Sample records for water year wy
-
Smith, Kirk P.
2015-01-01
Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate loads of sodium and chloride during water year (WY) 2013 (October 1, 2012, through September 30, 2013) for tributaries to the Scituate Reservoir, Rhode Island. Streamflow and water-quality data used in the study were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board (PWSB) in the cooperative study. Streamflow was measured or estimated by the USGS following standard methods at 23 streamgages; 14 of these streamgages are equipped with instrumentation capable of continuously monitoring water level, specific conductance, and water temperature. Water-quality samples were collected at 37 sampling stations by the PWSB and at 14 continuous-record streamgages by the USGS during WY 2013 as part of a long-term sampling program; all stations are in the Scituate Reservoir drainage area. Water-quality data collected by the PWSB are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2013.
-
Temperature impacts on the water year 2014 drought in California
Shukla, Shraddhanand; Safeeq, Mohammad; AghaKouchak, Amir; Guan, Kaiyu; Funk, Christopher C.
2015-01-01
California is experiencing one of the worst droughts on record. Here we use a hydrological model and risk assessment framework to understand the influence of temperature on the water year (WY) 2014 drought in California and examine the probability that this drought would have been less severe if temperatures resembled the historical climatology. Our results indicate that temperature played an important role in exacerbating the WY 2014 drought severity. We found that if WY 2014 temperatures resembled the 1916–2012 climatology, there would have been at least an 86% chance that winter snow water equivalent and spring-summer soil moisture and runoff deficits would have been less severe than the observed conditions. We also report that the temperature forecast skill in California for the important seasons of winter and spring is negligible, beyond a lead-time of one month, which we postulate might hinder skillful drought prediction in California.
-
Compound list: WY-14643 [Open TG-GATEs
Lifescience Database Archive (English)
Full Text Available WY-14643 WY 00030 ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Human/in_v...itro/WY-14643.Human.in_vitro.Liver.zip ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Rat/in_vitro/W...Y-14643.Rat.in_vitro.Liver.zip ftp://ftp.biosciencedbc.jp/archive/open-tggates/LATEST/Rat/in_vivo/Liver/Sing...le/WY-14643.Rat.in_vivo.Liver.Single.zip ftp://ftp.biosciencedbc.jp/archive/open-
-
Smith, Kirk P.
2016-05-03
Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate loads of sodium and chloride during water year (WY) 2014 (October 1, 2013, through September 30, 2014) for tributaries to the Scituate Reservoir, Rhode Island. Streamflow and water-quality data used in the study were collected by the U.S. Geological Survey and the Providence Water Supply Board in the cooperative study. Streamflow was measured or estimated by the U.S. Geological Survey following standard methods at 23 streamgages; 14 of these streamgages are equipped with instrumentation capable of continuously monitoring water level, specific conductance, and water temperature. Water-quality samples were collected at 37 sampling stations by the Providence Water Supply Board and at 14 continuous-record streamgages by the U.S. Geological Survey during WY 2014 as part of a long-term sampling program; all stations are in the Scituate Reservoir drainage area. Water-quality data collected by the Providence Water Supply Board are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2014.The largest tributary to the reservoir (the Ponaganset River, which was monitored by the U.S. Geological Survey) contributed a mean streamflow of 23 cubic feet per second to the reservoir during WY 2014. For the same time period, annual mean streamflows measured (or estimated) for the other monitoring stations in this study ranged from about 0.35 to about 14 cubic feet per second. Together, tributaries (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,200,000 kilograms of sodium and 2,100,000 kilograms of chloride to the Scituate Reservoir during WY 2014; sodium and chloride yields for the tributaries ranged from 7,700 to 45,000 kilograms per year per
-
Breault, Robert F.; Campbell, Jean P.
2010-01-01
Streamflow and water-quality data were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board, Rhode Island's largest drinking-water supplier. Streamflow was measured or estimated by the USGS following standard methods at 23 streamgage stations; 10 of these stations were also equipped with instrumentation capable of continuously monitoring specific conductance. Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate instantaneous (15-minute) loads of sodium and chloride during water year (WY) 2006 (October 1, 2005, to September 30, 2006). Water-quality samples were also collected at 37 sampling stations in the Scituate Reservoir drainage area by the Providence Water Supply Board during WY 2006 as part of a long-term sampling program. Water-quality data are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2006. The largest tributary to the reservoir (the Ponaganset River, which was monitored by the USGS) contributed about 42 cubic feet per second (ft3/s) to the reservoir during WY 2006. For the same time period, annual mean streamflows1 measured (or estimated) for the other monitoring stations in this study ranged from about 0.60 to 26 ft3/s. Together, tributary streams (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,600,000 kilograms (kg) of sodium and 2,500,000 kg of chloride to the Scituate Reservoir during WY 2006; sodium and chloride yields for the tributaries ranged from 15,000 to 100,000 kilograms per square mile (kg/mi2) and from 22,000 to 180,000 kg/mi2, respectively. At the stations where water-quality samples were collected by the Providence Water Supply Board, the median of the median chloride concentrations was 24.6 milligrams per liter
-
Breault, Robert F.; Campbell, Jean P.
2010-01-01
Streamflow and water-quality data were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board, Rhode Island's largest drinking-water supplier. Streamflow was measured or estimated by the USGS following standard methods at 23 streamgage stations; 10 of these stations were also equipped with instrumentation capable of continuously monitoring specific conductance. Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate instantaneous (15-minute) loads of sodium and chloride during water year (WY) 2003 (October 1, 2002, to September 30, 2003). Water-quality samples were also collected at 37 sampling stations in the Scituate Reservoir drainage area by the Providence Water Supply Board during WY 2003 as part of a long-term sampling program. Water-quality data are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2003. The largest tributary to the reservoir (the Ponaganset River, which was monitored by the USGS) contributed about 31 cubic feet per second (ft3/s) to the reservoir during WY 2003. For the same time period, annual mean streamflows1 measured (or estimated) for the other monitoring stations in this study ranged from about 0.44 to 20 ft3/s. Together, tributary streams (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,200,000 kilograms (kg) of sodium and 1,900,000 kg of chloride to the Scituate Reservoir during WY 2003; sodium and chloride yields for the tributaries ranged from 10,000 to 61,000 kilograms per square mile (kg/mi2) and from 15,000 to 100,000 kg/mi2, respectively. At the stations where water-quality samples were collected by the Providence Water Supply Board, the median of the median chloride concentrations was 21.3 milligrams per liter
-
Breault, Robert F.; Campbell, Jean P.
2010-01-01
Streamflow and water-quality data were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board, Rhode Island’s largest drinking-water supplier. Streamflow was measured or estimated by the USGS following standard methods at 23 streamgage stations; 10 of these stations were also equipped with instrumentation capable of continuously monitoring specific conductance. Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate instantaneous (15-minute) loads of sodium and chloride during water year (WY) 2005 (October 1, 2004, to September 30, 2005). Water-quality samples were also collected at 37 sampling stations in the Scituate Reservoir drainage area by the Providence Water Supply Board during WY 2005 as part of a long-term sampling program. Water-quality data are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2005. The largest tributary to the reservoir (the Ponaganset River, which was monitored by the USGS) contributed about 30 cubic feet per second (ft3/s) to the reservoir during WY 2005. For the same time period, annual mean streamflows1 measured (or estimated) for the other monitoring stations in this study ranged from about 0.42 to 19 ft3/s. Together, tributary streams (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,300,000 kilograms (kg) of sodium and 2,000,000 kg of chloride to the Scituate Reservoir during WY 2005; sodium and chloride yields for the tributaries ranged from 13,000 to 77,000 kilograms per square mile (kg/mi2) and from 19,000 to 130,000 kg/mi2, respectively. At the stations where water-quality samples were collected by the Providence Water Supply Board, the median of the median chloride concentrations was 25.3 milligrams per
-
Breault, Robert F.; Campbell, Jean P.
2010-01-01
Streamflow and water-quality data were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board, Rhode Island's largest drinking-water supplier. Streamflow was measured or estimated by the USGS following standard methods at 23 streamgage stations; 10 of these stations were also equipped with instrumentation capable of continuously monitoring specific conductance. Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate instantaneous (15-minute) loads of sodium and chloride during water year (WY) 2004 (October 1, 2003, to September 30, 2004). Water-quality samples were also collected at 37 sampling stations in the Scituate Reservoir drainage area by the Providence Water Supply Board during WY 2004 as part of a long-term sampling program. Water-quality data are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2004. The largest tributary to the reservoir (the Ponaganset River, which was monitored by the USGS) contributed about 27 cubic feet per second (ft3/s) to the reservoir during WY 2004. For the same time period, annual mean1 streamflows measured (or estimated) for the other monitoring stations in this study ranged from about 0.42 to 19 ft3/s. Together, tributary streams (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,100,000 kilograms (kg) of sodium and 1,700,000 kg of chloride to the Scituate Reservoir during WY 2004; sodium and chloride yields for the tributaries ranged from 12,000 to 61,000 kilograms per square mile (kg/mi2) and from 17,000 to 100,000 kg/mi2, respectively. At the stations where water-quality samples were collected by the Providence Water Supply Board, the median of the median chloride concentrations was 24.8 milligrams per liter
-
Smith, Kirk P.
2018-05-11
Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate loads of sodium and chloride during water year (WY) 2015 (October 1, 2014, through September 30, 2015) for tributaries to the Scituate Reservoir, Rhode Island. Streamflow and water-quality data used in the study were collected by the U.S. Geological Survey and the Providence Water Supply Board. Streamflow was measured or estimated by the U.S. Geological Survey following standard methods at 23 streamgages; 14 of these streamgages are equipped with instrumentation capable of continuously monitoring water level, specific conductance, and water temperature. Water-quality samples were collected at 36 sampling stations by the Providence Water Supply Board and at 14 continuous-record streamgages by the U.S. Geological Survey during WY 2015 as part of a long-term sampling program; all stations are in the Scituate Reservoir drainage area. Water-quality data collected by the Providence Water Supply Board are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2015.The largest tributary to the reservoir (the Ponaganset River, which was monitored by the U.S. Geological Survey) contributed a mean streamflow of 25 cubic feet per second to the reservoir during WY 2015. For the same time period, annual mean streamflows measured (or estimated) for the other monitoring stations in this study ranged from about 0.38 to about 14 cubic feet per second. Together, tributaries (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,500,000 kilograms of sodium and 2,400,000 kilograms of chloride to the Scituate Reservoir during WY 2015; sodium and chloride yields for the tributaries ranged from 8,000 to 54,000 kilograms per square mile and from 12,000 to 91
-
Smith, Kirk P.
2014-01-01
Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate loads of sodium and chloride during water year (WY) 2012 (October 1, 2011, through September 30, 2012), for tributaries to the Scituate Reservoir, Rhode Island. Streamflow and water-quality data used in the study were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board (PWSB). Streamflow was measured or estimated by the USGS following standard methods at 23 streamgages; 14 of these streamgages were equipped with instrumentation capable of continuously monitoring water level, specific conductance, and water temperature. Water-quality samples were collected at 37 sampling stations by the PWSB and at 14 continuous-record streamgages by the USGS during WY 2012 as part of a long-term sampling program; all stations were in the Scituate Reservoir drainage area. Water-quality data collected by the PWSB were summarized by using values of central tendency and used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2012. The largest tributary to the reservoir (the Ponaganset River, which was monitored by the USGS) contributed a mean streamflow of about 26 cubic feet per second (ft3/s) to the reservoir during WY 2012. For the same time period, annual mean1 streamflows measured (or estimated) for the other monitoring stations in this study ranged from about 0.40 to about 17 ft3/s. Together, tributaries (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,100,000 kilograms (kg) of sodium and 1,900,000 kg of chloride to the Scituate Reservoir during WY 2012; sodium and chloride yields for the tributaries ranged from 8,700 to 51,000 kilograms per square mile (kg/mi2) and from 14,000 to 87,000 kg/mi2, respectively. At the stations where water-quality samples were collected
-
Smith, Kirk P.
2013-01-01
Streamflow and concentrations of sodium and chloride estimated from records of specific conductance were used to calculate loads of sodium and chloride during water year (WY) 2011 (October 1, 2010, to September 30, 2011), for tributaries to the Scituate Reservoir, Rhode Island. Streamflow and water-quality data used in the study were collected by the U.S. Geological Survey (USGS) or the Providence Water Supply Board (PWSB). Streamflow was measured or estimated by the USGS following standard methods at 23 streamgages; 14 of these streamgages were also equipped with instrumentation capable of continuously monitoring water level, specific conductance, and water temperature. Water-quality samples also were collected at 37 sampling stations by the PWSB and at 14 continuous-record streamgages by the USGS during WY 2011 as part of a long-term sampling program; all stations were in the Scituate Reservoir drainage area. Water-quality data collected by PWSB are summarized by using values of central tendency and are used, in combination with measured (or estimated) streamflows, to calculate loads and yields (loads per unit area) of selected water-quality constituents for WY 2011. The largest tributary to the reservoir (the Ponaganset River, which was monitored by the USGS) contributed a mean streamflow of about 37 cubic feet per second (ft3/s) to the reservoir during WY 2011. For the same time period, annual mean1 streamflows measured (or estimated) for the other monitoring stations in this study ranged from about 0.5 to about 21 ft3/s. Together, tributaries (equipped with instrumentation capable of continuously monitoring specific conductance) transported about 1,600,000 kg (kilograms) of sodium and 2,600,000 kg of chloride to the Scituate Reservoir during WY 2011; sodium and chloride yields for the tributaries ranged from 9,800 to 53,000 kilograms per square mile (kg/mi2) and from 15,000 to 90,000 kg/mi2, respectively. At the stations where water-quality samples were
-
Financial Analysis of Experimental Releases Conducted at Glen Canyon Dam during Water Year 2015
Energy Technology Data Exchange (ETDEWEB)
Graziano, D. J. [Argonne National Lab. (ANL), Argonne, IL (United States); Poch, L. A. [Argonne National Lab. (ANL), Argonne, IL (United States); Veselka, T. D. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-11-01
This report examines the financial implications of experimental flows conducted at the Glen Canyon Dam (GCD) in water year (WY) 2015. It is the seventh report in a series examining the financial implications of experimental flows conducted since the Record of Decision (ROD) was adopted in February 1997 (Reclamation 1996). A report released in January 2011 examined WYs 1997 to 2005 (Veselka et al. 2011); a report released in August 2011 examined WYs 2006 to 2010 (Poch et al. 2011); a report released June 2012 examined WY 2011 (Poch et al. 2012); a report released April 2013 examined WY 2012 (Poch et al. 2013); a report released June 2014 examined WY 2013 (Graziano et al. 2014); and a report released September 2015 examined WY 2014 (Graziano et al. 2015). An experimental release may have either a positive or negative impact on the financial value of energy production. Only one experimental release was conducted at GCD in WY 2015; specifically, a high flow experimental (HFE) release conducted in November 2014. For this experimental release, financial costs of approximately $2.1 million were incurred because the HFE required sustained water releases that exceeded the powerplant’s maximum flow rate. In addition, during the month of the experiment, operators were not allowed to shape GCD power production to either follow firm power customer loads or to respond to market prices. This study identifies the main factors that contribute to HFE costs and examines the interdependencies among these factors. It applies an integrated set of tools to estimate financial impacts by simulating the GCD operations under two scenarios: (1) a baseline scenario that mimics both HFE operations during the experiment and during the rest of the year when it complies with the 1996 ROD operating criteria, and (2) a “without experiments” scenario that is identical to the baseline except it assumes that the HFE did not occur. The Generation and Transmission Maximization (GTMax) model was the
-
2013-05-02
...-AA08 Special Local Regulation; Wy-Hi Rowing Regatta, Trenton Channel; Detroit River, Wyandotte, MI..., during, and immediately after the Wy-Hi Rowing Regatta. This special local regulation will establish... to read as follows: Sec. 100.T09-0287 Special Local Regulation; Wy-Hi Rowing Regatta, Wyandotte, MI...
-
Energy Technology Data Exchange (ETDEWEB)
None
1993-12-31
This report contains environmental monitoring information for the following UMTRA sites for the 1992 Calendar Year: Lakeview, OR; Lowman, ID; Mexican Hat, UT; Monument Valley, AZ; Rifle, CO; Riverton, WY; Shiprock, NM; Spook, WY; Tuba City, AZ. Each site report contains a site description, compliance summary, environmental program information, environmental radiological and non-radiological program information, water resources protection, and quality assurance information.
-
International Nuclear Information System (INIS)
1993-01-01
This report contains environmental monitoring information for the following UMTRA sites for the 1992 Calendar Year: Lakeview, OR; Lowman, ID; Mexican Hat, UT; Monument Valley, AZ; Rifle, CO; Riverton, WY; Shiprock, NM; Spook, WY; Tuba City, AZ. Each site report contains a site description, compliance summary, environmental program information, environmental radiological and non-radiological program information, water resources protection, and quality assurance information
-
Activation of PPARα by Wy-14643 ameliorates systemic lipopolysaccharide-induced acute lung injury
International Nuclear Information System (INIS)
Yoo, Seong Ho; Abdelmegeed, Mohamed A.; Song, Byoung-Joon
2013-01-01
Highlights: •Activation of PPARα attenuated LPS-mediated acute lung injury. •Pretreatment with Wy-14643 decreased the levels of IFN-γ and IL-6 in ALI. •Nitrosative stress and lipid peroxidation were downregulated by PPARα activation. •PPARα agonists may be potential therapeutic targets for acute lung injury. -- Abstract: Acute lung injury (ALI) is a major cause of mortality and morbidity worldwide. The activation of peroxisome proliferator-activated receptor-α (PPARα) by its ligands, which include Wy-14643, has been implicated as a potential anti-inflammatory therapy. To address the beneficial efficacy of Wy-14643 for ALI along with systemic inflammation, the in vivo role of PPARα activation was investigated in a mouse model of lipopolysaccharide (LPS)-induced ALI. Using age-matched Ppara-null and wild-type mice, we demonstrate that the activation of PPARα by Wy-14643 attenuated LPS-mediated ALI. This was evidenced histologically by the significant alleviation of inflammatory manifestations and apoptosis observed in the lung tissues of wild-type mice, but not in the corresponding Ppara-null mice. This protective effect probably resulted from the inhibition of LPS-induced increases in pro-inflammatory cytokines and nitroxidative stress levels. These results suggest that the pharmacological activation of PPARα might have a therapeutic effect on LPS-induced ALI
-
Activation of PPARα by Wy-14643 ameliorates systemic lipopolysaccharide-induced acute lung injury
Energy Technology Data Exchange (ETDEWEB)
Yoo, Seong Ho, E-mail: yoosh@snu.ac.kr [Seoul National University Hospital, Biomedical Research Institute and Institute of Forensic Medicine, Seoul National University College of Medicine, Seoul (Korea, Republic of); Abdelmegeed, Mohamed A. [Laboratory of Membrane Biochemistry and Biophysics, National Institute on Alcohol Abuse and Alcoholism, Bethesda, MD (United States); Song, Byoung-Joon, E-mail: bj.song@nih.gov [Laboratory of Membrane Biochemistry and Biophysics, National Institute on Alcohol Abuse and Alcoholism, Bethesda, MD (United States)
2013-07-05
Highlights: •Activation of PPARα attenuated LPS-mediated acute lung injury. •Pretreatment with Wy-14643 decreased the levels of IFN-γ and IL-6 in ALI. •Nitrosative stress and lipid peroxidation were downregulated by PPARα activation. •PPARα agonists may be potential therapeutic targets for acute lung injury. -- Abstract: Acute lung injury (ALI) is a major cause of mortality and morbidity worldwide. The activation of peroxisome proliferator-activated receptor-α (PPARα) by its ligands, which include Wy-14643, has been implicated as a potential anti-inflammatory therapy. To address the beneficial efficacy of Wy-14643 for ALI along with systemic inflammation, the in vivo role of PPARα activation was investigated in a mouse model of lipopolysaccharide (LPS)-induced ALI. Using age-matched Ppara-null and wild-type mice, we demonstrate that the activation of PPARα by Wy-14643 attenuated LPS-mediated ALI. This was evidenced histologically by the significant alleviation of inflammatory manifestations and apoptosis observed in the lung tissues of wild-type mice, but not in the corresponding Ppara-null mice. This protective effect probably resulted from the inhibition of LPS-induced increases in pro-inflammatory cytokines and nitroxidative stress levels. These results suggest that the pharmacological activation of PPARα might have a therapeutic effect on LPS-induced ALI.
-
WY14,643, a PPARα ligand, attenuates expression of anti-glomerular basement membrane disease
Archer, D C; Frkanec, J T; Cromwell, J; Clopton, P; Cunard, R
2007-01-01
Peroxisome proliferator-activated receptor alpha (PPARα) ligands are medications used to treat hyperlipidaemia and atherosclerosis. Increasing evidence suggests that these agents are immunosuppressive. In the following studies we demonstrate that WY14,643, a PPARα ligand, attenuates expression of anti-glomerular basement membrane disease (AGBMD). C57BL/6 mice were fed 0·05% WY14,643 or control food and immunized with the non-collagenous domain of the α3 chain of Type IV collagen [α3(IV) NC1] in complete Freund's adjuvant (CFA). WY14,643 reduced proteinuria and greatly improved glomerular and tubulo-interstitial lesions. However, the PPARα ligand did not alter the extent of IgG-binding to the GBM. Immunohistochemical studies revealed that the prominent tubulo-interstitial infiltrates in the control-fed mice consisted predominately of F4/80+ macrophages and WY14,643-feeding decreased significantly the number of renal macrophages. The synthetic PPARα ligand also reduced significantly expression of the chemokine, monocyte chemoattractant protein (MCP)-1/CCL2. Sera from mice immunized with AGBMD were also evaluated for antigen-specific IgGs. There was a significant increase in the IgG1 : IgG2c ratio and a decline in the intrarenal and splenocyte interferon (IFN)-γ mRNA expression in the WY14,643-fed mice, suggesting that the PPARα ligand could skew the immune response to a less inflammatory T helper 2-type of response. These studies suggest that PPARα ligands may be a novel treatment for inflammatory renal disease. PMID:17888025
-
WY14,643, a PPARalpha ligand, attenuates expression of anti-glomerular basement membrane disease.
Archer, D C; Frkanec, J T; Cromwell, J; Clopton, P; Cunard, R
2007-11-01
Peroxisome proliferator-activated receptor alpha (PPARalpha) ligands are medications used to treat hyperlipidaemia and atherosclerosis. Increasing evidence suggests that these agents are immunosuppressive. In the following studies we demonstrate that WY14,643, a PPARalpha ligand, attenuates expression of anti-glomerular basement membrane disease (AGBMD). C57BL/6 mice were fed 0.05% WY14,643 or control food and immunized with the non-collagenous domain of the alpha3 chain of Type IV collagen [alpha3(IV) NC1] in complete Freund's adjuvant (CFA). WY14,643 reduced proteinuria and greatly improved glomerular and tubulo-interstitial lesions. However, the PPARalpha ligand did not alter the extent of IgG-binding to the GBM. Immunohistochemical studies revealed that the prominent tubulo-interstitial infiltrates in the control-fed mice consisted predominately of F4/80(+) macrophages and WY14,643-feeding decreased significantly the number of renal macrophages. The synthetic PPARalpha ligand also reduced significantly expression of the chemokine, monocyte chemoattractant protein (MCP)-1/CCL2. Sera from mice immunized with AGBMD were also evaluated for antigen-specific IgGs. There was a significant increase in the IgG1 : IgG2c ratio and a decline in the intrarenal and splenocyte interferon (IFN)-gamma mRNA expression in the WY14,643-fed mice, suggesting that the PPARalpha ligand could skew the immune response to a less inflammatory T helper 2-type of response. These studies suggest that PPARalpha ligands may be a novel treatment for inflammatory renal disease.
-
50 years of change at 14 headwater snowmelt-dominated watersheds in Wyoming
Voutchkova, D. D.; Miller, S. N.
2017-12-01
Wyoming is a headwater state contributing to the water resources of four major US basins: Columbia River, Colorado River, Great Basin, and Missouri River. Most of the annual precipitation in this semi-arid state is received at high elevations as snow. Water availability for drinking water supply, reservoir storage, industrial, agricultural, and ecological needs - all depends on the variable and potentially changing annual snowmelt. Thus, characterizing snowmelt and snowmelt-dominated runoff variability and change at high-elevation headwater watersheds in Wyoming is of utmost importance. Next to quantifying variability and changes in total precipitation, snow-water equivalent (SWE), annual runoff and low flows at 14 selected and representative high-elevation watersheds during the previous 50 years, we also explore past watershed disturbances. Wildfires, forest management (e.g. timber harvest), and recent bark beetle outbakes have altered the vegetation and potentially the hydrology of these high-elevation watersheds. We present a synthesis and trend analysis of 49-75 complete water years (wy) of daily streamflow data for 14 high-elevation watersheds, 25-36 complete wy of daily SWE and precipitation data for the closest SNOTEL stations, and spatiotemporal data on burned areas for 20 wy, tree mortality for 18 wy, timber harvest during the 20th century, as well as overview on legacy tie-drive related distrbances. These results are discussed with respect to the differing watershed characteristics in order to present a spectrum of possible hydrologic responses. The importance of our work lies in extending our understanding of snowmelt headwater annual runoff and low-flow dynamics in Wyoming specifically. Such regional synthesis would inform and facilitate water managers and planners both at local state-wide level, but also in the intermountain US West.
-
Several Diorhabda spp. beetles (Chrysomelidae) have been released and established as biological control agents of salt-cedar plants (Tamarisk spp.) in the western USA, whose defoliation over several years begins to kill Tamarisk plants. Although Diorhabda carinulata has established in northern WY (L...
-
Impacts of Land-Use and Land-Cover Changes on Water Yield: A Case Study in Jing-Jin-Ji, China
Directory of Open Access Journals (Sweden)
Suxiao Li
2018-03-01
Full Text Available Knowing the impact of land-use and land-cover (LULC changes on the distribution of water yield (WY is essential for water resource management. Using the Integrated Valuation of Ecosystem Services and Tradeoffs (InVEST model, we investigated the spatial-temporal variations of WY from 1990 to 2015 in China’s northern semi-arid region of Beijing–Tianjin–Hebei (Jing-Jin-Ji. We quantified the combined effects of LULC dynamics and climatic variation on WY. Furthermore, we identified the relative contribution of main LULC types to WY. For our study region, the built-up area increased by 35.66% (5380 km2 during the study period. In the meantime, cropland, grassland, and wetland decreased continuously. The expansion of built-up area and decline of vegetated land led to an increase of 1047 million m3 (5.1% in total WY. The impacts of LULC changes on WY were mainly determined by the biophysical characteristics of LULC composition. Vegetated land has relatively lower WY coefficients due to higher rates of evapotranspiration and water infiltration. Built-up areas and bare land have higher WY coefficients as a result of their impermeable surface. The spatial-temporal analysis of WY with specification of WY coefficients by LULC types can facilitate integrated land-use planning and water resource management.
