 5 Tg per year over the period 2020-2069. The ensemble projections suggest relatively slower glacier mass loss rates and reduced river discharge at Tibetan Plateau and adjacent regions under geoengineering scenario by stratospheric aerosol injection.
A new physically-based quantification of marine isoprene and primary organic aerosol emissions
Directory of Open Access Journals (Sweden)
N. Meskhidze
2009-07-01
Full Text Available The global marine sources of organic carbon (OC are estimated here using a physically-based parameterization for the emission of marine isoprene and primary organic matter. The marine isoprene emission model incorporates new physical parameters such as light sensitivity of phytoplankton isoprene production and dynamic euphotic depth to simulate hourly marine isoprene emissions totaling 0.92 Tg C yr−1. Sensitivity studies using different schemes for the euphotic zone depth and ocean phytoplankton speciation produce the upper and the lower range of marine-isoprene emissions of 0.31 to 1.09 Tg C yr−1, respectively. Established relationships between sea spray fractionation of water-insoluble organic carbon (WIOC and chlorophyll-a concentration are used to estimate the total primary sources of marine sub- and super-micron OC of 2.9 and 19.4 Tg C yr−1, respectively. The consistent spatial and temporal resolution of the two emission types allow us, for the first time, to explore the relative contributions of sub- and super-micron organic matter and marine isoprene-derived secondary organic aerosol (SOA to the total OC fraction of marine aerosol. Using a fixed 3% mass yield for the conversion of isoprene to SOA, our emission simulations show minor (<0.2% contribution of marine isoprene to the total marine source of OC on a global scale. However, our model calculations also indicate that over the tropical oceanic regions (30° S to 30° N, marine isoprene SOA may contribute over 30% of the total monthly-averaged sub-micron OC fraction of marine aerosol. The estimated contribution of marine isoprene SOA to hourly-averaged sub-micron marine OC emission is even higher, approaching 50% over the vast regions of the oceans during the midday hours when isoprene emissions are highest. As it is widely believed that sub-micron OC has the potential to influence the cloud droplet activation of marine aerosols, our
Energy Technology Data Exchange (ETDEWEB)
Svenningsson, B.
1997-11-01
Aerosol particles in the atmosphere are important in several aspects. Some major aerosol constituents that are deposited in ecosystems are acidic or fertilizers and some minor or trace constituents are toxic. Aerosol particles are also involved in the earth`s radiation balance, both directly by scattering the sunlight and indirectly by influencing the clouds. All these effects are influenced by the interaction between the aerosol particles and water vapour. A tandem differential mobility analyser (TDMA) has been designed to measure hygroscopic growth, i.e. the particle diameter change due to uptake of water at well defined relative humidities below 100%. Tests of the instrument performance have been made using aerosol particles of pure inorganic salts. Three field experiments have been performed as parts of large fog and cloud experiments. Bimodal hygroscopic growth spectra were found: less-hygroscopic particles containing a few percent and more-hygroscopic particles around 50% by volume of hygroscopically active material. In general the fraction of less-hygroscopic particles decreases with particle size and it is larger in polluted continental aerosols than in remote background aerosols. This external mixing cannot be fully understood using present views on the formation of aerosols. Evidence or the importance of the external mixing on the cloud nucleating properties of the particles are found in comparisons between hygroscopic growth spectra for the total aerosol, the interstitial aerosol in clouds, and cloud drop residuals. Cloud condensation nuclei spectra, calculated using aerosol particle size distributions and hygroscopic growth spectra, in combination with information on the major inorganic ions are presented. These CCN spectra reveal for instance that the influence of less-hygroscopic particles on the cloud droplets increases with increasing peak supersaturation. The fraction of the particles that were scavenged to cloud drops, as a function of particle
Directory of Open Access Journals (Sweden)
T. Furukawa
2011-05-01
Full Text Available Atmospheric aerosols have both a direct and an indirect cooling effect that influences the radiative balance at the Earth's surface. It has been estimated that the degree of cooling is large enough to weaken the warming effect of carbon dioxide. Among the cooling factors, secondary organic aerosols (SOA play an important role in the solar radiation balance in the troposphere as SOA can act as cloud condensation nuclei (CCN and extend the lifespan of clouds because of their high hygroscopic and water soluble nature. Oxalic acid is an important component of SOA, and is produced via several formation pathways in the atmosphere. However, it is not certain whether oxalic acid exists as free oxalic acid or as metal oxalate complexes in aerosols, although there is a marked difference in their solubility in water and their hygroscopicity. We employed X-ray absorption fine structure spectroscopy to characterize the calcium (Ca and zinc (Zn in aerosols collected at Tsukuba in Japan. Size-fractionated aerosol samples were collected for this purpose using an impactor aerosol sampler. It was shown that 10–60% and 20–100% of the total Ca and Zn in the finer particles (<2.1 μm were present as Ca and Zn oxalate complexes, respectively. Oxalic acid is hygroscopic and can thus increase the CCN activity of aerosol particles, while complexes with various polyvalent metal ions such as Ca and Zn are not hygroscopic, which cannot contribute to the increase of the CCN activity of aerosols. Based on the concentrations of noncomplexed and metal-complexed oxalate species, we found that most of the oxalic acid is present as metal oxalate complexes in the aerosols, suggesting that oxalic acid does not always increase the hygroscopicity of aerosols in the atmosphere. Similar results are expected for other dicarboxylic acids, such as malonic and succinic acids. Thus, it is advisable that the cooling effect of organic aerosols should be estimated by including the
Dry season aerosol iron solubility in tropical northern Australia
Directory of Open Access Journals (Sweden)
V. H. L. Winton
2016-10-01
Full Text Available Marine nitrogen fixation is co-limited by the supply of iron (Fe and phosphorus in large regions of the global ocean. The deposition of soluble aerosol Fe can initiate nitrogen fixation and trigger toxic algal blooms in nitrate-poor tropical waters. We present dry season soluble Fe data from the Savannah Fires in the Early Dry Season (SAFIRED campaign in northern Australia that reflects coincident dust and biomass burning sources of soluble aerosol Fe. The mean soluble and total aerosol Fe concentrations were 40 and 500 ng m−3 respectively. Our results show that while biomass burning species may not be a direct source of soluble Fe, biomass burning may substantially enhance the solubility of mineral dust. We observed fractional Fe solubility up to 12 % in mixed aerosols. Thus, Fe in dust may be more soluble in the tropics compared to higher latitudes due to higher concentrations of biomass-burning-derived reactive organic species in the atmosphere. In addition, biomass-burning-derived particles can act as a surface for aerosol Fe to bind during atmospheric transport and subsequently be released to the ocean upon deposition. As the aerosol loading is dominated by biomass burning emissions over the tropical waters in the dry season, additions of biomass-burning-derived soluble Fe could have harmful consequences for initiating nitrogen-fixing toxic algal blooms. Future research is required to quantify biomass-burning-derived particle sources of soluble Fe over tropical waters.
de Oliveira, Jhones Luiz; Campos, Estefânia Vangelie Ramos; Bakshi, Mansi; Abhilash, P C; Fraceto, Leonardo Fernandes
2014-12-01
This review article discusses the use of nanotechnology in combination with botanical insecticides in order to develop systems for pest control in agriculture. The main types of botanical insecticides are described, together with different carrier systems and their potential uses. The botanical insecticides include those based on active principles isolated from plant extracts, as well as essential oils derived from certain plants. The advantages offered by the systems are highlighted, together with the main technological challenges that must be resolved prior to future implementation of the systems for agricultural pest control. The use of botanical insecticides associated with nanotechnology offers considerable potential for increasing agricultural productivity, while at the same time reducing impacts on the environment and human health.
Directory of Open Access Journals (Sweden)
Endang Sulistyowati
2014-05-01
Full Text Available Control of cocoa mirid, Helopeltis antoniiso far uses chemicalinsecticides as the main alternative. Therefore, it is necessary to find out the environment friendly control techniques. Lemongrass, garlic, and tree marigold have been known as an efectiveness botanical insecticides for horticulture. A research with aim to study the effectiveness of lemongrass (Cymbopogon nardus, garlic (Allium sativum and tree marigold (Tithonia diversifoliafor controlling H. antoniihave been carried out in cocoa plantation at Kaliwining experimental garden of Indonesian Coffee and Cocoa Research Institute. The research was arranged in split plot design in three replication, with the main plot infestation time of H. antoniiand sub-plot kind of botanical insecticides. Concentration of botanical insecticides used in this study was 5% and applied on 12 cm cocoa pod in length by using knapsack sprayer. Infestation of H. antonii nymphes were conducted before and after insecticide applications. Observation was conducted on the mortality and the lesion of H. antonii. The results of orthogonal contrast test on feeding activity based on the number of lesion and percentage of mortality of H. antoniishowed that there were significantly different between insecticide treatment and control, between chemical insecticide and botanical insecticides, but there was no significant different on kind of botanical insecticides. The lowest number of lesion due to H. antonii was shown by chemical insecticide with an average 34.0, followed by garlic and lemongrass botanical insecticide with number of lesion were 51.2 and 64.7 respectively, whereas the number of lesion in the control reached 84.2. The highest percentage mortality of H. antoniiwas shown by chemical insecticide with active ingredient teta-cypermethrin at 84.3%, followed by garlic, lemon grass and tree marigold botanical insecticide were 65.8%; 65.0%; and 63.8% respectively and significantly different with control by 8
Burtet, Leonardo M; Bernardi, Oderlei; Melo, Adriano A; Pes, Maiquel P; Strahl, Thiago T; Guedes, Jerson Vc
2017-12-01
Maize plants expressing insecticidal proteins of Bacillus thuringiensis are valuable options for managing fall armyworm (FAW), Spodoptera frugiperda, in Brazil. However, control failures were reported, and therefore insecticides have been used to control this species. Based on these, we evaluated the use of Bt maize and its integration with insecticides against FAW in southern Brazil. Early-planted Agrisure TL, Herculex, Optimum Intrasect and non-Bt maize plants were severely damaged by FAW and required up to three insecticidal sprays. In contrast, YieldGard VT Pro, YieldGard VT Pro 3, PowerCore, Agrisure Viptera and Agrisure Viptera 3 showed little damage and did not require insecticides. Late-planted Bt maize plants showed significant damage by FAW and required up to four sprays, with the exceptions of Agrisure Viptera and Agrisure Viptera 3. Exalt (first and second sprays); Lannate + Premio (first spray) and Avatar (second spray); and Karate + Match (first spray) and Ampligo (second spray) were the most effective insecticides against FAW larvae in Bt and non-Bt maize. Maize plants expressing Cry proteins exhibited FAW control failures in southern Brazil, necessitating insecticidal sprays. In contrast, Bt maize containing the Vip3Aa20 protein remained effective against FAW. However, regardless of the insecticide used against FAW surviving on Bt maize, grain yields were similar. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Kalashnikova, O. V.; Garay, M. J.; Xu, F.; Seidel, F. C.; Diner, D. J.
2015-12-01
Satellite remote sensing of ocean color is a critical tool for assessing the productivity of marine ecosystems and monitoring changes resulting from climatic or environmental influences. Yet water-leaving radiance comprises less than 10% of the signal measured from space, making correction for absorption and scattering by the intervening atmosphere imperative. Traditional ocean color retrieval algorithms utilize a standard set of aerosol models and the assumption of negligible water-leaving radiance in the near-infrared. Modern improvements have been developed to handle absorbing aerosols such as urban particulates in coastal areas and transported desert dust over the open ocean, where ocean fertilization can impact biological productivity at the base of the marine food chain. Even so, imperfect knowledge of the absorbing aerosol optical properties or their height distribution results in well-documented sources of error. In the UV, the problem of UV-enhanced absorption and nonsphericity of certain aerosol types are amplified due to the increased Rayleigh and aerosol optical depth, especially at off-nadir view angles. Multi-angle spectro-polarimetric measurements have been advocated as an additional tool to better understand and retrieve the aerosol properties needed for atmospheric correction for ocean color retrievals. The central concern of the work to be described is the assessment of the effects of absorbing aerosol properties on water leaving radiance measurement uncertainty by neglecting UV-enhanced absorption of carbonaceous particles and by not accounting for dust nonsphericity. In addition, we evaluate the polarimetric sensitivity of absorbing aerosol properties in light of measurement uncertainties achievable for the next generation of multi-angle polarimetric imaging instruments, and demonstrate advantages and disadvantages of wavelength selection in the UV/VNIR range. The phase matrices for the spherical smoke particles were calculated using a standard
Pavese, G; Lettino, A; Calvello, M; Esposito, F; Fiore, S
2016-04-01
Aerosol composition and properties variation under the advection of different air masses were investigated, as case studies, by contemporary measurements over the atmospheric column and at the ground in a semi-rural site in South Italy. The absence of local strong sources in this area allowed to characterize background aerosol and to compare particle mixing effects under various atmospheric circulation conditions. Aerosol optical depth (AOD) and Ǻngström parameters from radiometric measurements allowed the detection and identification of polluted, dust, and volcanic atmospheric conditions. AODs were the input for a suitable model to evaluate the columnar aerosol composition, according to six main atmospheric components (water-soluble, soot, sea salt accumulation, sea salt coarse, mineral dus,t and biological). Scanning electron microscope (SEM) analysis of particulate sampled with a 13-stage impactor at the ground showed not only fingerprints typical of the different air masses but also the effects of transport and aging on atmospheric particles, suggesting processes that changed their chemical and optical properties. Background columnar aerosol was characterized by 72% of water-soluble and soot, in agreement with ground-based findings that highlighted 60% of contribution from anthropogenic carbonate particles and soot. In general, a good agreement between ground-based and columnar results was observed. Under the advection of trans-boundary air masses, water-soluble and soot were always present in columnar aerosol, whereas, in variable percentages, sea salt and mineral particles characterized both dust and volcanic conditions. At the ground, sulfates characterized the amorphous matrix produced in finer stages by the evaporation of solutions of organic and inorganic aerosols. Sulfates were also one of the key players involved in heterogeneous chemical reactions, producing complex secondary aerosol, as such clay-sulfate internally mixed particle externally mixed
Zhang, Yan-Lin; El-Haddad, Imad; Huang, Ru-Jin; Ho, Kin-Fai; Cao, Jun-Ji; Han, Yongming; Zotter, Peter; Bozzetti, Carlo; Daellenbach, Kaspar R.; Slowik, Jay G.; Salazar, Gary; Prévôt, André S. H.; Szidat, Sönke
2018-03-01
Water-soluble organic carbon (WSOC) is a large fraction of organic aerosols (OA) globally and has significant impacts on climate and human health. The sources of WSOC remain very uncertain in polluted regions. Here we present a quantitative source apportionment of WSOC, isolated from aerosols in China using radiocarbon (14C) and offline high-resolution time-of-flight aerosol mass spectrometer measurements. Fossil emissions on average accounted for 32-47 % of WSOC. Secondary organic carbon (SOC) dominated both the non-fossil and fossil derived WSOC, highlighting the importance of secondary formation to WSOC in severe winter haze episodes. Contributions from fossil emissions to SOC were 61 ± 4 and 50 ± 9 % in Shanghai and Beijing, respectively, significantly larger than those in Guangzhou (36 ± 9 %) and Xi'an (26 ± 9 %). The most important primary sources were biomass burning emissions, contributing 17-26 % of WSOC. The remaining primary sources such as coal combustion, cooking and traffic were generally very small but not negligible contributors, as coal combustion contribution could exceed 10 %. Taken together with earlier 14C source apportionment studies in urban, rural, semi-urban and background regions in Asia, Europe and the USA, we demonstrated a dominant contribution of non-fossil emissions (i.e., 75 ± 11 %) to WSOC aerosols in the Northern Hemisphere; however, the fossil fraction is substantially larger in aerosols from East Asia and the eastern Asian pollution outflow, especially during winter, due to increasing coal combustion. Inclusion of our findings can improve a modelling of effects of WSOC aerosols on climate, atmospheric chemistry and public health.
Insecticide resistance in vector Chagas disease: evolution, mechanisms and management.
Mougabure-Cueto, Gastón; Picollo, María Inés
2015-09-01
Chagas disease is a chronic parasitic infection restricted to America. The disease is caused by the protozoa Trypanosoma cruzi, which is transmitted to human through the feces of infected triatomine insects. Because no treatment is available for the chronic forms of the disease, vector chemical control represents the best way to reduce the incidence of the disease. Chemical control has been based principally on spraying dwellings with insecticide formulations and led to the reduction of triatomine distribution and consequent interruption of disease transmission in several areas from endemic region. However, in the last decade it has been repeatedly reported the presence triatomnes, mainly Triatoma infestans, after spraying with pyrethroid insecticides, which was associated to evolution to insecticide resistance. In this paper the evolution of insecticide resistance in triatomines is reviewed. The insecticide resistance was detected in 1970s in Rhodnius prolixus and 1990s in R. prolixus and T. infestans, but not until the 2000s resistance to pyrthroids in T. infestans associated to control failures was described in Argentina and Bolivia. The main resistance mechanisms (i.e. enhanced metabolism, altered site of action and reduced penetration) were described in the T. infestans resistant to pyrethrods. Different resistant profiles were demonstrated suggesting independent origin of the different resistant foci of Argentina and Bolivia. The deltamethrin resistance in T. infestans was showed to be controlled by semi-dominant, autosomally inherited factors. Reproductive and developmental costs were also demonstrated for the resistant T. infestans. A discussion about resistance and tolerance concepts and the persistence of T. infestans in Gran Chaco region are presented. In addition, theoretical concepts related to toxicological, evolutionary and ecological aspects of insecticide resistance are discussed in order to understand the particular scenario of pyrethroid
International Nuclear Information System (INIS)
Kulkarni, A.; Bak, M. S.; Ha, S.; Joshirao, P.; Manchanda, V.; Kim, T.
2015-01-01
A sensitive radioactive aerosols sensor has been designed and developed. Its design guidance is based on the need for a low operational cost and reliable measurements to provide daily aerosol monitoring. The exposure of diethylene-glycol bis (allylcarbonate) to radiation causes modification of its physico-chemical properties like surface roughness and reflectance. In the present study, optical sensor based on the reflectance measurement has been developed with an aim to monitor real time presence of alpha radioactive aerosols emitted from thorium nitrate hydrate. The results shows that the fabricated sensor can detect 0.0157 kBq to 0.1572 kBq of radio activity by radioactive aerosols generated from (Th(NO 3 ) 4 ⋅ 5H 2 O) at 0.1 ml/min flow rate. The proposed instrument will be helpful to monitor radioactive aerosols in/around a nuclear facility, building construction sites, mines, and granite polishing factories
Kulkarni, A.; Ha, S.; Joshirao, P.; Manchanda, V.; Bak, M. S.; Kim, T.
2015-06-01
A sensitive radioactive aerosols sensor has been designed and developed. Its design guidance is based on the need for a low operational cost and reliable measurements to provide daily aerosol monitoring. The exposure of diethylene-glycol bis (allylcarbonate) to radiation causes modification of its physico-chemical properties like surface roughness and reflectance. In the present study, optical sensor based on the reflectance measurement has been developed with an aim to monitor real time presence of alpha radioactive aerosols emitted from thorium nitrate hydrate. The results shows that the fabricated sensor can detect 0.0157 kBq to 0.1572 kBq of radio activity by radioactive aerosols generated from (Th(NO3)4 ṡ 5H2O) at 0.1 ml/min flow rate. The proposed instrument will be helpful to monitor radioactive aerosols in/around a nuclear facility, building construction sites, mines, and granite polishing factories.