-
Directory of Open Access Journals (Sweden)
Fabio Mascaro Querido
2013-04-01
Full Text Available A emergência da crise ecológica, como sintoma mais nítido de uma verdadeira crise civilizató-ria, impôs novos desafios ao pensamento crítico e, em especial, ao marxismo. Partindo desse pressuposto, o objetivo deste artigo é apresentar a defesa de Michael Löwy de uma radicalização ecossocialista da crítica marxista da modernidade, tarefa para a qual a grande recusa de Walter Benjamin das ideologias do pro- gresso é uma das fontes decisivas de inspiração. Para Michael Löwy, a ruptura com as ideologias do progresso e com o paradigma civilizatório capitalista moderno é uma condição indispensável para a atua-lização ecossocialista do marxismo.The emergence of the ecological crisis as a clearer symptom of a true civilizatory crisis has imposed new challenges to critical thought and, in particular, to Marxism. Based on this assumption, this article aims to present Michael Löwy's defense of an ecosocialist radicalization of the Marxist critique of modernity, a task for which Walter Benjamin's great refusal of the ideologies of progress is one of the critical sources of inspiration. To Michael Löwy, breaking away from the ideologies of progress and from the modern capitalistic civilizatory paradigm is a prerequisite for the ecosocialist updating of Marxism.
-
Alterations in 'water yield' associated with land use changes under different precipitation regime
Rohatyn, Shani; Ramati, Efrat; Tatarinov, Fyodor; Rotenberg, Eyal; Tas, Eran; Yakir, Dan
2016-04-01
Changes in rainfall regimes and land cover results in complex alterations in plant water use and in ecosystem water balance, which are not well quantified. This results in poor estimates of the 'water yield' (WY; the difference between precipitation, P, input and evapotranspiration, ET, losses), which provides the water available for runoff and re-charge, and ultimately also for human consumption. The objective of this study was to examine the interactions between the effects of land use change (from sparse shrubland to pine forest) on ecosystem WY, and changes in the precipitation regime (from humid Mediterranean to semi-arid conditions). We hypothesized that the forestation increased ET and reduced WY, but this impact diminishes with decreasing precipitation. We used a new approach centered on a custom-built mobile laboratory of eddy co-variance measurements deployed on a campaign basis (about two weeks per site repeated along the seasonal cycle), that allowed us to measure ecosystem-scale ET together with carbon and energy fluxes and meteorological parameters. Measurements were carried out between the years of 2012-2015 in three paired sites of Pinus halepensis forests and adjacent non-forest ecosystems along the rainfall gradient in Israel, from 755 to 290 mm in annual precipitation. Annual ET was estimated from the campaigns results based on multiple regression analyses with meteorological parameters (relative humidity, RH, temperature, T, and global radiation, Rg) from local meteorological stations that provided continuous data records. The results indicated that decrease in annual precipitation by a factor of ~2.5, resulted in decrease in ET by a factor of 2.4 from 685 mm, with WY=210 mm, in the humid forest, to 290 mm, with WY= 0 mm, in the dry forest. In the non-forest ecosystems ET showed relatively small decrease (by a factor of 1.3) from 285 mm, with WY=460 mm, to 220 mm, with WY=95 mm. The differences 'Forest-shrubland' in ET decreased from 400 mm to
-
Andersson, Lovisa
2016-01-01
Citizens of Sweden are now facing a large shift in their habits of managing money transferring using mobile phones. They are now forced to use an application called WyWallet when making purchases with cell-phones. WyWallet is an application based on a new EU-directive that has led to a law concerning the new payment service act that wants to prevent money laundering and terrorist financing. This has led to a lot of consequences for the citizens and also other agencies relying on donations via...
-
Dynamic Consolidation and Investigation of Nanostructural W-Cu / W-Y Cylindrical Billets
Godibadze, B.; Dgebuadze, A.; Chagelishvili, E.; Mamniashvili, G.; Peikrishvili, A.
2018-03-01
The main purpose of presented work is to obtain W-Cu & W-Y cylindrical bulk nanostructured billets by explosive consolidation technology (ECT) in hot condition, with low porosity near to theoretical densities and improved physical / mechanical properties. Nanocomposites were subjected to densification into cylindrical steel tube containers using hot explosive consolidation (HEC) technology to fabricate high dense cylindrical billets. The first stage : Preliminary explosive densification of the precursor powder blend is carried out at room temperature with a loading intensity up to 10GPa to increase the initial density and to activate the particle surfaces in the blend. The second stage investigation were carried out for the same already predensified billets, but consolidation were conducted in hot conditions, after heating of samples in between 940-11000C, the intensity of loading was equal to 10GPa. Consolidated different type of W-Cu composition containing 10-40% of nanoscale W, during investigation showed that the combination of high temperatures (above 940°C) and two-stage shock wave compression was beneficial to the consolidation of the incompatible pair W-Cu composites, resulting in high densities, good integrity and good electronic properties. The structure and property of the samples obtained, depended on the sizes of tungsten particles. It was established that in comparison with W-Cu composites with coarse tungsten the application of nanoscale W precursors and depending of content of W gives different result. Tungsten is a prime material candidate for the first wall of a future fusion reactor. In this study, the microstructure and microhardness of tungsten-yttrium (W-Y) composites were investigated as a function of Y doping content (0.5÷2 wt. %). It was found that the crystallite sizes and the powder particle sizes were increased as a result of the increase of Y content. Nearly fully dense materials were obtained for W-Y alloys when the Y content was
-
Ecossocialismo, romantismo e (autocrítica da modernidade em Michael Löwy
Directory of Open Access Journals (Sweden)
Fabio Mascaro Querido
2008-12-01
Full Text Available Partindo da concreticidade da crise ecológica e das transformações contemporâneas no âmbito dos processos de acumulação capitalista, o objetivo geral deste artigo é versar algumas notas preliminares a propósito da perspectiva teórica e política do assim chamado ecossocialismo, tal qual formulado em Michael Löwy. “Corrente de pensamento e de ação” cuja resposta à crise ecológica, a um só tempo romântica e socialista, constitui igualmente uma crítica às potencialidades destrutivas contidas no interior do paradigma societário e produtivo da modernidade. Neste trajeto, busca -se uma aproximação à apropriação löwiniana da obra de Walter Benjamin, especialmente de sua crítica do “progresso” moderno e das ideologias apologetas da “modernização”. Almeja -se assim antever a forma através da qual Michael Löwy e os ecossocialistas respondem às profundas transformações da (pós modernidade capitalista contemporânea, com ênfase particular sobre um argumento central projetado na obra do intelectual franco -brasileiro, qual seja: a defesa da necessidade de que o marxismo radicalize “sua crítica da modernidade, do paradigma da civilização ocidental, industrial, moderna, burguesa” (LÖWY, 2000c, p.242, argumento que o levaria, já em meados da década de 1980, a valorizar as potencialidades revolucionárias subjacentes a crítica romântica da modernidade. Por fim, indaga -se sobre a projeção ecossocialista da necessidade de superação revolucionária do paradigma civilizatório propalado pelo capitalismo moderno
-
Zhao, H.; Vance, G.F.; Urynowicz, M.A.; Gregory, R.W.
2009-01-01
Coalbed natural gas (CBNG) development in western U.S. states has resulted in an increase in an essential energy resource, but has also resulted in environmental impacts and additional regulatory needs. A concern associated with CBNG development relates to the production of the copious quantities of potentially saline-sodic groundwater required to recover the natural gas, hereafter referred to as CBNG water. Management of CBNG water is a major environmental challenge because of its quantity and quality. In this study, a locally available Na-rich natural zeolite (clinoptilolite) from Wyoming (WY) was examined for its potential to treat CBNG water to remove Na+ and lower the sodium adsorption ratio (SAR, mmol1/2 L- 1/2). The zeolite material was Ca-modified before being used in column experiments. Column breakthrough studies indicated that a metric tonne (1000??kg) of Ca-WY-zeolite could be used to treat 60,000??L of CBNG water in order to lower SAR of the CBNG water from 30 to an acceptable level of 10??mmol1/2 L- 1/2. An integrated treatment process using Na-WY-zeolite for alternately treating hard water and CBNG water was also examined for its potential to treat problematic waters in the region. Based on the results of this study, use of WY-zeolite appears to be a cost-effective water treatment technology for maximizing the beneficial use of poor-quality CBNG water. Ongoing studies are evaluating water treatment techniques involving infiltration ponds lined with zeolite. ?? 2008 Elsevier B.V. All rights reserved.
-
Sorenson, Jason R.; Granato, Gregory E.; Smith, Kirk P.
2018-01-10
Flow-proportional composite water samples were collected in water years 2013 and 2014 by the U.S. Geological Survey, in cooperation with the Massachusetts Department of Environmental Protection, from the Blackstone River at Millville, Massachusetts (U.S. Geological Survey station 01111230), about 0.5 mile from the border with Rhode Island. Samples were collected in order to better understand the dynamics of selected nutrient and metal constituents, assist with planning, guide activities to meet water-quality goals, and provide real-time water-quality information to the public. An automated system collected the samples at 14-day intervals to determine total and dissolved nitrogen and phosphorus concentrations, to provide accurate monthly nutrient concentration data, and to calculate monthly load estimates. Concentrations of dissolved trace metals and total aluminum were determined from 4-day composite water samples that were collected twice monthly by the automated system. Results from 4-day composites provide stakeholders with information to evaluate trace metals on the basis of chronic 4-day exposure criteria for aquatic life, and the potential to use the biotic ligand model to evaluate copper concentrations. Nutrient, trace metal, suspended sediment, dissolved organic carbon, and chlorophyll a concentrations were determined from discrete samples collected at the Millville station and from across the stream transect at the upstream railroad bridge, and these concentrations served as a means to evaluate the representativeness of the Millville point location.Analytical results from samples collected with the automated flow-proportional sampling system provided the means to calculate monthly and annual loading data. Total nitrogen and total phosphorus loads in water year (WY) 2013 were about 447,000 and 36,000 kilograms (kg), respectively. In WY 2014, annual loads of total nitrogen and total phosphorus were about 342,000 and 21,000 kg, respectively. Total nitrogen
-
Directory of Open Access Journals (Sweden)
Anna Baczko-Dombi
2017-12-01
Full Text Available Badania związane ze szkolnictwem wyższym są polem zróżnicowanym i pełnym sprzeczności. Z jednej strony bardzo cenione jest podejście interdyscyplinarne i porównania międzykrajowe, z drugiej zaś prowadzonym badaniom zarzuca się zbytnią lokalność. Stan badań w poszczególnych krajach zależy od uwarunkowań instytucjonalnych i historycznych. Widoczny jest rozdźwięk między badaniami stricte naukowymi a stosowanymi, typowymi dla sfery ewaluacji i przygotowywanymi na potrzeby budowania samowiedzy uczelni lub tworzenia polityk publicznych. W artykule omówiono funkcjonowanie takich badań w praktyce, oparto się na literaturze dotyczącej stanu badań nad szkolnictwem wyższym, omówiono ich potencjał naukowy, a także niektóre wyzwania i bariery związane z realizacją takich celów na przykładzie wybranych badań prowadzonych na Uniwersytecie Warszawskim.
-
Zhou, X; Wen, G; Ringseis, R; Eder, K
2014-01-01
Recent studies in rodents demonstrated that peroxisome proliferator-activated receptor α (PPARα), a central regulator of energy homeostasis, is an important transcriptional regulator of the gene encoding the carnitine transporter novel organic cation transporter 2 (OCTN2). Less is known with regard to the regulation of OCTN2 by PPARα and its role for carnitine transport in cattle, even though PPARα activation physiologically occurs in the liver of high-producing cows during early lactation. To explore the role of PPARα for OCTN2 expression and carnitine transport in cattle, we studied the effect of the PPARα activator WY-14,643 on the expression of OCTN2 in the presence and absence of PPARα antagonists and on OCTN2-mediated carnitine transport in the Madin-Darby bovine kidney (MDBK) cell line. The results show that WY-14,643 increases mRNA and protein levels of OCTN2, whereas co-treatment of MDBK cells with WY-14,643 and the PPARα antagonist GW6471 blocks the WY-14,643-induced increase in mRNA and protein levels of OCTN2 in bovine cells. In addition, treatment of MDBK cells with WY-14,643 stimulates specifically Na(+)-dependent carnitine uptake in MDBK cells, which is likely the consequence of the increased carnitine transport capacity of cells due to the elevated expression of OCTN2. In conclusion, our results indicate that OCTN2 expression and carnitine transport in cattle, as in rodents, are regulated by PPARα. Copyright © 2014 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.
-
Thiros, Susan A.
2017-03-23
The U.S. Geological Survey (USGS), in cooperation with the Colorado River Basin Salinity Control Forum, studied trends in dissolved-solids loads at selected sites in and near the Uinta Basin, Utah. The Uinta Basin study area includes the Duchesne River Basin and the Middle Green River Basin in Utah from below Flaming Gorge Reservoir to the town of Green River.Annual dissolved-solids loads for water years (WY) 1989 through 2013 were estimated for 16 gaging stations in the study area using streamflow and water-quality data from the USGS National Water Information System database. Eight gaging stations that monitored catchments with limited or no agricultural land use (natural subbasins) were used to assess loads from natural sources. Four gaging stations that monitored catchments with agricultural land in the Duchesne River Basin were used to assess loads from agricultural sources. Four other gaging stations were included in the dissolved-solids load and trend analysis to help assess the effects of agricultural areas that drain to the Green River in the Uinta Basin, but outside of the Duchesne River Basin.Estimated mean annual dissolved-solids loads for WY 1989–2013 ranged from 1,520 tons at Lake Fork River above Moon Lake, near Mountain Home, Utah (UT), to 1,760,000 tons at Green River near Green River, UT. The flow-normalized loads at gaging stations upstream of agricultural activities showed no trend or a relatively small change. The largest net change in modeled flow-normalized load was -352,000 tons (a 17.8-percent decrease) at Green River near Green River, UT.Annual streamflow and modeled dissolved-solids loads at the gaging stations were balanced between upstream and downstream sites to determine how much water and dissolved solids were transported to the Duchesne River and a section of the Green River, and how much was picked up in each drainage area. Mass-balance calculations of WY 1989–2013 mean annual dissolved-solids loads at the studied sites show
-
2011-07-13
..., Inc., Ross In Situ Recovery Uranium Project, Crook County, WY; Notice of Materials License Application...-4737, or by e-mail to [email protected] . The Ross In Situ Recovery Uranium Project License... source and byproduct materials license at its Ross In Situ Recovery Uranium Project site located in Crook...
-
International Nuclear Information System (INIS)
Woods, Courtney G.; Kosyk, Oksana; Bradford, Blair U.; Ross, Pamela K.; Burns, Amanda M.; Cunningham, Michael L.; Qu Pingping; Ibrahim, Joseph G.; Rusyn, Ivan
2007-01-01
Administration of peroxisome proliferators to rodents causes proliferation of peroxisomes, induction of β-oxidation enzymes, hepatocellular hypertrophy and hyperplasia, with chronic exposure ultimately leading to hepatocellular carcinomas. Many responses associated with peroxisome proliferators are nuclear receptor-mediated events involving peroxisome proliferators-activated receptor alpha (PPARα). A role for nuclear receptor-independent events has also been shown, with evidence of Kupffer cell-mediated free radical production, presumably through NAPDH oxidase, induction of redox-sensitive transcription factors involved in cytokine production and cytokine-mediated cell replication following acute treatment with peroxisome proliferators in rodents. Recent studies have demonstrated, by using p47 phox -null mice which are deficient in NADPH oxidase, that this enzyme is not related to the phenotypic events caused by prolonged administration of peroxisome proliferators. In an effort to determine the timing of the transition from Kupffer cell-to PPARα-dependent modulation of peroxisome proliferator effects, gene expression was assessed in liver from Pparα-null, p47 phox -null and corresponding wild-type mice following treatment with 4-chloro-6-(2,3-xylidino)-pyrimidynylthioacetic acid (WY-14,643) for 8 h, 24 h, 72 h, 1 week or 4 weeks. WY-14,643-induced gene expression in p47 phox -null mouse liver differed substantially from wild-type mice at acute doses and striking differences in baseline expression of immune related genes were evident. Pathway mapping of genes that respond to WY-14,643 in a time- and dose-dependent manner demonstrates suppression of immune response, cell death and signal transduction and promotion of lipid metabolism, cell cycle and DNA repair. Furthermore, these pathways were largely dependent on PPARα, not NADPH oxidase demonstrating a temporal shift in response to peroxisome proliferators. Overall, this study shows that NADPH oxidase
-
Therapeutic Effects of Water Extract of Arisaema Erubescens Tubers ...
African Journals Online (AJOL)
Purpose: To investigate the anti-arthritic activity of the water extract of Rhizoma Arisaematis (WERA) using collagen II .... Plethysmometer PV-200 (ChengDu Technology. & Market Co. ..... Chung WY. Red ginseng saponin extract attenuates.
-
Directory of Open Access Journals (Sweden)
Shichang Kang
2017-08-01
New hydrological insights: A water isotope framework for the Nam Co basin, including the Local Meteoric Water Line, limiting isotopic composition of evaporation and two hypothetical evaporation trajectories, is established. We further applied the isotope mass balance model to estimate the overall isotopic composition of input water to the Nam Co, the evaporation over inputs ratios (E/I for three consecutive years, and the water yields (Wy, depth equivalent runoff at a basin scale. Our results clearly suggest a positive water budget (i.e., E/I < 1, providing another line of evidence that the subsurface leakage from Nam Co is likely. The discrepancy between isotope-based water yields estimations and field-based runoff observations suggest that, compared to the well-studied Nyainqentanglha Mountains and southwestern mountains, the ridge-and-valley landscape in the western highlands and northwestern hogbacks are possibly low yields area, which should draw more research attentions in future hydrological investigations.
-
Energy Technology Data Exchange (ETDEWEB)
1982-01-01
Under the with-project scenario, WyCoalGas is projected to make a difference in the long-range future of Converse County. Because of the size of the proposed construction and operations work forces, the projected changes in employment, income, labor force, and population will alter Converse County's economic role in the region. Specifically, as growth occurs, Converse County will begin to satisfy a larger portion of its own higher-ordered demands, those that are currently being satisfied by the economy of Casper. Business-serving and household-serving activities, currently absent, will find the larger income and population base forecast to occur with the WyCoalGas project desirable. Converse County's economy will begin to mature, moving away from strict dependence on extractive industries to a more sophisticated structure that could eventually appeal to national, and certainly, regional markets. The technical demand of the WyCoalGas plant will mean a significant influx of varying occupations and skills. The creation of basic manufacturing, advanced trade and service sectors, and concomitant finance and transportation firms will make Converse County more economically autonomous. The county will also begin to serve market center functions for the smaller counties of eastern Wyoming that currently rely on Casper, Cheyenne or other distant market centers. The projected conditions expected to exist in the absence of the WyCoalGas project, the socioeconomic conditions that would accompany the project, and the differences between the two scenarios are considered. The analysis is keyed to the linkages between Converse County and Natrona County.
-
Energy Technology Data Exchange (ETDEWEB)
None
1982-01-01
This final technical report describes what WyCoalGas, Inc. and its subcontractors accomplished in resolving issues related to the resource, technology, economic, environmental, socioeconomic, and governmental requirements affecting a project located near Douglas, Wyoming for producing 150 Billion Btu per day by gasifying sub-bituminous coal. The report summarizes the results of the work on each task and includes the deliverables that WyCoalGas, Inc. and the subcontractors prepared. The co-venturers withdrew from the project for two reasons: federal financial assistance to the project was seen to be highly uncertain; and funds were being expended at an unacceptably high rate.
-
Directory of Open Access Journals (Sweden)
Elnaz Karimian Azari
Full Text Available PPAR-α plays a key role in lipid metabolism; it enhances fatty acid oxidation (FAO and ketogenesis. Pharmacological PPAR-α activation improves insulin sensitivity and reduces food intake, but its mechanisms of action remain unknown. We here report that intraperitoneal (IP administration of the PPAR-α agonist Wy-14643 (40 mg/kg BW reduced food intake in adult male rats fed a high-fat diet (HFD, 49% of the energy mainly through an increase in the latency to eat after injection, and without inducing a conditioned taste avoidance. Also, IP administered Wy-14643 caused an acute (the first 60 min decrease in the respiratory quotient (RQ and an increase in hepatic portal vein β-hydroxybutyrate level (at 35 min without affecting plasma non-esterified fatty acids. Given the known stimulatory effect of PPAR-α on FAO and ketogenesis, we measured the protein expression level of carnitine palmitoyltransferase-1 (CPT 1A and mitochondrial 3-hydroxy-3-methylglutaryl-coenzyme A synthase (HMG-CoAS2, two key enzymes for FAO and ketogenesis, respectively, in liver, duodenum and jejunum. Wy-14643 induced a significant increase in the expression of CPT 1A in the jejunum and duodenum and of HMG-CoAS2 in the jejunum, but neither CPT 1A nor HMG-CoAS2 expression was increased in the liver. The induction of CPT 1A and HMG-CoAS2 expression was associated with a decrease in the lipid droplet content selectively in the jejunum. Our findings indicate that Wy-14643 stimulates FAO and ketogenesis in the intestine, in particular in the jejunum, rather than in the liver, thus supporting the hypothesis that PPAR-α activation inhibits eating by stimulating intestinal FAO.
-
Jill A. McMurray; Dave W. Roberts; Mark E. Fenn; Linda H. Geiser; Sarah Jovan
2013-01-01
Rapid expansion of natural gas drilling in Sublette County, WY (1999-present), has raised concerns about the potential ecological effects of enhanced atmospheric nitrogen (N) deposition to the Wind River Range (WRR) including the Class I BridgerWilderness. We sampled annual throughfall (TF) N deposition and lichen thalli N concentrations under forest canopies in four...
-
Uczelnia na zagranicznym rynku edukacyjnym – strategia internacjonalizacji szkoły wyższej
Directory of Open Access Journals (Sweden)
Andrzej Szromnik
2014-03-01
Full Text Available Cel: Wyjaśnienie założeń i warunków realizacyjnych internacjonalizacji uczelni jako strategicznego kierunku jej rozwoju, a ponadto przedstawienie uniwersalnych scenariuszy strategicznych ekspansji uniwersytetu za granicą oraz determinantów sukcesu. Metodologia: Artykuł ma charakter koncepcyjny i opiera się na diagnozie oraz analizie na rynku usług edukacji uniwersyteckiej w Polsce. W wyniku studiów literatury specjalistycznej wyodrębniono główne zjawiska warunkujące funkcjonowanie i kierunki zmian szkolnictwa wyższego stanowiące ogólne tło rozważań i projektów szczegółowych. Wnioski: Autor wskazuje strategie uwarunkowania i procedury decyzyjne ekspansji uniwersytetu na zagraniczne rynki edukacji na poziomie wyższym. Akcentuje główne szanse i zagrożenia z tytułu działalności uczelni za granicą. Propozycje mają nie tylko charakter poznawczy, ale także mogą być podstawą ich aplikacji w realiach polskich uczelni. Oryginalność: Działalność uczelni zagranicznych na rodzimym rynku edukacyjnym jest zjawiskiem występujących w wielu krajach. W artykule zaproponowano koncepcję strategii internacjonalizacji uniwersytetu w jej wariancie ogólnym wraz ze szczegółową procedurą analityczno-decyzyjną. W piśmiennictwie fachowym ten aspekt rozwoju uczelni nie został rozwinięty zgodnie z założeniami marketingu międzynarodowego.
-
Water-quality conditions near the confluence of the Snake and Boise Rivers, Canyon County, Idaho
Wood, Molly S.; Etheridge, Alexandra
2011-01-01
Total Maximum Daily Loads (TMDLs) have been established under authority of the Federal Clean Water Act for the Snake River-Hells Canyon reach, on the border of Idaho and Oregon, to improve water quality and preserve beneficial uses such as public consumption, recreation, and aquatic habitat. The TMDL sets targets for seasonal average and annual maximum concentrations of chlorophyll-a at 14 and 30 micrograms per liter, respectively. To attain these conditions, the maximum total phosphorus concentration at the mouth of the Boise River in Idaho, a tributary to the Snake River, has been set at 0.07 milligrams per liter. However, interactions among chlorophyll-a, nutrients, and other key water-quality parameters that may affect beneficial uses in the Snake and Boise Rivers are unknown. In addition, contributions of nutrients and chlorophyll-a loads from the Boise River to the Snake River have not been fully characterized. To evaluate seasonal trends and relations among nutrients and other water-quality parameters in the Boise and Snake Rivers, a comprehensive monitoring program was conducted near their confluence in water years (WY) 2009 and 2010. The study also provided information on the relative contribution of nutrient and sediment loads from the Boise River to the Snake River, which has an effect on water-quality conditions in downstream reservoirs. State and site-specific water-quality standards, in addition to those that relate to the Snake River-Hells Canyon TMDL, have been established to protect beneficial uses in both rivers. Measured water-quality conditions in WY2009 and WY2010 exceeded these targets at one or more sites for the following constituents: water temperature, total phosphorus concentrations, total phosphorus loads, dissolved oxygen concentration, pH, and chlorophyll-a concentrations (WY2009 only). All measured total phosphorus concentrations in the Boise River near Parma exceeded the seasonal target of 0.07 milligram per liter. Data collected
-
Nan Lu; Ge Sun; Xiaoming Feng; Bojie Fu
2013-01-01
China is facing a growing water crisis due to climate and land use change, and rise in human water demand across this rapidly developing country. Understanding the spatial and temporal ecohydrologic responses to climate change is critical to sustainable water resource management. We investigated water yield (WY) responses to historical (1981â2000) and projected...
-
Surface-Water Data, Georgia, Water Year 1999
Alhadeff, S. Jack; Landers, Mark N.; McCallum, Brian E.
1999-01-01
Water resources data for the 1999 water year for Georgia consists of records of stage, discharge, and water quality of streams; and the stage and contents of lakes and reservoirs published in one volume in a digital format on a CD-ROM. This volume contains discharge records of 121 gaging stations; stage for 13 gaging stations; stage and contents for 18 lakes and reservoirs; continuous water quality records for 10 stations; and the annual peak stage and annual peak discharge for 75 crest-stage partial-record stations. These data represent that part of the National Water Data System collected by the U.S. Geological Survey and cooperating State and Federal agencies in Georgia. Records of discharge and stage of streams, and contents or stage of lakes and reservoirs were first published in a series of U.S. Geological water-supply papers entitled, 'Surface-Water Supply of the United States.' Through September 30, 1960, these water-supply papers were in an annual series and then in a 5-year series for 1961-65 and 1966-70. Records of chemical quality, water temperature, and suspended sediment were published from 1941 to 1970 in an annual series of water-supply papers entitled, 'Quality of Surface Waters of the United States.' Records of ground-water levels were published from 1935 to 1974 in a series of water-supply papers entitled, 'Ground-Water Levels in the United States.' Water-supply papers may be consulted in the libraries of the principal cities in the United States or may be purchased from the U.S. Geological Survey, Branch of Information Services, Federal Center, Box 25286, Denver, CO 80225. For water years 1961 through 1970, streamflow data were released by the U.S. Geological Survey in annual reports on a State-boundary basis prior to the two 5-year series water-supply papers, which cover this period. The data contained in the water-supply papers are considered the official record. Water-quality records for water years 1964 through 1970 were similarly released
-
Nacionalismos e internacionalismo: um debate entre Michael Löwy e Michel Cahen
Directory of Open Access Journals (Sweden)
Ângela Lazagna
2008-11-01
Full Text Available Este artigo consiste em um debate realizado entre Michel Löwy e Michael Cahen em meados dos anos 1990 e revisto para esta publicação. Mesmo que a discussão refira-se a acontecimentos que até certo ponto podem ser considerados datados, a preocupação de fundo que é comum a esses artigos concede-lhes atualidade: a necessidade do aprofundamento de uma reflexão, a partir da teoria marxista, sobre o problema dos nacionalismos e do internacionalismo em tempos de mundialização. Esse aprofundamento, segundo os autores, faz-se necessário sobretudo por meio de uma reflexão que rompa criticamente com uma visão eurocêntrica dos diferentes nacionalismos e que supere a atitude de muitos marxistas de desprezarem tudo aquilo que não seja diretamente relevante à "consciência de classe".
-
International Nuclear Information System (INIS)
Price, R.J.; Evans, J.G.; Lake, B.G.; Gangolli, S.D.
1991-01-01
A wide variety of chemicals have been shown to produce hepatic peroxisome proliferation (PP) in the rat and certain of these compounds are also hepatocarcinogens. In this study the authors have investigated the relationship between PP and cell replication in the rat liver. Male Sprague-Dawley rats were fed control diet or diet containing either 0.0125 and 0.05% nafenopin (NAF), 0.05% methyl clofenapate (MC), 0.025% Wy-14,643 (WY) or 0.5% clofibric acid (CA) for 1 and 15 wk. All four compounds produced marked liver enlargement and a sustained induction of peroxisomal (palmitoyl-CoA oxidation) and microsomal (lauric acid 12-hydroxylase) fatty acid oxidizing enzyme activities. Enzyme induction was less marked with 0.0125% NAF than with 0.05% NAF which was similar to that produced by the other three compounds. Replicative DNA synthesis was studied by implanting 7 day Alzet osmotic pumps containing [ 3 H]thymidine during wk 0-1 and 14-15. After 1 wk replicative DNA synthesis (assessed as radioactivity incorporated into homogenate DNA by scintillation counting) was increased in all treatment groups to 170-325% of control levels. Hepatocyte Labelling Index (determined by autoradiography of liver sections) was increased in all treated groups. After 15 wk hepatic DNA radioactivity levels were 155 and 200% of control in MC and WY treated rats, respectively, whereas NAF and CA had no effect. These results demonstrate that the relationship between the magnitude of PP and induction of cell replication depends on the compound being studied and that some peroxisome proliferators produce sustained stimulation of replicative DNA synthesis in the rat
-
International Nuclear Information System (INIS)
Wieneke, N.; Neuschaefer-Rube, F.; Bode, L.M.; Kuna, M.; Andres, J.; Carnevali, L.C.; Hirsch-Ernst, K.I.; Pueschel, G.P.
2009-01-01
Energy balance is maintained by controlling both energy intake and energy expenditure. Thyroid hormones play a crucial role in regulating energy expenditure. Their levels are adjusted by a tight feedback-controlled regulation of thyroid hormone production/incretion and by their hepatic metabolism. Thyroid hormone degradation has previously been shown to be enhanced by treatment with phenobarbital or other antiepileptic drugs due to a CAR-dependent induction of phase II enzymes of xenobiotic metabolism. We have recently shown, that PPARα agonists synergize with phenobarbital to induce another prototypical CAR target gene, CYP2B1. Therefore, it was tested whether a PPARα agonist could enhance the phenobarbital-dependent acceleration of thyroid hormone elimination. In primary cultures of rat hepatocytes the apparent half-life of T3 was reduced after induction with a combination of phenobarbital and the PPARα agonist WY14643 to a larger extent than after induction with either compound alone. The synergistic reduction of the half-life could be attributed to a synergistic induction of CAR and the CAR target genes that code for enzymes and transporters involved in the hepatic elimination of T3, such as OATP1A1, OATP1A3, UGT1A3 and UGT1A10. The PPARα-dependent CAR induction and the subsequent induction of T3-eliminating enzymes might be of physiological significance for the fasting-induced reduction in energy expenditure by fatty acids as natural PPARα ligands. The synergism of the PPARα agonist WY14643 and phenobarbital in inducing thyroid hormone breakdown might serve as a paradigm for the synergistic disruption of endocrine control by other combinations of xenobiotics.
-
Surface-Water Conditions in Georgia, Water Year 2005
Painter, Jaime A.; Landers, Mark N.
2007-01-01
INTRODUCTION The U.S. Geological Survey (USGS) Georgia Water Science Center-in cooperation with Federal, State, and local agencies-collected surface-water streamflow, water-quality, and ecological data during the 2005 Water Year (October 1, 2004-September 30, 2005). These data were compiled into layers of an interactive ArcReaderTM published map document (pmf). ArcReaderTM is a product of Environmental Systems Research Institute, Inc (ESRI?). Datasets represented on the interactive map are * continuous daily mean streamflow * continuous daily mean water levels * continuous daily total precipitation * continuous daily water quality (water temperature, specific conductance dissolved oxygen, pH, and turbidity) * noncontinuous peak streamflow * miscellaneous streamflow measurements * lake or reservoir elevation * periodic surface-water quality * periodic ecological data * historical continuous daily mean streamflow discontinued prior to the 2005 water year The map interface provides the ability to identify a station in spatial reference to the political boundaries of the State of Georgia and other features-such as major streams, major roads, and other collection stations. Each station is hyperlinked to a station summary showing seasonal and annual stream characteristics for the current year and for the period of record. For continuous discharge stations, the station summary includes a one page graphical summary page containing five graphs, a station map, and a photograph of the station. The graphs provide a quick overview of the current and period-of-record hydrologic conditions of the station by providing a daily mean discharge graph for the water year, monthly statistics graph for the water year and period of record, an annual mean streamflow graph for the period of record, an annual minimum 7-day average streamflow graph for the period of record, and an annual peak streamflow graph for the period of record. Additionally, data can be accessed through the layer's link
-
Hudson, A.; Alfaro-Sanchez, R.; Belmecheri, S.; Moore, D. J.; Trouet, V.
2017-12-01
Anthropogenic climate change has caused global temperatures to rise in recent decades. Temperatures at the regional scale are influenced by various factors including topography, atmospheric circulation, and seasonality that superimpose year-to-year variability on this global warming trend. Here, we develop a tree-ring based summer temperature reconstruction for the northern Rockies in order to investigate the drivers of the year-to-year temperature variability in this region. For this purpose, we sampled 10 sites in the semi-arid Bighorn Mountains, WY and developed two tree-ring width chronologies for differing elevations. The high elevation Picea engelmannii chronology (>2,630m) is positively correlated with July temperature variability, whereas the low elevation (<2,580m) chronology - consisting of Pinus contorta, Pseudotsuga menziesii, and Pinus albicaulis - is sensitive to summer precipitation and negatively correlated with June and July temperatures. A reconstruction based on a combination of the two chronologies explains 30% of the variance in regional June and July temperatures over the instrumental period, covers the period 1670-2014, and is representative for the central United States and southern Canada region. Our reconstruction shows significantly lower summer temperatures in the year following the 16 largest tropical eruptions from 1670 to the present. The reconstruction further captures the high summer temperatures during the 1930s dust bowl era and shows a steep increase in variance in the late 20th century. Enhanced late 20th century variance has also been detected in climate and ecosystem dynamics in the Northeast Pacific, which suggests an impact of an amplified meridional flow on northern Rockies summer temperatures.
-
Cheng, Yanbo; Ma, Qibin; Ren, Hailong; Xia, Qiuju; Song, Enliang; Tan, Zhiyuan; Li, Shuxian; Zhang, Gengyun; Nian, Hai
2017-05-01
Using a combination of phenotypic screening, genetic and statistical analyses, and high-throughput genome-wide sequencing, we have finely mapped a dominant Phytophthora resistance gene in soybean cultivar Wayao. Phytophthora root rot (PRR) caused by Phytophthora sojae is one of the most important soil-borne diseases in many soybean-production regions in the world. Identification of resistant gene(s) and incorporating them into elite varieties are an effective way for breeding to prevent soybean from being harmed by this disease. Two soybean populations of 191 F 2 individuals and 196 F 7:8 recombinant inbred lines (RILs) were developed to map Rps gene by crossing a susceptible cultivar Huachun 2 with the resistant cultivar Wayao. Genetic analysis of the F 2 population indicated that PRR resistance in Wayao was controlled by a single dominant gene, temporarily named RpsWY, which was mapped on chromosome 3. A high-density genetic linkage bin map was constructed using 3469 recombination bins of the RILs to explore the candidate genes by the high-throughput genome-wide sequencing. The results of genotypic analysis showed that the RpsWY gene was located in bin 401 between 4466230 and 4502773 bp on chromosome 3 through line 71 and 100 of the RILs. Four predicted genes (Glyma03g04350, Glyma03g04360, Glyma03g04370, and Glyma03g04380) were found at the narrowed region of 36.5 kb in bin 401. These results suggest that the high-throughput genome-wide resequencing is an effective method to fine map PRR candidate genes.
-
Retrospective Analysis of Low Flows at Headwater Watersheds in Wyoming
Voutchkova, D. D.; Miller, S. N.
2016-12-01
Understanding summer low-flow variability and change in the mountainous West has important implications for water allocations downstream and for maintaining water availability for drinking water supply, reservoir storage, industrial, agricultural, and ecological needs. Wildfires and insect infestations are classical disturbance hydrology topics. It is unclear, however, what are their effects on streamflow and in particular low-flows, when vegetation disturbances are overlapping in time and combined with highly variable and potentially changing local climate. The purpose of this study, therefore, is to quantify changes in low-flows resulting from disturbance in headwater streams. Here we present a retrospective analysis based on: (1) 49-75 complete water years (wy) of daily streamflow data (USGS) for 14 high-elevation headwater watersheds with varying areas (60-1730 km2, 86-100% of watershed area >2000masl) and evergreen forest cover (15-82%), (2) 25-36 complete wy of daily snow-water equivalent accumulation (SWE) and precipitation data from Wyoming SNOTEL stations, (3) burned area boundaries for 20wy (MTBS project), (4) aerial surveys by R1, R2, R4 Forest Service Regions for 18wy (data on tree mortality). We quantify the change in various low-flow characteristics (e.g. post-snowmelt baseflow, Q90 and Q95, 3-,7-, 30- and 90-day annual minima etc.) while accounting for local inter- and multi-annual climate variability by using SWE accumulation data, as it integrates both temperature and precipitation changes. Our approach differs from typical before-after field-based investigation for paired watersheds, as it provides a synthesis over large temporal and spatial scales, resulting in spectrum of possible hydrologic responses due to varying disturbance severity. Quantifying the changes in low-flows and low-flow variability will improve our understanding and will facilitate water management and planning at local state-wide level.
-
International Nuclear Information System (INIS)
Ramirez, P. Jr.
1993-01-01
Trace elements, hydrocarbons and radium-226 concentrations were analyzed in water, sediment and biota from the Loch Katrine wetlands at Park County, WY in 1992. This study was designed to determine if produced waters pose a risk to aquatic birds inhabiting the wetlands. The radium-226 concentration recorded at the Sidney Battery Discharge in July, 93.7 pCi/l, exceeded WY DEQ's 60 pCi/l standard for the protection of aquatic life. Water quality acute criteria were exceeded for arsenic, Custer Lake, July, and for zinc, Sidney Battery discharge, April. Radium-226 concentrations in sediments from Custer Lake and Sidney Battery Discharge exceeded the 3 pCi/g background for Oregon Basin soils. The radium-226 concentration in aquatic vegetation, Custer Lake, 29.5 pCi/g, greatly exceeded the 2.9 pCi/g average concentration found in plants growing in uranium mill tailings in South Dakota. Radium-226 in aquatic vegetation may be available to aquatic birds. Oil and grease concentrations, Sidney Battery Discharge, exceeded the 10 mg/l standard of WY DEQ. Sediment hydrocarbon concentrations were highest at Sidney Battery Discharge, 6.376 μg/g, followed by Custer Lake, 1.104 μg/g. Benzo(a)pyrene was not detected in gadwalls from Loch Katrine but was detected in northern shovelers from Custer Lake. Benzo(a)pyrene concentrations in northern shoveler bile ranged from 500 to 960 ng/g (ppb) wet weight. Benzo(a)pyrene concentrations in shovelers is indicative of exposure to petroleum hydrocarbons
-
Water resources data, Kentucky. Water year 1991
Energy Technology Data Exchange (ETDEWEB)
McClain, D.L.; Byrd, F.D.; Brown, A.C.
1991-12-31
Water resources data for the 1991 water year for Kentucky consist of records of stage, discharge, and water quality of streams and lakes; and water-levels of wells. This report includes daily discharge records for 115 stream-gaging stations. It also includes water-quality data for 38 stations sampled at regular intervals. Also published are 13 daily temperature and 8 specific conductance records, and 85 miscellaneous temperature and specific conductance determinations for the gaging stations. Suspended-sediment data for 12 stations (of which 5 are daily) are also published. Ground-water levels are published for 23 recording and 117 partial sites. Precipitation data at a regular interval is published for 1 site. Additional water data were collected at various sites not involved in the systematic data-collection program and are published as miscellaneous measurement and analyses. These data represent that part of the National Water Data System operated by the US Geological Survey and cooperation State and Federal agencies in Kentucky.
-
Nalley, G.M.; Gorman, J.G.; Goodrich, R.D.; Miller, V.E.; Turco, M.J.; Linhart, S.M.
2002-01-01
The Water Resources Division of the U.S. Geological Survey, in cooperation with State, county, municipal, and other Federal agencies, obtains a large amount of data pertaining to the water resources of Iowa each water year. These data, accumulated during many water years, constitute a valuable data base for developing an improved understanding of the water resources of the State. To make this data readily available to interested parties outside of the Geological Survey, the data is published annually in this report series entitled “Water Resources Data - Iowa” as part of the National Water Data System. Water resources data for water year 2001 for Iowa consists of records of stage, discharge, and water quality of streams; stage and contents of lakes and reservoirs; and water levels and water quality of ground water. This report, in two volumes, contains stage or discharge records for 132 gaging stations; stage records for 9 lakes and reservoirs; water-quality records for 4 gaging stations; sediment records for 13 gaging stations; and water levels for 163 ground-water observation wells. Also included are peak-flow data for 92 crest-stage partial-record stations, water-quality data from 86 municipal wells, and precipitation data collected at 6 gaging stations and 2 precipitation sites. Additional water data were collected at various sites not included in the systematic data-collection program, and are published here as miscellaneous measurements and analyses. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating local, State, and Federal agencies in Iowa.Records of discharge or stage of streams, and contents or stage of lakes and reservoirs were first published in a series of U.S. Geological Survey water-supply papers entitled “Surface Water Supply of the United States.” Through September 30, 1960, these water-supply papers were published in an annual series; during 1961-65 and 1966-70, they
-
Shi, Zhiming; Zhang, Qingyun; Schwingenschlö gl, Udo
2018-01-01
–xSex)2 and Mo1–yWyS2 with x = 1/3, 2/3 and y = 1/3, 1/2, 2/3 are stable according to phonon calculations and realize 1T′ or 1T″ phases. The transition barriers from the 2H phase are lower than for monolayer MoS2, implying that the 1T′ or 1T″ phases
-
Directory of Open Access Journals (Sweden)
Yuri Kim
2017-08-01
New hydrological insights for the region: Evapotranspiration (ET and water yield (WY with projected CO2, precipitation, and temperature during 2044–2070 were affected by each climate factor separately and synergistically. Increasing CO2 to 600 ppm only scenario resulted in an ET decrease (5–17% which led to WY increase (17–36%. With projected temperature increases (1–5 °C only scenarios, ET was projected to increase noticeably (12–112% especially in winter and spring. The amount of projected ET increase was reduced by a CO2 increase to 600 ppm due to decreased stomatal conductance. Projected WY varied due to the high variability of future precipitation patterns (−54% to 33% but generally increased when solely precipitation projections were applied. However, WY with combined effects of CO2, precipitation, and temperature did not show significant changes compared with the historical WY. Therefore, it is necessary to incorporate interactions of precipitation, temperature, and CO2 to simulate future water availability in the North Carolina Piedmont.
-
Peters, Norman E.; Burns, Douglas A.; Aulenbach, Brent T.
2014-01-01
Many previous investigations of mean streamwater transit times (MTT) have been limited by an inability to quantify the MTT dynamics. Here, we draw on (1) a linear relation (r 2 = 0.97) between groundwater 3H/3He ages and dissolved silica (Si) concentrations, combined with (2) predicted streamwater Si concentrations from a multiple-regression relation (R 2 = 0.87) to estimate MTT at 5-min intervals for a 23-year time series of streamflow [water year (WY) 1986 through 2008] at the Panola Mountain Research Watershed, Georgia. The time-based average MTT derived from the 5-min data was ~8.4 ± 2.9 years and the volume-weighted (VW) MTT was ~4.7 years for the study period, reflecting the importance of younger runoff water during high flow. The 5-min MTTs are normally distributed and ranged from 0 to 15 years. Monthly VW MTTs averaged 7.0 ± 3.3 years and ranged from 4 to 6 years during winter and 8–10 years during summer. The annual VW MTTs averaged 5.6 ± 2.0 years and ranged from ~5 years during wet years (2003 and 2005) to >10 years during dry years (2002 and 2008). Stormflows are composed of much younger water than baseflows, and although stormflow only occurs ~17 % of the time, this runoff fraction contributed 39 % of the runoff during the 23-year study period. Combining the 23-year VW MTT (including stormflow) with the annual average baseflow for the period (~212 mm) indicates that active groundwater storage is ~1,000 mm. However, the groundwater storage ranged from 1,040 to 1,950 mm using WY baseflow and WY VW MTT. The approach described herein may be applicable to other watersheds underlain by granitoid bedrock, where weathering is the dominant control on Si concentrations in soils, groundwater, and streamwater.
-
Variations in statewide water quality of New Jersey streams, water years 1998-2009
Heckathorn, Heather A.; Deetz, Anna C.
2012-01-01
Statistical analyses were conducted for six water-quality constituents measured at 371 surface-water-quality stations during water years 1998-2009 to determine changes in concentrations over time. This study examined year-round concentrations of total dissolved solids, dissolved nitrite plus nitrate, dissolved phosphorus, total phosphorus, and total nitrogen; concentrations of dissolved chloride were measured only from January to March. All the water-quality data analyzed were collected by the New Jersey Department of Environmental Protection and the U.S. Geological Survey as part of the cooperative Ambient Surface-Water-Quality Monitoring Network. Stations were divided into groups according to the 1-year or 2-year period that the stations were part of the Ambient Surface-Water-Quality Monitoring Network. Data were obtained from the eight groups of Statewide Status stations for water years 1998, 1999, 2000, 2001-02, 2003-04, 2005-06, 2007-08, and 2009. The data from each group were compared to the data from each of the other groups and to baseline data obtained from Background stations unaffected by human activity that were sampled during the same time periods. The Kruskal-Wallis test was used to determine whether median concentrations of a selected water-quality constituent measured in a particular 1-year or 2-year group were different from those measured in other 1-year or 2-year groups. If the median concentrations were found to differ among years or groups of years, then Tukey's multiple comparison test on ranks was used to identify those years with different or equal concentrations of water-quality constituents. A significance level of 0.05 was selected to indicate significant changes in median concentrations of water-quality constituents. More variations in the median concentrations of water-quality constituents were observed at Statewide Status stations (randomly chosen stations scattered throughout the State of New Jersey) than at Background stations
-
Modeling of phosphorus loads in sugarcane in a low-relief landscape using ontology-based simulation.
Kwon, Ho-Young; Grunwald, Sabine; Beck, Howard W; Jung, Yunchul; Daroub, Samira H; Lang, Timothy A; Morgan, Kelly T
2010-01-01
Water flow and P dynamics in a low-relief landscape manipulated by extensive canal and ditch drainage systems were modeled utilizing an ontology-based simulation model. In the model, soil water flux and processes between three soil inorganic P pools (labile, active, and stable) and organic P are represented as database objects. And user-defined relationships among objects are used to automatically generate computer code (Java) for running the simulation of discharge and P loads. Our objectives were to develop ontology-based descriptions of soil P dynamics within sugarcane- (Saccharum officinarum L.) grown farm basins of the Everglades Agricultural Area (EAA) and to calibrate and validate such processes with water quality monitoring data collected at one farm basin (1244 ha). In the calibration phase (water year [WY] 99-00), observed discharge totaled 11,114 m3 ha(-1) and dissolved P 0.23 kg P ha(-1); and in the validation phase (WY 02-03), discharge was 10,397 m3 ha(-1) and dissolved P 0.11 kg P ha(-). During WY 99-00 the root mean square error (RMSE) for monthly discharge was 188 m3 ha(-1) and for monthly dissolved P 0.0077 kg P ha(-1); whereas during WY 02-03 the RMSE for monthly discharge was 195 m3 ha(-1) and monthly dissolved P 0.0022 kg P ha(-1). These results were confirmed by Nash-Sutcliffe Coefficient of 0.69 (calibration) and 0.81 (validation) comparing measured and simulated P loads. The good model performance suggests that our model has promise to simulate P dynamics, which may be useful as a management tool to reduce P loads in other similar low-relief areas.
-
Directory of Open Access Journals (Sweden)
Maria Wanda Sidor
2010-01-01
Full Text Available W artykule przedstawiono kilka aspektów związanych z gromadzeniem zbiorów w bibliotece uczelni wyższej oraz zaprezentowano elektroniczny system wspomagający zarządzanie zasobami informacyjnymi w bibliotece uczelni niepublicznej. Zaprojektowany i wdrożony system nie rozwiązuje wszystkich problemów związanych z gromadzeniem zasobów, ale umożliwia sprawniejsze i efektywniejsze zarządzanie zasobami informacyjnymi oraz racjonalne dopasowanie zbiorów dydaktycznych do potrzeb studentów.
-
Downs, P. W.; Gilvear, D. J.
2017-12-01
Most river restoration research has been directed at rivers in the highly populated alluvial lowlands: significantly less is known about effectively rehabilitating upland channels, in part because the dynamics of sediment transfer are less well understood. Upland gravel augmentation is thus both a somewhat unproven method for rehabilitating degraded aquatic habitats in sediment-poor reaches, but also a natural experiment in better understanding sediment dynamics in steep, hydraulically-complex river channels. Monitoring on the River Avon in SW England since Water Year (WY) 2015 uses seismic impact plates, RFID-tagged particles and detailed channel bed mapping to establish the mobility rates of augmented particles, their dispersal distances and settling locations relative to flows received. Particles are highly, and equally, mobile: in WY2015, 17 sub-bankfull flows moved at least 60% of augmented particles with volumetric movement non-linearly correlated to flow energy but not to particle size. Waning rates of transport over the year suggest supply limitations. This relationship breaks down early in WY2017 where a two-year flow event moved 40% of the particles in just two months - confounding factors may include particle mass differences and particle supplies from upstream. Median particle travel distances correlate well to energy applied and suggest a long-tailed fan of dispersal with supplemental controls including channel curvature, boulder presence and stream power. Locally, particles are deposited preferentially around boulders and in sheltered river margins but also perched in clusters above the low-flow channel. High tracer mobility makes median transport distances highly dependent on the survey length - in WY2017 some particles travelled 300 m in a 3-month period that included the two-year flood event. Further, in WY2017 median transport distance as a function of volumetric transport suggested significant transport beyond the target reach. The observed
-
Henneberg, Mark F.
2018-04-23
The Gunnison Basin Selenium Management Program implemented a water-quality monitoring network in 2011 in the lower Gunnison River Basin in Colorado. Selenium is a trace element that bioaccumulates in aquatic food chains and can cause reproductive failure, deformities, and other harmful effects. This report presents the percentile values of selenium because regulatory agencies in Colorado make decisions based on the U.S. Environmental Protection Agency (EPA) Clean Water Act Section 303(d) that uses percentile values of concentration. Also presented are dissolved-selenium loads at 18 sites in the lower Gunnison River Basin for water years (WYs) 2011–2016 (October 1, 2010, through September 30, 2016). Annual dissolved-selenium loads were calculated for five sites with continuous U.S. Geological Survey (USGS) streamflow-gaging stations. Annual dissolved-selenium loads for WY 2011 through WY 2016 ranged from 179 and 391 pounds (lb) at Uncompahgre River at Colona to 11,100 and 17,300 lb at Gunnison River near Grand Junction (herein called Whitewater), respectively. Instantaneous loads were calculated for five sites with continuous U.S. Geological Survey (USGS) streamflow-gaging stations and 13 ancillary sites where discrete water-quality sampling also took place, using discrete water-quality samples and the associated discharge measurements collected during the period. Median instantaneous loads ranged from 0.01 pound per day (lb/d) at Smith Fork near Lazear to 33.0 lb/d at Whitewater. Mean instantaneous loads ranged from 0.06 lb/d at Smith Fork near Lazear to 36.2 lb/d at Whitewater. Most tributary sites in the basin had a median instantaneous dissolved-selenium load of less than 20.0 lb/day. In general, dissolved-selenium loads at Gunnison River main-stem sites showed an increase from upstream to downstream. The State of Colorado water-quality standard for dissolved selenium of 4.6 micrograms per liter (µg/L) was compared to the 85th percentiles for dissolved
-
Smith, Kirk P.
2008-01-01
Records of water quantity, water quality, and meteorological parameters were continuously collected from three reservoirs, two primary streams, and four subbasin tributaries in the Cambridge, Massachusetts, drinking-water source area during water year 2006 (October 2005 through September 2006). Water samples were collected during base-flow conditions and storms in the subbasins of the Cambridge Reservoir and Stony Brook Reservoir drainage areas and analyzed for dissolved calcium, sodium, chloride, and sulfate; total nitrogen and phosphorus; and polar pesticides and metabolites. These data were collected to assist watershed administrators in managing the drinking-water source area and to identify potential sources of contaminants and trends in contaminant loading to the water supply. Monthly reservoir contents for the Cambridge Reservoir varied from about 59 to 98 percent of capacity during water year 2006, while monthly reservoir contents for the Stony Brook Reservoir and the Fresh Pond Reservoir was maintained at greater than 83 and 94 percent of capacity, respectively. If water demand is assumed to be 15 million gallons per day by the city of Cambridge, the volume of water released from the Stony Brook Reservoir to the Charles River during the 2006 water year is equivalent to an annual water surplus of about 127 percent. Recorded precipitation in the source area was about 16 percent greater for the 2006 water year than for the previous water year and was between 12 and 73 percent greater than for any recorded amount since water year 2002. The monthly mean specific-conductance values for all continuously monitored stations within the drinking-water source area were generally within the range of historical data collected since water year 1997, and in many cases were less than the historical medians. The annual mean specific conductance of 738 uS/cm (microsiemens per centimeter) for water discharged from the Cambridge Reservoir was nearly identical to the annual
-
Water-quality and lake-stage data for Wisconsin lakes, water year 2014
Manteufel, S. Bridgett; Robertson, Dale M.