Energy Technology Data Exchange (ETDEWEB)
Kulkarni, A.; Bak, M. S., E-mail: tkim@skku.edu, E-mail: moonsoo@skku.edu [School of Mechanical Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Ha, S. [SKKU Advanced Institute of Nano Technology (SAINT), Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Joshirao, P.; Manchanda, V. [Department of Energy Science, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); Kim, T., E-mail: tkim@skku.edu, E-mail: moonsoo@skku.edu [School of Mechanical Engineering, Sungkyunkwan University, Suwon 440-746 (Korea, Republic of); SKKU Advanced Institute of Nano Technology (SAINT), Sungkyunkwan University, Suwon 440-746 (Korea, Republic of)
2015-06-15
A sensitive radioactive aerosols sensor has been designed and developed. Its design guidance is based on the need for a low operational cost and reliable measurements to provide daily aerosol monitoring. The exposure of diethylene-glycol bis (allylcarbonate) to radiation causes modification of its physico-chemical properties like surface roughness and reflectance. In the present study, optical sensor based on the reflectance measurement has been developed with an aim to monitor real time presence of alpha radioactive aerosols emitted from thorium nitrate hydrate. The results shows that the fabricated sensor can detect 0.0157 kBq to 0.1572 kBq of radio activity by radioactive aerosols generated from (Th(NO{sub 3}){sub 4} ⋅ 5H{sub 2}O) at 0.1 ml/min flow rate. The proposed instrument will be helpful to monitor radioactive aerosols in/around a nuclear facility, building construction sites, mines, and granite polishing factories.
Microbes as interesting source of novel insecticides: A review ...
African Journals Online (AJOL)
... strains with good insecticidal properties can be identified, evaluated and utilized for pest control. This paper reviews the insecticidal properties of microbes and their potential utility in pest management. Keywords: Microbes, insecticides, metabolites, pest management. African Journal of Biotechnology, Vol 13(26) 2582- ...
Mechanistic modeling of insecticide risks to breeding birds in ...
Insecticide usage in the United States is ubiquitous in urban, suburban, and rural environments. In evaluating data for an insecticide registration application and for registration review, scientists at the United States Environmental Protection Agency (USEPA) assess the fate of the insecticide and the risk the insecticide poses to the environment and non-target wildlife. At the present time, current USEPA risk assessments do not include population-level endpoints. In this paper, we present a new mechanistic model, which allows risk assessors to estimate the effects of insecticide exposure on the survival and seasonal productivity of birds known to use agricultural fields during their breeding season. The new model was created from two existing USEPA avian risk assessment models, the Terrestrial Investigation Model (TIM v.3.0) and the Markov Chain Nest Productivity model (MCnest). The integrated TIM/MCnest model has been applied to assess the relative risk of 12 insecticides used to control corn pests on a suite of 31 avian species known to use cornfields in midwestern agroecosystems. The 12 insecticides that were assessed in this study are all used to treat major pests of corn (corn root worm borer, cutworm, and armyworm). After running the integrated TIM/MCnest model, we found extensive differences in risk to birds among insecticides, with chlorpyrifos and malathion (organophosphates) generally posing the greatest risk, and bifenthrin and ë-cyhalothrin (
Ecdysone Agonist: New Insecticides with Novel Mode of Action
Directory of Open Access Journals (Sweden)
Y. Andi Trisyono
2002-12-01
Full Text Available Development of insect resistance to insecticide has been the major driving force for the development of new insecticides. Awareness and demand from public for more environmentally friendly insecticides have contributed in shifting the trend from using broad spectrum to selective insecticides. As a result, scientists have looked for new target sites beyond the nervous system. Insect growth regulators (IGRs are more selective insecticides than conventional insecticides, and ecdysone agonists are the newest IGRs being commercialized, e.g. tebufenozide, methoxyfenozide, and halofenozide. Ecdysone agonists bind to the ecdysteroid receptors, and they act similarly to the molting hormone 20-hydroxyecdysone. The binding provides larvae or nymphs with a signal to enter a premature and lethal molting cycle. In addition, the ecdysone agonists cause a reduction in the number of eggs laid by female insects. The ecdysone agonists are being developed as selective biorational insecticides. Tebufenozide and methoxyfenozide are used to control lepidopteran insect pests, whereas halofenozide is being used to control coleopteran insect pests. Their selectivity is due to differences in the binding affinity between these compounds to the receptors in insects from different orders. The selectivity of these compounds makes them candidates to be used in combinations with other control strategies to develop integrated pest management programs in agricultural ecosystems. Key words: new insecticides, selectivity, ecdysone agonists
Aerosol formation from heat and mass transfer in vapour-gas mixtures
International Nuclear Information System (INIS)
Clement, C.F.
1985-01-01
Heat and mass transfer equations and their coupling to the equation for the aerosol size distribution are examined for mixtures in which pressure changes are slow. Specific results in terms of Cn (the condensation number) and Le (the Lewis number - the ratio of the relative rates of evaporation and condensation) are obtained for the proportion of vapour condensing as a aerosol during the cooling and heating of a mixture in a well-mixed cavity. The assumption of allowing no supersaturations, the validity of which is examined, is shown to lead to maximum aerosol formation. For water vapour-air mixtures predictions are made as to temperature regions in which aerosols will evaporate or not form in cooling processes. The results are also qualitatively applied to some atmospheric effects as well as to water aerosols formed in the containment of a pressurized water reactor following a possible accident. In this context, the present conclusion that the whereabouts of vapour condensation is controlled by heat and mass transfer, contrasts with previous assumptions that the controlling factor is relative surface areas. (U.K.)
International Nuclear Information System (INIS)
Wang Jizhong; Li Huizhen; You Jing
2012-01-01
Current-use insecticides including organophosphate (OPs) and synthetic pyrethroid (SPs) insecticides were analyzed in 35 sediment samples collected from Chaohu Lake in China, where a transition from a traditional agricultural to a modern urbanized society is ongoing. Total concentrations of five OPs and eight SPs ranged from 0.029 to 0.681 ng/g dry weight and 0.016–301 ng/g dry weight, respectively. Toxic unit analysis showed that 13% of the sediment samples likely produced over 50% of the mortality for benthic invertebrates. Analysis also showed that cypermethrin was the principal contributor to the toxicity. Spatial distribution evaluation implied that OPs were mainly from non-point sources associated with agricultural activities. Conversely, SPs may have been derived from runoff of inflowing rivers through urban regions, as their concentrations were well-correlated with concentrations of other urban-oriented contaminants. - Highlights: ► Though lower than urban sites, pyrethroid insecticides in Chaohu Lake, China may cause toxicity to benthic invertebrates. ► Concentrations of pyrethroids were well correlated with those of other urban-oriented contaminants, e.g. PAHs and LABs. ► Spatial distribution showed urban runoff was the major source of pyrethroids deposited in the lake sediment. ► Conversely, organophosphate insecticides were mainly associated with agricultural non-point sources. - Evaluation of the distribution, potential toxicity, and input sources of organophosphate and pyrethroid insecticides in sediment from Chaohu Lake, China.
International Nuclear Information System (INIS)
Gopalakrishnan, V.; Subramanian, V.; Baskaran, R.; Venkatraman, B.
2015-01-01
Wireless based custom built aerosol sampling network is designed, developed, and implemented for environmental aerosol sampling. These aerosol sampling systems are used in field measurement campaign, in which sodium aerosol dispersion experiments have been conducted as a part of environmental impact studies related to sodium cooled fast reactor. The sampling network contains 40 aerosol sampling units and each contains custom built sampling head and the wireless control networking designed with Programmable System on Chip (PSoC™) and Xbee Pro RF modules. The base station control is designed using graphical programming language LabView. The sampling network is programmed to operate in a preset time and the running status of the samplers in the network is visualized from the base station. The system is developed in such a way that it can be used for any other environment sampling system deployed in wide area and uneven terrain where manual operation is difficult due to the requirement of simultaneous operation and status logging
Energy Technology Data Exchange (ETDEWEB)
Gopalakrishnan, V.; Subramanian, V.; Baskaran, R.; Venkatraman, B. [Radiation Impact Assessment Section, Radiological Safety Division, Indira Gandhi Centre for Atomic Research, Kalpakkam 603 102 (India)
2015-07-15
Wireless based custom built aerosol sampling network is designed, developed, and implemented for environmental aerosol sampling. These aerosol sampling systems are used in field measurement campaign, in which sodium aerosol dispersion experiments have been conducted as a part of environmental impact studies related to sodium cooled fast reactor. The sampling network contains 40 aerosol sampling units and each contains custom built sampling head and the wireless control networking designed with Programmable System on Chip (PSoC™) and Xbee Pro RF modules. The base station control is designed using graphical programming language LabView. The sampling network is programmed to operate in a preset time and the running status of the samplers in the network is visualized from the base station. The system is developed in such a way that it can be used for any other environment sampling system deployed in wide area and uneven terrain where manual operation is difficult due to the requirement of simultaneous operation and status logging.
Preparation of durable insecticide cotton fabrics through sol–gel treatment with permethrin
Ardanuy Raso, Mònica; Faccini, Mirko; Amantia, David; Aubouy, Laurent; Borja, Guadalupe
2014-01-01
This paper presents the development of an industrially viable procedure for the fabrication of durable insecticide textiles based on the sol–gel technique. Permethrin was incorporated on cotton fabrics by a silicon oxide nanocoating applied by conventional padding followed by curing. The effect of the sol–gel process parameters, such as silica solid content and the permethrin/tetraethyl orthosilicate (TEOS) ratio on the insecticide activity and on the textile properties of the resulting fabri...
Giménez, Joaquín; Pastor, Carlos; Castañer, Ramón; Nicolás, José; Crespo, Javier; Carratalá, Adoración
2010-01-01
Vertical profiles of aerosols and meteorological parameters were obtained using a hot air balloon and motorized paraglider. They were studied under anticyclonic conditions in four different contexts. Three flights occurred near sunrise, and one took place in the central hours of the day. The effects of North African dust intrusions were analyzed, whose entrance to the study area took place above the Stable Boundary Layer (SBL) in flight 1 and below it in flight 2. These flights have been compared with a non-intrusion situation (flight 3). A fourth flight characterized the profiles in the central hours of the day with a well-formed Convective Boundary Layer (CBL). With respect to the particle number distribution, the results show that not all sizes increase within the presence of an intrusion; during the first flight the smallest particles were not affected. The particle sizes affected in the second flight fell within the 0.35-2.5 μm interval. Under situations of convective dynamics, the reduction percentage of the particle number concentration reduces with increasing altitude, independently of their size, with respect to stability conditions. The negative vertical gradient for aerosols and water vapor, characteristic of a highly stable SBL (flight 3) becomes a constant profile within a CBL (flight 4). There are two situations that seem to alter the negative vertical gradient of the water vapor mixing ratio within the SBL: the presence of an intrusion and the possible stratification of the SBL based on different degrees of stability.
Behavior of generated aerosols in decommissioning of reactor
International Nuclear Information System (INIS)
Tomii, H.; Nakamura, K.
1999-01-01
Generated aerosols in dismantling of the JPDR were investigated for making an estimation of air contamination. The maximum dose equivalent rate at the surface of each reactor component was 9.4 Sv/h for core shroud, 80 mSv/h for pressure vessel, 2.0 mSv/h for biological shield, respectively. An under-water cutting method with remote handling plasma torch was used for dismantling of the core shroud and the pressure vessel. The biological shield was dismantled by an in-air cutting method and a controlled blasting method. Pipes connected to recirculation system were dismounted by a conventional mechanical and thermal cutting machine in the air. Generated radioactive aerosols were collected in the exhaust air of green house which enclosed the upper part of the reactor room to control the air contamination. An Andersen sampler was used for the measurement of particle distribution in the aerosols. Most of the particle size was below 0.1 μm in the under-water cutting method. The particle size distribution in the in-air cutting method, however, was divided into two parts at 0.1 μm and 0.3 μm. Dispersion rate of aerosol into the atmosphere was decreased exponentially with the depth of water. The dispersion rate and the size distribution of aerosol generated during cutting of the stainless steel pipes and blasting of the biological shield are also reported in the paper. (Suetake, M.)
Sodium oxide aerosol filtration
International Nuclear Information System (INIS)
Duverger de Cuy, G.
1979-01-01
In the scope of the sodium aerosol trapping research effort by the CEA/DSN, the retention capacity and yield were measured for very high efficiency fiberglass filters and several types of prefilters (cyclone agglomerator, fabric prefilters, water scrubbers). (author)
Sodium oxide aerosol filtration
Energy Technology Data Exchange (ETDEWEB)
Duverger de Cuy, G [DSN/SESTR, Centre de Cadarache, Saint-Paul-lez-Durance (France)
1979-03-01
In the scope of the sodium aerosol trapping research effort by the CEA/DSN, the retention capacity and yield were measured for very high efficiency fiberglass filters and several types of prefilters (cyclone agglomerator, fabric prefilters, water scrubbers). (author)
Factors Affecting Aerosol Radiative Forcing from Both Production-based and Consumption-based View
Wang, J.; Lin, J.; Ni, R.
2017-12-01
Aerosol radiative forcing (RF) is determined by emissions and various chemical-transport-radiative processes in the atmosphere, a multi-factor problem whose individual contributors have not been well quantified. This problem becomes more complicated when taking into account the role of international trade, which means reallocated aerosol RF due to separation of regions producing goods and emissions and regions consuming those goods. Here we analyze major factors affecting RF of secondary inorganic aerosols (SIOAs, including sulfate, nitrate and ammonium), primary organic aerosol (POA) and black carbon (BC), extending the work of Lin et al. (2016, Nature Geoscience). We contrast five factors determining production-based (RFp, due to a region's production of goods) and consumption-based (RFc, due to a region's consumption) forcing by 11 major regions, including population size, per capita output, emission intensity (emission per output), chemical efficiency (mass per unit emission) and radiative efficiency (RF per unit mass). Comparing across the 11 regions, East Asia produces the strongest RFp and RFc of SIOA and BC and the second largest RFp and RFc of POA primarily due to its high emission intensity. Although Middle East and North Africa has low emissions, its RFp is strengthened by its largest chemical efficiency for POA and BC and second largest chemical efficiency for SIOA. However, RFp of South-East Asia and Pacific is greatly weakened by its lowest chemical efficiency. Economic trade means that net importers (Western Europe, North America and Pacific OECD) have higher RFc than RFp by 50-100%. And such forcing difference is mainly due to the high emission intensity of the exporters supplying these regions. For North America, SIOA's RFc is 50% stronger than RFp, for that emission intensity of SIOA is 5.2 times in East Asia and 2.5 times in Latin America and Caribbean compared with that in North America, and the chemical efficiency in the top four exporters are
Directory of Open Access Journals (Sweden)
J. Brito
2014-11-01
Full Text Available This paper investigates the physical and chemical characteristics of aerosols at ground level at a site heavily impacted by biomass burning. The site is located near Porto Velho, Rondônia, in the southwestern part of the Brazilian Amazon rainforest, and was selected for the deployment of a large suite of instruments, among them an Aerosol Chemical Speciation Monitor. Our measurements were made during the South American Biomass Burning Analysis (SAMBBA field experiment, which consisted of a combination of aircraft and ground-based measurements over Brazil, aimed to investigate the impacts of biomass burning emissions on climate, air quality, and numerical weather prediction over South America. The campaign took place during the dry season and the transition to the wet season in September/October 2012. During most of the campaign, the site was impacted by regional biomass burning pollution (average CO mixing ratio of 0.6 ppm, occasionally superimposed by intense (up to 2 ppm of CO, freshly emitted biomass burning plumes. Aerosol number concentrations ranged from ~1000 cm−3 to peaks of up to 35 000 cm−3 (during biomass burning (BB events, corresponding to an average submicron mass mean concentrations of 13.7 μg m−3 and peak concentrations close to 100 μg m−3. Organic aerosol strongly dominated the submicron non-refractory composition, with an average concentration of 11.4 μg m−3. The inorganic species, NH4, SO4, NO3, and Cl, were observed, on average, at concentrations of 0.44, 0.34, 0.19, and 0.01 μg m−3, respectively. Equivalent black carbon (BCe ranged from 0.2 to 5.5 μg m−3, with an average concentration of 1.3 μg m−3. During BB peaks, organics accounted for over 90% of total mass (submicron non-refractory plus BCe, among the highest values described in the literature. We examined the ageing of biomass burning organic aerosol (BBOA using the changes in the H : C and O : C ratios, and found that throughout most of the
David, Jean-Philippe; Ismail, Hanafy Mahmoud; Chandor-Proust, Alexia; Paine, Mark John Ingraham
2013-02-19
The fight against diseases spread by mosquitoes and other insects has enormous environmental, economic and social consequences. Chemical insecticides remain the first line of defence but the control of diseases, especially malaria and dengue fever, is being increasingly undermined by insecticide resistance. Mosquitoes have a large repertoire of P450s (over 100 genes). By pinpointing the key enzymes associated with insecticide resistance we can begin to develop new tools to aid the implementation of control interventions and reduce their environmental impact on Earth. Recent technological advances are helping us to build a functional profile of the P450 determinants of insecticide metabolic resistance in mosquitoes. Alongside, the cross-responses of mosquito P450s to insecticides and pollutants are also being investigated. Such research will provide the means to produce diagnostic tools for early detection of P450s linked to resistance. It will also enable the design of new insecticides with optimized efficacy in different environments.
Directory of Open Access Journals (Sweden)
V. Varutbangkul
2006-01-01
Full Text Available A series of experiments has been conducted in the Caltech indoor smog chamber facility to investigate the water uptake properties of aerosol formed by oxidation of various organic precursors. Secondary organic aerosol (SOA from simple and substituted cycloalkenes (C5-C8 is produced in dark ozonolysis experiments in a dry chamber (RH~5%. Biogenic SOA from monoterpenes, sesquiterpenes, and oxygenated terpenes is formed by photooxidation in a humid chamber (~50% RH. Using the hygroscopicity tandem differential mobility analyzer (HTDMA, we measure the diameter-based hygroscopic growth factor (GF of the SOA as a function of time and relative humidity. All SOA studied is found to be slightly hygroscopic, with smaller water uptake than that of typical inorganic aerosol substances. The aerosol water uptake increases with time early in the experiments for the cycloalkene SOA, but decreases with time for the sesquiterpene SOA. This behavior could indicate competing effects between the formation of more highly oxidized polar compounds (more hygroscopic, and formation of longer-chained oligomers (less hygroscopic. All SOA also exhibit a smooth water uptake with RH with no deliquescence or efflorescence. The water uptake curves are found to be fitted well with an empirical three-parameter functional form. The measured pure organic GF values at 85% RH are between 1.09–1.16 for SOA from ozonolysis of cycloalkenes, 1.01–1.04 for sesquiterpene photooxidation SOA, and 1.06–1.10 for the monoterpene and oxygenated terpene SOA. The GF of pure SOA (GForg in experiments in which inorganic seed aerosol is used is determined by assuming volume-weighted water uptake (Zdanovskii-Stokes-Robinson or 'ZSR' approach and using the size-resolved organic mass fraction measured by the Aerodyne Aerosol Mass Spectrometer. Knowing the water content associated with the inorganic fraction yields GForg values. However, for each precursor, the GForg values computed from different
Liu, M.; Lin, J.; Boersma, F.; Pinardi, G.; Wang, Y.; Chimot, J.; Wagner, T.; Xie, P.; Eskes, H.; Van Roozendael, M.; Hendrick, F.