2017-05-25
IntroductionThe U.S. Geological Survey (USGS), in cooperation with local and other agencies, collects data at selected lakes throughout Wisconsin. These data, accumulated over many years, provide a database for developing an improved understanding of the water quality of lakes. To make these data available to interested parties outside the USGS, the data are published annually in this report series. The locations of water-quality and lake-stage stations in Wisconsin for water year 2014 are shown in figure 1. A water year is the 12-month period from October 1 through September 30. It is designated by the calendar year in which it ends. Thus, the periodOctober 1, 2013, through September 30, 2014, is called “water year 2014.”The purpose of this report is to provide information about the chemical and physical characteristics of Wisconsin lakes. Data that have been collected at specific lakes, and information to aid in the interpretation of those data, are included in this report. Data collected include measurements of in-lake water quality and lake stage. Time series of Secchi depths, surface total phosphorus, and chlorophyll a concentrations collected during nonfrozen periods are included for many lakes. Graphs of vertical profiles of temperature, dissolved oxygen, pH, and specific conductance are included for sites where these parameters were measured. Descriptive information for each lake includes the location of the lake, area of the lake’s watershed, period for which data are available, revisions to previously published records, and pertinent remarks. Additional data, such as streamflow and water quality in tributary and outlet streams of some of the lakes, are published online at http://nwis.waterdata.usgs.gov/wi/nwis.Water-resources data, including stage and discharge data at most streamflow-gaging stations, are available online. The Wisconsin Water Science Center’s home page is at https://www.usgs.gov/centers/wisconsin-water-science-center. Information
-
Water Resources Data Ohio: Water year 1994. Volume 1, Ohio River Basin excluding Project Data
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The Water Resources Division of the US Geological Survey (USGS) in cooperation with State agencies, obtains a large amount of data each water year (a water year is the 12-month period from October 1 through September 30 and is identified by the calendar year in which it ends) pertaining to the water resources of Ohio. These data, accumulated during many years, constitute a valuable data base for developing an improved understanding of the water resources of the State. To make these data readily available to interested parties outside the USGS, they are published annually in this report series entitled ``Water Resources Data--Ohio.`` This report (in two volumes) includes records on surface water and ground water in the State. Specifically, it contains: (1) Discharge records for streamflow-gaging stations, miscellaneous sites, and crest-stage stations; (2) stage and content records for streams, lakes, and reservoirs; (3) water-quality data for streamflow-gaging stations, wells, synoptic sites, and partial-record sit -aid (4) water-level data for observation wells. Locations of lake-and streamflow-gaging stations, water-quality stations, and observation wells for which data are presented in this volume are shown in figures 8a through 8b. The data in this report represent that part of the National Water Data System collected by the USGS and cooperating State and Federal agencies in Ohio. This series of annual reports for Ohio began with the 1961 water year with a report that contained only data relating to the quantities of surface water. For the 1964 water year, a similar report was introduced that contained only data relating to water quality. Beginning with the 1975 water year, the report was changed to present (in two or three volumes) data on quantities of surface water, quality of surface and ground water, and ground-water levels.
-
Smith, Kirk P.
2007-01-01
Records of water quantity, water quality, and meteorological parameters were continuously collected from three reservoirs, two primary streams, and four subbasin tributaries in the Cambridge, Massachusetts, drinking-water source area during water year 2005 (October 2004 through September 2005). Water samples were collected during base-flow conditions and storms in the subbasins of the Cambridge Reservoir and Stony Brook Reservoir drainage areas and analyzed for selected elements, organic constituents, suspended sediment, and Escherichia coli bacteria. These data were collected to assist watershed administrators in managing the drinking-water source area and to identify potential sources of contaminants and trends in contaminant loading to the water supply. Monthly reservoir capacities for the Cambridge Reservoir varied from about 59 to 98 percent during water year 2005, while monthly reservoir capacities for the Stony Brook Reservoir and the Fresh Pond Reservoir were maintained at capacities greater than 84 and 96 percent, respectively. Assuming a water demand of 15 million gallons per day by the city of Cambridge, the volume of water released from the Stony Brook Reservoir to the Charles River during the 2005 water year is equivalent to an annual water surplus of about 119 percent. Recorded precipitation in the source area for the 2005 water year was within 2 inches of the total annual precipitation for the previous 2 water years. The monthly mean specific conductances for the outflow of the Cambridge Reservoir were similar to historical monthly mean values. However, monthly mean specific conductances for Stony Brook near Route 20, in Waltham (U.S. Geological Survey station 01104460), which is the principal tributary feeding the Stony Brook Reservoir, were generally higher than the medians of the monthly mean specific conductances for the period of record. Similarly, monthly mean specific conductances for a small tributary to Stony Brook (U.S. Geological Survey
-
Water-resources activities, North Dakota District, Fiscal Year 1992
Martin, Cathy R.
1993-01-01
The mission of the U.S. Geological Survey, Water Resources Division, is to provide the hydrologic information and understanding needed for the optimum utilization and management of the Nation's water resources for the overall benefit of the people of the United States. This report describes water-resources activities of the Water Resources Division in North Dakota in fiscal year 1992. Information on each project includes objectives, approach, progress, plans for fiscal year 1993, and completed and planned report products.
-
Water-quality and lake-stage data for Wisconsin lakes, water years 2012–2013
Manteufel, S. Bridgett; Robertson, Dale M.
2017-05-25
IntroductionThe U.S. Geological Survey (USGS), in cooperation with local and other agencies, collects data at selected lakes throughout Wisconsin. These data, accumulated over many years, provide a data base for developing an improved understanding of the water quality of lakes. To make these data available to interested parties outside the USGS, the data are published annually in this report series. The locations of water-quality and lake-stage stations in Wisconsin for water year 2012 are shown in figure 1. A water year is the 12-month period from October 1 through September 30. It is designated by the calendar year in which it ends. Thus, the period October 1, 2011 through September 30, 2012, is called “water year 2012.”The purpose of this report is to provide information about the chemical and physical characteristics of Wisconsin lakes. Data that have been collected at specific lakes, and information to aid in the interpretation of those data, are included in this report. Data collected include measurements of in-lake water quality and lake stage. Time series of Secchi depths, surface total phosphorus and chlorophyll a concentrations collected during non-frozen periods are included for all lakes. Graphs of vertical profiles of temperature, dissolved oxygen, pH, and specific conductance are included for sites where these parameters were measured. Descriptive information for each lake includes: location of the lake, area of the lake’s watershed, period for which data are available, revisions to previously published records, and pertinent remarks. Additional data, such as streamflow and water quality in tributary and outlet streams of some of the lakes, are published online at http://nwis.waterdata.usgs.gov/wi/nwis.Water-resources data, including stage and discharge data at most streamflow-gaging stations, are available online. The Wisconsin Water Science Center’s home page is at https://www.usgs.gov/centers/wisconsin-water-science-center. Information on
-
Eighty years of cooperative water science
Stone, Mandy L.
2017-05-09
The Equus Beds aquifer in south-central Kansas is a primary water source for the city of Wichita. The Equus Beds aquifer storage and recovery (ASR) project was developed to help the city of Wichita meet increasing current and future demands. The Equus Beds ASR project is a recent part of an 80-year cooperative water science effort with the city of Wichita. The U.S. Geological Survey (USGS) Kansas Water Science Center characterizes river and aquifer water-quality and quantity and evaluates changes that may or may not be related to ASR. The USGS data are used by the city of Wichita to make informed management decisions, satisfy regulatory requirements, and serve as a baseline to detect any subsequent changes that may be related to ASR.
-
Water-resources activities, North Dakota District, fiscal year 1990
Martin, Cathy R.
1991-01-01
The mission of the U.S. Geological Survey, Water Resources Division, is to provide the hydrologic information and understanding needed for the optimum utilization and management of the Nation's water resources for the overall benefit of the people of the United States. This report describes waterresources activities of the Water Resources Division in North Dakota in fiscal year 1990. Information on each project includes objectives, approach, progress in fiscal year 1990, plans for fiscal year 1991, completed and planned report products, and the name of the project chief.
-
Ten years of Brazilian ballast water management
Castro, Maria Cecilia Trindade; Hall-Spencer, Jason M.; Poggian, Cecília Fonseca; Fileman, Timothy W.
2018-03-01
In 2005, Brazil addressed the environmental challenges posed by ballast water through a unilateral regulation, called the Maritime Standard N° 20 (NORMAM-20), applied to all shipping in her waters. This world-leading decision was the culmination of a process that started during the 1990‧s. Here, we summarize how these ballast water regulations were brought in and adopted and present the findings of 10 years of enforcement (2005-2015) in 39 ports along the Brazilian coast. We show that compliance with the Brazilian standard has increased significantly since the regulations were implemented (p < 0.001). After five years of implementation, non-compliance decreased probably reflecting an increase in awareness of the Brazilian Standard and a shift in the shipping industry commitment to minimize and control the spread of invasive species through ballast water. The Brazilian experience shows that very high levels (97%) of compliance with ballast water management regulations can be made to work in a region of global importance to the maritime industry. In the last decade, the rules governing ballast water in Brazil have evolved to address the demands from the maritime community and to provide updates such as imminent requirements for the use of ballast water management systems on board ships. These regulations are rarely cited when ballast water regulations are discussed internationally, yet there is much to learn from the proactive approach taken by Brazil such as what is feasible and enforceable.
-
Lian, Youyun; Liu, Xiang; Feng, Fan; Song, Jiupeng; Yan, Binyou; Wang, Yingmin; Wang, Jianbao; Chen, Jiming
2017-12-01
The effects of the addition of Y2O3 and hot-deformation on the mechanical properties of tungsten (W) have been studied. The processing route comprises a doping technique for the distribution of Y2O3 particles in a tungsten matrix, conventional sintering in a hydrogen environment, and high-energy-rate forging (HERF). The microstructure of the composite was characterized by using transmission electron microscopy and electron backscattering diffraction imaging technique, and its mechanical properties were studied by means of tensile testing. The thermal shock response of the HERF processed W-Y2O3 was evaluated by applying edge-localized mode-like loads (100 pulses) with a pulse duration of 1 ms and an absorbed power density of up to 1 GW m-2 at various temperatures between room temperature and 200 °C. HERF processing has produced elongated W grains with preferred orientations and a high density of structure defects in the composite. The composite material exhibits high tensile strength and good ductility, and a thermal shock cracking threshold lower than 100 °C.
-
Spahr, N.E.
2003-01-01
Introduction: Population growth and changes in land-use practices have the potential to affect water quality and quantity in the upper Gunnison River basin. In 1995, the U.S. Geological Survey (USGS), in cooperation with local sponsors, City of Gunnison, Colorado River Water Conservation District, Crested Butte South Metropolitan District, Gunnison County, Mount Crested Butte Water and Sanitation District, National Park Service, Town of Crested Butte, and Upper Gunnison River Water Conservancy District, established a water-quality monitoring program in the upper Gunnison River basin to characterize current water-quality conditions and to assess the effects of increased urban development and other land-use changes on water quality. The monitoring network has evolved into two groups of stations, stations that are considered as long term and stations that are rotational. The long-term stations are monitored to assist in defining temporal changes in water quality (how conditions have changed over time). The rotational stations are monitored to assist in the spatial definition of water-quality conditions (how conditions differ throughout the basin) and to address local and short term concerns. Another group of stations (rotational group 2) will be chosen and sampled beginning in water year 2004. Annual summaries of the water-quality data from the monitoring network provide a point of reference for discussions regarding water-quality sampling in the upper Gunnison River basin. This summary includes data collected during water year 2002. The introduction provides a map of the sampling locations, definitions of terms, and a one-page summary of selected water-quality conditions at the network stations. The remainder of the summary is organized around the data collected at individual stations. Data collected during water year 2002 are compared to historical data (data collected for this network since 1995), state water-quality standards, and federal water-quality guidelines
-
Hydrologic conditions in New Hampshire and Vermont, water year 2011
Kiah, Richard G.; Jarvis, Jason D.; Hegemann, Robert F.; Hilgendorf, Gregory S.; Ward, Sanborn L.
2013-01-01
Record-high hydrologic conditions in New Hampshire and Vermont occurred during water year 2011, according to data from 125 streamgages and lake gaging stations, 27 creststage gages, and 41 groundwater wells. Annual runoff for the 2011 water year was the sixth highest on record for New Hampshire and the highest on record for Vermont on the basis of a 111-year reference period (water years 1901–2011). Groundwater levels for the 2011 water year were generally normal in New Hampshire and normal to above normal in Vermont. Record flooding occurred in April, May, and August of water year 2011. Peak-of-record streamflows were recorded at 38 streamgages, 25 of which had more than 10 years of record. Flooding in April 2011 was widespread in parts of northern New Hampshire and Vermont; peak-of-record streamflows were recorded at nine streamgages. Flash flooding in May 2011 was isolated to central and northeastern Vermont; peakof- record streamflows were recorded at five streamgages. Devastating flooding in August 2011 occurred throughout most of Vermont and in parts of New Hampshire as a result of the heavy rains associated with Tropical Storm Irene. Peak-ofrecord streamflows were recorded at 24 streamgages.
-
Maloney, T.J.; Ludtke, A.S.; Krizman, T.L.
1994-01-01
The US. Geological Survey operates a quality- assurance program based on the analyses of reference samples for the National Water Quality Laboratory in Arvada, Colorado, and the Quality of Water Service Unit in Ocala, Florida. Reference samples containing selected inorganic, nutrient, and low ionic-strength constituents are prepared and disguised as routine samples. The program goal is to determine precision and bias for as many analytical methods offered by the participating laboratories as possible. The samples typically are submitted at a rate of approximately 5 percent of the annual environmental sample load for each constituent. The samples are distributed to the laboratories throughout the year. Analytical data for these reference samples reflect the quality of environmental sample data produced by the laboratories because the samples are processed in the same manner for all steps from sample login through data release. The results are stored permanently in the National Water Data Storage and Retrieval System. During water year 1991, 86 analytical procedures were evaluated at the National Water Quality Laboratory and 37 analytical procedures were evaluated at the Quality of Water Service Unit. An overall evaluation of the inorganic (major ion and trace metal) constituent data for water year 1991 indicated analytical imprecision in the National Water Quality Laboratory for 5 of 67 analytical procedures: aluminum (whole-water recoverable, atomic emission spectrometric, direct-current plasma); calcium (atomic emission spectrometric, direct); fluoride (ion-exchange chromatographic); iron (whole-water recoverable, atomic absorption spectrometric, direct); and sulfate (ion-exchange chromatographic). The results for 11 of 67 analytical procedures had positive or negative bias during water year 1991. Analytical imprecision was indicated in the determination of two of the five National Water Quality Laboratory nutrient constituents: orthophosphate as phosphorus and
-
Water Resources Data, Puerto Rico and the U.S. Virgin Islands, Water Year 2002
Diaz, Pedro L.; Aquino, Zaida; Figueroa-Alamo, Carlos; Garcia, Rene; Sanchez, Ana V.
2004-01-01
The Water Resources Division of the U.S. Geological Survey, in cooperation with local and Federal agencies obtains a large amount of data pertaining to the water resources of the Commonwealth of Puerto Rico and the Territory of the U.S. Virgin Islands each water year. These data, accumulated during many water years, constitute a valuable data base for developing an improved understanding of the water resources of the area. To make these data readily available to interested parties outside the U.S. Geological Survey, the data are published annually in this report series entitled 'Water Resources Data for Puerto Rico and the U.S. Virgin Islands, 2002.' This report includes records on both surface and ground water. Specifically, it contains: (1) discharge records for 95 streamflow gaging stations, daily sediment records for 28 streamflow stations, 27 partial-record or miscellaneous streamflow stations, stage records for 17 reservoirs, and (2) water-quality records for 17 streamflow-gaging stations, and for 42 ungaged stream sites, 11 lake sites, 2 lagoons, and 1 bay, and (3) water-level records for 102 observation wells.
-
Water Resources Data, Puerto Rico and the U.S. Virgin Islands, Water Year 2001
Diaz, Pedro L.; Aquino, Zaida; Figueroa-Alamo, Carlos; Garcia, Rene; Sanchez, Ana V.
2002-01-01
The Water Resources Division of the U.S. Geological Survey, in cooperation with local and Federal agencies obtains a large amount of data pertaining to the water resources of the Commonwealth of Puerto Rico and the Territory of the U.S. Virgin Islands each water year. These data, accumulated during many water years, constitute a valuable data base for developing an improved understanding of the water resources of the area. To make these data readily available to interested parties outside the U.S. Geological Survey, the data are published annually in this report series entitled 'Water Resources Data for Puerto Rico and the U.S. Virgin Islands, 2001.' This report includes records on both surface and ground water. Specifically, it contains: (1) discharge records for 95 streamflow gaging stations, daily sediment records for 23 streamflow stations, 20 partial-record or miscellaneous streamflow stations, stage records for 18 reservoirs, and (2) water-quality records for 17 streamflow-gaging stations, and for 42 ungaged stream sites, 11 lake sites, 2 lagoons, and 1 bay, and (3) water-level records for 103 observation wells.
-
Water-resources activities, North Dakota District, fiscal year 1994-95
Martin, Cathy R.
1995-01-01
The mission of the U.S. Geological Survey, Water Resources Division, is to provide the hydrologic information and understanding needed for the optimum utilization and management of the Nation's water resources for the overall benefit of the people of the United States. This report describes water-resources activities of the Water Resources Division in North Dakota in fiscal year 1994. Information on each project includes objectives, approach, progress, plans for fiscal year 1995, and completed and planned report products.
-
Smith, Kirk P.
2011-01-01
Records of water quantity, water quality, and meteorological parameters were continuously collected from three reservoirs, two primary streams, and five subbasin tributaries in the Cambridge, Massachusetts, drinking-water source area during water years 2007-08 (October 2006 through September 2008). Water samples were collected during base-flow conditions and storms in the Cambridge Reservoir and Stony Brook Reservoir drainage areas and analyzed for dissolved calcium, sodium, chloride, and sulfate; total nitrogen and phosphorus; and polar pesticides and metabolites. Composite samples of stormwater also were analyzed for concentrations of total petroleum hydrocarbons and suspended sediment in one subbasin in the Stony Brook Reservoir drainage basin. These data were collected to assist watershed administrators in managing the drinking-water source area and to identify potential sources of contaminants and trends in contaminant loading to the water supply.
-
Streamflow of 2016—Water year summary
Jian, Xiaodong; Wolock, David M.; Lins, Harry F.; Brady, Steven J.
2017-09-26
The maps and graphs in this summary describe national streamflow conditions for water year 2016 (October 1, 2015, to September 30, 2016) in the context of streamflow ranks relative to the 87-year period of 1930–2016, unless otherwise noted. The illustrations are based on observed data from the U.S. Geological Survey’s (USGS) National Streamflow Network. The period of 1930–2016 was used because the number of streamgages before 1930 was too small to provide representative data for computing statistics for most regions of the country.In the summary, reference is made to the term “runoff,” which is the depth to which a river basin, State, or other geographic area would be covered with water if all the streamflow within the area during a specified period was uniformly distributed on it. Runoff quantifies the magnitude of water flowing through the Nation’s rivers and streams in measurement units that can be compared from one area to another.In all the graphics, a rank of 1 indicates the highest flow of all years analyzed and 87 indicates the lowest flow of all years. Rankings of streamflow are grouped into much below normal, below normal, normal, above normal, and much above normal based on percentiles of flow (less than 10 percent, 10–24 percent, 25–75 percent, 76–90 percent, and greater than 90 percent, respectively). Some of the data used to produce the maps and graphs are provisional and subject to change.
-
Energy Technology Data Exchange (ETDEWEB)
Shindel, H.L.; Klingler, J.H.; Mangus, J.P.; Trimble, L.E.
1992-03-01
The Water Resources Division of the US Geological Survey (USGS), in cooperation with State agencies, obtains a large amount of data pertaining to the water resources of Ohio each water year. These data, accumulated during many years, constitute a valuable data base for developing an improved understanding of the water resources of the State. To make these data readily available to interested parties outside the USGS, the data are published annually in this report series entitled ``Water Resources Data--Ohio.`` This report (in two volumes) includes records on surface water and ground water in the State. Specifically, it contains: (1) Discharge records for 131 streamflow-gaging stations, 95 miscellaneous sites; (2) stage and content records for 5 streams, lakes, and reservoirs; (3) water-quality for 40 streamflow-gaging stations, 378 wells, and 74 partial-record sites; and (4) water levels for 431 observation wells.
-
Quality of surface-water supplies in the Triangle area of North Carolina, water years 2010-11
Pfeifle, C.A.; Cain, J.L.; Rasmussen, R.B.
2016-02-02
Surface-water supplies are important sources of drinking water for residents in the Triangle area of North Carolina, which is located within the upper Cape Fear and Neuse River Basins. Since 1988, the U.S. Geological Survey and a consortium of local governments have tracked water-quality conditions and trends in several of the area’s water-supply lakes and streams. This report summarizes data collected through this cooperative effort, known as the Triangle Area Water Supply Monitoring Project, during October 2009 through September 2010 (water year 2010) and October 2010 through September 2011 (water year 2011). Major findings for this data-collection effort include Annual precipitation was approximately 4 percent above the long-term mean (average) annual precipitation in 2010 and approximately 6 percent below the long-term mean in 2011.
-
International Nuclear Information System (INIS)
Prugh, B.J.; Powell, E.D.
1993-01-01
Water-resources data for the 1992 water year for Virginia consist of records of water levels and water quality of ground-water wells. The report (Volume 2. Ground-Water-Level and Ground-Water-Quality Records) contains water levels at 356 observation wells and water quality at 2 wells. Locations of these wells are given in the report
-
ThinPrep Pap-smear and cervical intraepithelial neoplasia in reproductive-aged Thai women.
Rugpao, S; Koonlertkit, S; Ruengkrist, T; Lamlertkittikul, S; Pinjaroen, S; Limtrakul, A; Werawatakul, Y; Sinchai, W
2009-06-01
To estimate the incidence of abnormal cervical cytology by ThinPrep Pap-tests and cervical intraepithelial neoplasia (CIN) in young adult reproductive-aged Thai women. A total of 1254 women distributed in all regions of Thailand were monitored from 2002 through 2004. Women were screened for abnormal cervical cytology using the ThinPrep method every 6 months. Interpretation of cervical cytology was based on the Bethesda system, version 2001. Women who had the ThinPrep Pap results as atypical squamous cells of undetermined significance or worse underwent colposcopic examination. The ThinPrep and all cervical tissue samples obtained from diagnostic or therapeutic procedures were analyzed and reviewed by Covance Central Laboratory Service, Inc., Indianapolis, USA. The cumulative incidence of abnormal ThinPrep Pap-tests was as follows: 15.3 per 100 woman years (WY) (95% confidence interval [CI] 12.3, 18.9) at 6 months; 12.3 per 100 WY (95% CI 10.3, 14.6) at 12 months; and 11.6 per 100 WY (95% CI 10.0, 13.5) at 18 months. Of 1448.6 woman years of follow up, the incidence of CIN1 was 4.1 per 100 WY (95% CI 3.2, 5.3); CIN2 0.8 per 100 WY (95% CI 0.4, 1.4); and CIN3 0.6 per 100 WY (95% CI 0.3, 1.2). The incidence of abnormal ThinPrep Pap-test and CIN in young adult Thai women had been reported. No comparable data is available.
-
Spahr, Norman E.; Hartle, David M.; Diaz, Paul
2008-01-01
Population growth and changes in land use have the potential to affect water quality and quantity in the upper Gunnison River Basin. In 1995, the U.S. Geological Survey (USGS), in cooperation with the Bureau of Land Management, City of Gunnison, Colorado River Water Conservation District, Crested Butte South Metropolitan District, Gunnison County, Hinsdale County, Mount Crested Butte Water and Sanitation District, National Park Service, Town of Crested Butte, Upper Gunnison River Water Conservancy District, and Western State College, established a water-quality monitoring program in the upper Gunnison River Basin to characterize current water-quality conditions and to assess the effects of increased urban development and other land-use changes on water quality. The monitoring network has evolved into two groups of stations - stations that are considered long term and stations that are considered rotational. The long-term stations are monitored to assist in defining temporal changes in water quality (how conditions may change over time). The rotational stations are monitored to assist in the spatial definition of water-quality conditions (how conditions differ throughout the basin) and to address local and short-term concerns. Some stations in the rotational group were changed beginning in water year 2007. Annual summaries of the water-quality data from the monitoring network provide a point of reference for discussions regarding water-quality monitoring in the upper Gunnison River Basin. This summary includes data collected during water years 2004 and 2005. The introduction provides a map of the sampling sites, definitions of terms, and a one-page summary of selected water-quality conditions at the network stations. The remainder of the summary is organized around the data collected at individual stations. Data collected during water years 2004 and 2005 are compared to historical data, State water-quality standards, and Federal water-quality guidelines. Data were
-
Directory of Open Access Journals (Sweden)
Zdzisława Cecylia Szadowska-Szlachetka
2015-03-01
2Centrum Onkologii Ziemi Lubelskiej im. św.Jana z Dukli Streszczenie Wstęp Wyłonienie stomii jelitowej jest to sytuacja bardzo trudna w której występuje naruszenie integralności fizycznej człowieka. Osoby, u których w trakcie zabiegu została wyłoniona stomia jelitowa czują się bezradne, zagubione i okaleczone. Postrzegają ją jak coś nienaturalnego, obcego dla nich [1] Pojawia się obawa dotycząca procesu adaptacji do zmian, jakie zachodzą w ciele człowieka oraz do nowej sytuacji życiowej. Ważne jest przygotowanie pacjenta do zmienionej sytuacji życiowej poprzez udzielenie mu wsparcia emocjonalnego, informacyjnego, instrumentalnego, duchowego zarówno przez pracowników służby zdrowia, psychologa, osobę duchowną oraz przez bliskich chorego. Cel: Celem pracy było ustalenie zapotrzebowania na różne rodzaje wsparcia oraz ustalenie jakie są oczekiwania pacjentów z wyłonioną stomią jelitową co do osób, świadczących im wsparcie. Materiał i metoda Badani to 102 osoby leczone w Centrum Onkologii Ziemi Lubelskiej. W pracy zastosowano metodę sondażu diagnostycznego z wykorzystaniem techniki wywiadu. Narzędziem był autorski kwestionariusz ankiety. Wyniki Respondenci potrzebowali najczęściej wsparcia emocjonalnego, informacyjnego i duchowego, rzadziej instrumentalnego oraz materialnego. Wnioski 1 Pacjenci z wyłonioną stomią jelitową potrzebują wsparcia informacyjnego i emocjonalnego. 2 Niewielki odsetek pacjentów potrzebuje wsparcia materialnego, duchowego i instrumentalnego. 3 Kobiety z wyłonioną stomią jelitową oczekują najczęściej wsparcia emocjonalnego i duchowego. Summary Introduction Emergence of intestinal stoma is a very difficult situation involving violation of a physical integrity of human. People in which, during the operation, the intestinal stoma has been emerged, feel helpless
-
Solberg, P.A.; Moore, Bryan; Smits, Dennis
2009-01-01
Population growth and changes in land use have the potential to affect water quality and quantity in the upper Gunnison River basin. In 1995, the U.S. Geological Survey (USGS), in cooperation with the Bureau of Land Management, City of Gunnison, Colorado River Water Conservation District, Crested Butte South Metropolitan District, Gunnison County, Hinsdale County, Mount Crested Butte Water and Sanitation District, National Park Service, Town of Crested Butte, Upper Gunnison River Water Conservancy District, and Western State College established a water-quality monitoring program in the upper Gunnison River basin to characterize current water-quality conditions and to assess the effects of increased urban development and other land-use changes on water quality. The monitoring network has evolved into two groups of stations - stations that are considered long term and stations that are considered rotational. The long-term stations are monitored to assist in defining temporal changes in water quality (how conditions may change over time). The rotational stations are monitored to assist in the spatial definition of water-quality conditions (how conditions differ throughout the basin) and to address local and short-term concerns. Some stations in the rotational group were changed beginning in water year 2007. Annual summaries of the water-quality data from the monitoring network provide a point of reference for discussions regarding water-quality monitoring in the upper Gunnison River basin. This summary includes data collected during water years 2006 and 2007. The introduction provides a map of the sampling sites, definitions of terms, and a one-page summary of selected water-quality conditions at the network stations. The remainder of the summary is organized around the data collected at individual stations. Data collected during water years 2006 and 2007 are compared to historical data, State water-quality standards, and Federal water-quality guidelines. Data were
-
Performance of a Surface Barrier for Waste Isolation and Flux Reduction at the Hanford Site
Energy Technology Data Exchange (ETDEWEB)
Zhang, Z. F.; Wellman, Dawn M.; Morse, John G.; Leary, Kevin D.; Freshley, Mark D.