2017-12-01
Satellite retrieval of vertical column densities (VCDs) of tropospheric nitrogen dioxide (NO2) is influenced by aerosols substantially. Aerosols affect the retrieval of "effective cloud fraction (CF)" and "effective cloud top pressure (CP)" that are used in the subsequent NO2 retrieval to account for the presentence of clouds. And aerosol properties and vertical distributions directly affect the NO2 air mass factor (AMF) calculations. Our published POMINO algorithm uses a parallelized LIDORT-driven AMFv6 code to derive CF, CP and NO2 VCD. Daily information on aerosol optical properties are taken from GEOS-Chem simulations, with aerosol optical depth (AOD) further constrained by monthly MODIS AOD. However, the published algorithm does not include an observation-based constraint of aerosol vertical distribution. Here we construct a monthly climatological observation dataset of aerosol extinction profiles, based on Level-2 CALIOP data over 2007-2015, to further constrain aerosol vertical distributions. GEOS-Chem captures the temporal variations of CALIOP aerosol layer heights (ALH) but has an overall underestimate by about 0.3 km. It tends to overestimate the aerosol extinction by 10% below 2 km but with an underestimate by 30% above 2 km, leading to a low bias by 10-30% in the retrieved tropospheric NO2 VCD. After adjusting GEOS-Chem aerosol extinction profiles by the CALIOP monthly ALH climatology, the retrieved NO2 VCDs increase by 4-16% over China on a monthly basis in 2012. The improved NO2 VCDs are better correlated to independent MAX-DOAS observations at three sites than POMINO and DOMINO are - especially for the polluted cases, R2 reaches 0.76 for the adjusted POMINO, much higher than that for the published POMINO (0.68) and DOMINO (0.38). The newly retrieved CP increases by 60 hPa on average, because of a stronger aerosol screening effect. Compared to the CF used in DOMINO, which implicitly includes aerosol information, our improved CF is much lower and can
Loso, Michael R; Benko, Zoltan; Buysse, Ann; Johnson, Timothy C; Nugent, Benjamin M; Rogers, Richard B; Sparks, Thomas C; Wang, Nick X; Watson, Gerald B; Zhu, Yuanming
2016-02-01
Sap-feeding insect pests constitute a major insect pest complex that includes a range of aphids, whiteflies, planthoppers and other insect species. Sulfoxaflor (Isoclast™ active), a new sulfoximine class insecticide, targets sap-feeding insect pests including those resistant to many other classes of insecticides. A structure activity relationship (SAR) investigation of the sulfoximine insecticides revealed the importance of a 3-pyridyl ring and a methyl substituent on the methylene bridge linking the pyridine and the sulfoximine moiety to achieving strong Myzus persicae activity. A more in depth QSAR investigation of pyridine ring substituents revealed a strong correlation with the calculated logoctanol/water partition coefficient (SlogP). Model development resulted in a highly predictive model for a set of 18 sulfoximines including sulfoxaflor. The model is consistent with and helps explain the highly optimized pyridine substitution pattern for sulfoxaflor. Copyright © 2015 Elsevier Ltd. All rights reserved.
Evaluating MODIS Collection 6 Dark Target Over Water Aerosol Products for Multi-sensor Data Fusion
Shi, Y.; Zhang, J.; Reid, J. S.; Hyer, E. J.; McHardy, T. M.; Lee, L.
2014-12-01
The Moderate Resolution Imaging Spectroradiometer (MODIS) aerosol products have been widely used in aerosol related climate, visibility, and air quality studies for more than a decade. Recently, the MODIS collection 6 (c6) aerosol products from MODIS-Aqua have been released. The reported changes between Collection 5 and Collection 6 include updates in the retrieving algorithms and a new cloud filtering process for the over-ocean products. Thus it is necessary to fully evaluate the collection 6 products for applications that require high quality MODIS aerosol optical depth data, such as operational aerosol data assimilation. The uncertainties in the MODIS c6 DT over ocean products are studied through both inter-comparing with the Multi-angle Imaging Spectroradiometer (MISR) aerosol products and by evaluation against ground truth. Special attention is given to the low bias in MODIS DT products due to the misclassifications of heavy aerosol plumes as clouds. Finally, a quality assured data assimilation grade aerosol optical product is constructed for aerosol data assimilation related applications.
Aerosol Climate Time Series Evaluation In ESA Aerosol_cci
Popp, T.; de Leeuw, G.; Pinnock, S.
2015-12-01
Within the ESA Climate Change Initiative (CCI) Aerosol_cci (2010 - 2017) conducts intensive work to improve algorithms for the retrieval of aerosol information from European sensors. By the end of 2015 full mission time series of 2 GCOS-required aerosol parameters are completely validated and released: Aerosol Optical Depth (AOD) from dual view ATSR-2 / AATSR radiometers (3 algorithms, 1995 - 2012), and stratospheric extinction profiles from star occultation GOMOS spectrometer (2002 - 2012). Additionally, a 35-year multi-sensor time series of the qualitative Absorbing Aerosol Index (AAI) together with sensitivity information and an AAI model simulator is available. Complementary aerosol properties requested by GCOS are in a "round robin" phase, where various algorithms are inter-compared: fine mode AOD, mineral dust AOD (from the thermal IASI spectrometer), absorption information and aerosol layer height. As a quasi-reference for validation in few selected regions with sparse ground-based observations the multi-pixel GRASP algorithm for the POLDER instrument is used. Validation of first dataset versions (vs. AERONET, MAN) and inter-comparison to other satellite datasets (MODIS, MISR, SeaWIFS) proved the high quality of the available datasets comparable to other satellite retrievals and revealed needs for algorithm improvement (for example for higher AOD values) which were taken into account for a reprocessing. The datasets contain pixel level uncertainty estimates which are also validated. The paper will summarize and discuss the results of major reprocessing and validation conducted in 2015. The focus will be on the ATSR, GOMOS and IASI datasets. Pixel level uncertainties validation will be summarized and discussed including unknown components and their potential usefulness and limitations. Opportunities for time series extension with successor instruments of the Sentinel family will be described and the complementarity of the different satellite aerosol products
Directory of Open Access Journals (Sweden)
Ann Sluder
Full Text Available The efficacy of all major insecticide classes continues to be eroded by the development of resistance mediated, in part, by selection of alleles encoding insecticide insensitive target proteins. The discovery of new insecticide classes acting at novel protein binding sites is therefore important for the continued protection of the food supply from insect predators, and of human and animal health from insect borne disease. Here we describe a novel class of insecticides (Spiroindolines encompassing molecules that combine excellent activity against major agricultural pest species with low mammalian toxicity. We confidently assign the vesicular acetylcholine transporter as the molecular target of Spiroindolines through the combination of molecular genetics in model organisms with a pharmacological approach in insect tissues. The vesicular acetylcholine transporter can now be added to the list of validated insecticide targets in the acetylcholine signalling pathway and we anticipate that this will lead to the discovery of novel molecules useful in sustaining agriculture. In addition to their potential as insecticides and nematocides, Spiroindolines represent the only other class of chemical ligands for the vesicular acetylcholine transporter since those based on the discovery of vesamicol over 40 years ago, and as such, have potential to provide more selective tools for PET imaging in the diagnosis of neurodegenerative disease. They also provide novel biochemical tools for studies of the function of this protein family.
Influence of moisture on the behavior of aerosols
International Nuclear Information System (INIS)
Adams, R.E.; Longest, A.W.; Tobias, M.L.
1986-01-01
The behavior of aerosols assumed to be characteristic of those generated during light water reactor (LWR) accident sequences and released into containment has been studied in the Nuclear Safety Pilot Plant (NSPP) located at the Oak Ridge National Laboratory (ORNL). It has been observed that in a saturated steam-air environment a change occurs in the shape of aerosol agglomerates of U 3 O 8 aerosol, Fe 2 O 3 aerosol, and mixed U 3 O 8 -Fe 2 O 3 aerosol from branched-chain to spherical, and that the rate of reduction in the airborne aerosol mass concentration is increased relative to the rate observed in a dry atmosphere. The effect of a steam-air environment on the behavior of concrete aerosol is different. The shape of the agglomerated concrete aerosol is intermediate between branched-chain and spherical and the effect on the rate of reduction in airborne mass concentration appears to be slight. In a related project the shape of an agglomerated Fe 2 O 3 aerosol was observed to change from branched-chain to spherical at, or near, 100% relative humidity
Directory of Open Access Journals (Sweden)
Renata Bažok
2016-12-01
Full Text Available In the production of ornamental plants, it is often necessary to combine plant protection products (PPPs for simultaneous pest control. The use of a combination of PPPs often leads to phytotoxicity. The aim of this study was to determine the phytotoxicity of the combination of fungicides (azoxystrobin and cyprodinil + fludioxonil and insecticides based on abamectin and thiomethoxam on the ornamental plant Petunia sp. The PPPs are used at recommended and double doses. Based on the damage, phytotoxicity indices were calculated. Petunia plants are sensitive even when PPPs are used in recommended doses. Combinations of the both insecticides with the combined fungicide based on cyprodinil and fludioxinil can be advised to protect petunias only if one applies the recommended doses. All combinations of insecticides with a fungicide based on azoxystrobin should not be applied because there is a serious risk of phytotoxicity.
Ground-based SMART-COMMIT Measurements for Studying Aerosol and Cloud Properties
Tsay, Si-Chee
2008-01-01
From radiometric principles, it is expected that the retrieved properties of extensive aerosols and clouds from reflected/emitted measurements by satellite (and/or aircraft) should be consistent with those retrieved from transmitted/emitted radiance observed at the surface. Although space-borne remote sensing observations cover large spatial domain, they are often plagued by contamination of surface signatures. Thus, ground-based in-situ and remote-sensing measurements, where signals come directly from atmospheric constituents, the sun, and/or the Earth-atmosphere interactions, provide additional information content for comparisons that confirm quantitatively the usefulness of the integrated surface, aircraft, and satellite data sets. The development and deployment of SMARTCOMMIT (Surface-sensing Measurements for Atmospheric Radiative Transfer - Chemical, Optical & Microphysical Measurements of In-situ Troposphere) mobile facilities are aimed for the optimal utilization of collocated ground-based observations as constraints to yield higher fidelity satellite retrievals and to determine any sampling bias due to target conditions. To quantify the energetics of the surface-atmosphere system and the atmospheric processes, SMART-COMMIT instruments fall into three categories: flux radiometer, radiance sensor and in-situ probe. In this paper, we will demonstrate the capability of SMART-COMMIT in recent field campaigns (e.g., CRYSTAL-FACE, UAE 2, BASEASIA, NAMMA) that were designed and executed to study the compelling variability in temporal scale of both anthropogenic and natural aerosols (e.g., biomass-burning smoke, airborne dust) and cirrus clouds. We envision robust approaches in which well-collocated ground-based measurements and space-borne observations will greatly advance our knowledge of extensive aerosols and clouds.
Effect of selected insecticides on SF9 insect cell line
International Nuclear Information System (INIS)
Saleh, M.; Rahmo, A.; Hajjar, J.
2013-01-01
The toxic effect of three insecticides: dimethoate (organophosphate insecticide), acetamiprid (neonicotinoid insecticide) and deltamethrin (pyrethroid insecticide) were evaluated in vitro on cultured Sf9 cell line. Cell growth inhibition was measured by the 3- (4,5- dimethylthiazol - 2-yl) - 2,5 - diphenyl tetrazolium bromide (MTT) assay. Regression Analysis was used to estimate the 20% inhibition of cells growth (IC 20). The IC 20 values obtained for deltamethrin, acetamipridand dimethoate were: 46.8, 61.6 and 68.9 μM, respectively. The proportion of phagocytic cells was positively correlated with the applied concentrations of the insecticides. (author)
Aerosols, clouds and radiation
Energy Technology Data Exchange (ETDEWEB)
Twomey, S [University of Arizona, Tucson, AZ (USA). Inst. of Atmospheric Physics
1991-01-01
Most of the so-called 'CO{sub 2} effect' is, in fact, an 'H{sub 2}O effect' brought into play by the climate modeler's assumption that planetary average temperature dictates water-vapor concentration (following Clapeyron-Clausius). That assumption ignores the removal process, which cloud physicists know to be influenced by the aerosol, since the latter primarily controls cloud droplet number and size. Droplet number and size are also influential for shortwave (solar) energy. The reflectance of many thin to moderately thick clouds changes when nuclei concentrations change and make shortwave albedo susceptible to aerosol influence.
A novel tandem differential mobility analyzer with organic vapor treatment of aerosol particles
Directory of Open Access Journals (Sweden)
J. Joutsensaari
2001-01-01
Full Text Available A novel method to characterize the organic composition of aerosol particles has been developed. The method is based on organic vapor interaction with aerosol particles and it has been named an Organic Tandem Differential Mobility Analyzer (OTDMA. The OTDMA method has been tested for inorganic (sodium chloride and ammonium sulfate and organic (citric acid and adipic acid particles. Growth curves of the particles have been measured in ethanol vapor and as a comparison in water vapor as a function of saturation ratio. Measurements in water vapor show that sodium chloride and ammonium sulfate as well as citric acid particles grow at water saturation ratios (S of 0.8 and above, whereas adipic acid particles do not grow at S S = 0.75 and S = 0.79, respectively. Citric acid particles grow monotonously with increasing saturation ratios already at low saturation ratios and no clear deliquescence point is found. For sodium chloride and ammonium sulfate particles, no growth can be seen in ethanol vapor at saturation ratios below 0.93. In contrast, for adipic acid particles, the deliquescence takes place at around S = 0.95 in the ethanol vapor. The recrystallization of adipic acid takes place at S The results show that the working principles of the OTDMA are operational for single-component aerosols. Furthermore, the results indicate that the OTDMA method may prove useful in determining whether aerosol particles contain organic substances, especially if the OTDMA is operated in parallel with a hygroscopicity TDMA, as the growth of many substances is different in ethanol and water vapors.
Directory of Open Access Journals (Sweden)
Y. H. Lee
2010-03-01
Full Text Available The Aerosol Optical Depth (AOD and Angstrom Coefficient (AC predictions in the GISS-TOMAS model of global aerosol microphysics are evaluated against remote sensing data from MODIS, MISR, and AERONET. The model AOD agrees well (within a factor of two over polluted continental (or high sulfate, dusty, and moderate sea-salt regions but less well over the equatorial, high sea-salt, and biomass burning regions. Underprediction of sea-salt in the equatorial region is likely due to GCM meteorology (low wind speeds and high precipitation. For the Southern Ocean, overprediction of AOD is very likely due to high sea-salt emissions and perhaps aerosol water uptake in the model. However, uncertainties in cloud screening at high latitudes make it difficult to evaluate the model AOD there with the satellite-based AOD. AOD in biomass burning regions is underpredicted, a tendency found in other global models but more severely here. Using measurements from the LBA-SMOCC 2002 campaign, the surface-level OC concentration in the model are found to be underpredicted severely during the dry season while much less severely for EC concentration, suggesting the low AOD in the model is due to underpredictions in OM mass. The potential for errors in emissions and wet deposition to contribute to this bias is discussed.
Aerosol Climate Time Series in ESA Aerosol_cci
Popp, Thomas; de Leeuw, Gerrit; Pinnock, Simon
2016-04-01
Within the ESA Climate Change Initiative (CCI) Aerosol_cci (2010 - 2017) conducts intensive work to improve algorithms for the retrieval of aerosol information from European sensors. Meanwhile, full mission time series of 2 GCOS-required aerosol parameters are completely validated and released: Aerosol Optical Depth (AOD) from dual view ATSR-2 / AATSR radiometers (3 algorithms, 1995 - 2012), and stratospheric extinction profiles from star occultation GOMOS spectrometer (2002 - 2012). Additionally, a 35-year multi-sensor time series of the qualitative Absorbing Aerosol Index (AAI) together with sensitivity information and an AAI model simulator is available. Complementary aerosol properties requested by GCOS are in a "round robin" phase, where various algorithms are inter-compared: fine mode AOD, mineral dust AOD (from the thermal IASI spectrometer, but also from ATSR instruments and the POLDER sensor), absorption information and aerosol layer height. As a quasi-reference for validation in few selected regions with sparse ground-based observations the multi-pixel GRASP algorithm for the POLDER instrument is used. Validation of first dataset versions (vs. AERONET, MAN) and inter-comparison to other satellite datasets (MODIS, MISR, SeaWIFS) proved the high quality of the available datasets comparable to other satellite retrievals and revealed needs for algorithm improvement (for example for higher AOD values) which were taken into account for a reprocessing. The datasets contain pixel level uncertainty estimates which were also validated and improved in the reprocessing. For the three ATSR algorithms the use of an ensemble method was tested. The paper will summarize and discuss the status of dataset reprocessing and validation. The focus will be on the ATSR, GOMOS and IASI datasets. Pixel level uncertainties validation will be summarized and discussed including unknown components and their potential usefulness and limitations. Opportunities for time series extension
Energy Technology Data Exchange (ETDEWEB)
Michalsky, Joseph [National Oceanic and Atmospheric Administration (NOAA), Boulder, CO (United States); Lantz, Kathy [Univ. of Colorado, Boulder, CO (United States)
2016-05-01
The National Oceanic and Atmospheric Administration (NOAA) is preparing for the launch of the Geostationary Operational Environmental Satellite R-Series (GOES-R) satellite in 2015. This satellite will feature higher time (5-minute versus 30-minute sampling) and spatial resolution (0.5 km vs 1 km in the visible channel) than current GOES instruments provide. NOAA’s National Environmental Satellite Data and Information Service has funded the Global Monitoring Division at the Earth System Research Laboratory to provide ground-based validation data for many of the new and old products the new GOES instruments will retrieve specifically related to radiation at the surface and aerosol and its extensive and intensive properties in the column. The Two-Column Aerosol Project (TCAP) had an emphasis on aerosol; therefore, we asked to be involved in this campaign to de-bug our new instrumentation and to provide a new capability that the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Mobile Facilities (AMF) did not possess, namely surface albedo measurement out to 1625 nm. This gave us a chance to test remote operation of our new multi-filter rotating shadowband radiometer/multi-filter radiometer (MFRSR/MFR) combination. We did not deploy standard broadband shortwave and longwave radiation instrumentation because ARM does this as part of every AMF deployment. As it turned out, the ARM standard MFRSR had issues, and we were able to provide the aerosol column data for the first 2 months of the campaign covering the summer flight phase of the deployment. Using these data, we were able to work with personnel at Pacific Northwest National Laboratory (PNNL) to retrieve not only aerosol optical depth (AOD), but single scattering albedo and asymmetry parameter, as well.
Hsu, N.
2005-12-01
The environment in Southwest Asia exhibits one of the most complex situations for aerosol remote sensing from space. Several air masses with different aerosol characteristics commonly converge in this region. In particular, there are often fine mode pollution particles generated from oil industry activities in the Persian Gulf colliding with coarse mode dust particles lifted from desert sources in the surrounding areas. During the course of the UAE field campaign (August-October, 2004), we provided near-real time information, calculated using the Deep Blue algorithm, of satellite aerosol optical thickness and Angstrom exponent over the Southwest Asia region, including the Arabian Peninsula, Iran, Afghanistan, Pakistan, and part of north Africa. In this paper, we will present results of aerosol characteristics retrieved from SeaWiFS and MODIS over the Arabian Peninsula, Persian Gulf, and the Arabian Sea during the UAE experiment. The spectral surface reflectance data base constructed using satellite reflectance from MODIS and SeaWiFS employed in our algorithm will be discussed. We will also compare the resulting satellite retrieved aerosol optical thickness and Angstrom exponent with those obtained from the ground based sun photometers from AERONET in the region. Finally, we will discuss the changes in shortwave and longwave fluxes at the top of atmosphere in response to changes in aerosol optical thickness (i.e. aerosol forcing).
A risk-based framework for assessing the effectiveness of stratospheric aerosol geoengineering.