2016-05-13
Based on the knowledge gained from a decade of laboratory, field, and numerical studies, the Prototype Hanford Barrier (PHB) was designed and constructed between late 1993 and late 1994 over the 216-B-57 Crib in the 200-BP-1 Operable Unit at the Hanford Site. The PHB has been monitored since 1994 to evaluate the physical, hydrologic, and ecological performance. Two stress tests were carried out in the past: (1) an enhanced (about 3 times the multi-year average of 160 mm/year) precipitation test from water year (WY) 1995 to WY1997, which included a man-made 1000-year return 24-hour rainstorms in March each year, and (2) a controlled fire test in 2008. The purpose of this article is to present the main findings of the PHB demonstration since 1994. From 1994 to present, the PHB has limited drainage of less than 0.2 mm yr-1, which is below the 0.5 mm yr-1 design goal, and minimized erosion. The observations suggest the PHB is robust enough to endure the hydrological stress of three times average precipitation and 1000-year return 24-hour rainstorms. After the controlled fire, far less vegetation grows and grasses are the dominant vegetation (compared to shrubs on the unburned section). Even so, the grasses can remove nearly all the stored water in the burned section, although during a longer period of time than in the unburned section. The findings at the PHB are useful for the design and monitoring of future surface barriers at Hanford and elsewhere.
-
Solberg, Patricia A.; Moore, Bryan; Blacklock, Ty D.
2012-01-01
Population growth and changes in land use have the potential to affect water quality and quantity in the upper Gunnison River Basin. In 1995, the U.S. Geological Survey (USGS), in cooperation with the Bureau of Land Management, City of Gunnison, Colorado River Water Conservation District, Crested Butte South Metropolitan District, Gunnison County, Hinsdale County, Mount Crested Butte Water and Sanitation District, National Park Service, Town of Crested Butte, U.S. Forest Service, Upper Gunnison River Water Conservancy District, and Western State College, established a water-quality monitoring program in the upper Gunnison River Basin to characterize current water-quality conditions and to assess the effects of increased urban development and other land-use changes on water quality. The monitoring network has evolved into two groups of sites: (1) sites that are considered long term and (2) sites that are considered rotational. Data from the long-term sites assist in defining temporal changes in water quality (how conditions may change over time). The rotational sites assist in the spatial definition of water-quality conditions (how conditions differ throughout the basin) and address local and short-term concerns. Biannual summaries of the water-quality data from the monitoring network provide a point of reference for stakeholder discussions regarding the location and purpose of water-quality monitoring sites in the upper Gunnison River Basin. This report compares and summarizes the data collected during water years 2008 and 2009 to the historical data available at these sites. The introduction provides a map of the sampling sites, definitions of terms, and a one-page summary of selected water-quality conditions at the network sites. The remainder of the report is organized around the data collected at individual sites. Data collected during water years 2008 and 2009 are compared to historical data, State water-quality standards, and Federal water-quality guidelines
-
International Nuclear Information System (INIS)
Myers, J. E.; Jackson, L. M.
2001-01-01
This paper is a summary of some of the activities conducted during the first year of a three-year cooperative research and development agreement (CRADA) between the Department of Energy (DOE) Rocky Mountain Oilfield Testing Center (RMOTC) and Texaco relating to the treatment of produced water by constructed wetlands. The first year of the CRADA is for design, construction and acclimation of the wetland pilot units. The second and third years of the CRADA are for tracking performance of pilot wetlands as the plant and microbial communities mature. A treatment wetland is a proven technology for the secondary and tertiary treatment of produced water, storm water and other wastewaters. Treatment wetlands are typically classified as either free-water surface (FWS) or subsurface flow (SSF). Both FWS and SSF wetlands work well when properly designed and operated. This paper presents a collection of kinetic data gathered from pilot units fed a slipstream of Wyoming (NPR-3) produced water. The pilot units are set up outdoors to test climatic influences on treatment. Monitoring parameters include evapotranspiration, plant growth, temperature, and NPDES discharge limits. The pilot wetlands (FWS and SSF) consist of a series of 100-gal plastic tubs filled with local soils, gravel, sharp sand and native wetland plants (cattail (Typha spp.), bulrush (Scirpus spp.), dwarf spikerush (Eleocharis)). Feed pumps control hydraulic retention time (HRT) and simple water control structures control the depth of water. The treated water is returned to the existing produced water treatment system. All NPDES discharge limits are met. Observations are included on training RMOTC summer students to do environmental work
-
Water resources data, Ohio: Water year 1991. Volume 1, Ohio River Basin excluding project data
Energy Technology Data Exchange (ETDEWEB)
Shindel, H.L.; Klingler, J.H.; Mangus, J.P.; Trimble, L.E.
1992-03-01
Water-resources data for the 1991 water year for Ohio consist of records of stage, discharge, and water quality of streams; stage and contents of lakes and reservoirs; and water levels and water quality of ground-water wells. This report, in two volumes, contains records for water discharge at 131 gaging stations, 378 wells, and 74 partial-record sites; and water levels at 431 observation wells. Also included are data from miscellaneous sites. Additional water data were collected at various sites not involved in the systematic data-collection program and are published as miscellaneous measurements and analyses. These data represent that part of the National Water Data System collected by the US Geological Survey and cooperating State and Federal agencies in Ohio.
-
DNA aptamer evolved by cell-SELEX for recognition of prostate cancer.
Directory of Open Access Journals (Sweden)
Yuanyuan Wang
Full Text Available Morbidity and mortality of prostate cancer (PCa have increased in recent years worldwide. Currently existing methods for diagnosis and treatment do not make the situation improve, especially for hormone refractory prostate cancer (HRPC. The lack of molecular probes for PCa hindered the early diagnosis of metastasis and accurate staging for PCa. In this work, we have developed a new aptamer probe Wy-5a against PCa cell line PC-3 by cell-SELEX technique. Wy-5a shows high specificity to the target cells with dissociation constants in the nanomolar range, and does not recognize other tested PCa cell lines and other tested tumor cell lines. The staining of clinical tissue sections with fluorescent dye labeled Wy-5a shows that sections from high risk group with metastasis exhibited stronger fluorescence and sections from Benign Prostatic Hyperplasia (BPH did not exhibit notable fluorescence, which suggests that aptamer Wy-5a may bind to protein related to the progression of PCa. The high affinity and specificity of Wy-5a makes this aptamer hold potential for application in diagnosis and target therapy of PCa.
-
Water Quality in the Tanana River Basin, Alaska, Water Years 2004-06
Moran, Edward H.
2007-01-01
OVERVIEW This report contains water-quality data collected from 84 sites in Tanana River basin during water years 2004 through 2006 (October 2003 through September 2006) as part of a cooperative study between the U.S. Geological Survey (USGS) and Alaska Department of Environmental Conservation (ADEC) Alaska Monitoring and Assessment Program (AKMAP), supported in part through the U.S. Environmental Protection Agency (USEPA) Office of Water, Cooperative Assistance Agreement X7-97078801. A broad range of chemical analyses are presented for 93 sets of samples collected at 59 tributaries to the Tanana River and at 25 locations along the mainstem. These data are to provide a means to assess baseline characteristics and establish indicators that are ecologically important, affordable, and relevant to society.
-
Soil moisture transport during the 1974--1975 and 1975--1976 water years
International Nuclear Information System (INIS)
Last, G.V.; Easley, P.G.; Brown, D.J.
1976-12-01
The rate and direction of soil moisture movement in Hanford sediments were determined for the 1974-1975 and 1975-1976 water years. The data for these determinations was obtained from two large lysimeters located on the 200 area plateau near the center of the Hanford Reservation. During the 1974-75 water year, meteoric moisture percolated to a depth of 2.5 meters with a peak moisture content of 10.5 volume-percent. This percolation envelope was eliminated by evaporation during the hot dry summer of 1975. The 1975-76 water year had only 70 percent of the normal precipitation, thus the percolation envelope was small and penetrated to a depth of only two meters. However, in spite of this shallow depth and low volume of moisture, the percolation envelope was not eliminated by the end of the water year because of lower seasonal temperatures and higher humidity during the drying season. Moisture content of sediments in the 4-18 meter depth range showed no relative change throughout the two water years, and no moisture accumulated at the bottom of the lysimeters, which indicates there is no deep percolation of meteoric moisture at this site, and no recharge to the ground water
-
Precipitation and stream water stable isotope data from the Marys River, Oregon in water year 2015.
U.S. Environmental Protection Agency — Water stable isotope data collected from a range of streams throughout the Marys River basin in water year 2015, and precipitation data collected within the basin at...
-
Surface-Water Quality-Assurance Plan for the USGS Georgia Water Science Center
2005-01-01
data-collection activi- ties through offices in Atlanta, Albany, Savannah, and Tifton . A Field Office Chief Technician, under the supervision of the...Roswell, GA (02335450) on May 19, 2004, will have the file- name 040519_02335450_555.txt and will be placed in the /sw/edldata/02335450/555/WY2004...letters of the stream and the first three letters of the nearest location. EXAMPLE: The transect prefix for Chattahoochee River near Norcross, GA
-
Hofman, Walter; Briggs, R.C.; Littlefield, W.M.
1954-01-01
This WATER BULLETTIN is one of a series issued annually since June 1944. Its main purpose is to present a brief analysis of those phases of the local water supply associated with the work of the Geological Survey. The first part of this review deals with the water resources for the water year ending September 30, 1953. It contains a brief analysis of the annual precipitation, the provisional runoff at a few stations, the changes in water reserves both in surface reservoirs and underground, and the imported waters. It concludes by pointing out the deficiences in the local water reserves. This bulletin has been prepared by the Surface Water Branch; the section on ground-water conditions was prepared chiefly from information supplied by the Ground Hater Branch.
-
Water Resources Data. Ohio - Water Year 1992. Volume 1. Ohio River Basin excluding project data
Energy Technology Data Exchange (ETDEWEB)
H.L. Shindel; J.H. Klingler; J.P. Mangus; L.E. Trimble
1993-03-01
Water-resources data for the 1992 water year for Ohio consist of records of stage, discharge, and water quality of streams; stage and contents of lakes and reservoirs; and water levels and water quality of ground-water wells. This report, in two volumes, contains records for water discharge at 121 gaging stations, 336 wells, and 72 partial-record sites; and water levels at 312 observation wells. Also included are data from miscellaneous sites. Additional water data were collected at various sites not involved in the systematic data-collection program and are published as miscellaneous measurements and analyses. These data represent that part of the National Water Data System collected by the US Geological Survey and cooperating State and Federal agencies in Ohio. Volume 1 covers the central and southern parts of Ohio, emphasizing the Ohio River Basin. (See Order Number DE95010451 for Volume 2 covering the northern part of Ohio.)
-
Quality of surface-water supplies in the Triangle area of North Carolina, water year 2009
Pfeifle, C. A.; Giorgino, M. J.; Rasmussen, R. B.
2014-01-01
Surface-water supplies are important sources of drinking water for residents in the Triangle area of North Carolina, which is located within the upper Cape Fear and Neuse River Basins. Since 1988, the U.S. Geological Survey and a consortium of governments have tracked water-quality conditions and trends in several of the area’s water-supply lakes and streams. This report summarizes data collected through this cooperative effort, known as the Triangle Area Water Supply Monitoring Project, during October 2008 through September 2009. Major findings for this period include: - Annual precipitation was approximately 20 percent below the long-term mean (average) annual precipitation. - Streamflow was below the long-term mean at the 10 project streamgages during most of the year. - More than 7,000 individual measurements of water quality were made at a total of 26 sites—15 in the Neuse River Basin and 11 in the Cape Fear River Basin. Forty-seven water-quality properties and constituents were measured. - All observations met North Carolina water-quality standards for water temperature, pH, hardness, chloride, fluoride, sulfate, nitrate, arsenic, cadmium, chromium, lead, nickel, and selenium. - North Carolina water-quality standards were exceeded one or more times for dissolved oxygen, dissolved oxygen percent saturation, chlorophyll a, mercury, copper, iron, manganese, silver, and zinc. Exceedances occurred at 23 sites—13 in the Neuse River Basin and 10 in the Cape Fear River Basin. - Stream samples collected during storm events contained elevated concentrations of 18 water-quality constituents compared to samples collected during non-storm events. - Concentrations of nitrogen and phosphorus were within ranges observed during previous years. - Five reservoirs had chlorophyll a concentrations in excess of 40 micrograms per liter at least once during 2009: Little River Reservoir, Falls Lake, Cane Creek Reservoir, University Lake, and Jordan Lake.
-
Study on characteristics of water resources in Beijing in recent 15 years
Chuan, L. M.; Zheng, H. G.; Zhao, J. J.; Wang, A. L.; Zhang, X. J.
2018-02-01
In order to understand the characteristics of water supply and water usage in Beijing in recent 15 years, a variety of statistical datasets were collected and field investigations were carried out, to analyze the total water resource, the characteristics and trends of water resource supply, utilization and distribution during 2000-2014. The results showed that the total amount of water resources in Beijing is maintained at 1.61~3.95 billion m3, and the surface water accounts for about 1/3, and the groundwater accounts for 2/3. Agricultural water and living water were the dominated consumption in the past 15 years in Beijing, accounted for 35.3% and 38.9% of the total amount, followed by industrial water, which accounting for 17.9% of total water consumption, and water used in environment is relatively small, only accounting for 7.8% of the total amount. This study can provide theoretical support for the establishment and management of water conservation policies and the rational utilization of water resources in Beijing.
-
Water, ice, and meteorological measurements at South Cascade glacier, Washington, balance year 2003
Bidlake, William R.; Josberger, Edward G.; Savoca, Mark E.
2005-01-01
Winter snow accumulation and summer snow and ice ablation were measured at South Cascade Glacier, Washington, to estimate glacier mass-balance quantities for balance year 2003. The 2003 glacier-average maximum winter snow balance was 2.66 meters water equivalent, which was about equal to the average of such balances for the glacier since balance year 1959. The 2003 glacier summer balance (-4.76 meters water equivalent) was the most negative reported for the glacier, and the 2003 net balance (-2.10 meters water equivalent), was the second-most negative reported. The glacier 2003 annual (water year) balance was -1.89 meters water equivalent. The area of the glacier near the end of the balance year was 1.89 square kilometers, a decrease of 0.03 square kilometer from the previous year. The equilibrium-line altitude was higher than any part of the glacier; however, because snow remained along part of one side of the upper glacier, the accumulation-area ratio was 0.07. During September 13, 2002-September 13, 2003, the glacier terminus retreated at a rate of about 15 meters per year. Average speed of surface ice, computed using a series of vertical aerial photographs dating back to 2001, ranged from 2.2 to 21.8 meters per year. Runoff from the subbasin containing the glacier and from an adjacent non-glacierized basin was gaged during part of water year 2003. Air temperature, precipitation, atmospheric water-vapor pressure, wind speed, and incoming solar radiation were measured at selected locations on and near the glacier. Summer 2003 at the glacier was among the warmest for which data are available.
-
Wang, Dan; Singhasemanon, Nan; Goh, Kean S
2017-07-01
Diazinon is an organophosphorus insecticide that has been widely used in the USA and in California resulting in contamination of surface waters. Several federal and state regulations have been implemented with the aim of reducing its impact to human health and the environment, e.g., the cancellation of residential use products by the USEPA and dormant spray regulations by the California Department of Pesticide Regulation. This study reviewed the change in diazinon use and surface water contamination in accordance with the regulatory actions implemented in California over water years 1992-2014. We observed that use amounts began declining when agencies announced the intention to regulate certain use patterns and continued to decline after the implementation of those programs and regulations. The reduction in use amounts led to a downward trend in concentration data and exceedance frequencies in surface waters. Moreover, we concluded that diazinon concentrations in California's surface waters in recent years (i.e., water years 2012-2014) posed a de minimis risk to aquatic organisms.
-
Bottled water, spas, and early years of water chemistry
Back, William; Landa, Edward R.; Meeks, Lisa
1995-01-01
Although hot springs have been used and enjoyed for thousands of years, it was not until the late 1700s that they changed the course of world civilization by being the motivation for development of the science of chemistry. The pioneers of chemistry such as Priestley, Cavendish, Lavoisier, and Henry were working to identify and generate gases, in part, to determine their role in carbonated beverages. In the 18th century, spas in America were developed to follow the traditional activities of popular European spas. However, they were to become a dominant political and economic force in American history on three major points: (1) By far the most important was to provide a place for the leaders of individual colonies to meet and discuss the need for separation from England and the necessity for the Revolutionary War; (2) the westward expansion of the United States was facilitated by the presence of hot springs in many locations that provided the economic justification for railroads and settlement; and (3) the desire for the preservation of hot springs led to the establishment of the National Park Service. Although mineral springs have maintained their therapeutic credibility in many parts of the world, they have not done so in the United States. We suggest that the American decline was prompted by: (1) the establishment of The Johns Hopkins School of Medicine in 1893; (2) enactment of the Pure Food and Drug Act of 1907; and (3) the remarkable achievement of providing safe water supplies for American cities by the end of the 1920s. The current expanding market for bottled water is based in part on bottled water being an alternative beverage Ito alcohol and sweetened drinks and the inconsistent palatability and perceived health hazards of some tap waters.
-
Buttle, J. M.; Beall, F. D.; Webster, K. L.; Hazlett, P. W.; Creed, I. F.; Semkin, R. G.; Jeffries, D. S.
2018-02-01
Hydrological consequences of alternative harvesting strategies in deciduous forest landscapes with seasonal snow cover have received relatively little attention. Most forest harvesting experiments in landscapes with seasonal snow cover have focused on clearcutting in coniferous forests. Few have examined alternative strategies such as selection or shelterwood cutting in deciduous stands whose hydrologic responses to harvesting may differ from those of conifers. This study presents results from a 31-year examination of hydrological response to and recovery from alternative harvesting strategies in a deciduous forest landscape with seasonal snow cover in central Ontario, Canada. A quantitative means of assessing hydrologic recovery to harvesting is also developed. Clearcutting resulted in increased water year (WY) runoff. This was accompanied by increased runoff in all seasons, with greatest relative increases in Summer. Direct runoff and baseflow from treatment catchments generally increased following harvesting, although annual peak streamflow did not. Largest increases in WY runoff and seasonal runoff as well as direct runoff and baseflow generally occurred in the selection harvest catchment, likely as a result of interception of hillslope runoff by a forest access road and redirection to the stream channel. Hydrologic recovery appeared to begin towards the end of the experimental period for several streamflow metrics but was incomplete for all harvesting strategies 15 years after harvesting. Geochemical tracing indicated that harvesting enhanced the relative importance of surface and near-surface water pathways on catchment slopes for all treatments, with the clearcut catchment showing the most pronounced and prolonged response. Such insights into water partitioning between flow pathways may assist assessments of the ecological and biogeochemical consequences of forest disturbance.
-
Millennium scale radiocarbon variations in Eastern North Atlantic thermocline waters: 0-7000 years
Energy Technology Data Exchange (ETDEWEB)
Frank, N.; Tisnerat-Laborde, N.; Hatte, C. [LSCE, F-91190 Gif Sur Yvette, (France); Colin, C. [Univ Paris 11, IDES, Orsay, (France); Dottori, M.; Reverdin, G. [Univ Paris 06, LOCEAN, F-75252 Paris, (France)
2009-07-01
Complete text of publication follows: Deep water corals are exceptional archives of modern and past ocean circulation as combined U-series and radiocarbon dating allows to reconstruct seawater radiocarbon. Here we present thermocline water radiocarbon concentrations that have been reconstructed for the past {approx} 7000 years for the eastern north Atlantic, based on deep-water corals from Rockall Bank and Porcupine Seabight. We find that thermocline water radiocarbon values follow overall the mean atmospheric long term trend with an average offset of {Delta}{sup 14}C between intermediate water and atmosphere of -55{+-}5 per thousand until 1960 AD. Residual variations are strong ({+-}25 per thousand) over the past 7000 years and there is first evidence that those are synchronous to millennium scale climate variability. Over the past 60 years thermocline water radiocarbon values increase due to the penetration of bomb-radiocarbon into the upper intermediate ocean. Radiocarbon increases by {Delta}{sup 14}C of +95 per thousand compared to +210 per thousand for eastern North Atlantic surface waters. Moreover, bomb-radiocarbon penetration to thermocline depth occurs with a delay of {approx} 10-15 years. Based on high resolution ocean circulation models we suggest that radiocarbon changes at upper intermediate depth are today barely affected by vertical mixing and represent more likely variable advection and mixing of water masses from the Labrador Sea and the temperate Atlantic (including Mediterranean outflow water). Consequently, we assume that residual radiocarbon variations over the past 7000 years reflect millennium scale variability of the Atlantic sub-polar and sub-tropical gyres
-
Marella, R.L.
1992-01-01
Public-supply water use in Florida increased 242 percent between 1960 and 1987 from 530 Mgal/d (million gallons per day) to 1,811 Mgal/d. This change is primarily a result of increases in population and tourism since 1960. Public-supply utilities provide water to a variety of users. In 1985, 71 percent of the water used for public supply was delivered for residential uses, 15 percent for commercial uses, 9 percent for industrial uses, and the remaining 5 percent for public use or other uses. Residential use of public-supply water in Florida has increased nearly 280 Mgal/d, but has decreased in the proportion of total deliveries from 80 to 71 percent between 1975 and 1985. This trend resulted from increased tourism and related commercial services associated with population and visitors. One of several factors that influences public-supply water use in Florida is the increase in resident population, which increased from 4.95 million in 1960 to more than 12.0 million in 1987. Additionally, Florida's nonresident population increased from 18.8 million visitors in 1977, to 34.1 million visitors in 1987, and the part of Florida?s population that relies on public-supply water increased from 68 percent in 1960, to 86 percent in 1987. The public supply per capita use was multiplied by the projected populations for each county for the years 2000, 2010, and 2020 to forecast public-supply water use. Using medium projections, Florida?s population is expected to increase to nearly 16 million in the year 2000, to 18 million in the year 2010, and to almost 20 million in the year 2020, of which an estimated 13.5 million people will be supplied water from public-supply water systems in the year 2000, 15 million in 2010, and nearly 17 million by the year 2020. Public-supply water use is expected to increase to a projected (medium) 2,310 Mgal/d in the year 2000, 2,610 Mgal/d in the year 2010, and 2,890 Mgal/d in the year 2020. If the population exceeds the medium projections for the
-
Sources of trends in water-quality data for selected streams in Texas, 1975-89 water years
Schertz, T.L.; Wells, F.C.; Ohe, D.J.
1994-01-01
Sources of trends in water-quality data for selected streams in Texas for the 1975-89 water years were investigated in this study. The investigation of sources was confined to distinct geographic patterns in the trend indicators for one constituent or for a group of related constituents.
-
Albeke, S. E.; Perkins, D. G.; Ewers, S. L.; Ewers, B. E.; Holbrook, W. S.; Miller, S. N.
2015-12-01
The sharing of data and results is paramount for advancing scientific research. The Wyoming Center for Environmental Hydrology and Geophysics (WyCEHG) is a multidisciplinary group that is driving scientific breakthroughs to help manage water resources in the Western United States. WyCEHG is mandated by the National Science Foundation (NSF) to share their data. However, the infrastructure from which to share such diverse, complex and massive amounts of data did not exist within the University of Wyoming. We developed an innovative framework to meet the data organization, sharing, and discovery requirements of WyCEHG by integrating both open and closed source software, embedded metadata tags, semantic web technologies, and a web-mapping application. The infrastructure uses a Relational Database Management System as the foundation, providing a versatile platform to store, organize, and query myriad datasets, taking advantage of both structured and unstructured formats. Detailed metadata are fundamental to the utility of datasets. We tag data with Uniform Resource Identifiers (URI's) to specify concepts with formal descriptions (i.e. semantic ontologies), thus allowing users the ability to search metadata based on the intended context rather than conventional keyword searches. Additionally, WyCEHG data are geographically referenced. Using the ArcGIS API for Javascript, we developed a web mapping application leveraging database-linked spatial data services, providing a means to visualize and spatially query available data in an intuitive map environment. Using server-side scripting (PHP), the mapping application, in conjunction with semantic search modules, dynamically communicates with the database and file system, providing access to available datasets. Our approach provides a flexible, comprehensive infrastructure from which to store and serve WyCEHG's highly diverse research-based data. This framework has not only allowed WyCEHG to meet its data stewardship
-
van Breukelen, B.M.; Appelo, C.A.J.; Olsthoorn, T.N.