Directory of Open Access Journals (Sweden)
Angus J Ferraro
Full Text Available Geoengineering by stratospheric aerosol injection has been proposed as a policy response to warming from human emissions of greenhouse gases, but it may produce unequal regional impacts. We present a simple, intuitive risk-based framework for classifying these impacts according to whether geoengineering increases or decreases the risk of substantial climate change, with further classification by the level of existing risk from climate change from increasing carbon dioxide concentrations. This framework is applied to two climate model simulations of geoengineering counterbalancing the surface warming produced by a quadrupling of carbon dioxide concentrations, with one using a layer of sulphate aerosol in the lower stratosphere, and the other a reduction in total solar irradiance. The solar dimming model simulation shows less regional inequality of impacts compared with the aerosol geoengineering simulation. In the solar dimming simulation, 10% of the Earth's surface area, containing 10% of its population and 11% of its gross domestic product, experiences greater risk of substantial precipitation changes under geoengineering than under enhanced carbon dioxide concentrations. In the aerosol geoengineering simulation the increased risk of substantial precipitation change is experienced by 42% of Earth's surface area, containing 36% of its population and 60% of its gross domestic product.
A Risk-Based Framework for Assessing the Effectiveness of Stratospheric Aerosol Geoengineering
Ferraro, Angus J.; Charlton-Perez, Andrew J.; Highwood, Eleanor J.
2014-01-01
Geoengineering by stratospheric aerosol injection has been proposed as a policy response to warming from human emissions of greenhouse gases, but it may produce unequal regional impacts. We present a simple, intuitive risk-based framework for classifying these impacts according to whether geoengineering increases or decreases the risk of substantial climate change, with further classification by the level of existing risk from climate change from increasing carbon dioxide concentrations. This framework is applied to two climate model simulations of geoengineering counterbalancing the surface warming produced by a quadrupling of carbon dioxide concentrations, with one using a layer of sulphate aerosol in the lower stratosphere, and the other a reduction in total solar irradiance. The solar dimming model simulation shows less regional inequality of impacts compared with the aerosol geoengineering simulation. In the solar dimming simulation, 10% of the Earth's surface area, containing 10% of its population and 11% of its gross domestic product, experiences greater risk of substantial precipitation changes under geoengineering than under enhanced carbon dioxide concentrations. In the aerosol geoengineering simulation the increased risk of substantial precipitation change is experienced by 42% of Earth's surface area, containing 36% of its population and 60% of its gross domestic product. PMID:24533155
Berg, Larry K.; Fast, Jerome D.; Barnard, James C.; Burton, Sharon P.; Cairns, Brian; Chand, Duli; Comstock, Jennifer M.; Dunagan, Stephen; Ferrare, Richard A.; Flynn, Connor J.;
2015-01-01
The Two-Column Aerosol Project (TCAP), conducted from June 2012 through June 2013, was a unique study designed to provide a comprehensive data set that can be used to investigate a number of important climate science questions, including those related to aerosol mixing state and aerosol radiative forcing. The study was designed to sample the atmosphere be tween and within two atmospheric columns; one fixed near the coast of North America (over Cape Cod, MA) and a second moveable column over the Atlantic Ocean several hundred kilometers from the coast. The U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Mobile Facility (AMF) was deployed at the base of the Cape Cod column, and the ARM Aerial Facility was utilized for the summer and winter intensive observation periods. One important finding from TCAP is that four of six nearly cloud-free flight days had aerosol layers aloft in both the Cape Cod and maritime columns that were detected using the nadir pointing second-generation NASA high-spectral resolution lidar (HSRL-2).These layer s contributed up to 60 of the total observed aerosol optical depth (AOD). Many of these layers were also intercepted by the aircraft configured for in situ sampling, and the aerosol in the layers was found to have increased amounts of biomass burning material and nitrate compared to aerosol found near the surface. In addition, while there was a great deal of spatial and day-to-day variability in the aerosol chemical composition and optical properties, no systematic differences between the two columns were observed.
Energy Technology Data Exchange (ETDEWEB)
Berg, Larry K.; Fast, Jerome D.; Barnard, James C.; Burton, Sharon; Cairns, Brian; Chand, Duli; Comstock, Jennifer M.; Dunagan, Stephen; Ferrare, Richard A.; Flynn, Connor J.; Hair, John; Hostetler, Chris A.; Hubbe, John M.; Jefferson, Anne; Johnson, Roy; Kassianov, Evgueni I.; Kluzek, Celine D.; Kollias, Pavlos; Lamer, Katia; Lantz, K.; Mei, Fan; Miller, Mark A.; Michalsky, Joseph; Ortega, Ivan; Pekour, Mikhail S.; Rogers, Ray; Russell, P.; Redemann, Jens; Sedlacek, Art; Segal Rozenhaimer, Michal; Schmid, Beat; Shilling, John E.; Shinozuka, Yohei; Springston, Stephen R.; Tomlinson, Jason M.; Tyrrell, Megan; Wilson, Jacqueline; Volkamer, Rainer M.; Zelenyuk, Alla; Berkowitz, Carl M.
2016-01-08
The Two-Column Aerosol Project (TCAP), which was conducted from June 2012 through June 2013, was a unique field study that was designed to provide a comprehensive data set that can be used to investigate a number of important climate science questions, including those related to aerosol mixing state and aerosol radiative forcing. The study was designed to sample the atmosphere at a number of altitudes, from near the surface to as high as 8 km, within two atmospheric columns; one located near the coast of North America (over Cape Cod, MA) and a second over the Atlantic Ocean several hundred kilometers from the coast. TCAP included the yearlong deployment of the U.S. Department of Energy’s (DOE) Atmospheric Radiation Measurement (ARM) Mobile Facility (AMF) that was located at the base of the Cape Cod column, as well as summer and winter aircraft intensive observation periods of the ARM Aerial Facility. One important finding from TCAP is the relatively common occurrence (on four of six nearly cloud-free flights) of elevated aerosol layers in both the Cape Cod and maritime columns that were detected using the nadir pointing second-generation NASA high-spectral resolution lidar (HSRL-2). These layers contributed up to 60% of the total aerosol optical depth (AOD) observed in the column. Many of these layers were also intercepted by the aircraft configured for in situ sampling, and the aerosol in the layers was found to have increased amounts of biomass burning aerosol and nitrate compared to the aerosol found near the surface.
Berg, Larry K.; Fast, Jerome D.; Barnard, James C.; Burton, Sharon P.; Cairns, Brian; Chand, Duli; Comstock, Jennifer M.; Dunagan, Stephen; Ferrare, Richard A.; Flynn, Connor J.; Hair, Johnathan W.; Hostetler, Chris A.; Hubbe, John; Jefferson, Anne; Johnson, Roy; Kassianov, Evgueni I.; Kluzek, Celine D.; Kollias, Pavlos; Lamer, Katia; Lantz, Kathleen; Mei, Fan; Miller, Mark A.; Michalsky, Joseph; Ortega, Ivan; Pekour, Mikhail; Rogers, Ray R.; Russell, Philip B.; Redemann, Jens; Sedlacek, Arthur J.; Segal-Rosenheimer, Michal; Schmid, Beat; Shilling, John E.; Shinozuka, Yohei; Springston, Stephen R.; Tomlinson, Jason M.; Tyrrell, Megan; Wilson, Jacqueline M.; Volkamer, Rainer; Zelenyuk, Alla; Berkowitz, Carl M.
2016-01-01
The Two-Column Aerosol Project (TCAP), conducted from June 2012 through June 2013, was a unique study designed to provide a comprehensive data set that can be used to investigate a number of important climate science questions, including those related to aerosol mixing state and aerosol radiative forcing. The study was designed to sample the atmosphere between and within two atmospheric columns; one fixed near the coast of North America (over Cape Cod, MA) and a second moveable column over the Atlantic Ocean several hundred kilometers from the coast. The U.S. Department of Energy's (DOE) Atmospheric Radiation Measurement (ARM) Mobile Facility (AMF) was deployed at the base of the Cape Cod column, and the ARM Aerial Facility was utilized for the summer and winter intensive observation periods. One important finding from TCAP is that four of six nearly cloud-free flight days had aerosol layers aloft in both the Cape Cod and maritime columns that were detected using the nadir pointing second-generation NASA high-spectral resolution lidar (HSRL-2). These layers contributed up to 60% of the total observed aerosol optical depth (AOD). Many of these layers were also intercepted by the aircraft configured for in situ sampling, and the aerosol in the layers was found to have increased amounts of biomass burning material and nitrate compared to aerosol found near the surface. In addition, while there was a great deal of spatial and day-to-day variability in the aerosol chemical composition and optical properties, no systematic differences between the two columns were observed.
Evidence of Aerosol's Influence on Climate from Beijing Olympics
Chen, S.; Fu, Q.; Huang, J.; Ge, J.; Su, J.
2009-12-01
Air pollution is a difficult problem during the process of industrialization in most developing countries. In China, the main air pollutants are inhaled aerosol particles. Because of the extremely high loading and rapid development, Beijing became a heavily polluted city, with a population of more than 16 million. The 2008 Olympic Summer Games provided a unique opportunity for the study of climate effects of aerosols due to many measurements taken to fight pollution caused by industrialization and economic growth.Surface temperature is the most intuitive meteorological factor and easy to get. Therefore, aerosol’s radiative effects on regional climate can be known by studying the relationship between aerosols and surface temperature in Beijing city in August 2008. However, many factors can affect the surface temperature and cloud is considered as a very important meteorological element in radiation balance. In order to remove the impact of clouds on surface temperature, here the ground temperature in clear sky days (when cloud cover is less than 2) are selected. Aerosol data from the MODerate resolution Imaging Spectroradiometer (MODIS) onboard the Earth Observing System (EOS) Aqua shows that aerosol concentration decreased significantly in the area of Olympic venues in August 2008. Meanwhile, the ground-based observation data shows the surface temperature during the day (14LT) and night (02LT) in August 2008 is higher and lower than the mean temperature in August from 2002 to 2008, respectively. It is discovered that the distribution of satellite-retrieved aerosol optical Depth (AOD) in the whole area of Beijing in August of 2003 and 2004 is similar to that in 2008. We chosen four meteorological stations to analyze surface temperature and found that the diurnal changes of surface temperature are consistent with that in August of 2003, 2004 and 2008. Meanwhile, the decrease of AOD in the area of Olympic venues in August 2008 leads to the increase of precipitation
DARE: a dedicated aerosols retrieval instrument
Court, A.J.; Smorenburg, K.; Courrèges-Lacoste, G.B.; Visser, H.; Leeuw, G. de; Decae, R.
2004-01-01
Satellite remote sensing of aerosols is a largely unresolved problem. A dedicated instrument aimed at aerosols would be able to reduce the large uncertainties connected to this kind of remote sensing. TNO is performing a study of a space based instrument for aerosol measurements, together with the
Park, Donguk
2012-03-01
The aim of this review was to assess current knowledge related to the occupational exposure limit (OEL) for fluid aerosols including either mineral or chemical oil that are generated in metalworking operations, and to discuss whether their OEL can be appropriately used to prevent several health risks that may vary among metalworking fluid (MWF) types. The OEL (time-weighted average; 5 mg/m(3), short-term exposure limit ; 15 mg/m(3)) has been applied to MWF aerosols without consideration of different fluid aerosol-size fractions. The OEL, is also based on the assumption that there are no significant differences in risk among fluid types, which may be contentious. Particularly, the health risks from exposure to water-soluble fluids may not have been sufficiently considered. Although adoption of The National Institute for Occupational Safety and Health's recommended exposure limit for MWF aerosol (0.5 mg/m(3)) would be an effective step towards minimizing and evaluating the upper respiratory irritation that may be caused by neat or diluted MWF, this would fail to address the hazards (e.g., asthma and hypersensitivity pneumonitis) caused by microbial contaminants generated only by the use of water-soluble fluids. The absence of an OEL for the water-soluble fluids used in approximately 80-90 % of all applicants may result in limitations of the protection from health risks caused by exposure to those fluids.
Assessing physical models used in nuclear aerosol transport models
International Nuclear Information System (INIS)
McDonald, B.H.
1987-01-01
Computer codes used to predict the behaviour of aerosols in water-cooled reactor containment buildings after severe accidents contain a variety of physical models. Special models are in place for describing agglomeration processes where small aerosol particles combine to form larger ones. Other models are used to calculate the rates at which aerosol particles are deposited on building structures. Condensation of steam on aerosol particles is currently a very active area in aerosol modelling. In this paper, the physical models incorporated in the current available international codes for all of these processes are reviewed and documented. There is considerable variation in models used in different codes, and some uncertainties exist as to which models are superior. 28 refs
Shan, Huihui; Zhang, Hui; Liu, Junjian; Tao, Zongming; Wang, Shenhao; Ma, Xiaomin; Zhou, Pucheng; Yao, Ling; Liu, Dong; Xie, Chenbo; Wang, Yingjian
2018-03-01
Aerosol extinction coefficient profile is an essential parameter for atmospheric radiation model. It is difficult to get higher signal to noise ratio (SNR) of backscattering lidar from the ground to the tropopause especially in near range. Higher SNR problem can be solved by combining side-scattering and backscattering lidar. Using Raman-scattering lidar, aerosol extinction to backscatter ratio (lidar ratio) can be got. Based on side-scattering, backscattering and Raman-scattering lidar system, aerosol extinction coefficient is retrieved precisely from the earth's surface to the tropopause. Case studies show this method is reasonable and feasible.
Potential influences of neglecting aerosol effects on the NCEP GFS precipitation forecast
Directory of Open Access Journals (Sweden)
M. Jiang
2017-11-01
Full Text Available Aerosol–cloud interactions (ACIs have been widely recognized as a factor affecting precipitation. However, they have not been considered in the operational National Centers for Environmental Predictions Global Forecast System model. We evaluated the potential impact of neglecting ACI on the operational rainfall forecast using ground-based and satellite observations and model reanalysis. The Climate Prediction Center unified gauge-based precipitation analysis and the Modern-Era Retrospective analysis for Research and Applications Version 2 aerosol reanalysis were used to evaluate the forecast in three countries for the year 2015. The overestimation of light rain (47.84 % and underestimation of heavier rain (31.83, 52.94, and 65.74 % for moderate rain, heavy rain, and very heavy rain, respectively from the model are qualitatively consistent with the potential errors arising from not accounting for ACI, although other factors cannot be totally ruled out. The standard deviation of the forecast bias was significantly correlated with aerosol optical depth in Australia, the US, and China. To gain further insight, we chose the province of Fujian in China to pursue a more insightful investigation using a suite of variables from gauge-based observations of precipitation, visibility, water vapor, convective available potential energy (CAPE, and satellite datasets. Similar forecast biases were found: over-forecasted light rain and under-forecasted heavy rain. Long-term analyses revealed an increasing trend in heavy rain in summer and a decreasing trend in light rain in other seasons, accompanied by a decreasing trend in visibility, no trend in water vapor, and a slight increasing trend in summertime CAPE. More aerosols decreased cloud effective radii for cases where the liquid water path was greater than 100 g m−2. All findings are consistent with the effects of ACI, i.e., where aerosols inhibit the development of shallow liquid clouds and
Aleme, Adisu; Girma, Eshetu; Fentahun, Netsanet
2014-01-01
Understanding the feasibility of achieving widespread coverage with Insecticide-Treated Nets has to be preceded by learning how people value the Insecticide-Treated Nets and estimating the potential demand and willingness to pay so that sustainability of the intervention can be assured. The objective of this study was to determine willingness to pay for Insecticide-Treated Nets among households in Berehet District, Northern Ethiopia. A community-based cross-sectional study was conducted using both quantitative and qualitative methods in five randomly selected Kebeles from January-February 2012. Open ended contingent valuation technique with follow-up method was used. Qualitative data were collected through focus group discussions and observation methods. Binary logistic regression was used to determine the association between dependent and independent variables. The average number of individuals per Insecticide-Treated Nets was 3.83. Nearly 68.5% persons had willingness to buy Insecticide-Treated Nets if they have access to these Nets. The median maximum price a person is willingness to pay for blue rectangular Insecticide-Treated Net was 20 ETB. People had willingness to pay 30 ETB for blue and white conical insecticide-treated nets. Working on knowledge of malaria (OR=0.68, CI (0.47, 0.98; ppay Insecticide-Treated Nets. Respondents who prefer Kebele/place/ to buy Insecticide-Treated Net for rectangular shape had a significant association with a willingness to pay for Insecticide-Treated Nets (OR=1.92, CI= 1.07-3.92). Promotions, products, price and place had significant association with willingness to pay for Insecticide-Treated Nets. Designing a social marketing strategy helps ensure sustainable supply of Insecticide-Treated Nets and proper use of Insecticide-Treated Nets.
Roubos, Craig R; Rodriguez-Saona, Cesar; Holdcraft, Robert; Mason, Keith S; Isaacs, Rufus
2014-02-01
A series of bioassays were conducted to determine the relative toxicities and residual activities of insecticides labeled for use in blueberry (Vaccinium corymbosum L.) on natural enemies, to identify products with low toxicity or short duration effects on biological control agents. In total, 14 insecticides were evaluated using treated petri dishes and four commercially available natural enemies (Aphidius colemani Viereck, Orius insidiosus [Say], Chrysoperla rufilabris [Burmeister], and Hippodamia convergens [Guérin-Menéville]). Dishes were aged under greenhouse conditions for 0, 3, 7, or 14 d before introducing insects to test residual activity. Acute effects (combined mortality and knockdown) varied by insecticide, residue age, and natural enemy species. Broad-spectrum insecticides caused high mortality to all biocontrol agents, whereas products approved for use in organic agriculture had little effect. The reduced-risk insecticide acetamiprid consistently caused significant acute effects, even after aging for 14 d. Methoxyfenozide, novaluron, and chlorantraniliprole, which also are classified as reduced-risk insecticides, had low toxicity, and along with the organic products could be compatible with biological control. This study provides information to guide blueberry growers in their selection of insecticides. Further research will be needed to determine whether adoption of a pest management program based on the use of more selective insecticides will result in higher levels of biological control in blueberry.
Trifluoromethylphenyl amides as novel insecticides and fungicides
Because of increased resistance to insecticides in arthropods, it is necessary to identify new chemicals that may have novel modes of action. Following an extensive literature search for compounds with insecticidal and mosquito repellent activity, we have designed and synthesized a set of 20 trifluo...
Redemann, J.; Livingston, J.; Shinozuka, Y.; Kacenelenbogen, M.; Russell, P.; LeBlanc, S.; Vaughan, M.; Ferrare, R.; Hostetler, C.; Rogers, R.;
2014-01-01
We have developed a technique for combining CALIOP aerosol backscatter, MODIS spectral AOD (aerosol optical depth), and OMI AAOD (absorption aerosol optical depth) retrievals for the purpose of estimating full spectral sets of aerosol radiative properties, and ultimately for calculating the 3-D distribution of direct aerosol radiative forcing. We present results using one year of data collected in 2007 and show comparisons of the aerosol radiative property estimates to collocated AERONET retrievals. Use of the recently released MODIS Collection 6 data for aerosol optical depths derived with the dark target and deep blue algorithms has extended the coverage of the multi-sensor estimates towards higher latitudes. We compare the spatio-temporal distribution of our multi-sensor aerosol retrievals and calculations of seasonal clear-sky aerosol radiative forcing based on the aerosol retrievals to values derived from four models that participated in the latest AeroCom model intercomparison initiative. We find significant inter-model differences, in particular for the aerosol single scattering albedo, which can be evaluated using the multi-sensor A-Train retrievals. We discuss the major challenges that exist in extending our clear-sky results to all-sky conditions. On the basis of comparisons to suborbital measurements, we present some of the limitations of the MODIS and CALIOP retrievals in the presence of adjacent or underlying clouds. Strategies for meeting these challenges are discussed.