1998-01-01
Water quality changes were modelled along a flowpath in a plume of artificially recharged, pretreated Rhine water in the dunes of the Amsterdam Water Supply, after 24 years of infiltration. The hydrogeochemical transport model PHREEQC was extended with dispersion/diffusion and kinetics for selected
-
Seismic Interface Waves in Coastal Waters: A Review
1980-11-15
description of a plane, monochromatic Scholte *Th(s secton is based on a SACLANTCEN YiteAnal wortk ing papek (IN-461) tha~t was ucg ~iaWy wt0Atten i...scientific purposes. 48 SACLANTCEN SR-42 In 1977 Teledyne-Geotech marketed a l-Hz geophone (model S-500) that can be transported carefully without mass-locking
-
Li, Hongying; Qin, Lijie; He, Hongshi
2018-06-01
Rice is a special crop, and its production differs from that of other crops because it requires a thin layer of water coverage for a long period. The calculation of the water footprint of rice production should differ from that of other crops owing to the rice growing process. This study improved the calculation of blue and grey water footprints of rice production and analyzed the variations in the water footprints for rice production under different rainfall years in Jilin Province. In the drought year, the green water footprint was the lowest and the blue water footprint was the highest among the three years, while in the humid year, the green water footprint was the highest and the blue water footprint was not the lowest. The areas with higher water footprints were found in the east and west regions of Jilin Province, while the areas with lower water footprints were found in the middle east and middle regions of Jilin Province. Blue water was the primary water resource for rice production, although more precipitation provided the highest green water in the humid year; also, the spatial distributions of water footprints were not the same under different rainfall years. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
-
Constituent concentrations, loads, and yields to Beaver Lake, Arkansas, water years 1999-2008
Bolyard, Susan E.; De Lanois, Jeanne L.; Green, W. Reed
2010-01-01
Beaver Lake is a large, deep-storage reservoir used as a drinking-water supply and considered a primary watershed of concern in the State of Arkansas. As such, information is needed to assess water quality, especially nutrient enrichment, nutrient-algal relations, turbidity, and sediment issues within the reservoir system. Water-quality samples were collected at three main inflows to Beaver Lake: the White River near Fayetteville, Richland Creek at Goshen, and War Eagle Creek near Hindsville. Water-quality samples collected over the period represented different flow conditions (from low to high). Constituent concentrations, flow-weighted concentrations, loads, and yields from White River, Richland Creek, and War Eagle Creek to Beaver Lake for water years 1999-2008 were documented for this report. Constituents include total ammonia plus organic nitrogen, dissolved nitrite plus nitrate nitrogen, dissolved orthophosphorus (soluble reactive phosphorus), total phosphorus, total nitrogen, dissolved organic carbon, total organic carbon, and suspended sediment. Linear regression models developed by computer program S-LOADEST were used to estimate loads for each constituent for the 10-year period at each station. Constituent yields and flow-weighted concentrations for each of the three stations were calculated for the study. Constituent concentrations and loads and yields varied with time and varied among the three tributaries contributing to Beaver Lake. These differences can result from differences in precipitation, land use, contributions of nutrients from point sources, and variations in basin size. Load and yield estimates varied yearly during the study period, water years 1999-2008, with the least nutrient and sediment load and yields generally occurring in water year 2006, and the greatest occurring in water year 2008, during a year with record amounts of precipitation. Flow-weighted concentrations of most constituents were greatest at War Eagle Creek near Hindsville
-
Directory of Open Access Journals (Sweden)
Jong Wook Song
2016-01-01
Full Text Available Activation of peroxisome proliferator-activated receptor α (PPARα confers cardioprotection, while its mechanism remains elusive. We investigated the protective effect of PPARα activation against cardiac ischemia-reperfusion injury in terms of the expression of uncoupling protein (UCP. Myocardial infarct size and UCP expression were measured in rats treated with WY-14643 20 mg/kg, a PPARα ligand, or vehicle. WY-14643 increased UCP3 expression in vivo. Myocardial infarct size was decreased in the WY-14643 group (76 ± 8% versus 42 ± 12%, P<0.05. During reperfusion, the incidence of arrhythmia was higher in the control group compared with the WY-14643 group (9/10 versus 3/10, P<0.05. H9c2 cells were incubated for 24 h with WY-14643 or vehicle. WY-14643 increased UCP3 expression in H9c2 cells. WY-14643 decreased hypoxia-stimulated ROS production. Cells treated with WY-14643 were more resistant to hypoxia-reoxygenation than the untreated cells. Knocking-down UCP3 by siRNA prevented WY-14643 from attenuating the production of ROS. UCP3 siRNA abolished the effect of WY-14643 on cell viability against hypoxia-reoxygenation. In summary, administration of PPARα agonist WY-14643 mitigated the extent of myocardial infarction and incidence of reperfusion-induced arrhythmia. PPARα activation conferred cytoprotective effect against hypoxia-reoxygenation. Associated mechanisms involved increased UCP3 expression and resultant attenuation of ROS production.
-
Goldstein, H. L.; Reynolds, R. L.; Derry, J.; Kokaly, R. F.; Moskowitz, B. M.
2017-12-01
Dust deposited on snow cover (DOS) in the American West can enhance snow-melt rates and advance the timing of melting, which together can result in earlier-than-normal runoff and overall smaller late-season water supplies. Understanding DOS properties and how they affect the absorption of solar radiation can lead to improved snow-melt models by accounting for important dust components. Here, we report on the interannual variability of DOS-mass loading, particle size, organic matter, and iron mineralogy, and their correspondences to laboratory-measured reflectance of samples from the Swamp Angel Study Plot in the San Juan Mountains, Colorado, USA. Samples were collected near the end of spring in water year 2009 (WY09) and from WY11-WY16, when dust layers deposited throughout the year had merged into one layer at the snow surface. Dust-mass loading on snow ranged 2-64 g/m2, mostly as particles with median sizes of 13-33 micrometers. Average reflectance values of DOS varied little across total (0.4 to 2.50 µm) and visible (0.4 to 0.7 µm) wavelengths at 0.30-0.45 and 0.19-0.27, respectively. Reflectance values lacked correspondence to particle-size. Total reflectance values inversely corresponded to concentrations of (1) organic matter content (4-20 weight %; r2 = 0.71) that included forms of black carbon and locally derived material such as pollen, and (2) magnetite (0.05 to 0.13 weight %; r2 = 0.44). Magnetite may be a surrogate for related dark, light-absorbing minerals. Concentrations of crystalline ferric oxide minerals (hematite+goethite) based on magnetic properties at room-temperature did not show inverse association to visible reflectance values. These ferric oxide measures, however, did not account for the amounts of nano-sized ferric oxides known to exist in these samples. Quantification of such nano-sized particles is required to evaluate their possible effects on visible reflectance. Nonetheless, our results emphasize that reflectance values of year
-
Soil water distribution on different number of growing years of alfalfa ...
African Journals Online (AJOL)
GREGORY
2010-08-30
Aug 30, 2010 ... dNational Engineering Research Center for Water-Saving and ... After alfalfa grew for >18 years, the annual recovery of its soil water at 0 - 200 cm soil depth was 1.49%, ... yield of following crops, or even lead to failure of the.
-
Conceptual and numerical models of the glacial aquifer system north of Aberdeen, South Dakota
Marini, Katrina A.; Hoogestraat, Galen K.; Aurand, Katherine R.; Putnam, Larry D.
2012-01-01
This U.S. Geological Survey report documents a conceptual and numerical model of the glacial aquifer system north of Aberdeen, South Dakota, that can be used to evaluate and manage the city of Aberdeen's water resources. The glacial aquifer system in the model area includes the Elm, Middle James, and Deep James aquifers, with intervening confining units composed of glacial till. The Elm aquifer ranged in thickness from less than 1 to about 95 feet (ft), with an average thickness of about 24 ft; the Middle James aquifer ranged in thickness from less than 1 to 91 ft, with an average thickness of 13 ft; and the Deep James aquifer ranged in thickness from less than 1 to 165 ft, with an average thickness of 23 ft. The confining units between the aquifers consisted of glacial till and ranged in thickness from 0 to 280 ft. The general direction of groundwater flow in the Elm aquifer in the model area was from northwest to southeast following the topography. Groundwater flow in the Middle James aquifer was to the southeast. Sparse data indicated a fairly flat potentiometric surface for the Deep James aquifer. Horizontal hydraulic conductivity for the Elm aquifer determined from aquifer tests ranged from 97 to 418 feet per day (ft/d), and a confined storage coefficient was determined to be 2.4x10-5. Estimates of the vertical hydraulic conductivity of the sediments separating the Elm River from the Elm aquifer, determined from the analysis of temperature gradients, ranged from 0.14 to 2.48 ft/d. Average annual precipitation in the model area was 19.6 inches per year (in/yr), and agriculture was the primary land use. Recharge to the Elm aquifer was by infiltration of precipitation through overlying outwash, lake sediments, and glacial till. The annual recharge for the model area, calculated by using a soil-water-balance method for water year (WY) 1975-2009, ranged from 0.028 inch in WY 1980 to 4.52 inches in WY 1986, with a mean of 1.56 inches. The annual potential
-
Szadowska-Szlachetka, Zdzisława; Janczaruk, Marzena; Kijewska, Jadwiga; Starosławska, Elżbieta; Łuczyk Marta
2015-01-01
Szadowska-Szlachetka Zdzisława, Janczaruk Marzena, Kijewska Jadwiga, Starosławska Elżbieta, Łuczyk Marta. Analiza wsparcia oczekiwanego z ustaleniem jego dawców w odniesieniu do osób z wyłonioną stomią jelitową = Expected and received support as well as its providers at patients with emerged intestinal stoma. Journal of Education, Health and Sport. 2015;5(3):91-102. ISSN 2391-8306. DOI: 10.5281/zenodo.16253 http://ojs.ukw.edu.pl/index.php/johs/article/view/2015%3B5%283%29%3A91-102 htt...
-
ORF Alignment: NC_005072 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available = 122 ... Query: 53 ... ELDQLLQTVGWSRRPIRRVKRALEFSILVVGLWRHDEKFPRLVGFARCTGDGIIEATIWD ...112 ... ELDQLLQTVGWSRRPIRRVKRALEFSILVVGLWRHDEKFPRLVGFARCTGDGIIEATIWD Sbjct: 1 ... ELDQLLQTVGWSRRPIRRVKR...ALEFSILVVGLWRHDEKFPRLVGFARCTGDGIIEATIWD 60 ... Query: 173 WY 174 ... WY Sbjct: 121 WY 122
-
ORF Alignment: NC_005042 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 122 ... Query: 57 ... ELEQLLQSVGWSRRPIRRVKKALDNSLLKVGVWQHDPKFPRLIGFARCTGDEVIQATIWD 116 ... ... ... ELEQLLQSVGWSRRPIRRVKKALDNSLLKVGVWQHDPKFPRLIGFARCTGDEVIQATIWD Sbjct: 1 ... ELEQL...LQSVGWSRRPIRRVKKALDNSLLKVGVWQHDPKFPRLIGFARCTGDEVIQATIWD 60 ... Query: 177 WY 178 ... WY Sbjct: 121 WY 122
-
Water Resources Research Grant Program project descriptions, fiscal year 1987
,
1987-01-01
This report contains information on the 34 new projects funded by the United States Geological Survey 's Water Resources Research Grant Program in fiscal year 1987 and on 3 projects completed during the year. For the new projects, the report gives the grant number, project title, performing organization, principal investigator(s), and a project description that includes: (1) identification of water related problems and problem-solution approach (2) contribution to problem solution, (3) objectives, and (4) approach. The 34 projects include 12 in the area of groundwater quality problems, 12 in the science and technology of water quality management, 1 in climate variability and the hydrologic cycle, 4 in institutional change in water resources management, and 5 in surface water management. For the three completed projects, the report furnishes the grant number; project title; performing organization; principal investor(s); starting data; data of receipt of final report; and an abstract of the final report. Each project description provides the information needed to obtain a copy of the final report. The report contains tables showing: (1) proposals received according to area of research interest, (2) grant awards and funding according to area of research interest, (3) proposals received according to type of submitting organization, and (4) awards and funding according to type of organization. (Author 's abstract)
-
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The Water Resources Division of the US Geological Survey (USGS), in cooperation with State agencies, obtains a large amount of data each water year (a water year is the 12-month period from October 1 through September 30 and is identified by the calendar year in which it ends) pertaining to the water resources of Ohio. These data, accumulated during many years, constitute a valuable data base for developing an improved understanding of the water resources of the State. To make these data readily available to interested parties outside the USGS, they are published annually in this report series entitled ``Water Resources Data--Ohio.`` This report (in two volumes) includes records on surface water and ground water in the State. Specifically, it contains: (1) Discharge records for streamflow-gaging stations, miscellaneous sites, and crest-stage stations; (2) stage and content records for streams, lakes, and reservoirs; (3) water-quality data for streamflow-gaging stations, wells, synaptic sites, and partial-record sites; and (4) water-level data for observation wells. Locations of lake- and streamflow-gaging stations, water-quality stations, and observation wells for which data are presented in this volume are shown in figures ga through 8b. The data in this report represent that part of the National Water Data System collected by the USGS and cooperating State and Federal agencies in Ohio. This series of annual reports for Ohio began with the 1961 water year with a report that contained only data relating to the quantities of surface water. For the 1964 water year, a similar report was introduced that contained only data relating to water quality. Beginning with the 1975 water year, the report was changed to present (in two to three volumes) data on quantities of surface water, quality of surface and ground water, and ground-water levels.
-
Energy-water analysis of the 10-year WECC transmission planning study cases.
Energy Technology Data Exchange (ETDEWEB)
Tidwell, Vincent Carroll; Passell, Howard David; Castillo, Cesar; Moreland, Barbara
2011-11-01
modules for calculating water withdrawal and consumption for current and planned electric power generation; projected water demand from competing use sectors; and, surface and groundwater availability. WECC's long range planning is organized according to two target planning horizons, a 10-year and a 20-year. This study supports WECC in the 10-year planning endeavor. In this case the water implications associated with four of WECC's alternative future study cases (described below) are calculated and reported. In future phases of planning we will work with WECC to craft study cases that aim to reduce the thermoelectric footprint of the interconnection and/or limit production in the most water stressed regions of the West.
-
ORF Alignment: NC_005070 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available nechococcus sp. WH 8102] ... Length = 122 ... Query: 44 ... ELEQLLEAVGWSRRPVRRVRKALANSLLTVGLWRHDPRIPRLVGFARC...TGDGVFEATVWD 103 ... ELEQLLEAVGWSRRPVRRVRKALANSLLTVGLWRHDPRIPRLVGFARCTGDG...VFEATVWD Sbjct: 1 ... ELEQLLEAVGWSRRPVRRVRKALANSLLTVGLWRHDPRIPRLVGFARCTGDGVFEATVWD 60 ... Query: 164 WY 165 ... WY Sbjct: 121 WY 122
-
Kelly, Todd; Romero, Orlando; Jimenez, Mike
2006-01-01
Urbanization has dramatically increased precipitation runoff to the system of drainage channels and natural stream channels in the Albuquerque, New Mexico, metropolitan area. Rainfall and runoff data are important for planning and designing future storm-water conveyance channels in newly developing areas. Storm-water quality also is monitored in accordance with the National Pollutant Discharge Elimination System mandated by the U.S. Environmental Protection Agency. The Albuquerque Metropolitan Arroyo Flood Control Authority, the City of Albuquerque, and the U.S. Geological Survey began a cooperative program to collect hydrologic data to assist in assessing the quality and quantity of surface-water resources in the Albuquerque area. This report presents water-quality, streamflow, and rainfall data collected from October 1, 2003, to September 30, 2004 (water year 2004). Also provided is a station analysis for each of the 18 streamflow-gaging sites and 39 rainfall-gaging sites, which includes a description of monitoring equipment, problems associated with data collection during the year, and other information used to compute streamflow discharges or rainfall records. A hydrographic comparison shows the effects that the largest drainage channel in the metropolitan area, the North Floodway Channel, has on total flow in the Rio Grande.
-
ORF Alignment: NC_005071 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... [Prochlorococcus marinus str. MIT 9313] ... Length = 122 ... Query: 44 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD 103 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARC...TGDGVLEATVWD Sbjct: 1 ... ELEQLLEAVGWSRRPMRRVRLALDHTLLKVGLWRHDPLFPRLVGFARCTGDGVLEATVWD 60 ... Query: 164 WY 165 ... WY Sbjct: 121 WY 122
-
A Road Map for America's Water for the Next 20 Years
Lall, U.; Rising, J.; Ho, M. W.; Josset, L.; Allaire, M.; Troy, T.; Devineni, N.; Ruddell, B. L.; Pal, I.
2016-12-01
This talk will present a perspective from the America's Water Initiative team that has been discussing the past, present and future of water in America. Paleoclimate reconstructions reveal dramatic inter-annual to decadal structure in the variation in drought across America and provide a backdrop for increasing climate variability expected in the next century. At the same time our water infrastructure ranging from main pipes to dams is aging and in urgent need of renewal. Non-point source pollution from cities and agriculture continues to be a concern and poses a challenge for water supplies. At the same time, there has been progress on water use efficiency, and on the acceptability of water reuse. To assure water, energy and food security for the future, one needs significant investments in water infrastructure of all types, and the cumulative estimates for these run to nearly $3 trillion over the next 20 years. A discussion on infrastructure provision is not complete without a discussion on how use patterns (e.g., where and which crops are grown and how), economic and financial instruments (e.g., insurance associated with the failure of water supply or with flooding, water pricing and trading, capital for construction), regulatory instruments (e.g., standards and policies), technological innovation (e.g., in sensors to improve water utilization in agriculture or pervasive monitoring of drinking and environmental water quality, nanofiltration and resource extraction from waste streams), and governance of water systems. We present for discussion, a proposal for the next 5 and the next 20 years that lays out an adaptive strategy to apprach these issues, and the associated unknowns and challenges that we need to address. The America's Water initiative was launched by Columbia University in partnership with other Universities and representatives from the public and private sectors. A modeling platform that brings together climate, water, agricultural, energy and urban
-
The rapid development of unconventional gas resources has been accompanied by an increase in public awareness regarding the potential effects of drilling operations on drinking water sources. Incidents have been reported involving blowouts (e.g., Converse County, WY; Lawrence Tow...
-
Water, ice, and meteorological measurements at South Cascade Glacier, Washington, balance year 2002
Bidlake, William R.; Josberger, Edward G.; Savoca, Mark E.
2004-01-01
Winter snow accumulation and summer snow and ice ablation were measured at South Cascade Glacier, Washington, to estimate glacier mass balance quantities for balance year 2002. The 2002 glacier-average maximum winter snow balance was 4.02 meters, the second largest since 1959. The 2002 glacier summer, net, and annual (water year) balances were -3.47, 0.55, and 0.54 meters, respectively. The area of the glacier near the end of the balance year was 1.92 square kilometers, and the equilibrium-line altitude and the accumulation area ratio were 1,820 meters and 0.84, respectively. During September 20, 2001 to September 13, 2002, the terminus retreated 4 meters, and computed average ice speeds in the ablation area ranged from 7.8 to 20.7 meters per year. Runoff from the subbasin containing the glacier and from an adjacent non-glacierized basin were measured during part of the 2002 water year. Air temperature, precipitation, atmospheric water-vapor pressure, wind speed and incoming solar radiation were measured at selected locations near the glacier.
-
Toward the second 50 years of Water Resources Research
Rajaram, H.
2014-12-01
Since the first issue in 1965, 49 volumes and 464 issues of Water Resources Research (WRR) have been published, including more than 13,800 contributions that received more than 380,000 citations. WRR has always maintained a forward-looking vision, providing an interdisciplinary platform to nurture the initiation and development of numerous sub-disciplines and research themes in hydrology, water resources, and earth sciences and over the last 50 years. This vision, supported in no small measure by a dedicated community of researchers who submitted their best research to WRR, have helped the journal maintain its international leadership in this field. As we enter the second 50 years of WRR, new trends in scientific publishing, open access publication and web-based discussion forums, pose challenges (and opportunities) for sustaining WRR's leadership role. In this presentation, we will present the vision of the present editorial board for the future of WRR, and discuss several steps we are undertaking to adapt the journal to modern trends in communicating scientific research. This includes the introduction of new article types, such as the forthcoming "Debates on Water Resources", targeted special sections, and efforts to improve the timeliness of the review process. We humbly stand on the shoulders of the thirty-four dedicated previous editors of WRR, and remain open to receiving suggestions from the AGU hydrologic community.
-
Bidlake, William R.; Josberger, Edward G.; Savoca, Mark E.
2007-01-01
Winter snow accumulation and summer snow and ice ablation were measured at South Cascade Glacier, Washington, to estimate glacier mass-balance quantities for balance years 2004 and 2005. The North Cascade Range in the vicinity of South Cascade Glacier accumulated smaller than normal winter snowpacks during water years 2004 and 2005. Correspondingly, the balance years 2004 and 2005 maximum winter snow balances of South Cascade Glacier, 2.08 and 1.97 meters water equivalent, respectively, were smaller than the average of such balances since 1959. The 2004 glacier summer balance (-3.73 meters water equivalent) was the eleventh most negative during 1959 to 2005 and the 2005 glacier summer balance (-4.42 meters water equivalent) was the third most negative. The relatively small winter snow balances and unusually negative summer balances of 2004 and 2005 led to an overall loss of glacier mass. The 2004 and 2005 glacier net balances, -1.65 and -2.45 meters water equivalent, respectively, were the seventh and second most negative during 1953 to 2005. For both balance years, the accumulation area ratio was less than 0.05 and the equilibrium line altitude was higher than the glacier. The unusually negative 2004 and 2005 glacier net balances, combined with a negative balance previously reported for 2003, resulted in a cumulative 3-year net balance of -6.20 meters water equivalent. No equal or greater 3-year mass loss has occurred previously during the more than 4 decades of U.S. Geological Survey mass-balance measurements at South Cascade Glacier. Accompanying the glacier mass losses were retreat of the terminus and reduction of total glacier area. The terminus retreated at a rate of about 17 meters per year during balance year 2004 and 15 meters per year during balance year 2005. Glacier area near the end of balance years 2004 and 2005 was 1.82 and 1.75 square kilometers, respectively. Runoff from the basin containing the glacier and from an adjacent nonglacierized basin was
-
Fiscal Year 1990 program report: New York State Water Resources Institute
International Nuclear Information System (INIS)
Porter, K.S.
1991-08-01
New York has made major strides in reducing or eliminating point sources of water pollutants. Nonpoint sources have become the primary focus of many State water pollution control programs. Among the most critical remaining water pollutant sources in New York are toxics-contaminated sediments in surface water bodies and leaks and spills of toxic and hazardous materials. Contaminated sediments are implicated as a major origin of certain persistent synthetic organics accumulated by higher aquatic organisms, as well as representing an uncertain but large reservoir of contaminants which may be re-released during high flows. Spills and leaks represent threats to both surface and ground water. The State now responds to over 10,000 of these cases each year. A growing number of cases are leaking underground petroleum storage tanks, requiring long and expensive cleanup activities
-
Directory of Open Access Journals (Sweden)
Anthony Erico Guimarães
1985-06-01
Full Text Available Em prosseguimento aos estudos sobre a ecologia de culicídeos que vimos realizando no Parque Nacional da Serra dos Orgãos (PNSO, apresentamos nesta oportunidade a sua distribuição vertical. Por meio de capturas feitas em isca humana concomitantemente ao nível do solo e nas imediações da copa das árvores, estabelecemos as tendências das espécies que ali ocorreram de março de 1981 a fevereiro de 1982, por se alimentarem de sangue na copa da floresta ou junto ao solo. A distribuição é analisada comparativamente em ambos os níveis levando-se em consideração as variações de temperatura, umidade, precipitações pluviométricas e estações do ano. Dentre as espécies com nítida preferência à acrodendrofilia encontramos alguns importantes transmissores de doenças: Anopheles cruzii - malária humana e simiana; Culex nigripalpus - encefalite de São Luis (SLE; Haemagogus leucocelaenus e Haemagogus capricornii - febre amarela silvestre, todas também sendo obtidas, embora em menor número, a nível do solo. Os sabetíneos - Wyeomyia Knabi, Phoniomyia theobaldi, Sabethes tarsopus, Sabethes quasicyaneus, Sabethes chloropterus - completam a relação das principais espécies que preferem a copa. Por outro lado, Aedes fluviatilis, Trichoprosopon digitatum, Tr. similis, Tr. frontosus, Tr. theobaldi, Wy, arthrostigma, Wy. aporonoma, Wy. personata, Wy undulata, Wy. mystes, Limatus durhami, Li. pseudomethisticus, Sa. identicus e Sa. undosus foram capturados em grande maioria próximo ao solo.In this paper we deal with the vertical distribution of the mosquitoes which we have been studying at the National Park of Serra dos Órgãos, state of Rio de Janeiro, Brazil. We have established, for a whole year, by means of concomitant weekly captures on human baits the preferences of the various species for feeding. A comparative analysis of the monthly vertical distribution is made, taking into account variations of temperature, humidity, rainfall
-
Fifty Years of Water Sensitive Urban Design, Salisbury, South Australia
Institute of Scientific and Technical Information of China (English)
John C.Radcliffe; Declan Page; Bruce Naumann; Peter Dillon
2017-01-01
Australia has developed extensive policies and guidelines for the management of its water.The City of Salisbury,located within metropolitan Adelaide,South Australia,developed rapidly through urbanisation from the 1970s.Water sensitive urban design principles were adopted to maximise the use of the increased run-off generated by urbanisation and ameliorate flood risk.Managed aquifer recharge was introduced for storing remediated low-salinity stormwater by aquifer storage and recovery (ASR) in a brackish aquifer for subsequent irrigation.This paper outlines how a municipal government has progressively adopted principles of Water Sensitive Urban Design during its development within a framework of evolving national water policies.Salisbury's success with stormwater harvesting led to the formation of a pioneering water business that includes linking projects from nine sites to provide a non-potable supply of 5 × 106 m3 ·year-1.These installations hosted a number of applied research projects addressing well configuration,water quality,reliability and economics and facilitated the evaluation of its system as a potential potable water source.The evaluation showed that while untreated stormwater contained contaminants,subsurface storage and end-use controls were sufficient to make recovered water safe for public open space irrigation,and with chlorination,acceptable for third pipe supplies.Drinking water quality could be achieved by adding microfiltration,disinfection with UV and chlorination.The costs that would need to be expended to achieve drinking water safety standards were found to be considerably less than the cost of establishing dual pipe distribution systems.The full cost of supply was determined to be AUD$1.57 m-3 for non-potable water for public open space irrigation,much cheaper than mains water,AUD $3.45 m-3 at that time.Producing and storing potable water was found to cost AUD$1.96 to $2.24 m-3.
-
Break-up of Ca-montmorillonite particles by Na-montmorillonite
International Nuclear Information System (INIS)
Hedstroem, Magnus; Birgersson, Martin
2012-01-01
Document available in extended abstract form only. In the Swedish KBS-3 concept for a geological deep storage of spent nuclear fuel, bentonite of high montmorillonite content is proposed to serve as a buffer surrounding copper canisters containing the spent fuel. Montmorillonite has an exceptional affinity for water which results in the build-up of a swelling pressure when bentonite is placed in a confined volume. However, there is a concern that during and after a glaciation, meltwater of low ionic strength may cause the bentonite to swell extensively into fractures and turn into a sol that could be transported away by the seeping water. It is thus warranted to understand the behaviour of montmorillonite at aqueous condition of low ionic strength. Turbidity measurements were used to a large extent in previous work to follow the free swelling or settling process of montmorillonite in various aqueous solutions and thereby give information regarding sol formation. From theory we know that turbidity of a suspension is proportional to the particle concentration. However turbidity is also proportional to V p 2 where V p is the volume of the scattering particle. Thus the fact that turbidity of a Ca-montmorillonite suspension is higher than the turbidity of a Na- montmorillonite suspension of the same clay concentration indicates that Na-montmorillonite separate into smaller particles than Ca-montmorillonite. In this work we make use this size dependence to quantify the difference between Wyoming, Milos and Kutch montmorillonite in particular with respect to how mixed Ca/Na montmorillonite systems behave. Some Ca/Mg, Mg/Na and Na/K systems are also included for comparison. Figure 1 shows the final (stabilized) turbidity response of mixed Wy-Ca/Na montmorillonite as a function of the fraction of Ca 2+ in the clay. Starting material are suspensions of homo-ionic Wy-Ca and Wy-Na montmorillonite at a concentration of 1 g/l. The turbidity of the suspensions of the homo
-
Long Island Sound Water Temperatures During the Last Two Thousand Years
Warren, C. E.; Varekamp, J. C.; Thomas, E.
2010-12-01
The Long Island Sound (LIS), sometimes called the “urban sea”, is a large estuary in the heavily populated coastal zone between New York City and the Connecticut - Rhode Island border. LIS has seen dramatic environmental shifts since colonial times, including major changes in aquatic food extraction, land use, contaminant and nutrient inputs, and climate change. Annual seasonal hypoxic/anoxic events, especially common in westernmost LIS, have been identified as potentially severe stressors for LIS biota including valuable fisheries species such as lobsters and shellfish. These conditions develop when the Sound becomes stratified in midsummer and oxygen consumption from the oxidation of organic matter exceeds oxygen resupply from the atmosphere or photosynthesis. Severity, lateral extent and frequency of hypoxia/anoxia is influenced by the amount of organic matter available for oxidation, both marine organic matter (produced by algal blooms in response to influx of N-rich effluents from waste water treatment plants) and terrestrial organic matter. These events are also influenced by the severity of stratification, determined by differences in density from temperature and salinity gradients of surface and bottom waters. Studies of cores in western and central LIS, dated using Hg-pollution profiles, 210Pb - 137Cs, and 14C, indicate that eutrophication and hypoxia have occurred in LIS only over the last ~150 years, with the possible exception of the Narrows (closest to NY) where it may have occurred before colonial times. Salinity decreased as well over the last 150 years, possibly due to changes in land use or deflection of fresh water from the Hudson River. Temperature variability in LIS over the last few thousand years has not been clearly documented, as several paleotemperature proxies are difficult to use in estuarine settings. Oxygen isotope values of carbonate microfossils are influenced by salinity fluctuations, and Mg/Ca values in these shells may be
-
Chambers, Jeanne C.; Miller, Richard F.; Board, David I.; Pyke, David A.; Roundy, Bruce A.; Grace, James B.; Schupp, Eugene W.; Tausch, Robin J.
2014-01-01
In sagebrush ecosystems invasion of annual exotics and expansion of piñon (Pinus monophylla Torr. and Frem.) and juniper (Juniperus occidentalis Hook., J. osteosperma [Torr.] Little) are altering fire regimes and resulting in large-scale ecosystem transformations. Management treatments aim to increase resilience to disturbance and enhance resistance to invasive species by reducing woody fuels and increasing native perennial herbaceous species. We used Sagebrush Steppe Treatment Evaluation Project data to test predictions on effects of fire vs. mechanical treatments on resilience and resistance for three site types exhibiting cheatgrass (Bromus tectorum L.) invasion and/or piñon and juniper expansion: 1) warm and dry Wyoming big sagebrush (WY shrub); 2) warm and moist Wyoming big sagebrush (WY PJ); and 3) cool and moist mountain big sagebrush (Mtn PJ). Warm and dry (mesic/aridic) WY shrub sites had lower resilience to fire (less shrub recruitment and native perennial herbaceous response) than cooler and moister (frigid/xeric) WY PJ and Mtn PJ sites. Warm (mesic) WY Shrub and WY PJ sites had lower resistance to annual exotics than cool (frigid to cool frigid) Mtn PJ sites. In WY shrub, fire and sagebrush mowing had similar effects on shrub cover and, thus, on perennial native herbaceous and exotic cover. In WY PJ and Mtn PJ, effects were greater for fire than cut-and-leave treatments and with high tree cover in general because most woody vegetation was removed increasing resources for other functional groups. In WY shrub, about 20% pretreatment perennial native herb cover was necessary to prevent increases in exotics after treatment. Cooler and moister WY PJ and especially Mtn PJ were more resistant to annual exotics, but perennial native herb cover was still required for site recovery. We use our results to develop state and transition models that illustrate how resilience and resistance influence vegetation dynamics and management options.
-
Global change and water resources in the next 100 years
Larsen, Matthew C.; Hirsch, R.M.
2010-01-01
We are in the midst of a continental-scale, multi-year experiment in the United States, in which we have not defined our testable hypotheses or set the duration and scope of the experiment, which poses major water-resources challenges for the 21st century. What are we doing? We are expanding population at three times the national growth rate in our most water-scarce region, the southwestern United States, where water stress is already great and modeling predicts decreased streamflow by the middle of this century. We are expanding irrigated agriculture from the west into the east, particularly to the southeastern states, where increased competition for ground and surface water has urban, agricultural, and environmental interests at odds, and increasingly, in court. We are expanding our consumption of pharmaceutical and personal care products to historic high levels and disposing them in surface and groundwater, through sewage treatment plants and individual septic systems. These substances are now detectable at very low concentrations and we have documented significant effects on aquatic species, particularly on fish reproduction function. We don’t yet know what effects on human health may emerge, nor do we know if we need to make large investments in water treatment systems, which were not designed to remove these substances. These are a few examples of our national-scale experiment. In addition to these water resources challenges, over which we have some control, climate change models indicate that precipitation and streamflow patterns will change in coming decades, with western mid-latitude North America generally drier. We have already documented trends in more rain and less snow in western mountains. This has large implications for water supply and storage, and groundwater recharge. We have documented earlier snowmelt peak spring runoff in northeastern and northwestern States, and western montane regions. Peak runoff is now about two weeks earlier than it was
-
78 FR 55731 - Notice of Service Delivery Area Designation for the Wilton Rancheria
2013-09-11
... medical priority, and the actual availability and accessibility of alternate resources in accordance with... Springs, WY, Fremont, WY, Reservation, Wyoming. Sublette, WY. Aroostook Band of Micmac Indians of... Reservation, Montana. Richland, MT, Roosevelt, MT, Sheridan, MT, Valley, MT. Bad River Band of the Lake...
-
Properties of Concrete Exposed to Running Fresh Water for 24 Years
DEFF Research Database (Denmark)
Sørensen, Eigil V.
2008-01-01
A total of nine concretes, comprising three cement types, incorporation of fly ash, superplasticized high strength concrete and high performance concrete with microsilica, have been monitored during 24 years of exposure to running fresh water under Danish outdoor climatic conditions....... The compressive strength development has been measured, and durability aspects have been assessed after 6 and 21 years of exposure, with very positive results....
-
Fifty years of solid-phase extraction in water analysis--historical development and overview.
Liska, I
2000-07-14
The use of an appropriate sample handling technique is a must in an analysis of organic micropollutants in water. The efforts to use a solid phase for the recovery of analytes from a water matrix prior to their detection have a long history. Since the first experimental trials using activated carbon filters that were performed 50 years ago, solid-phase extraction (SPE) has become an established sample preparation technique. The initial experimental applications of SPE resulted in widespread use of this technique in current water analysis and also to adoption of SPE into standardized analytical methods. During the decades of its evolution, chromatographers became aware of the advantages of SPE and, despite many innovations that appeared in the last decade, new SPE developments are still expected in the future. A brief overview of 50 years of the history of the use of SPE in organic trace analysis of water is given in presented paper.
-
Yang, Hao; Luo, Peng; Wang, Jun; Mou, Chengxiang; Mo, Li; Wang, Zhiyuan; Fu, Yao; Lin, Honghui; Yang, Yongping; Bhatta, Laxmi Dutt
2015-01-01
Climate and human-driven changes play an important role in regional droughts. Northwest Yunnan Province is a key region for biodiversity conservation in China, and it has experienced severe droughts since the beginning of this century; however, the extent of the contributions from climate and human-driven changes remains unclear. We calculated the ecosystem evapotranspiration (ET) and water yield (WY) of northwest Yunnan Province, China from 2001 to 2013 using meteorological and remote sensing observation data and a Surface Energy Balance System (SEBS) model. Multivariate regression analyses were used to differentiate the contribution of climate and vegetation coverage to ET. The results showed that the annual average vegetation coverage significantly increased over time with a mean of 0.69 in spite of the precipitation fluctuation. Afforestation/reforestation and other management efforts attributed to vegetation coverage increase in NW Yunnan. Both ET and WY considerably fluctuated with the climate factors, which ranged from 623.29 mm to 893.8 mm and -51.88 mm to 384.40 mm over the time period. Spatially, ET in the southeast of NW Yunnan (mainly in Lijiang) increased significantly, which was in line with the spatial trend of vegetation coverage. Multivariate linear regression analysis indicated that climatic factors accounted for 85.18% of the ET variation, while vegetation coverage explained 14.82%. On the other hand, precipitation accounted for 67.5% of the WY. We conclude that the continuous droughts in northwest Yunnan were primarily climatically driven; however, man-made land cover and vegetation changes also increased the vulnerability of local populations to drought. Because of the high proportion of the water yield consumed for subsistence and poor infrastructure for water management, local populations have been highly vulnerable to climate drought conditions. We suggest that conservation of native vegetation and development of water
-
Ten years of radiometric monitoring in water samples in Uruguay potables plants
International Nuclear Information System (INIS)
Perruni, P.
2000-01-01
The work exposes the summary of having been radiometrics obtained during the last 10 years in several water treatment plants of the national territory, with the purpose of determining if in the total dose to the one that this exposed one naturally the population of the country, is important the contribution of polluting radioactives in the drinkable water, in function of the geographical area and the time of the year. The investigation is framed inside the Program of Control Radiometrics of Products of Fission in waters, floors, foods and aerosols of the Uruguay developed by the Radiochemistry Department, of the Nuclear Research Center, Montevideo (UY) The samples of water filter, they process and they analyze according to laboratory protocols, had duplicated by each plant, parallel with radio-active, white bottom measures and standards. The results net average obtained for each factory, gave below the one it limits of detection: 2 BQ/Kg for geometry Marinelli and 0.02 BQ/g for plane geometry, with 99,3% of dependability (standard 3 deviations), very below the maximum values admitted by International Organisms (WHO, FAO, ICRP) [es
-
Smith, Kirk P.
2017-09-12
The source water area for the drinking-water supply of the city of Cambridge, Massachusetts, encompasses major transportation corridors, as well as large areas of light industrial, commercial, and residential land use. Because of the large amount of roadway in the drinking-water source area, the Cambridge water supply is affected by the usage of deicing compounds and by other constituents that are flushed from such impervious areas. The U.S. Geological Survey (USGS) has monitored surface-water quality in the Cambridge Reservoir and Stony Brook Reservoir Basins, which compose the drinking-water source area, since 1997 (water year 1998) through continuous monitoring and the collection of stream-flow samples.In a study conducted by the USGS, in cooperation with the City of Cambridge Water Department, concentrations and loads of calcium (Ca), chloride (Cl), magnesium (Mg), sodium (Na), and sulfate (SO4) were estimated from continuous records of specific conductance and streamflow for streams and tributaries at 10 continuous water-quality monitoring stations. These data were used to characterize current (2015) water-quality conditions, estimate loads and yields, and describe trends in Cl and Na in the tributaries and main-stem streams in the Cambridge Reservoir and Stony Brook Reservoir Basins. These data also were used to describe how stream-water quality is related to various basin characteristics and provide information to guide future management of the drinking-water source area.Water samples from 2009–15 were analyzed for physical properties and concentrations of Ca, Cl, Mg, Na, potassium (K), SO4, and total phosphorus (TP). Values of physical properties and constituent concentrations varied widely, particularly in composite samples of stormflow from tributaries that have high percentages of constructed impervious areas. Median concentrations of Ca, Cl, Mg, Na, and K in samples collected from the tributaries in the Cambridge Reservoir Basin (27.2, 273, 4.7, 154
-
Global change and water resources in the next 100 years
Larsen, M. C.; Hirsch, R. M.
2010-03-01
We are in the midst of a continental-scale, multi-year experiment in the United States, in which we have not defined our testable hypotheses or set the duration and scope of the experiment, which poses major water-resources challenges for the 21st century. What are we doing? We are expanding population at three times the national growth rate in our most water-scarce region, the southwestern United States, where water stress is already great and modeling predicts decreased streamflow by the middle of this century. We are expanding irrigated agriculture from the west into the east, particularly to the southeastern states, where increased competition for ground and surface water has urban, agricultural, and environmental interests at odds, and increasingly, in court. We are expanding our consumption of pharmaceutical and personal care products to historic high levels and disposing them in surface and groundwater, through sewage treatment plants and individual septic systems. These substances are now detectable at very low concentrations and we have documented significant effects on aquatic species, particularly on fish reproduction function. We don’t yet know what effects on human health may emerge, nor do we know if we need to make large investments in water treatment systems, which were not designed to remove these substances. These are a few examples of our national-scale experiment. In addition to these water resources challenges, over which we have some control, climate change models indicate that precipitation and streamflow patterns will change in coming decades, with western mid-latitude North America generally drier. We have already documented trends in more rain and less snow in western mountains. This has large implications for water supply and storage, and groundwater recharge. We have documented earlier snowmelt peak spring runoff in northeastern and northwestern States, and western montane regions. Peak runoff is now about two weeks earlier than it was
-
100 years of California’s water rights system: patterns, trends and uncertainty
Grantham, Theodore E.; Viers, Joshua H.
2014-08-01
For 100 years, California’s State Water Resources Control Board and its predecessors have been responsible for allocating available water supplies to beneficial uses, but inaccurate and incomplete accounting of water rights has made the state ill-equipped to satisfy growing societal demands for water supply reliability and healthy ecosystems. Here, we present the first comprehensive evaluation of appropriative water rights to identify where, and to what extent, water has been dedicated to human uses relative to natural supplies. The results show that water right allocations total 400 billion cubic meters, approximately five times the state’s mean annual runoff. In the state’s major river basins, water rights account for up to 1000% of natural surface water supplies, with the greatest degree of appropriation observed in tributaries to the Sacramento and San Joaquin Rivers and in coastal streams in southern California. Comparisons with water supplies and estimates of actual use indicate substantial uncertainty in how water rights are exercised. In arid regions such as California, over-allocation of surface water coupled with trends of decreasing supply suggest that new water demands will be met by re-allocation from existing uses. Without improvements to the water rights system, growing human and environmental demands portend an intensification of regional water scarcity and social conflict. California’s legal framework for managing its water resources is largely compatible with needed reforms, but additional public investment is required to enhance the capacity of the state’s water management institutions to effectively track and regulate water rights.
-
Water and beverage consumption patterns among 4 to 13-year-old children in the United Kingdom
Directory of Open Access Journals (Sweden)
Florent Vieux
2017-05-01
Full Text Available Abstract Background The UK government has announced a tax on sugar-sweetened beverages. The aim of this study was to assess consumption patterns for plain drinking water relative to sugary beverages among UK children. Methods Dietary intake data for 845 children aged 4–13 years came from the nationally representative cross-sectional National Diet and Nutrition Survey, 2008–2011. Beverage categories were drinking water (tap or bottled, milk, 100% fruit juices, soda, fruit drinks, tea, coffee, sports drinks, flavored waters, and liquid supplements. Consumption patterns were examined by age group, gender, household incomes, time and location of consumption, region and seasonality. Total water consumption from drinking water, beverages, and foods, and the water-to-calorie ratios (L/kcal were compared to the EFSA (European Food Safety Authority adequate intake standards. Results Total water intake (1338 ml/d came from plain water (19%, beverages (48%, and food moisture (33%. Plain drinking water provided 258 g/d (241 g/d for children aged 4–8 years; 274 g/d for 9–13 years, mostly (83.8% from tap. Water and beverages supplied 901 g /d of water. Tap water consumption increased with income and was highest in the South of England. The consumption of bottled water, soda, tea and coffee increased with age, whereas milk consumption declined. About 88.7% of children did not meet EFSA adequate intake standards. The daily water shortfall ranged from 322 ml/d to 659 ml/d. Water-to-calorie ratio was 0.845 L/1000 kcal short of desirable levels of 1.0–1.5 L/1000 kcal. Conclusion Total water intake were at 74.8% of EFSA reference values. Drinking water consumption among children in the UK was well below US and French estimates.
-
Water and beverage consumption patterns among 4 to 13-year-old children in the United Kingdom.
Vieux, Florent; Maillot, Matthieu; Constant, Florence; Drewnowski, Adam
2017-05-19
The UK government has announced a tax on sugar-sweetened beverages. The aim of this study was to assess consumption patterns for plain drinking water relative to sugary beverages among UK children. Dietary intake data for 845 children aged 4-13 years came from the nationally representative cross-sectional National Diet and Nutrition Survey, 2008-2011. Beverage categories were drinking water (tap or bottled), milk, 100% fruit juices, soda, fruit drinks, tea, coffee, sports drinks, flavored waters, and liquid supplements. Consumption patterns were examined by age group, gender, household incomes, time and location of consumption, region and seasonality. Total water consumption from drinking water, beverages, and foods, and the water-to-calorie ratios (L/kcal) were compared to the EFSA (European Food Safety Authority) adequate intake standards. Total water intake (1338 ml/d) came from plain water (19%), beverages (48%), and food moisture (33%). Plain drinking water provided 258 g/d (241 g/d for children aged 4-8 years; 274 g/d for 9-13 years), mostly (83.8%) from tap. Water and beverages supplied 901 g /d of water. Tap water consumption increased with income and was highest in the South of England. The consumption of bottled water, soda, tea and coffee increased with age, whereas milk consumption declined. About 88.7% of children did not meet EFSA adequate intake standards. The daily water shortfall ranged from 322 ml/d to 659 ml/d. Water-to-calorie ratio was 0.845 L/1000 kcal short of desirable levels of 1.0-1.5 L/1000 kcal. Total water intake were at 74.8% of EFSA reference values. Drinking water consumption among children in the UK was well below US and French estimates.
-
Water quality for the year 2000
International Nuclear Information System (INIS)
Newman, A.
1991-01-01
Under an umbrella labeled Water Quality 2000, 86 organizations - ranging from the Natural Resources Defense Council to the Chemical Manufacturers Association - have reached a consensus on the major water quality problems currently facing the US. Their broad-based conclusions have been released in a report entitled Challenges for the Future, which represents one step in an ongoing discussion among representatives of these diverse groups on improving water quality. Although the report presents a long-term view, William Matuszeski from EPA described the document as a superb background for the upcoming debate over reauthorization of the Clean Water Act. In general terms, the report cites the major sources of current water problems as agricultural and urban runoff, especially following storms; airborne pollutants; continued dumping of toxic wastes; accidental spills; overharvesting of fish and shellfish; habitat competition from exotic species; and land and water use practices. This article summarizes some of the findings
-
Shi, Zhiming
2018-04-26
On the basis of first-principles and cluster expansion calculations, we propose an effective approach to realize monolayer transition metal dichalcogenides with sizable band gaps and improved optoelectronic performance. We show that monolayer Mo(S1–xSex)2 and Mo1–yWyS2 with x = 1/3, 2/3 and y = 1/3, 1/2, 2/3 are stable according to phonon calculations and realize 1T′ or 1T″ phases. The transition barriers from the 2H phase are lower than for monolayer MoS2, implying that the 1T′ or 1T″ phases can be achieved experimentally. Furthermore, it turns out that the 1T″ monolayer alloys with x = 1/3, 2/3 and y = 1/3, 2/3 are semiconductors with band gaps larger than 1 eV, due to trimerization. The visible light absorption and carrier mobility are strongly improved as compared to 2H monolayer MoS2, MoSe2, and WS2. Thus, the 1T″ monolayer alloys have the potential to expand the applications of transition metal dichalcogenides, for example, in solar cells.
-
Water fluoridation in 40 Brazilian cities: 7 year analysis
Directory of Open Access Journals (Sweden)
Suzely Adas Saliba MOIMAZ
2013-01-01
Full Text Available Objectives Fluoride levels in the public water supplies of 40 Brazilian cities were analyzed and classified on the basis of risk/benefit balance. Material and Methods Samples were collected monthly over a seven-year period from three sites for each water supply source. The samples were analyzed in duplicate in the laboratory of the Center for Research in Public Health - UNESP using an ion analyzer coupled to a fluoride-specific electrode. Results A total of 19,533 samples were analyzed, of which 18,847 were artificially fluoridated and 686 were not artificially fluoridated. In samples from cities performing water fluoridation, 51.57% (n=9,720 had fluoride levels in the range of 0.55 to 0.84 mg F/L; 30.53% (n=5,754 were below 0.55 mg F/L and 17.90% (n=3,373 were above 0.84 mg F/L (maximum concentration=6.96 mg F/L. Most of the cities performing fluoridation that had a majority of samples with fluoride levels above the recommended parameter had deep wells and more than one source of water supply. There was some variability in the fluoride levels of samples from the same site and between collection sites in the same city. Conclusions The majority of samples from cities performing fluoridation had fluoride levels within the range that provides the best combination of risks and benefits, minimizing the risk of dental fluorosis while preventing dental caries. The conduction of studies about water distribution systems is suggested in cities with high natural fluoride concentrations in order to optimize the use of natural fluoride for fluoridation costs and avoid the risk of dental fluorosis.
-
International Nuclear Information System (INIS)
McKinley, P.W.; Oliver, T.A.
1995-01-01
The US Geological Survey, in cooperation with the US Department of Energy, is studying Yucca Mountain, Nevada, as a potential repository for high level nuclear waste. As part of the Yucca Mountain Site Project, the analog recharge study is providing data for the evaluation of recharge to the Yucca Mountain ground-water system given a cooler and wetter climate than currently exists. The current and climatic conditions are favorable to the isolation of radioactive waste. Because waste isolation from the accessible environment for 10,000 years is necessary, climatic change and the potential for increased ground-water recharge need to be considered as part of the characterization of the potential repository. Therefore, two small basins, measuring less than 2 square miles, were studied to determine the volume of precipitation available for recharge to ground water. The semiarid 3-Springs Basin is located to the east of Kawich Peak in the Kawich Range east of Tonopah, Nevada. Stewart Basin is a subalpine drainage basin north of Arc Dome in the Toiyabe Range north of Tonopah, Nevada. The purpose of this publication is to make available the meteorological, stream-discharge, and water-quality data collected during the study. Meteorological data collected include air temperature, soil temperature, solar radiation, and relative humidity. Stream-discharge data were collected from the surface-water outlet of each basin. Water-quality data are chemical analyses of water samples collected from surface- and ground-water sources. Each basin has a meteorological station located in the lower and upper reaches of the basin. Hydrologic records include stream-discharge and water-quality data from the lower meteorological site and water-quality data from springs within the basins
-
Orem, W.H.; Tatu, C.A.; Lerch, H.E.; Rice, C.A.; Bartos, T.T.; Bates, A.L.; Tewalt, S.; Corum, M.D.
2007-01-01
The organic composition of produced water samples from coalbed natural gas (CBNG) wells in the Powder River Basin, WY, sampled in 2001 and 2002 are reported as part of a larger study of the potential health and environmental effects of organic compounds derived from coal. The quality of CBNG produced waters is a potential environmental concern and disposal problem for CBNG producers, and no previous studies of organic compounds in CBNG produced water have been published. Organic compounds identified in the produced water samples included: phenols, biphenyls, N-, O-, and S-containing heterocyclic compounds, polycyclic aromatic hydrocarbons (PAHs), aromatic amines, various non-aromatic compounds, and phthalates. Many of the identified organic compounds (phenols, heterocyclic compounds, PAHs) are probably coal-derived. PAHs represented the group of organic compounds most commonly observed. Concentrations of total PAHs ranged up to 23 ??g/L. Concentrations of individual compounds ranged from about 18 to compound concentrations was documented, as two wells with relatively high organic compound contents in produced water in 2001 had much lower concentrations in 2002. In many areas, including the PRB, coal strata provide aquifers for drinking water wells. Organic compounds observed in produced water are also likely present in drinking water supplied from wells in the coal. Some of the organic compounds identified in the produced water samples are potentially toxic, but at the levels measured in these samples are unlikely to have acute health effects. The human health effects of low-level, chronic exposure to coal-derived organic compounds in drinking water are currently unknown. Continuing studies will evaluate possible toxic effects from low level, chronic exposure to coal-derived organic compounds in drinking water supplies.