Ethnobotany of plants used as insecticides, repellents and ...
African Journals Online (AJOL)
An ethnobotanical study on plants used for the prevention and treatment of malaria was conducted to document the indigenous knowledge particularly associated with the use and conservation of anti-malarial, insecticide and insect repellent medicinal plants. In this study, five sampling sites were selected based on the ...
Zhang, Wenming
2017-09-19
virescens (Distant), GLH), but also against representative lepidoptera species Diamondback moth (Plutella xylostella (Linnaeus), DBM) and fall armyworm (Spodoptera frugiperda (J.E. Smith), FAW). Further optimization based on 3 led to discovery of triflumezopyrim (4), with a 5-pyrimidinylmethyl group, as a potent hopper insecticide for rice usage. Optimization of the substituents on the pyrido- moiety of 3 resulted in discovery of dicloromezotiaz (5) as a lepidoptera insecticide. In this Account, we present the discovery and optimization of mesoionic pyrido[1,2-a]pyrimidinone insecticides toward the identification of triflumezopyrim (4) and dicloromezotiaz (5). We hope that knowledge and lessons derived from this discovery program will provide valuable information for future agrochemical and drug discovery. Our successful discovery and commercialization development of two novel insecticides based on meosoionic pyrido[1,2-a]pyridiminones may also stimulate interests of scientists from other disciplines to adopt this uncommon yet intriguing heterocycle ring system in pharmaceutical and other material science discovery research.
ASGDB: a specialised genomic resource for interpreting Anopheles sinensis insecticide resistance.
Zhou, Dan; Xu, Yang; Zhang, Cheng; Hu, Meng-Xue; Huang, Yun; Sun, Yan; Ma, Lei; Shen, Bo; Zhu, Chang-Liang
2018-01-10
Anopheles sinensis is an important malaria vector in Southeast Asia. The widespread emergence of insecticide resistance in this mosquito species poses a serious threat to the efficacy of malaria control measures, particularly in China. Recently, the whole-genome sequencing and de novo assembly of An. sinensis (China strain) has been finished. A series of insecticide-resistant studies in An. sinensis have also been reported. There is a growing need to integrate these valuable data to provide a comprehensive database for further studies on insecticide-resistant management of An. sinensis. A bioinformatics database named An. sinensis genome database (ASGDB) was built. In addition to being a searchable database of published An. sinensis genome sequences and annotation, ASGDB provides in-depth analytical platforms for further understanding of the genomic and genetic data, including visualization of genomic data, orthologous relationship analysis, GO analysis, pathway analysis, expression analysis and resistance-related gene analysis. Moreover, ASGDB provides a panoramic view of insecticide resistance studies in An. sinensis in China. In total, 551 insecticide-resistant phenotypic and genotypic reports on An. sinensis distributed in Chinese malaria-endemic areas since the mid-1980s have been collected, manually edited in the same format and integrated into OpenLayers map-based interface, which allows the international community to assess and exploit the high volume of scattered data much easier. The database has been given the URL: http://www.asgdb.org /. ASGDB was built to help users mine data from the genome sequence of An. sinensis easily and effectively, especially with its advantages in insecticide resistance surveillance and control.
Energy Technology Data Exchange (ETDEWEB)
Bluvshtein, Nir [Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot Israel; Lin, Peng [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland Washington USA; Flores, J. Michel [Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot Israel; Segev, Lior [Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot Israel; Mazar, Yinon [Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot Israel; Tas, Eran [The Robert H. Smith Faculty of Agriculture, Food and Environment, The Hebrew University of Jerusalem, Rehovot Israel; Snider, Graydon [Department of Physics and Atmospheric Science, Dalhousie University, Halifax Nova Scotia Canada; Weagle, Crystal [Department of Chemistry, Dalhousie University, Halifax Nova Scotia Canada; Brown, Steven S. [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder Colorado USA; Chemical Sciences Division, Earth System Research Laboratory, National Oceanic and Atmospheric Administration, Boulder Colorado USA; Laskin, Alexander [Environmental Molecular Sciences Laboratory, Pacific Northwest National Laboratory, Richland Washington USA; Rudich, Yinon [Department of Earth and Planetary Sciences, Weizmann Institute of Science, Rehovot Israel
2017-05-23
The radiative effects of biomass burning aerosols on regional and global scale is substantial. Accurate modeling of the radiative effects of smoke aerosols require wavelength-dependent measurements and parameterizations of their optical properties in the UV and visible spectral ranges along with improved description of their chemical composition. To address this issue, we used a recently developed approach to retrieve the time- and spectral-dependent optical properties of ambient biomass burning aerosols between 300 and 650 nm wavelength during a regional bonfire festival in Israel. During the biomass burning event, the overall absorption at 400 nm increased by about two orders of magnitude, changing the size-weighted single scattering albedo from a background level of 0.95 to 0.7. Based on the new retrieval method, we provide parameterizations of the wavelength-dependent effective complex refractive index from 350 to 650 nm for freshly emitted and aged biomass burning aerosols. In addition, PM2.5 filter samples were collected for detailed off-line chemical analysis of the water soluble organics that contribute to light absorption. Nitrophenols were identified as the main organic species responsible for the increased absorption at 400-500 nm. These include species such as 4- nitrocatechol, 4-nitrophenol, nitro-syringol and nitro-guaiacol; oxidation-nitration products of methoxyphenols, known products of lignin pyrolysis. Our findings emphasize the importance of both primary and secondary organic aerosol from biomass burning in absorption of solar radiation and in effective radiative forcing.
Directory of Open Access Journals (Sweden)
Sharp Brian L
2007-10-01
Full Text Available Abstract Background Indoor residual spraying (IRS has again become popular for malaria control in Africa. This combined with the affirmation by WHO that DDT is appropriate for use in the absence of longer lasting insecticide formulations in some malaria endemic settings, has resulted in an increase in IRS with DDT as a major malaria vector control intervention in Africa. DDT was re-introduced into Mozambique's IRS programme in 2005 and is increasingly becoming the main insecticide used for malaria vector control in Mozambique. The selection of DDT as the insecticide of choice in Mozambique is evidence-based, taking account of the susceptibility of Anopheles funestus to all available insecticide choices, as well as operational costs of spraying. Previously lambda cyhalothrin had replaced DDT in Mozambique in 1993. However, resistance appeared quickly to this insecticide and, in 2000, the pyrethroid was phased out and the carbamate bendiocarb introduced. Low level resistance was detected by biochemical assay to bendiocarb in 1999 in both An. funestus and Anopheles arabiensis, although this was not evident in WHO bioassays of the same population. Methods Sentinel sites were established and monitored for insecticide resistance using WHO bioassays. These assays were conducted on 1–3 day old F1 offspring of field collected adult caught An. funestus females to determine levels of insecticide resistance in the malaria vector population. WHO biochemical assays were carried out to determine the frequency of insecticide resistance genes within the same population. Results In surveys conducted between 2002 and 2006, low levels of bendiocarb resistance were detected in An. funestus, populations using WHO bioassays. This is probably due to significantly elevated levels of Acetylcholinesterase levels found in the same populations. Pyrethroid resistance was also detected in populations and linked to elevated levels of p450 monooxygenase activity. One site had
Li, L.; Colussi, A. J.; Hoffmann, M. R.
2017-12-01
Aqueous phase chemistry plays a vital role in the global atmosphere. The importance of heterogeneous chemistry has been recently underscored by the severe haze-fog pollution episodes experienced in Chinese megacities. A key finding is that despite reduced photochemistry during the wintertime haze events, the oxidation of S(IV) into sulfate aerosol occurs rapidly in spite of the low levels of ozone and H2O2. Field observations suggest that NO2 could serve as a suitable oxidant of S(IV) during the events under neutral pH conditions. However, the haze aerosols are mostly acidic. Furthermore, the air-water interface is more acidic than bulk-phase aquated system according to our recent findings. This work investigates the chemistry taking place as NO2(g) collides with the surface of aqueous S(IV) microdroplets as a function of pH to closely simulate actual haze aerosol events under atmospheric conditions. The reaction between NO2(g) and HSO3- (aq) is studied in situ under ambient temperature and pressure via online electrospray ionization mass spectrometry. The aqueous aerosols containing HSO3- is generated using a microjet which is exposed to NO2(g) alternatively, while the composition of the 1 nm interfacial liquid layer of the aerosol is instantaneously measured. The ratio of HSO3- to HSO4- is observed to decrease with the concomitant appearance of a strong m/z 62 signal upon NO2(g) exposure. The appearance of m/z 62 indicates the formation of NO3- via the disproportionation of NO2 (2NO2(g) + H2O (l) ⇌ H++NO3-(aq) + HONO(aq)) and thus impacts the ion-ion interactions of NO3- on the ratio of HSO3- to HSO4- in the outermost interfacial layers. Parallel experiments with NO3-(aq) additions are conducted to quantify the impact of NO3- on the the ratio, in order to unravel the contribution of NO2 to the oxidation of S(IV). After accounting for the HNO3 effect, it is concluded: (1) most NO2(g) is converted into NO3- via anion-catalyzed hydrolytic disproportionation; (2
Aerosol behavior in the reactor containment building during severe accident
International Nuclear Information System (INIS)
Berthion, Y.; Lhiaubet, G.; Gauvain, J.
1984-07-01
Thermohydraulic behavior inside a PWR containment during severe accident depends on decay heat transferred to the sump water by aerosol gravitational settling and deposition. Conversely, aerosol behavior depends on thermal hydraulic conditions, especially atmosphere moisture for soluble aerosol GsI, and CsOH. Therefore, a small iterative procedure between thermo-hydraulic and aerosol calculations has been performed in order to evaluate the importance of this coupling between the two phenomena. In this paper, it is shown that with this procedure and using our codes JERICHO, RICOCHET and AEROSOLS/B1, the steam condensation on aerosols is an important phenomenon for a correct estimation of the attenuation factor of the suspended mass of aerosols in the airborne of the containment. Then, we have a more realistic assessment of the source term released by the containment
High-power laser radiation in atmospheric aerosols: Nonlinear optics of aerodispersed media
Zuev, V. E.; Zemlianov, A. A.; Kopytin, Iu. D.; Kuzikovskii, A. V.
The bulk of this book contains the results of investigations carried out at the Institute of Atmospheric Optics, Siberian Branch, USSR Academy of Science with the participation of the authors. The microphysical and optical characteristics of atmospheric aerosols are considered, taking into account light scattering by a single aerosol particle, light scattering by a system of particles, the scattering phase matrix, light scattering by clouds and fogs, light scattering by hazes, and scattering phase functions of polydispersed aerosols. Other topics studies are related to low-energy (subexplosive) effects of radiation on individual particles, the formation of clear zones in clouds and fogs due to the vaporization of droplets under regular regimes, self-action of a wave beam in a water aerosol under conditions of regular droplet vaporization, laser beam propagation through an explosively evaporating water-droplet aerosol, the propagation of high-power laser radiation through hazes, the ionization and optical breakdown in aerosol media, and laser monitoring of a turbid atmosphere using nonlinear effects.
Directory of Open Access Journals (Sweden)
H. Lihavainen
2008-12-01
Full Text Available Physical and chemical properties of boundary layer clouds, together with relevant aerosol properties, were investigated during the first Pallas Cloud Experiment (First Pace conducted in northern Finland between 20 October and 9 November 2004. Two stations located 6 km apart from each other at different altitudes were employed in measurements. The low-altitude station was always below the cloud layer, whereas the high-altitude station was inside clouds about 75% of the time during the campaign. Direct measurements of cloud droplet populations showed that our earlier approach of determining cloud droplet residual particle size distributions and corresponding activated fractions using continuous aerosol number size distribution measurements at the two stations is valid, as long as the cloud events are carefully screened to exclude precipitating clouds and to make sure the same air mass has been measured at both stations. We observed that a non-negligible fraction of cloud droplets originated from Aitken mode particles even at moderately-polluted air masses. We found clear evidence on first indirect aerosol effect on clouds but demonstrated also that no simple relation between the cloud droplet number concentration and aerosol particle number concentration exists for this type of clouds. The chemical composition of aerosol particles was dominated by particulate organic matter (POM and sulphate in continental air masses and POM, sodium and chlorine in marine air masses. The inorganic composition of cloud water behaved similarly to that of the aerosol phase and was not influenced by inorganic trace gases.
Directory of Open Access Journals (Sweden)
Marko Rodić
2011-05-01
Full Text Available Two types of bismuth modified electrodes, a bismuth-film modified glassy carbon (BiF-GCE and a bismuth bulk modified carbon paste, were applied for the determination of selected nitroguanidine neonicotinoid insecticides. The method based on an ex situ prepared BiF-GCE operated in the differential pulse voltammetric (DPV mode was applied to determine clothianidin in the concentration range from 2.5 to 23 μg cm−3 with a relative standard deviation (RSD not exceeding 1.5%. The tricresyl phosphate-based carbon paste electrodes (TCP-CPEs, bulk modified with 5 and 20 w/w% of bismuth, showed a different analytical performance in the determination of imidacloprid, regarding the peak shape, potential window, and noise level. The TCP-CPE with 5% Bi was advantageous, and the developed DPV method based on it allowed the determination in the concentration range from 1.7 to 60 μg cm−3 with an RSD of 2.4%. To get a deeper insight into the morphology of the bismuth-based sensor surfaces, scanning electron microscopic measurements were performed of both the surface film and the bulk modified electrodes.
Energy Technology Data Exchange (ETDEWEB)
Esselborn, Michael
2008-07-01
In the frame of this thesis a high-resolution spectral LIDAR (HSRL) was used for the field study SAMUM during May/June 2006 and January/February 2008 on board of the research aircraft Falcon. The intensity of the LIDAR signals are mainly influences by backscattering and extinction of atmospheric particles (aerosols). Using a narrow-band optical filter the HSRL allows the measurement of the molecular backscattering besides the total atmospheric backscattering. During SAMUM-1 the optical properties of the Sahara dust aerosols were measured for the first time, esp. its extinction, the ratio extinction/backscattering and the depolarization close to the source region. The results of the optical density of the aerosols were compared with satellite-based data. South of the Atlas-mountains optical aerosol densities in the range of 0.50 to 0.60 were measured.
Padró, Luz T.; Tkacik, Daniel; Lathem, Terry; Hennigan, Chris J.; Sullivan, Amy P.; Weber, Rodney J.; Huey, L. Greg; Nenes, Athanasios
2010-05-01
We present hygroscopic and cloud condensation nuclei (CCN) relevant properties of the water-soluble fraction of Mexico City aerosol collected upon filters during the 2006 Megacity Initiative: Local and Global Research Observations (MILAGRO) campaign. Application of κ-Köhler theory to the observed CCN activity gave a fairly constant hygroscopicity parameter (κ = 0.28 ± 0.06) regardless of location and organic fraction. Köhler theory analysis was used to understand this invariance by separating the molar volume and surfactant contributions to the CCN activity. Organics were found to depress surface tension (10-15%) from that of pure water. Daytime samples exhibited lower molar mass (˜200 amu) and surface tension depression than nighttime samples (˜400 amu); this is consistent with fresh hygroscopic secondary organic aerosol (SOA) condensing onto particles during peak photochemical hours, subsequently aging during nighttime periods of high relative humidity. Changes in surface tension partially compensate for shifts in average molar volume to give the constant hygroscopicity observed, which implies the amount (volume fraction) of soluble material in the parent aerosol is the key composition parameter required for CCN predictions. This finding, if applicable elsewhere, may explain why CCN predictions are often found to be insensitive to assumptions of chemical composition and provides a very simple way to parameterize organic hygroscopicity in atmospheric models (i.e., κorg = 0.28ɛWSOC). Special care should be given, however, to surface tension depression from organic surfactants, as its nonlinear dependence with organic fraction may introduce biases in observed (and predicted) hygroscopicity. Finally, threshold droplet growth analysis suggests the water-soluble organics do not affect activation kinetics.
Influence of non-ideality on condensation to aerosol
Directory of Open Access Journals (Sweden)
S. Compernolle
2009-02-01
Full Text Available Secondary organic aerosol (SOA is a complex mixture of water and organic molecules. Its composition is determined by the presence of semi-volatile or non-volatile compounds, their saturation vapor pressure and activity coefficient. The activity coefficient is a non-ideality effect and is a complex function of SOA composition. In a previous publication, the detailed chemical mechanism (DCM for α-pinene oxidation and subsequent aerosol formation BOREAM was presented. In this work, we investigate with this DCM the impact of non-ideality by simulating smog chamber experiments for α-pinene degradation and aerosol formation and taking the activity coefficient into account of all molecules in the aerosol phase. Several versions of the UNIFAC method are tested for this purpose, and missing parameters for e.g. hydroperoxides and nitrates are inferred from fittings to activity coefficient data generated using the SPARC model. Alternative approaches to deal with these missing parameters are also tested, as well as an activity coefficient calculation method based on Hansen solubility parameters (HSP. It turns out that for most experiments, non-ideality has only a limited impact on the interaction between the organic molecules, and therefore on SOA yields and composition, when water uptake is ignored. The reason is that often, the activity coefficient is on average close to 1 and, specifically for high-VOC experiments, partitioning is not very sensitive on the activity coefficient because the equilibrium is shifted strongly towards condensation. Still, for ozonolysis experiments with low amounts of volatile organic carbon (low-VOC, the UNIFAC parameterization of Raatikainen et al. leads to significantly higher SOA yields (by up to a factor 1.6 compared to the ideal case and to other parameterizations. Water uptake is model dependent, in the order: ideal > UNIFAC-Raatikainen > UNIFAC-Peng > UNIFAC-Hansen ≈ UNIFAC-Magnussen ≈ UNIFAC-Ming. In the absence
An Optimal-Estimation-Based Aerosol Retrieval Algorithm Using OMI Near-UV Observations
Jeong, U; Kim, J.; Ahn, C.; Torres, O.; Liu, X.; Bhartia, P. K.; Spurr, R. J. D.; Haffner, D.; Chance, K.; Holben, B. N.
2016-01-01
An optimal-estimation(OE)-based aerosol retrieval algorithm using the OMI (Ozone Monitoring Instrument) near-ultraviolet observation was developed in this study. The OE-based algorithm has the merit of providing useful estimates of errors simultaneously with the inversion products. Furthermore, instead of using the traditional lookup tables for inversion, it performs online radiative transfer calculations with the VLIDORT (linearized pseudo-spherical vector discrete ordinate radiative transfer code) to eliminate interpolation errors and improve stability. The measurements and inversion products of the Distributed Regional Aerosol Gridded Observation Network campaign in northeast Asia (DRAGON NE-Asia 2012) were used to validate the retrieved aerosol optical thickness (AOT) and single scattering albedo (SSA). The retrieved AOT and SSA at 388 nm have a correlation with the Aerosol Robotic Network (AERONET) products that is comparable to or better than the correlation with the operational product during the campaign. The OEbased estimated error represented the variance of actual biases of AOT at 388 nm between the retrieval and AERONET measurements better than the operational error estimates. The forward model parameter errors were analyzed separately for both AOT and SSA retrievals. The surface reflectance at 388 nm, the imaginary part of the refractive index at 354 nm, and the number fine-mode fraction (FMF) were found to be the most important parameters affecting the retrieval accuracy of AOT, while FMF was the most important parameter for the SSA retrieval. The additional information provided with the retrievals, including the estimated error and degrees of freedom, is expected to be valuable for relevant studies. Detailed advantages of using the OE method were described and discussed in this paper.
Dai, Mengyan; Liu, Jianghai; Cui, Jianlin; Chen, Chunsheng; Jia, Peng
2017-10-01
In order to solve the problem of the quantitative test of spectrum and color of aerosol, the measurement method of spectrum of aerosol based on human visual system was proposed. The spectrum characteristics and color parameters of three different aerosols were tested, and the color differences were calculated according to the CIE1976-L*a*b* color difference formula. Three tested powders (No 1# No 2# and No 3# ) were dispersed in a plexglass box and turned into aerosol. The powder sample was released by an injector with different dosages in each experiment. The spectrum and color of aerosol were measured by the PRO 6500 Fiber Optic Spectrometer. The experimental results showed that the extinction performance of aerosol became stronger and stronger with the increase of concentration of aerosol. While the chromaticity value differences of aerosols in the experiment were so small, luminance was verified to be the main influence factor of human eye visual perception and contributed most in the three factors of the color difference calculation. The extinction effect of No 3# aerosol was the strongest of all and caused the biggest change of luminance and color difference which would arouse the strongest human visual perception. According to the sensation level of chromatic color by Chinese, recognition color difference would be produced when the dosage of No 1# powder was more than 0.10 gram, the dosage of No 2# powder was more than 0.15 gram, and the dosage of No 3# powder was more than 0.05 gram.
An interfacial mechanism for cloud droplet formation on organic aerosols.
Ruehl, Christopher R; Davies, James F; Wilson, Kevin R
2016-03-25
Accurate predictions of aerosol/cloud interactions require simple, physically accurate parameterizations of the cloud condensation nuclei (CCN) activity of aerosols. Current models assume that organic aerosol species contribute to CCN activity by lowering water activity. We measured droplet diameters at the point of CCN activation for particles composed of dicarboxylic acids or secondary organic aerosol and ammonium sulfate. Droplet activation diameters were 40 to 60% larger than predicted if the organic was assumed to be dissolved within the bulk droplet, suggesting that a new mechanism is needed to explain cloud droplet formation. A compressed film model explains how surface tension depression by interfacial organic molecules can alter the relationship between water vapor supersaturation and droplet size (i.e., the Köhler curve), leading to the larger diameters observed at activation. Copyright © 2016, American Association for the Advancement of Science.
Extraction and Characterization of Surfactants from Atmospheric Aerosols.
Nozière, Barbara; Gérard, Violaine; Baduel, Christine; Ferronato, Corinne
2017-04-21
Surface-active compounds, or surfactants, present in atmospheric aerosols are expected to play important roles in the formation of liquid water clouds in the Earth's atmosphere, a central process in meteorology, hydrology, and for the climate system. But because specific extraction and characterization of these compounds have been lacking for decades, very little is known on their identity, properties, mode of action and origins, thus preventing the full understanding of cloud formation and its potential links with the Earth's ecosystems. In this paper we present recently developed methods for 1) the targeted extraction of all the surfactants from atmospheric aerosol samples and for the determination of 2) their absolute concentrations in the aerosol phase and 3) their static surface tension curves in water, including their Critical Micelle Concentration (CMC). These methods have been validated with 9 references surfactants, including anionic, cationic and non-ionic ones. Examples of results are presented for surfactants found in fine aerosol particles (diameter <1 μm) collected at a coastal site in Croatia and suggestions for future improvements and other characterizations than those presented are discussed.
Lindfors, A. V.; Kouremeti, N.; Arola, A.; Kazadzis, S.; Bais, A. F.; Laaksonen, A.
2013-01-01
Pyranometer measurements of the solar surface radiation (SSR) are available at many locations worldwide, often as long time series covering several decades into the past. These data constitute a potential source of information on the atmospheric aerosol load. Here, we present a method for estimating the aerosol optical depth (AOD) using pyranometer measurements of the SSR together with total water vapor column information. The method, which is based on radiative transfer simulations, w...
An insecticidal toxin from Nephila clavata spider venom.
Jin, Lin; Fang, Mingqian; Chen, Mengrou; Zhou, Chunling; Ombati, Rose; Hakim, Md Abdul; Mo, Guoxiang; Lai, Ren; Yan, Xiuwen; Wang, Yumin; Yang, Shilong
2017-07-01
Spiders are the most successful insect predators given that they use their venom containing insecticidal peptides as biochemical weapons for preying. Due to the high specificity and potency of peptidic toxins, discoveries of insecticidal toxins from spider venom have provided an opportunity to obtain natural compounds for agricultural applications without affecting human health. In this study, a novel insecticidal toxin (μ-NPTX-Nc1a) was identified and characterized from the venom of Nephila clavata. Its primary sequence is GCNPDCTGIQCGWPRCPGGQNPVMDKCVSCCPFCPPKSAQG which was determined by automated Edman degradation, cDNA cloning, and MS/MS analysis. BLAST search indicated that Nc1a shows no similarity with known peptides or proteins, indicating that Nc1a belongs to a novel family of insecticidal peptide. Nc1a displayed inhibitory effects on Na V and K V channels in cockroach dorsal unpaired median neurons. The median lethal dose (LD50) of Nc1a on cockroach was 573 ng/g. Herein, a study that identifies a novel insecticidal toxin, which can be a potential candidate and/or template for the development of bioinsecticides, is presented.
Chalbot, M.-C. G.; Brown, J.; Chitranshi, P.; Gamboa da Costa, G.; Pollock, E. D.; Kavouras, I. G.
2014-06-01
The chemical content of water-soluble organic carbon (WSOC) as a function of particle size was characterized in Little Rock, Arkansas in winter and spring 2013. The objectives of this study were to (i) compare the functional characteristics of coarse, fine and ultrafine WSOC and (ii) reconcile the sources of WSOC for periods when carbonaceous aerosol was the most abundant particulate component. The WSOC accounted for 5% of particle mass for particles with dp > 0.96 μm and 10% of particle mass for particles with dp magnetic resonance (1H-NMR). The total non-exchangeable organic hydrogen concentrations varied from 4.1 ± 0.1 nmol m-3 for particles with 1.5 fingerprints of fine particles. Sucrose, fructose, glucose, formate and acetate were associated with coarse particles. These qualitative differences of 1H-NMR profiles for different particle sizes indicated the possible contribution of biological aerosols and a mixture of aliphatic and oxygenated compounds from biomass burning and traffic exhausts. The concurrent presence of ammonium and amines also suggested the presence of ammonium/aminium nitrate and sulfate secondary aerosol. The size-dependent origin of WSOC was further corroborated by the increasing δ13C abundance from -26.81 ± 0.18‰ for the smallest particles to -25.93 ± 0.31‰ for the largest particles and the relative distribution of the functional groups as compared to those previously observed for marine, biomass burning and secondary organic aerosol. The latter also allowed for the differentiation of urban combustion-related aerosol and biological particles. The five types of organic hydrogen accounted for the majority of WSOC for particles with dp > 3.0 μm and dp < 0.96 μm.
Chalbot, M.-C. G.; Brown, J.; Chitranshi, P.; Gamboa da Costa, G.; Pollock, E. D.; Kavouras, I. G.
2014-02-01
The chemical content of the water soluble organic carbon (WSOC) as a function of particle size was characterized in Little Rock, Arkansas in winter and spring 2013. The objectives of this study were to: (i) compare the functional characteristics of coarse, fine and ultrafine WSOC and (ii) reconcile the sources of WSOC for the period when carbonaceous aerosol was the most abundant particulate component. The WSOC accounted for 5% of particle mass for particles with dp > 0.96 μm and 10% of particle mass for particles with dp magnetic resonance. The total non-exchangeable organic hydrogen concentrations varied from 4.1 ± 0.1 nmol m-3 for particles with 0.96 fingerprints of fine particles. Sucrose, fructose, glucose, formate and acetate were associated with coarse particles. These qualitative differences of 1H-NMR profiles for different particle sizes indicated the possible contribution of biological aerosol and a mixture of aliphatic and oxygenated compounds from biomass burning and traffic exhausts. The concurrent presence of ammonium and amines also suggested the presence of ammonium/aminium nitrate and sulfate secondary aerosol. The size-dependent origin of WSOC was further corroborated by the increasing δ13C abundance from -26.81 ± 0.18‰ for the smallest particles to -25.93 ± 0.31‰ for the largest particles and the relative distribution of the functional groups as compared to those previously observed for marine, biomass burning and secondary organic aerosol. The latter also allowed for the differentiation of urban combustion-related aerosol and biological particles. The five types of organic hydrogen accounted for the majority of WSOC for particles with dp > 3.0 μm and dp < 0.96 μm.
Haji, Khamis A; Thawer, Narjis G; Khatib, Bakari O; Mcha, Juma H; Rashid, Abdallah; Ali, Abdullah S; Jones, Christopher; Bagi, Judit; Magesa, Stephen M; Ramsan, Mahdi M; Garimo, Issa; Greer, George; Reithinger, Richard; Ngondi, Jeremiah M
2015-12-09
Indoor residual spraying (IRS) of households with insecticide is a principal malaria vector control intervention in Zanzibar. In 2006, IRS using the pyrethroid lambda-cyhalothrine was introduced in Zanzibar. Following detection of pyrethroid resistance in 2010, an insecticide resistance management plan was proposed, and IRS using bendiocarb was started in 2011. In 2014, bendiocarb was replaced by pirimiphos methyl. This study investigated the residual efficacy of pirimiphos methyl (Actellic 300CS) sprayed on common surfaces of human dwellings in Zanzibar. The residual activity of Actellic 300CS was determined over 9 months through bioassay tests that measured the mortality of female Anopheles mosquitoes, exposed to sprayed surfaces under a WHO cone. The wall surfaces included; mud wall, oil or water painted walls, lime washed wall, un-plastered cement block wall and stone blocks. Insecticide susceptibility testing was done to investigate the resistance status of local malaria vectors against Actellic 300CS using WHO protocols; Anopheline species were identified using PCR methods. Baseline tests conducted one-day post-IRS revealed 100% mortality on all sprayed surfaces. The residual efficacy of Actellic 300CS was maintained on all sprayed surfaces up to 8 months post-IRS. However, the bioassay test conducted 9 months post-IRS showed the 24 h mortality rate to be ≤80% for lime wash, mud wall, water paint and stone block surfaces. Only oil paint surface retained the recommended residual efficacy beyond 9 months post-IRS, with mortality maintained at ≥97 %. Results of susceptibility tests showed that malaria vectors in Zanzibar were fully (100%) susceptible to Actellic 300CS. The predominant mosquito vector species was An. arabiensis (76.0%) in Pemba and An. gambiae (83.5%) in Unguja. The microencapsulated formulation of pirimiphos methyl (Actellic 300CS) is a highly effective and appropriate insecticide for IRS use in Zanzibar as it showed a relatively prolonged
Strong Constraints on Aerosol-Cloud Interactions from Volcanic Eruptions
Malavelle, Florent F.; Haywood, Jim M.; Jones, Andy; Gettelman, Andrew; Clarisse, Lieven; Bauduin, Sophie; Allan, Richard P.; Karset, Inger Helene H.; Kristjansson, Jon Egill; Oreopoulos, Lazaros;
2017-01-01
Aerosols have a potentially large effect on climate, particularly through their interactions with clouds, but the magnitude of this effect is highly uncertain. Large volcanic eruptions produce sulfur dioxide, which in turn produces aerosols; these eruptions thus represent a natural experiment through which to quantify aerosol-cloud interactions. Here we show that the massive 2014-2015 fissure eruption in Holuhraun, Iceland, reduced the size of liquid cloud droplets - consistent with expectations - but had no discernible effect on other cloud properties. The reduction in droplet size led to cloud brightening and global-mean radiative forcing of around minus 0.2 watts per square metre for September to October 2014. Changes in cloud amount or cloud liquid water path, however, were undetectable, indicating that these indirect effects, and cloud systems in general, are well buffered against aerosol changes. This result will reduce uncertainties in future climate projections, because we are now able to reject results from climate models with an excessive liquid-water-path response.
Field Trial of an Aerosol-Based Enclosure Sealing Technology
Energy Technology Data Exchange (ETDEWEB)
Harrington, Curtis [Univ. of California, Davis, CA (United States); Springer, David [Alliance for Residential Building Innovation (ARBI), Davis, CA (United States)
2015-09-01
This report presents the results from several demonstrations of a new method for sealing building envelope air leaks using an aerosol sealing process developed by the Western Cooling Efficiency Center at UC Davis. The process involves pressurizing a building while applying an aerosol sealant to the interior. As air escapes through leaks in the building envelope, the aerosol particles are transported to the leaks where they collect and form a seal that blocks the leak. Standard blower door technology is used to facilitate the building pressurization, which allows the installer to track the sealing progress during the installation and automatically verify the final building tightness. Each aerosol envelope sealing installation was performed after drywall was installed and taped, and the process did not appear to interrupt the construction schedule or interfere with other trades working in the homes. The labor needed to physically seal bulk air leaks in typical construction will not be replaced by this technology.
Buseck, P. R.; Schwartz, S. E.
2003-12-01
uncertainties by "the I-beams". Only an uncertainty range rather than a best estimate is presented for direct aerosol forcing by mineral dust and for indirect aerosol forcing. An assessment of the present level of scientific understanding is indicated at the bottom of the figure (reproduced by permission of Intergovernmental Panel on Climate Change). The importance of atmospheric aerosols to issues of societal concern has motivated much research intended to describe their loading, distribution, and properties and to develop understanding of the controlling processes to address such issues as air pollution, acid deposition, and climate influences of aerosols. However, description based wholly on measurements will inevitably be limited in its spatial and temporal coverage and in the limited characterization of aerosol properties. These limitations are even more serious for predictions of future emissions and provide motivation for concurrent theoretical studies and development of model-based description of atmospheric aerosols.An important long-range goal, which has already been partly realized, is to develop quantitative understanding of the processes that control aerosol loading, composition, and microphysical properties as well as the resultant optical and cloud-nucleating properties. An objective is to incorporate these results into chemical transport models that can be used for predictions. Such models are required, for example, to design approaches to achieve air quality standards and to assess and predict aerosol influences on climate change. Much current research is directed toward enhancing this understanding and to evaluating it by comparison of model results and observations. However, compared to gases, models involving particles are far more complex because of the need to specify additional parameters such as particle sizes and size distributions, compositions as a function of size, particle shapes, and temporal and spatial variations, including reactions that occur
Insecticides suppress natural enemies and increase pest damage in cabbage.
Bommarco, Riccardo; Miranda, Freddy; Bylund, Helena; Björkman, Christer
2011-06-01
Intensive use of pesticides is common and increasing despite a growing and historically well documented awareness of the costs and hazards. The benefits from pesticides of increased yields from sufficient pest control may be outweighed by developed resistance in pests and killing of beneficial natural enemies. Other negative effects are human health problems and lower prices because of consumers' desire to buy organic products. Few studies have examined these trade-offs in the field. Here, we demonstrate that Nicaraguan cabbage (Brassica spp.) farmers may suffer economically by using insecticides as they get more damage by the main pest diamondback moth, Plutella xylostella (L.) (Lepidoptera: Plutellidae), at the same time as they spend economic resources on insecticides. Replicated similarly sized cabbage fields cultivated in a standardized manner were either treated with insecticides according common practice or not treated with insecticides over two seasons. Fields treated with insecticides suffered, compared with nontreated fields, equal or, at least in some periods of the seasons, higher diamondback moth pest attacks. These fields also had increased leaf damage on the harvested cabbage heads. Weight and size of the heads were not affected. The farmers received the same price on the local market irrespective of insecticide use. Rates of parasitized diamondback moth were consistently lower in the treated fields. Negative effects of using insecticides against diamondback moth were found for the density of parasitoids and generalist predatory wasps, and tended to affect spiders negatively. The observed increased leaf damages in insecticide-treated fields may be a combined consequence of insecticide resistance in the pest, and of lower predation and parasitization rates from naturally occurring predators that are suppressed by the insecticide applications. The results indicate biological control as a viable and economic alternative pest management strategy
Aerosols, cloud physics and radiation
International Nuclear Information System (INIS)
Twomey, S.
1990-01-01
Some aspects of climate physics are discussed with special attention given to cases where cloud physics is relevant for the phase and microstructure of clouds and, therefore, in the optical properties of the planet. It is argued that aerosol particles, through their strong effect on cloud microphysics, influence the shortwave energy input to earth, and that cloud microphysics strongly influence rain formation. Therefore, through their influence on microphysics, the aerosols play a central role in the atmospheric water cycle and, thus, on the planet's outgoing radiation. 20 refs
Protective effect and economic impact of insecticide application methods on barley
Directory of Open Access Journals (Sweden)
Alfred Stoetzer
2014-03-01
Full Text Available The objective of this work was to evaluate the protective effect of different forms of insecticide application on the transmission of yellow dwarf disease in barley cultivars, as well as to determine the production costs and the net profit of these managements. The experiments were carried out during 2011 and 2012 growing seasons, using the following managements at main plots: T1, seed treatment with insecticide (ST + insecticide on shoots at 15-day interval; T2, just ST; T3, insecticide applied on shoots, when aphid control level (CL was reached; T4, without insecticide; and T5, ST + insecticide on shoots when CL was reached. Different barley cultivars - BRS Cauê, BRS Brau and MN 6021 - were arranged in the subplots. Insecticides lambda cyhalothrin (pyrethroid and thiamethoxam (neonicotinoid were used. There were differences on yellow dwarf disease index in both seasons for the different treatments, while damage to grain yield was influenced by year and aphid population. Production costs and net profit were different among treatments. Seed treatment with insecticide is sufficient to reduce the transmission of yellow dwarf disease in years with low aphid population pressure, while in years with larger populations, the application of insecticide on shoots is also required.
Directory of Open Access Journals (Sweden)
J. E. Ten Hoeve
2011-04-01
Full Text Available Aerosol, cloud, water vapor, and temperature profile data from the Moderate Resolution Imaging Spectroradiometer (MODIS are utilized to examine the impact of aerosols on clouds during the Amazonian biomass burning season in Rondônia, Brazil. It is found that increasing background column water vapor (CWV throughout this transition season between the Amazon dry and wet seasons likely exerts a strong effect on cloud properties. As a result, proper analysis of aerosol-cloud relationships requires that data be stratified by CWV to account better for the influence of background meteorological variation. Many previous studies of aerosol-cloud interactions over Amazonia have ignored the systematic changes to meteorological factors during the transition season, leading to possible misinterpretation of their results. Cloud fraction (CF is shown to increase or remain constant with aerosol optical depth (AOD, depending on the value of CWV, whereas the relationship between cloud optical depth (COD and AOD is quite different. COD increases with AOD until AOD ~ 0.3, which is assumed to be due to the first indirect (microphysical effect. At higher values of AOD, COD is found to decrease with increasing AOD, which may be due to: (1 the inhibition of cloud development by absorbing aerosols (radiative effect/semi-direct effect and/or (2 a possible retrieval artifact in which the measured reflectance in the visible is less than expected from a cloud top either from the darkening of clouds through the addition of carbonaceous biomass burning aerosols within or above clouds or subpixel dark surface contamination in the measured cloud reflectance. If (1 is a contributing mechanism, as we suspect, then an empirically-derived increasing function between cloud drop number and aerosol concentration, assumed in a majority of global climate models, is inaccurate since these models do not include treatment of aerosol absorption in and around clouds. The relationship between
Carrieri, Arthur H; Copper, Jack; Owens, David J; Roese, Erik S; Bottiger, Jerold R; Everly, Robert D; Hung, Kevin C
2010-01-20
An active spectrophotopolarimeter sensor and support system were developed for a military/civilian defense feasibility study concerning the identification and standoff detection of biological aerosols. Plumes of warfare agent surrogates gamma-irradiated Bacillus subtilis and chicken egg white albumen (analytes), Arizona road dust (terrestrial interferent), water mist (atmospheric interferent), and talcum powders (experiment controls) were dispersed inside windowless chambers and interrogated by multiple CO(2) laser beams spanning 9.1-12.0 microm wavelengths (lambda). Molecular vibration and vibration-rotation activities by the subject analyte are fundamentally strong within this "fingerprint" middle infrared spectral region. Distinct polarization-modulations of incident irradiance and backscatter radiance of tuned beams generate the Mueller matrix (M) of subject aerosol. Strings of all 15 normalized elements {M(ij)(lambda)/M(11)(lambda)}, which completely describe physical and geometric attributes of the aerosol particles, are input fields for training hybrid Kohonen self-organizing map feed-forward artificial neural networks (ANNs). The properly trained and validated ANN model performs pattern recognition and type-classification tasks via internal mappings. A typical ANN that mathematically clusters analyte, interferent, and control aerosols with nil overlap of species is illustrated, including sensitivity analysis of performance.
Remote sensing for studying atmospheric aerosols in Malaysia
Kanniah, Kasturi D.; Kamarul Zaman, Nurul A. F.
2015-10-01
The aerosol system is Southeast Asia is complex and the high concentrations are due to population growth, rapid urbanization and development of SEA countries. Nevertheless, only a few studies have been carried out especially at large spatial extent and on a continuous basis to study atmospheric aerosols in Malaysia. In this review paper we report the use of remote sensing data to study atmospheric aerosols in Malaysia and document gaps and recommend further studies to bridge the gaps. Satellite data have been used to study the spatial and seasonal patterns of aerosol optical depth (AOD) in Malaysia. Satellite data combined with AERONET data were used to delineate different types and sizes of aerosols and to identify the sources of aerosols in Malaysia. Most of the aerosol studies performed in Malaysia was based on station-based PM10 data that have limited spatial coverage. Thus, satellite data have been used to extrapolate and retrieve PM10 data over large areas by correlating remotely sensed AOD with ground-based PM10. Realising the critical role of aerosols on radiative forcing numerous studies have been conducted worldwide to assess the aerosol radiative forcing (ARF). Such studies are yet to be conducted in Malaysia. Although the only source of aerosol data covering large region in Malaysia is remote sensing, satellite observations are limited by cloud cover, orbital gaps of satellite track, etc. In addition, relatively less understanding is achieved on how the atmospheric aerosol interacts with the regional climate system. These gaps can be bridged by conducting more studies using integrated approach of remote sensing, AERONET and ground based measurements.
Energy Technology Data Exchange (ETDEWEB)
Losert, Sabrina; Hess, Adrian [Empa Swiss Federal Laboratories for Materials Science and Technology, Laboratory for Analytical Chemistry (Switzerland); Ilari, Gabriele [Empa Swiss Federal Laboratories for Materials Science and Technology, Electron Microscopy Center (Switzerland); Goetz, Natalie von, E-mail: natalie.von.goetz@chem.ethz.ch; Hungerbuehler, Konrad [ETH Zürich Swiss Federal Institute of Technology Zürich, Institute for Chemical and Bioengineering (Switzerland)
2015-07-15
Nanoparticle-containing sprays are a critical class of consumer products, since human exposure may occur by inhalation of nanoparticles (NP) in the generated aerosols. In this work, the suspension and the released aerosol of six different commercially available consumer spray products were analyzed. Next to a broad spectrum of analytical methods for the characterization of the suspension, a standardized setup for the analysis of aerosol has been used. In addition, a new online coupling technique (SMPS–ICPMS) for the simultaneous analysis of particle size and elemental composition of aerosol particles has been applied. Results obtained with this new method were confirmed by other well-established techniques. Comparison of particles in the original suspensions and in the generated aerosol showed that during spraying single particles of size less than 20 nm had been formed, even though in none of the suspensions particles of size less than 280 nm were present (Aerosol size range scanned: 7–300 nm). Both pump sprays and propellant gas sprays were analyzed and both released particles in the nm size range. Also, both water-based and organic solvent-based sprays released NP. However, a trend was observed that spraying an aqueous suspension contained in a pump spray dispenser after drying resulted in bigger agglomerates than spraying organic suspensions in propellant gas dispensers.
Alpert, P. A.; Radway, J.; Kilthau, W.; Bothe, D.; Knopf, D. A.; Aller, J. Y.
2013-12-01
The oceans cover the majority of the earth's surface, host nearly half the total global primary productivity and are a major source of atmospheric aerosol particles. However, effects of biological activity on sea spray generation and composition, and subsequent cloud formation are not well understood. Our goal is to elucidate these effects which will be particularly important over nutrient rich seas, where microorganisms can reach concentrations of 10^9 per mL and along with transparent exopolymer particles (TEP) can become aerosolized. Here we report the results of mesocosm experiments in which bubbles were generated by two methods, either recirculating impinging water jets or glass frits, in natural or artificial seawater containing bacteria and unialgal cultures of three representative phytoplankton species, Thalassiosira pseudonana, Emiliania huxleyi, and Nannochloris atomus. Over time we followed the size distribution of aerosolized particles as well as their hygroscopicity, heterogeneous ice nucleation potential, and individual physical-chemical characteristics. Numbers of cells and the mass of dissolved and particulate organic carbon (DOC, POC), TEP (which includes polysaccharide-containing microgels and nanogels >0.4 μm in diameter) were determined in the bulk water, the surface microlayer, and aerosolized material. Aerosolized particles were also impacted onto substrates for ice nucleation and water uptake experiments, elemental analysis using computer controlled scanning electron microscopy and energy dispersive analysis of X-rays (CCSEM/EDX), and determination of carbon bonding with scanning transmission X-ray microscopy and near-edge X-ray absorption fine structure spectroscopy (STXM/NEXAFS). Regardless of bubble generation method, the overall concentration of aerosol particles, TEP, POC and DOC increased as concentrations of bacterial and phytoplankton cells increased, stabilized, and subsequently declined. Particles cloud formation and potential
Barbee, Gary C; Stout, Michael J
2009-11-01
Most insecticides used to control rice water weevil (Lissorhoptrus oryzophilus Kuscel) infestations are pyrethroids. However, pyrethroids are highly toxic to non-target crayfish associated with rice-crayfish crop rotations. One solution to the near-exclusive reliance on pyrethroids in a rice-crayfish pest management program is to incorporate neonicotinoid insecticides, which are insect specific and effective against weevils but not extremely toxic to crayfish. This study aimed to take the first step to assess neonicotinoids as alternatives to pyrethroids in rice-crayfish crop rotations by measuring the acute toxicities of three candidate neonicotinoid insecticides, clothianidin, dinotefuran and thiamethoxam, to juvenile Procambarus clarkii (Girard) crayfish and comparing them with the acute toxicities of two currently used pyrethroid insecticides, lambda-cyhalothrin and etofenprox. Neonicotinoid insecticides are at least 2-3 orders of magnitude less acutely toxic (96 h LC(50)) than pyrethroids to juvenile Procambarid crayfish: lambda-cyhalothrin (0.16 microg AI L(-1)) = etofenprox (0.29 microg AI L(-1)) > clothianidin (59 microg AI L(-1)) > thiamethoxam (967 microg AI L(-1)) > dinotefuran (2032 microg AI L(-1)). Neonicotinoid insecticides appear to be much less hazardous alternatives to pyrethroids in rice-crayfish crop rotations. Further field-level neonicotinoid acute and chronic toxicity testing with crayfish is needed. (c) 2009 Society of Chemical Industry.
Energy Technology Data Exchange (ETDEWEB)
Hirano, M. [Sumitomo Chemical Co. Ltd., Osaka (Japan)
1998-06-01
Described herein are the current status and development of insecticides for domestic purposes. For aerosol type cockroach-killing insecticides, oily type is predominant in Japan whereas aqueous type in USA and other countries. They are mixtures of knockdown agents and killing agents, the former being used for their immediate and lethal effects whereas the latter for their lethal effect. In 1996, agents showing high knockdown effects, such as pyrethroids, are registered. Fumigants are used in closed spaces, which are ventilated after they are used. Bait agents contain inducing agents. Recently, ticks become social problems as an allergy source. The insecticides are generally used to remove them, although physical methods, such as cleaning and heat treatment, are effective. They are centered by aerosols and fumigants, but insecticidal sheets are used to some extent. Fleas coming from pets also cause problems. Increased resistance of insects to insecticides has led to development of new types of insecticides, such as those based on organophosphates and those aimed at prevention of their metamorphosis. Commercial insecticides are safe, as long as they are produced in compliance with the Pharmaceutical Affairs Law and used correctly. Nevertheless, however, researches for safer countermeasures against insects are needed. 3 refs., 2 figs., 1 tab.
Marcombe, Sébastien; Poupardin, Rodolphe; Darriet, Frederic; Reynaud, Stéphane; Bonnet, Julien; Strode, Clare; Brengues, Cecile; Yébakima, André; Ranson, Hilary; Corbel, Vincent; David, Jean-Philippe
2009-10-26
The yellow fever mosquito Aedes aegypti is a major vector of dengue and hemorrhagic fevers, causing up to 100 million dengue infections every year. As there is still no medicine and efficient vaccine available, vector control largely based on insecticide treatments remains the only method to reduce dengue virus transmission. Unfortunately, vector control programs are facing operational challenges with mosquitoes becoming resistant to commonly used insecticides. Resistance of Ae. aegypti to chemical insecticides has been reported worldwide and the underlying molecular mechanisms, including the identification of enzymes involved in insecticide detoxification are not completely understood. The present paper investigates the molecular basis of insecticide resistance in a population of Ae. aegypti collected in Martinique (French West Indies). Bioassays with insecticides on adults and larvae revealed high levels of resistance to organophosphate and pyrethroid insecticides. Molecular screening for common insecticide target-site mutations showed a high frequency (71%) of the sodium channel 'knock down resistance' (kdr) mutation. Exposing mosquitoes to detoxification enzymes inhibitors prior to bioassays induced a significant increased susceptibility of mosquitoes to insecticides, revealing the presence of metabolic-based resistance mechanisms. This trend was biochemically confirmed by significant elevated activities of cytochrome P450 monooxygenases, glutathione S-transferases and carboxylesterases at both larval and adult stages. Utilization of the microarray Aedes Detox Chip containing probes for all members of detoxification and other insecticide resistance-related enzymes revealed the significant constitutive over-transcription of multiple detoxification genes at both larval and adult stages. The over-transcription of detoxification genes in the resistant strain was confirmed by using real-time quantitative RT-PCR. These results suggest that the high level of
Energy Technology Data Exchange (ETDEWEB)
Mills, Michael J. [Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research, Boulder Colorado USA; Schmidt, Anja [School of Earth and Environment, University of Leeds, Leeds UK; Easter, Richard [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland Washington USA; Solomon, Susan [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge Massachusetts USA; Kinnison, Douglas E. [Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research, Boulder Colorado USA; Ghan, Steven J. [Atmospheric Sciences and Global Change Division, Pacific Northwest National Laboratory, Richland Washington USA; Neely, Ryan R. [School of Earth and Environment, University of Leeds, Leeds UK; National Centre for Atmospheric Science, University of Leeds, Leeds UK; Marsh, Daniel R. [Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research, Boulder Colorado USA; Conley, Andrew [Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research, Boulder Colorado USA; Bardeen, Charles G. [Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research, Boulder Colorado USA; Gettelman, Andrew [Atmospheric Chemistry Observations and Modeling Laboratory, National Center for Atmospheric Research, Boulder Colorado USA
2016-03-06
Accurate representation of global stratospheric aerosol properties from volcanic and non-volcanic sulfur emissions is key to understanding the cooling effects and ozone-loss enhancements of recent volcanic activity. Attribution of climate and ozone variability to volcanic activity is of particular interest in relation to the post-2000 slowing in the apparent rate of global average temperature increases, and variable recovery of the Antarctic ozone hole. We have developed a climatology of global aerosol properties from 1990 to 2014 calculated based on volcanic and non-volcanic emissions of sulfur sources. We have complied a database of volcanic SO2 emissions and plume altitudes for eruptions between 1990 and 2014, and a new prognostic capability for simulating stratospheric sulfate aerosols in version 5 of the Whole Atmosphere Community Climate Model, a component of the Community Earth System Model. Our climatology shows remarkable agreement with ground-based lidar observations of stratospheric aerosol optical depth (SAOD), and with in situ measurements of aerosol surface area density (SAD). These properties are key parameters in calculating the radiative and chemical effects of stratospheric aerosols. Our SAOD climatology represents a significant improvement over satellite-based analyses, which ignore aerosol extinction below 15 km, a region that can contain the vast majority of stratospheric aerosol extinction at mid- and high-latitudes. Our SAD climatology significantly improves on that provided for the Chemistry-Climate Model Initiative, which misses 60% of the SAD measured in situ. Our climatology of aerosol properties is publicly available on the Earth System Grid.
Giorio, Chiara; Safer, Anton; Sánchez-Bayo, Francisco; Tapparo, Andrea; Lentola, Andrea; Girolami, Vincenzo; van Lexmond, Maarten Bijleveld; Bonmatin, Jean-Marc
2017-11-05
With the exponential number of published data on neonicotinoids and fipronil during the last decade, an updated review of literature has been conducted in three parts. The present part focuses on gaps of knowledge that have been addressed after publication of the Worldwide Integrated Assessment (WIA) on systemic insecticides in 2015. More specifically, new data on the mode of action and metabolism of neonicotinoids and fipronil, and their toxicity to invertebrates and vertebrates, were obtained. We included the newly detected synergistic effects and/or interactions of these systemic insecticides with other insecticides, fungicides, herbicides, adjuvants, honeybee viruses, and parasites of honeybees. New studies have also investigated the contamination of all environmental compartments (air and dust, soil, water, sediments, and plants) as well as bees and apicultural products, food and beverages, and the exposure of invertebrates and vertebrates to such contaminants. Finally, we review new publications on remediation of neonicotinoids and fipronil, especially in water systems. Conclusions of the previous WIA in 2015 are reinforced; neonicotinoids and fipronil represent a major threat worldwide for biodiversity, ecosystems, and all the services the latter provide.
Directory of Open Access Journals (Sweden)
S. Metzger
2012-06-01
Full Text Available Water activity is a key factor in aerosol thermodynamics and hygroscopic growth. We introduce a new representation of water activity (aw, which is empirically related to the solute molality (μs through a single solute specific constant, νi. Our approach is widely applicable, considers the Kelvin effect and covers ideal solutions at high relative humidity (RH, including cloud condensation nuclei (CCN activation. It also encompasses concentrated solutions with high ionic strength at low RH such as the relative humidity of deliquescence (RHD. The constant νi can thus be used to parameterize the aerosol hygroscopic growth over a wide range of particle sizes, from nanometer nucleation mode to micrometer coarse mode particles. In contrast to other aw-representations, our νi factor corrects the solute molality both linearly and in exponent form x · ax. We present four representations of our basic aw-parameterization at different levels of complexity for different aw-ranges, e.g. up to 0.95, 0.98 or 1. νi is constant over the selected aw-range, and in its most comprehensive form, the parameterization describes the entire aw range (0–1. In this work we focus on single solute solutions. νi can be pre-determined with a root-finding method from our water activity representation using an aw−μs data pair, e.g. at solute saturation using RHD and solubility measurements. Our aw and supersaturation (Köhler-theory results compare well with the thermodynamic reference model E-AIM for the key compounds NaCl and (NH42SO4 relevant for CCN modeling and calibration studies. Envisaged applications include regional and global atmospheric chemistry and
Papanikolaou, Nikos E; Kalaitzaki, Argyro; Karamaouna, Filitsa; Michaelakis, Antonios; Papadimitriou, Vassiliki; Dourtoglou, Vassilis; Papachristos, Dimitrios P
2018-04-01
The insecticidal activity of a new nano-formulated natural pyrethrin was examined on the cotton aphid, Aphis gossypii Glover (Hemiptera: Aphididae), and the predators Coccinella septempunctata L. (Coleoptera: Coccinellidae) and Macrolophus pygmaeus Rambur (Hemiptera: Miridae), in respect with the nano-scale potential to create more effective and environmentally responsible pesticides. Pyrethrin was nano-formulated in two water-in-oil micro-emulsions based on safe biocompatible materials, i.e., lemon oil terpenes as dispersant, polysorbates as stabilizers, and mixtures of water with glycerol as the dispersed aqueous phase. Laboratory bioassays showed a superior insecticidal effect of the pyrethrin micro-emulsions compared to two commercial suspension concentrates of natural pyrethrins against the aphid. The nano-formulated pyrethrins were harmless, in terms of caused mortality and survival time, to L3 larvae and four-instar nymphs of the predators C. septempunctata and M. pygmaeus, respectively. We expect that these results can contribute to the application of nano-technology in optimization of pesticide formulation, with further opportunities in the development of effective plant protection products compatible with integrated pest management practices.
Aerosol metrology: aerodynamic and electrostatic techniques
International Nuclear Information System (INIS)
Prodi, V.
1988-01-01
Aerosols play an ever increasing role in science, engineering and especially in industrial and environmental hygiene. They are being studied since a long time, but only recently the progress in aerosol instrumentation has made it possible to pose of aerosol metrology, especially the problem of absolute measurements, as based directly on measurements of fundamental quantities. On the basis of absolute measurements, the hierarchy of standards can be prepared and adequately disseminated. In the aerosol field, the quantities to be measured are mainly size, charge, density, and shape. In this paper a possible standardisation framework for aerosols is proposed, for the main physical quantities
Directory of Open Access Journals (Sweden)
Y.-L. Zhang
2018-03-01
Full Text Available Water-soluble organic carbon (WSOC is a large fraction of organic aerosols (OA globally and has significant impacts on climate and human health. The sources of WSOC remain very uncertain in polluted regions. Here we present a quantitative source apportionment of WSOC, isolated from aerosols in China using radiocarbon (14C and offline high-resolution time-of-flight aerosol mass spectrometer measurements. Fossil emissions on average accounted for 32–47 % of WSOC. Secondary organic carbon (SOC dominated both the non-fossil and fossil derived WSOC, highlighting the importance of secondary formation to WSOC in severe winter haze episodes. Contributions from fossil emissions to SOC were 61 ± 4 and 50 ± 9 % in Shanghai and Beijing, respectively, significantly larger than those in Guangzhou (36 ± 9 % and Xi'an (26 ± 9 %. The most important primary sources were biomass burning emissions, contributing 17–26 % of WSOC. The remaining primary sources such as coal combustion, cooking and traffic were generally very small but not negligible contributors, as coal combustion contribution could exceed 10 %. Taken together with earlier 14C source apportionment studies in urban, rural, semi-urban and background regions in Asia, Europe and the USA, we demonstrated a dominant contribution of non-fossil emissions (i.e., 75 ± 11 % to WSOC aerosols in the Northern Hemisphere; however, the fossil fraction is substantially larger in aerosols from East Asia and the eastern Asian pollution outflow, especially during winter, due to increasing coal combustion. Inclusion of our findings can improve a modelling of effects of WSOC aerosols on climate, atmospheric chemistry and public health.
Yancey Piens, D.; Kelly, S. T.; OBrien, R. E.; Wang, B.; Petters, M. D.; Laskin, A.; Gilles, M. K.
2014-12-01
The hygroscopic behavior of atmospheric aerosols influences their optical and cloud-nucleation properties, and therefore affects climate. Although changes in particle size as a function of relative humidity have often been used to quantify the hygroscopic behavior of submicron aerosol particles, it has been noted that calculations of hygroscopicity based on size contain error due to particle porosity, non-ideal volume additivity and changes in surface tension. We will present a method to quantify the hygroscopic behavior of submicron aerosol particles based on changes in mass, rather than size, as a function of relative humidity. This method results from a novel experimental approach combining scanning transmission x-ray microscopy with near-edge x-ray absorption fine spectroscopy (STXM/NEXAFS), as well as scanning electron microscopy with energy dispersive x-ray spectroscopy (SEM/EDX) on the same individual particles. First, using STXM/NEXAFS, our methods are applied to aerosol particles of known composition ‒ for instance ammonium sulfate, sodium bromide and levoglucosan ‒ and validated by theory. Then, using STXM/NEXAFS and SEM/EDX, these methods are extended to mixed atmospheric aerosol particles collected in the field at the DOE Atmospheric Radiation Measurement (ARM) Climate Research Facility at the Southern Great Planes sampling site in Oklahoma, USA. We have observed and quantified a range of hygroscopic behaviors which are correlated to the composition and morphology of individual aerosol particles. These methods will have implications for parameterizing aerosol mixing state and cloud-nucleation activity in atmospheric models.
CALIPSO-Inferred Aerosol Direct Radiative Effects: Bias Estimates Using Ground-Based Raman Lidars
Thorsen, Tyler; Fu, Qiang
2016-01-01
Observational constraints on the change in the radiative energy budget caused by the presence of aerosols, i.e. the aerosol direct radiative effect (DRE), have recently been made using observations from the Cloud- Aerosol Lidar and Infrared Pathfinder Satellite (CALIPSO). CALIPSO observations have the potential to provide improved global estimates of aerosol DRE compared to passive sensor-derived estimates due to CALIPSO's ability to perform vertically-resolved aerosol retrievals over all surface types and over cloud. In this study we estimate the uncertainties in CALIPSO-inferred aerosol DRE using multiple years of observations from the Atmospheric Radiation Measurement (ARM) program's Raman lidars (RL) at midlatitude and tropical sites. Examined are assumptions about the ratio of extinction-to-backscatter (i.e. the lidar ratio) made by the CALIPSO retrievals, which are needed to retrieve the aerosol extinction profile. The lidar ratio is shown to introduce minimal error in the mean aerosol DRE at the top-of-atmosphere and surface. It is also shown that CALIPSO is unable to detect all radiatively-significant aerosol, resulting in an underestimate in the magnitude of the aerosol DRE by 30-50%. Therefore, global estimates of the aerosol DRE inferred from CALIPSO observations are likely too weak.
Estimation of Downwelling Surface Longwave Radiation under Heavy Dust Aerosol Sky
Directory of Open Access Journals (Sweden)
Chunlei Wang
2017-02-01
Full Text Available The variation of aerosols, especially dust aerosol, in time and space plays an important role in climate forcing studies. Aerosols can effectively reduce land surface longwave emission and re-emit energy at a colder temperature, which makes it difficult to estimate downwelling surface longwave radiation (DSLR with satellite data. Using the latest atmospheric radiative transfer code (MODTRAN 5.0, we have simulated the outgoing longwave radiation (OLR and DSLR under different land surface types and atmospheric profile conditions. The results show that dust aerosol has an obvious “warming” effect to longwave radiation compared with other aerosols; that aerosol longwave radiative forcing (ALRF increased with the increasing of aerosol optical depth (AOD; and that the atmospheric water vapor content (WVC is critical to the understanding of ALRF. A method is proposed to improve the accuracy of DSLR estimation from satellite data for the skies under heavy dust aerosols. The AOD and atmospheric WVC under cloud-free conditions with a relatively simple satellite-based radiation model yielding the high accurate DSLR under heavy dust aerosol are used explicitly as model input to reduce the effects of dust aerosol on the estimation of DSLR. Validations of the proposed model with satellites data and field measurements show that it can estimate the DSLR accurately under heavy dust aerosol skies. The root mean square errors (RMSEs are 20.4 W/m2 and 24.2 W/m2 for Terra and Aqua satellites, respectively, at the Yingke site, and the biases are 2.7 W/m2 and 9.6 W/m2, respectively. For the Arvaikheer site, the RMSEs are 23.2 W/m2 and 19.8 W/m2 for Terra and Aqua, respectively, and the biases are 7.8 W/m2 and 10.5 W/m2, respectively. The proposed method is especially applicable to acquire relatively high accurate DSLR under heavy dust aerosol using MODIS data with available WVC and AOD data.
Directory of Open Access Journals (Sweden)
Kingsley C. Kanu
2016-11-01
Full Text Available The indiscriminate use of pesticide is a treat to non-target organisms. This study evaluates the haematological and biochemical changes induced by inhalation of local Nigerian dichlorvos insecticide on rats. The rats were randomly assigned to a control group which received only food and water and a test group which, in addition to food and water, was exposed to the pesticide for a period of 4 h daily for 28 days, after which exposure was discontinued for seven days. Five animals were sacrificed from each group on days 1, 7, 14, 21, 28 and 35, and blood was collected by cardiac puncture for haematological, biochemical and antioxidant analysis. Results obtained showed lowered values of red blood cell count (RBC, packed cell volume (PCV, haemoglobin, mean cell haemoglobin (MCH and mean cell haemoglobin concentration (MCHC (p < 0.05 with increased white blood cell count (WBC and platelet counts after day 14 when compared to the control group. Liver enzymes aspartate amino transaminase (AST and alanine amino transaminase (ALT were higher in the exposed rats compared to the control group (p < 0.05. Urea and creatinine concentrations increased significantly after day 1 and at day 28, while superoxide dismutase (SOD, gluthathione (GSH and catalase (CAT activity increased significantly compared to the control after day 1, day 14 and day 21, respectively. The RBC, PCV and haemoglobin values of all exposed rats were restored to normal following withdrawal of the pesticide, though AST, ALT, urea, creatinine and, glutathione values remained significantly high compared to the control. Inhalation of the local insecticide is toxic to the blood, liver and kidney of laboratory rats and may be deleterious to human health following long-term exposure.
Directory of Open Access Journals (Sweden)
T. Koop
2009-12-01
Full Text Available Interactions with water are crucial for the properties, transformation and climate effects of atmospheric aerosols. Here we present a conceptual framework for the interaction of amorphous aerosol particles with water vapor, outlining characteristic features and differences in comparison to crystalline particles. We used a hygroscopicity tandem differential mobility analyzer (H-TDMA to characterize the hydration and dehydration of crystalline ammonium sulfate, amorphous oxalic acid and amorphous levoglucosan particles (diameter ~100 nm, relative humidity 5–95% at 298 K. The experimental data and accompanying Köhler model calculations provide new insights into particle microstructure, surface adsorption, bulk absorption, phase transitions and hygroscopic growth. The results of these and related investigations lead to the following conclusions:
(1 Many organic substances, including carboxylic acids, carbohydrates and proteins, tend to form amorphous rather than crystalline phases upon drying of aqueous solution droplets. Depending on viscosity and microstructure, the amorphous phases can be classified as glasses, rubbers, gels or viscous liquids.
(2 Amorphous organic substances tend to absorb water vapor and undergo gradual deliquescence and hygroscopic growth at lower relative humidity than their crystalline counterparts.
(3 In the course of hydration and dehydration, certain organic substances can form rubber- or gel-like structures (supramolecular networks and undergo transitions between swollen and collapsed network structures.
(4 Organic gels or (semi-solid amorphous shells (glassy, rubbery, ultra-viscous with low molecular diffusivity can kinetically limit the uptake and release of water and may influence the hygroscopic growth and activation of aerosol particles as cloud condensation nuclei (CCN and ice nuclei (IN. Moreover, (semi-solid amorphous phases may influence the uptake of gaseous photo
Directory of Open Access Journals (Sweden)
S. E. Bauer
2008-10-01
Full Text Available A new aerosol microphysical module MATRIX, the Multiconfiguration Aerosol TRacker of mIXing state, and its application in the Goddard Institute for Space Studies (GISS climate model (ModelE are described. This module, which is based on the quadrature method of moments (QMOM, represents nucleation, condensation, coagulation, internal and external mixing, and cloud-drop activation and provides aerosol particle mass and number concentration and particle size information for up to 16 mixed-mode aerosol populations. Internal and external mixing among aerosol components sulfate, nitrate, ammonium, carbonaceous aerosols, dust and sea-salt particles are represented. The solubility of each aerosol population, which is explicitly calculated based on its soluble and insoluble components, enables calculation of the dependence of cloud drop activation on the microphysical characterization of multiple soluble aerosol populations.
A detailed model description and results of box-model simulations of various aerosol population configurations are presented. The box model experiments demonstrate the dependence of cloud activating aerosol number concentration on the aerosol population configuration; comparisons to sectional models are quite favorable. MATRIX is incorporated into the GISS climate model and simulations are carried out primarily to assess its performance/efficiency for global-scale atmospheric model application. Simulation results were compared with aircraft and station measurements of aerosol mass and number concentration and particle size to assess the ability of the new method to yield data suitable for such comparison. The model accurately captures the observed size distributions in the Aitken and accumulation modes up to particle diameter 1 μm, in which sulfate, nitrate, black and organic carbon are predominantly located; however the model underestimates coarse-mode number concentration and size, especially in the marine environment
International Nuclear Information System (INIS)
Geogdzhayev, Igor V.; Mishchenko, Michael I.; Liu Li; Remer, Lorraine
2004-01-01
We present an update on the status of the global climatology of the aerosol column optical thickness and Angstrom exponent derived from channel-1 and -2 radiances of the Advanced Very High Resolution Radiometer (AVHRR) in the framework of the Global Aerosol Climatology Project (GACP). The latest version of the climatology covers the period from July 1983 to September 2001 and is based on an adjusted value of the diffuse component of the ocean reflectance as derived from extensive comparisons with ship sun-photometer data. We use the updated GACP climatology and Stratospheric Aerosol and Gas Experiment (SAGE) data to analyze how stratospheric aerosols from major volcanic eruptions can affect the GACP aerosol product. One possible retrieval strategy based on the AVHRR channel-1 and -2 data alone is to infer both the stratospheric and the tropospheric aerosol optical thickness while assuming fixed microphysical models for both aerosol components. The second approach is to use the SAGE stratospheric aerosol data in order to constrain the AVHRR retrieval algorithm. We demonstrate that the second approach yields a consistent long-term record of the tropospheric aerosol optical thickness and Angstrom exponent. Preliminary comparisons of the GACP aerosol product with MODerate resolution Imaging Spectrometer (MODIS) and Multiangle Imaging Spectro-Radiometer aerosol retrievals show reasonable agreement, the GACP global monthly optical thickness being lower than the MODIS one by approximately 0.03. Larger differences are observed on a regional scale. Comparisons of the GACP and MODIS Angstrom exponent records are less conclusive and require further analysis
Lin, X; Jiang, Y; Zhang, L; Cai, Y
2017-12-04
Spodoptera litura is a widespread polyphagous insect pest that can develop resistance and cross-resistance to insecticides, making it difficult to control. Insecticide exposure has previously been linked with induction of specific olfactory-related proteins, including some chemosensory proteins (CSPs) and odorant-binding proteins (OPBs), which may disrupt detection of environmental factors and reduce fitness. However, functional evidence supporting insecticide and OBPs/CSPs mediation remains unknown. Here we fed male S. litura moths with sucrose water containing one of three insecticides, chlorpyrifos, emamectin benzoate or fipronil, and used real-time quantitative polymerase chain reaction and RNAi to investigate OBPs and CSPs expression and their correlations with survival. Chlorpyrifos and emamectin benzoate increased expression of 78% of OBPs, plus 63 and 56% of CSP genes, respectively, indicating a major impact on these gene families. RNAi knockdown of SlituCSP18, followed by feeding with chlorpyrifos or fipronil, decreased survival rates of male moths significantly compared with controls. Survival rate also decreased significantly with the downregulation of SlituOBP9 followed by feeding with chlorpyrifos. Thus, although these three insecticides had different effects on OBP and CSP gene expression, we hypothesize that SlituOBPs and SlituCSPs might mediate their effects by increasing their expression levels to improve survival. Moreover, the differential response of S. litura male moths to the three insecticides indicated the potential specificity of chlorpyrifos affect SlituCSP18 and SlituOBP9 expression.
Czech Academy of Sciences Publication Activity Database
Vojtěšek, Martin; Mikuška, Pavel; Večeřa, Zbyněk; Křůmal, Kamil
2012-01-01
Roč. 92, č. 4 (2012), s. 432-449 ISSN 0306-7319 R&D Projects: GA MŽP SP/1A3/148/08; GA MŽP SP/1B7/189/07; GA MŽP SP/1A3/55/08 Institutional research plan: CEZ:AV0Z40310501 Keywords : atmospheric aerosols * metals * continuous aerosol collector Subject RIV: CB - Analytical Chemistry, Separation Impact factor: 1.240, year: 2012
Energy Technology Data Exchange (ETDEWEB)
Esselborn, Michael
2008-07-01
In the frame of this thesis a high-resolution spectral LIDAR (HSRL) was used for the field study SAMUM during May/June 2006 and January/February 2008 on board of the research aircraft Falcon. The intensity of the LIDAR signals are mainly influences by backscattering and extinction of atmospheric particles (aerosols). Using a narrow-band optical filter the HSRL allows the measurement of the molecular backscattering besides the total atmospheric backscattering. During SAMUM-1 the optical properties of the Sahara dust aerosols were measured for the first time, esp. its extinction, the ratio extinction/backscattering and the depolarization close to the source region. The results of the optical density of the aerosols were compared with satellite-based data. South of the Atlas-mountains optical aerosol densities in the range of 0.50 to 0.60 were measured.
Directory of Open Access Journals (Sweden)
N. Meskhidze
2011-11-01
Full Text Available Marine organic aerosol emissions have been implemented and evaluated within the National Center of Atmospheric Research (NCAR's Community Atmosphere Model (CAM5 with the Pacific Northwest National Laboratory's 7-mode Modal Aerosol Module (MAM-7. Emissions of marine primary organic aerosols (POA, phytoplankton-produced isoprene- and monoterpenes-derived secondary organic aerosols (SOA and methane sulfonate (MS− are shown to affect surface concentrations of organic aerosols in remote marine regions. Global emissions of submicron marine POA is estimated to be 7.9 and 9.4 Tg yr−1, for the Gantt et al. (2011 and Vignati et al. (2010 emission parameterizations, respectively. Marine sources of SOA and particulate MS− (containing both sulfur and carbon atoms contribute an additional 0.2 and 5.1 Tg yr−1, respectively. Widespread areas over productive waters of the Northern Atlantic, Northern Pacific, and the Southern Ocean show marine-source submicron organic aerosol surface concentrations of 100 ng m−3, with values up to 400 ng m−3 over biologically productive areas. Comparison of long-term surface observations of water insoluble organic matter (WIOM with POA concentrations from the two emission parameterizations shows that despite revealed discrepancies (often more than a factor of 2, both Gantt et al. (2011 and Vignati et al. (2010 formulations are able to capture the magnitude of marine organic aerosol concentrations, with the Gantt et al. (2011 parameterization attaining better seasonality. Model simulations show that the mixing state of the marine POA can impact the surface number concentration of cloud condensation nuclei (CCN. The largest increases (up to 20% in CCN (at a supersaturation (S of 0.2% number concentration are obtained over biologically productive ocean waters when marine organic aerosol is assumed to be externally mixed with sea-salt. Assuming
Seixas, Gonçalo; Grigoraki, Linda; Weetman, David; Vicente, José Luís; Silva, Ana Clara; Pinto, João; Vontas, John; Sousa, Carla Alexandra
2017-07-01
Aedes aegypti is a major mosquito vector of arboviruses, including dengue, chikungunya and Zika. In 2005, Ae. aegypti was identified for the first time in Madeira Island. Despite an initial insecticide-based vector control program, the species expanded throughout the Southern coast of the island, suggesting the presence of insecticide resistance. Here, we characterized the insecticide resistance status and the underlying mechanisms of two populations of Ae. aegypti from Madeira Island, Funchal and Paúl do Mar. WHO susceptibility bioassays indicated resistance to cyfluthrin, permethrin, fenitrothion and bendiocarb. Use of synergists significantly increased mortality rates, and biochemical assays indicated elevated activities of detoxification enzymes, suggesting the importance of metabolic resistance. Microarray-based transcriptome analysis detected significant upregulation in both populations of nine cytochrome P450 oxidase genes (including four known pyrethroid metabolizing enzymes), the organophosphate metabolizer CCEae3a, Glutathione-S-transferases, and multiple putative cuticle proteins. Genotyping of knockdown resistance loci linked to pyrethroid resistance revealed fixation of the 1534C mutation, and presence with moderate frequencies of the V1016I mutation in each population. Significant resistance to three major insecticide classes (pyrethroid, carbamate and organophosphate) is present in Ae. aegypti from Madeira Island, and appears to be mediated by multiple mechanisms. Implementation of appropriate resistance management strategies including rotation of insecticides with alternative modes of action, and methods other than chemical-based vector control are strongly advised to delay or reverse the spread of resistance and achieve efficient control.
Insecticides promote viral outbreaks by altering herbivore competition.
Pan, Huipeng; Preisser, Evan L; Chu, Dong; Wang, Shaoli; Wu, Qingjun; Carriére, Yves; Zhou, Xuguo; Zhang, Youjun
2015-09-01
While the management of biological invasions is often characterized by a series of single-specieg decisions, invasive species exist within larger food webs. These biotic interactions can alter the impact of control/eradication programs and may cause suppression efforts to inadvertently facilitate invasion spread and impact. We document the rapid replacement of the invasive Bemisia Middle East-Asia Minor I (MEAM1) cryptic biotype by the cryptic Mediterranean (MED) biotype throughout China and demonstrate that MED is more tolerant of insecticides and a better vector of tomato yellow leaf curl virus (TYLCV) than MEAMJ. While MEAM1 usually excludes MED under natural conditions, insecticide application reverses the MEAM1-MED competitive hierarchy and allows MED to exclude MEAMI. The insecticide-mediated success of MED has led to TYLCV outbreaks throughout China. Our work strongly supports the hypothesis that insecticide use in China reverses the MEAMl-MED competitive hierarchy and allows MED to displace MEAM1 in managed landscapes. By promoting the dominance of a Bemisia species that is a competent viral vector, insecticides thus increase the spread and impact of TYLCV in heterogeneous agroecosystems.
Sensitivity of warm-frontal processes to cloud-nucleating aerosol concentrations
Igel, Adele L.; Van Den Heever, Susan C.; Naud, Catherine M.; Saleeby, Stephen M.; Posselt, Derek J.
2013-01-01
An extratropical cyclone that crossed the United States on 9-11 April 2009 was successfully simulated at high resolution (3-km horizontal grid spacing) using the Colorado State University Regional Atmospheric Modeling System. The sensitivity of the associated warm front to increasing pollution levels was then explored by conducting the same experiment with three different background profiles of cloud-nucleating aerosol concentration. To the authors' knowledge, no study has examined the indirect effects of aerosols on warm fronts. The budgets of ice, cloud water, and rain in the simulation with the lowest aerosol concentrations were examined. The ice mass was found to be produced in equal amounts through vapor deposition and riming, and the melting of ice produced approximately 75% of the total rain. Conversion of cloud water to rain accounted for the other 25%. When cloud-nucleating aerosol concentrations were increased, significant changes were seen in the budget terms, but total precipitation remained relatively constant. Vapor deposition onto ice increased, but riming of cloud water decreased such that there was only a small change in the total ice production and hence there was no significant change in melting. These responses can be understood in terms of a buffering effect in which smaller cloud droplets in the mixed-phase region lead to both an enhanced vapor deposition and decreased riming efficiency with increasing aerosol concentrations. Overall, while large changes were seen in the microphysical structure of the frontal cloud, cloud-nucleating aerosols had little impact on the precipitation production of the warm front.