-
Partition of some key regulating services in terrestrial ecosystems: Meta-analysis and review
Energy Technology Data Exchange (ETDEWEB)
Viglizzo, E.F., E-mail: evigliz@cpenet.com.ar [INTA, EEA Anguil, Grupo de Investigaciones en Gestión Ambiental (GIGA), Av. Spinetto 785, 6300 Santa Rosa, La Pampa (Argentina); INCITAP-CONICET, Ruta 35, km 335, 6300 Santa Rosa, La Pampa (Argentina); UNLPam, Facultad de Ciencias Exactas y Naturales, Av. Uruguay 151, 6300 Santa Rosa, La Pampa (Argentina); Jobbágy, E.G. [CONICET, Andes 950, 5700 San Luis, San Luis (Argentina); Grupo de Estudios Ambientales IMASL, Ejército de los, Andes 950, 5700 San Luis, San Luis (Argentina); Ricard, M.F. [INCITAP-CONICET, Ruta 35, km 335, 6300 Santa Rosa, La Pampa (Argentina); UNLPam, Facultad de Ciencias Exactas y Naturales, Av. Uruguay 151, 6300 Santa Rosa, La Pampa (Argentina); Paruelo, J.M. [Laboratorio de Análisis Regional y Teledetección, Departamento de Métodos Cuantitativos Sistemas de información, Facultad de Agronomía and IFEVA, Universidad de Buenos Aires and CONICET, Av. San Martín 4453, 1417 Buenos Aires (Argentina)
2016-08-15
Our knowledge about the functional foundations of ecosystem service (ES) provision is still limited and more research is needed to elucidate key functional mechanisms. Using a simplified eco-hydrological scheme, in this work we analyzed how land-use decisions modify the partition of some essential regulatory ES by altering basic relationships between biomass stocks and water flows. A comprehensive meta-analysis and review was conducted based on global, regional and local data from peer-reviewed publications. We analyzed five datasets comprising 1348 studies and 3948 records on precipitation (PPT), aboveground biomass (AGB), AGB change, evapotranspiration (ET), water yield (WY), WY change, runoff (R) and infiltration (I). The conceptual framework was focused on ES that are associated with the ecological functions (e.g., intermediate ES) of ET, WY, R and I. ES included soil protection, carbon sequestration, local climate regulation, water-flow regulation and water recharge. To address the problem of data normality, the analysis included both parametric and non-parametric regression analysis. Results demonstrate that PPT is a first-order biophysical factor that controls ES release at the broader scales. At decreasing scales, ES are partitioned as result of PPT interactions with other biophysical and anthropogenic factors. At intermediate scales, land-use change interacts with PPT modifying ES partition as it the case of afforestation in dry regions, where ET and climate regulation may be enhanced at the expense of R and water-flow regulation. At smaller scales, site-specific conditions such as topography interact with PPT and AGB displaying different ES partition formats. The probable implications of future land-use and climate change on some key ES production and partition are discussed. - Highlights: • The partition of regulatory services in ecosystems poses a major policy challenge. • We examined how partitions occur at the hydrosphere
-
Partition of some key regulating services in terrestrial ecosystems: Meta-analysis and review
International Nuclear Information System (INIS)
Viglizzo, E.F.; Jobbágy, E.G.; Ricard, M.F.; Paruelo, J.M.
2016-01-01
Our knowledge about the functional foundations of ecosystem service (ES) provision is still limited and more research is needed to elucidate key functional mechanisms. Using a simplified eco-hydrological scheme, in this work we analyzed how land-use decisions modify the partition of some essential regulatory ES by altering basic relationships between biomass stocks and water flows. A comprehensive meta-analysis and review was conducted based on global, regional and local data from peer-reviewed publications. We analyzed five datasets comprising 1348 studies and 3948 records on precipitation (PPT), aboveground biomass (AGB), AGB change, evapotranspiration (ET), water yield (WY), WY change, runoff (R) and infiltration (I). The conceptual framework was focused on ES that are associated with the ecological functions (e.g., intermediate ES) of ET, WY, R and I. ES included soil protection, carbon sequestration, local climate regulation, water-flow regulation and water recharge. To address the problem of data normality, the analysis included both parametric and non-parametric regression analysis. Results demonstrate that PPT is a first-order biophysical factor that controls ES release at the broader scales. At decreasing scales, ES are partitioned as result of PPT interactions with other biophysical and anthropogenic factors. At intermediate scales, land-use change interacts with PPT modifying ES partition as it the case of afforestation in dry regions, where ET and climate regulation may be enhanced at the expense of R and water-flow regulation. At smaller scales, site-specific conditions such as topography interact with PPT and AGB displaying different ES partition formats. The probable implications of future land-use and climate change on some key ES production and partition are discussed. - Highlights: • The partition of regulatory services in ecosystems poses a major policy challenge. • We examined how partitions occur at the hydrosphere
-
Water-resources investigations in Dinosaur National Monument, Utah-Colorado, fiscal year 1970
Sumsion, C.T.
1971-01-01
Water-resources data were acquired during fiscal year 1970 by the U.S. Geological Survey at Dinosaur National Monument, Utah-Colorado, for the U.S. National Park Service as part of a continuing project. The data provide a basis for planning the development, management, and use of the available water resources to provide adequate water supplies. Thirty-one springs, 19 in relatively inaccessible areas, were evaluated as sources of water supplies. Seven potential well sites were evaluated for drilling depths in specific aquifers. A well drilled in Echo Park near the confluence of the Green and Yampa Rivers was tested. The pumping test showed the well to yield 130 gallons per minute with a drawdown of 1.96 feet; specific capacity of the well at 130 gallons per minute is 66 gallons per minute per foot. Water samples for chemical analysis were - collected from nine springs and one well; all except that from Disappointment Spring, were of good chemical quality.
-
Shope, Christopher L.; Angeroth, Cory E.
2015-01-01
Effective management of surface waters requires a robust understanding of spatiotemporal constituent loadings from upstream sources and the uncertainty associated with these estimates. We compared the total dissolved solids loading into the Great Salt Lake (GSL) for water year 2013 with estimates of previously sampled periods in the early 1960s.We also provide updated results on GSL loading, quantitatively bounded by sampling uncertainties, which are useful for current and future management efforts. Our statistical loading results were more accurate than those from simple regression models. Our results indicate that TDS loading to the GSL in water year 2013 was 14.6 million metric tons with uncertainty ranging from 2.8 to 46.3 million metric tons, which varies greatly from previous regression estimates for water year 1964 of 2.7 million metric tons. Results also indicate that locations with increased sampling frequency are correlated with decreasing confidence intervals. Because time is incorporated into the LOADEST models, discrepancies are largely expected to be a function of temporally lagged salt storage delivery to the GSL associated with terrestrial and in-stream processes. By incorporating temporally variable estimates and statistically derived uncertainty of these estimates,we have provided quantifiable variability in the annual estimates of dissolved solids loading into the GSL. Further, our results support the need for increased monitoring of dissolved solids loading into saline lakes like the GSL by demonstrating the uncertainty associated with different levels of sampling frequency.
-
222Rn in private well water in the vicinity of uranium mines over ten years
International Nuclear Information System (INIS)
Yunoki, Eiji; Kataoka, Toshio; Michihiro, Kenshu; Sugiyama, Hirokazu; Shimizu, Mitsuo; Mori, Tadashige
1994-01-01
There are many small uranium mines of the sedimentary type in Kamisaibara, Okayama Prefecture, Japan. As inhabitants in Kamisaibara consume water from privately-dug wells, it is important to investigate distributions of 222 Rn in privately-dug well water in the vicinity of the mines. The determination of 222 Rn in well water was carried out from April 1980 to October 1990. Though small in area (16 km 2 ), each well water has its own characteristic activity concentrations of 222 Rn. The activity concentrations of 222 Rn are almost constant for each specific well over a long period (about 10 years). In general, the correlation coefficients for several sampling points are small. As Akawase and Tennoh are situated in the same rock type, the correlation coefficient is the highest value in this area. The estimated dose equivalent for the human stomach is approximately 0.4-54 μSv/year. The type of distribution of 222 Rn in privately-dug well water is log normal. (author)
-
Shivers, Molly J.; Andrews, William J.
2013-01-01
Water year 2011 (October 1, 2010, through September 30, 2011) was a year of hydrologic drought (based on streamflow) in Oklahoma and the second-driest year to date (based on precipitation) since 1925. Drought conditions worsened substantially in the summer, with the highest monthly average temperature record for all States being broken by Oklahoma in July (89.1 degrees Fahrenheit), June being the second hottest and August being the hottest on record for those months for the State since 1895. Drought conditions continued into the fall, with all of the State continuing to be in severe to exceptional drought through the end of September. In addition to effects on streamflow and reservoirs, the 2011 drought increased damage from wildfires, led to declarations of states of emergency, water-use restrictions, and outdoor burning bans; caused at least $2 billion of losses in the agricultural sector and higher prices for food and other agricultural products; caused losses of tourism and wildlife; reduced hydropower generation; and lowered groundwater levels in State aquifers. The U.S. Geological Survey, in cooperation with the Oklahoma Water Resources Board, conducted an investigation to compare the severity of the 2011 drought with four previous major hydrologic drought periods during the 20th century – water years 1929–41, 1952–56, 1961–72, and 1976–81. The period of water years 1925–2011 was selected as the period of record because few continuous record streamflow-gaging stations existed before 1925, and gaps in time existed where no streamflow-gaging stations were operated before 1925. In water year 2011, statewide annual precipitation was the 2d lowest, statewide annual streamflow was 16th lowest, and statewide annual runoff was 42d lowest of those 87 years of record. Annual area-averaged precipitation totals by the nine National Weather Service climate divisions from water year 2011 were compared to those during four previous major hydrologic drought
-
Havelaar, A H; De Hollander, A E; Teunis, P F; Evers, E G; Van Kranen, H J; Versteegh, J F; Van Koten, J E; Slob, W
2000-01-01
To evaluate the applicability of disability adjusted life-years (DALYs) as a measure to compare positive and negative health effects of drinking water disinfection, we conducted a case study involving a hypothetical drinking water supply from surface water. This drinking water supply is typical in The Netherlands. We compared the reduction of the risk of infection with Cryptosporidium parvum by ozonation of water to the concomitant increase in risk of renal cell cancer arising from the produc...
-
Hofman, J.A.M.H.; Kramer, O.J.I.; van der Hoek, J.P.; Nederlof, M; Groenendijk, M
2006-01-01
Central softening has been utilized by the Dutch water utilities since the late 1970s. It was introduced in the water treatment process as a method to supply water with an optimum water composition to prevent lead and copper release and to prevent excessive scaling. Twenty years of experience show
-
PPARα ligands activate antioxidant enzymes and suppress hepatic fibrosis in rats
International Nuclear Information System (INIS)
Toyama, Tetsuya; Nakamura, Hideki; Harano, Yuichi; Yamauchi, Norihito; Morita, Atsuhiro; Kirishima, Toshihiko; Minami, Masahito; Itoh, Yoshito; Okanoue, Takeshi
2004-01-01
Oxidative stress is a major pathogenetic factor in hepatic fibrosis. Peroxisome proliferator-activated receptor α (PPARα) is a nuclear receptor which is known to affect oxidative stress and PPARα ligands may have rescue effects on hepatic fibrosis. We tested this hypothesis using rat thioacetamide (TAA) models of liver cirrhosis. Rats were given intraperitoneal injection of TAA and treated with a diet containing one of the two PPARα ligands, Wy-14,643 (WY) or fenofibrate. WY treatment dramatically reduced hepatic fibrosis and also prevented the inhibition catalase of mRNA expression caused by TAA. Correspondingly, catalase activity increased in the TAA + WY group but decreased in the control TAA group. The antifibrotic action of fenofibrate in the TAA model was comparable with that of WY. PPARα ligands have an antifibrotic action in the rat TAA model of liver cirrhosis, probably due to an antioxidant effect of enhanced catalase expression and activity in the liver
-
Evaluation of Nonpoint-Source Contamination, Wisconsin: Selected Topics for Water Year 1995
Owens, D.W.; Corsi, Steven R.; Rappold, K.F.
1997-01-01
The objective of the watershed-management evaluation monitoring program in Wisconsin is to evaluate the effectiveness of best-management practices (BMP's) for controlling nonpoint-source contamination in eight rural and four urban watersheds. This report, the fourth in an annual series of reports, presents a summary of the data collected for the program by the U.S. Geological Survey and the results of several detailed analyses of the data. To complement assessments of water quality, a land-use and BMP inventory is ongoing for 12 evaluation monitoring projects to track nonpoint sources of contamination in each watershed and to document implementation of BMP's that were designed to cause changes in the water quality of streams. Each year, updated information is gathered, mapped, and stored in a geographic-information-system data base. Summaries of land-use, BMP implementation, and water-quality data collected during water years 1989-95 are presented. Storm loads, snowmelt-period loads, and annual loads of suspended sediment and total phosphorus are summarized for eight rural sites. Storm-load data for suspended solids, total phosphorus, total recoverable lead, copper, zinc, and cadmium are summarized for four urban sites. Quality-assurance and quality-control (QA/QC) samples were collected at the eight rural sites to evaluate inorganic sample contamination and at one urban site to evaluate sample-collection and filtration techniques for polycyclic aromatic hydrocarbons (PAR's). Some suspended solids and fecal coliform contamination was detected at the rural sites. Corrective actions will be taken to address this contamination. Evaluation of PAR sample-collection techniques did not uncover any deficiencies, but the small amount of data collected was not sufficient to draw any definite conclusions. Evaluation of PAR filtration techniques indicate that water-sample filtration with O.7-um glass-fiber filters in an aluminum filter unit does not result in significant loss
-
Sobieszczyk, Steven; Bragg, Heather M.; Uhrich, Mark A.
2015-07-28
In October 2011, the U.S. Geological Survey began investigating and monitoring water-quality conditions and suspended-sediment transport in the Wilson and Trask Rivers, northwestern Oregon. Water temperature, specific conductance, turbidity, and dissolved oxygen were measured every 15–30 minutes in both streams using real-time instream water-quality monitors. In conjunction with the monitoring effort, suspended-sediment samples were collected and analyzed to model the amount of suspended sediment being transported by each river. Over the course of the 3-year study, which ended in September 2014, nearly 600,000 tons (t) of suspended-sediment material entered Tillamook Bay from these two tributaries.
-
Directory of Open Access Journals (Sweden)
Hao Yang
Full Text Available Climate and human-driven changes play an important role in regional droughts. Northwest Yunnan Province is a key region for biodiversity conservation in China, and it has experienced severe droughts since the beginning of this century; however, the extent of the contributions from climate and human-driven changes remains unclear. We calculated the ecosystem evapotranspiration (ET and water yield (WY of northwest Yunnan Province, China from 2001 to 2013 using meteorological and remote sensing observation data and a Surface Energy Balance System (SEBS model. Multivariate regression analyses were used to differentiate the contribution of climate and vegetation coverage to ET. The results showed that the annual average vegetation coverage significantly increased over time with a mean of 0.69 in spite of the precipitation fluctuation. Afforestation/reforestation and other management efforts attributed to vegetation coverage increase in NW Yunnan. Both ET and WY considerably fluctuated with the climate factors, which ranged from 623.29 mm to 893.8 mm and -51.88 mm to 384.40 mm over the time period. Spatially, ET in the southeast of NW Yunnan (mainly in Lijiang increased significantly, which was in line with the spatial trend of vegetation coverage. Multivariate linear regression analysis indicated that climatic factors accounted for 85.18% of the ET variation, while vegetation coverage explained 14.82%. On the other hand, precipitation accounted for 67.5% of the WY. We conclude that the continuous droughts in northwest Yunnan were primarily climatically driven; however, man-made land cover and vegetation changes also increased the vulnerability of local populations to drought. Because of the high proportion of the water yield consumed for subsistence and poor infrastructure for water management, local populations have been highly vulnerable to climate drought conditions. We suggest that conservation of native vegetation and development of water
-
International Nuclear Information System (INIS)
Gu, Alun; Teng, Fei; Wang, Yu
2014-01-01
Highlights: • Energy and water limit China’s sustainable development. • Current energy policies fail to address water saving issues. • The energy-water coefficient is estimated for both direct use and indirect use. • Water saving effects associated with energy-saving policies is calculated. • Water-energy nexus should be enhanced in key industrial sectors. - Abstract: Energy and water have become major factors limiting sustainable development in China. Energy efficiency and optimization of water management are critical for the healthy growth of the Chinese economy. Current national energy policies fail to adequately address water use issues. Similarly, current water policies do not consider the impact of energy consumption and greenhouse gas emissions. Consequently, few studies have investigated the relationship between energy consumption and water use. The present study analyzes the energy-water nexus in Chinese industries using input–output tables. Coefficients that characterize the relationship between energy consumption and water are used to describe the supply-consumption relationship between the water supply and primary energy sectors. Next, we calculate the water-saving effects associated with the enforcement of energy-saving policies in selected industrial sectors during the eleventh Five-year Plan, from 2005 to 2010. These calculations address the ferrous metals, non-ferrous metals, petrochemical engineering, building materials, and electricity industries as well as key light industries. Our findings indicate that energy-saving efforts in these industries will result in savings in water consumption. This study suggests that a cooperative relationship between water and energy conservation efforts should be an important factor in creating policies that encourage simultaneous savings of both resources. Additionally, the study indicates that government should promote water- and energy-saving techniques in key industrial sectors to encourage
-
Nutrient Flux from Mediterranean Coastal Streams: Carpinteria Valley, California
Robinson, T. H.; Leydecker, A.; Melack, J. M.; Keller, A. A.
2003-12-01
Along the southern California coast, near Santa Barbara, California, we are measuring nutrient export from specific land uses and developing a model to predict nutrient export at a watershed scale. The area is characterized by a Mediterranean-like climate and short steep catchments producing flashy runoff. The six land uses include chaparral, avocado orchards, greenhouse agriculture, open-field nurseries, and residential and commercial development. Sampling sites are located on defined drainages or storm drains that collect runoff from relatively homogeneous areas representing each land use. Stream water samples are taken once a week during the rainy season, every two weeks during the dry season and every one to four hours during storms. Samples are analyzed for ammonium, nitrate, phosphate, total dissolved nitrogen and particulate nitrogen and phosphorus. Intensive sampling at the thirteen sites of the study was conducted throughout Water Year (WY) 2002 and 2003. We determine discharge from measurements of stage derived from pressure transducers at all sampling sites. This information is then converted to flux at a high temporal resolution. Wet and dry season sampling has shown that nitrate baseflow concentrations vary over three orders of magnitude, from a few micromoles per liter in undeveloped catchments, to a few 100 æmol/L in agricultural and urban watersheds, to 1000 æmol/L where intensive "greenhouse" agriculture dominates. Nitrate loading ranged from a few moles per hectare per storm at undeveloped and residential sites to hundreds at the greenhouse site. Phosphate concentrations show a similar, but smaller, variation from 1 to 100 æmol/L, although the loading is comparable at 1-100 moles/ha-storm. Stormflow concentrations fluctuate with the storm hydrograph: phosphate increases with flow, while nitrate typically decreases due to dilution from runoff probably from impervious surfaces. Nitrate export patterns indicate a marked difference between land use
-
Water balance along a chain of tundra lakes: A 20-year isotopic perspective
Gibson, J. J.; Reid, R.
2014-11-01
Stable isotope measurements and isotope mass balance (IMB) calculations are presented in support of an unprecedented 20-year water balance assessment for a tailings pond and a chain of downstream lakes at the Salmita-Tundra mine site, situated near Courageous Lake, Northwest Territories, Canada (65°03‧N; 111°11‧W). The method is shown to provide a comprehensive annual and interannual perspective of water balance fluxes along a chain of lakes during the period 1991-2010, without the need for continuous streamflow gauging, and reveals important lake-order-dependent patterns of land-surface runoff, discharge accumulation, and several key diagnostic ratios, i.e., evaporation/inflow, evaporation/evapotranspiration, land-surface-runoff/precipitation and discharge/ precipitation. Lake evaporation is found to be a significant component of the water balance, accounting for between 26% and 32% of inflow to natural lakes and between 72% and 100% of inflow to mine-tailings ponds. Evaporation/evapotranspiration averages between 7% and 22% and is found to be higher in low-precipitation years, and in watersheds with a higher proportion of lakes. Runoff ratios for land-surface drainages and runoff ratios for watersheds (including lakes) ranged between 14-47% and 20-47%, respectively, and were higher in low precipitation years, in watersheds with a higher proportion of lakes, and in watersheds less affected by mining development. We propose that in general these two runoff ratios will likely converge as lake order increases and as land cover conditions become regionally representative. Notably, the study demonstrates application of IMB, validated with streamflow measurements, to constrain local water balance in a remote low-arctic region. For IMB chain-of-lakes applications, it underlines the importance of accounting for evaporatively-enriched upstream sources to avoid overestimation of evaporation losses.
-
Nitrate exposure from drinking water in Denmark over the last 35 years
DEFF Research Database (Denmark)
Schullehner, Jörg; Hansen, Birgitte
2014-01-01
users were far more prone to exposure to elevated nitrate concentrations than consumers connected to public supplies. While the fraction exposed to elevated nitrate concentrations amongst public supply users has been decreasing since the 1970s, it has been increasing amongst private well users, leading......In Denmark, drinking water quality data covering the entire country for over 35 years are registered in a publicly-accessible database. These data were analysed to determine the fraction of population exposed to elevated nitrate concentrations. Data from 2,852 water supply areas from the 98 Danish...... municipalities were collected in one dataset. Public water supplies are extensively registered; private wells supplying only few households are neither monitored nor registered sufficiently. The study showed that 5.1% of the Danish population was exposed to nitrate concentrations 25 mg L−1 in 2012. Private well...
-
Cancer mortality in women after repeated fluoroscopic examinations of the chest
International Nuclear Information System (INIS)
Boice, J.D.; Monson, R.R.; Rosenstein, M.
1981-01-01
Among 1,047 women fluoroscopically examined in average of 102 times during pneumothorax therapy for tuberculosis and followed up to 45 years (average . 27 yr), no increase in the total number of cancer deaths occurred when these women were compared to 717 women who received other treatments [relative risk (RR) . 0.8]. However, elevated risks of mortality from stomach cancer (RR . 2.3), rectal cancer (RR . 3.8), breast cancer (RR . 1.2), lung cancer (RR . 1.8), and leukemia (RR . 1.2) were observed, but none was statistically significant and all were based on very small numbers of deaths. These increases were balanced by decreases of genital cancer (RR . 0.2), pancreatic cancer (RR . 0.9), lymphoma (RR . 0.6), and all other cancers (RR . 0.1). Average cumulative absorbed doses were 110 rads for the lungs, 33 rads for the trunk, 13 rads for the active bone marrow, and 7 rads for the stomach. The following upper levels of excess risk could be excluded with 95% confidence: 3.5 deaths/10(6) woman-year (WY)-rad for lung cancer, 4.8 deaths/10(6) WY-rad for lymphoma, and 12 deaths/10(6) WY-rad for leukemia. These findings indicated that the carcinogenic effect of multiple low-dose X-ray exposures was not greater than that currently assumed
-
Directory of Open Access Journals (Sweden)
Mariusz Korytowski
2014-10-01
years. Evaporation from pond surface which was from 408 mm (2009/2010 to 835 mm (2002/2003 was the dominant factor of outgoing part of water balance. Outflow from the pond to neighboring areas had significant participation – about 44% of precipitation, in water balance in wet 2009/2010 hydrological year.
-
Directory of Open Access Journals (Sweden)
Ildegardis Bertol
2014-12-01
Full Text Available The action of rain and surface runoff together are the active agents of water erosion, and further influences are the soil type, terrain, soil cover, soil management, and conservation practices. Soil water erosion is low in the no-tillage management system, being influenced by the amount and form of lime and fertilizer application to the soil, among other factors. The aim was to evaluate the effect of the form of liming, the quantity and management of fertilizer application on the soil and water losses by erosion under natural rainfall. The study was carried out between 2003 and 2013 on a Humic Dystrupept soil, with the following treatments: T1 - cultivation with liming and corrective fertilizer incorporated into the soil in the first year, and with 100 % annual maintenance fertilization of P and K; T2 - surface liming and corrective fertilization distributed over five years, and with 75 % annual maintenance fertilization of P and K; T3 - surface liming and corrective fertilization distributed over three years, and with 50 % annual maintenance fertilization of P and K; T4 - surface liming and corrective fertilization distributed over two years, and with 25 % annual maintenance fertilization of P and K; T5 - fallow soil, without liming or fertilization. In the rotation the crops black oat (Avena strigosa , soybean (Glycine max , common vetch (Vicia sativa , maize (Zea mays , fodder radish (Raphanus sativus , and black beans (Phaseolus vulgaris . The split application of lime and mineral fertilizer to the soil surface in a no-tillage system over three and five years, results in better control of soil losses than when split in two years. The increase in the amount of fertilizer applied to the soil surface under no-tillage cultivation increases phytomass production and reduces soil loss by water erosion. Water losses in treatments under no-tillage cultivation were low in all crop cycles, with a similar behavior as soil losses.
-
Water-resources investigations of the U.S. Geological Survey in New Mexico; fiscal year 1981
White, Robert R.; Wells, J.G.
1983-01-01
The Water Resources Division of the U.S. Geological Survey investigates the occurrence, quantity, quality, distribution, and movement of the Nation 's surface and underground waters, and coordinates Federal water data acquisition activities. During fiscal year 1981, the New Mexico District had 40 active projects, released 19 reports, and answered hundreds of requests of water-related information. Investigations included the following: (1) chemical quality of surface water in New Mexico; (2) chemical quality of groundwater in New Mexico; (3) sediment transport in New Mexico streams; (4) surface water supply; (5) surface water diversions for irrigation; (6) streamflow characteristics; (7) effect of urban development on storm runoff; (8) inundation from floods; (9) effects of groundwater pumping; (10) long-term monitoring of groundwater levels; (11) groundwater and surface water relationships; (12) consumptive use by phreatophytes; (13) hydrologic impacts of energy development; and (14) groundwater supplies. (Lantz-PTT)
-
Havelaar, A H; De Hollander, A E; Teunis, P F; Evers, E G; Van Kranen, H J; Versteegh, J F; Van Koten, J E; Slob, W
2000-04-01
To evaluate the applicability of disability adjusted life-years (DALYs) as a measure to compare positive and negative health effects of drinking water disinfection, we conducted a case study involving a hypothetical drinking water supply from surface water. This drinking water supply is typical in The Netherlands. We compared the reduction of the risk of infection with Cryptosporidium parvum by ozonation of water to the concomitant increase in risk of renal cell cancer arising from the production of bromate. We applied clinical, epidemiologic, and toxicologic data on morbidity and mortality to calculate the net health benefit in DALYs. We estimated the median risk of infection with C. parvum as 10(-3)/person-year. Ozonation reduces the median risk in the baseline approximately 7-fold, but bromate is produced in a concentration above current guideline levels. However, the health benefits of preventing gastroenteritis in the general population and premature death in patients with acquired immunodeficiency syndrome outweigh health losses by premature death from renal cell cancer by a factor of > 10. The net benefit is approximately 1 DALY/million person-years. The application of DALYs in principle allows us to more explicitly compare the public health risks and benefits of different management options. In practice, the application of DALYs may be hampered by the substantial degree of uncertainty, as is typical for risk assessment.
-
Sloto, Ronald A.; Olson, Leif E.
2011-01-01
Turbidity and suspended-sediment concentration data were collected by the U.S. Geological Survey (USGS) at four stream stations--French Creek near Phoenixville, West Branch Brandywine Creek near Honey Brook, West Branch Brandywine Creek at Modena, and East Branch Brandywine Creek below Downingtown--in Chester County, Pa. Sedimentation and siltation is the leading cause of stream impairment in Chester County, and these data are critical for quantifying sediment transport. This study was conducted by the USGS in cooperation with the Chester County Water Resources Authority and the Chester County Health Department. Data from optical turbidity sensors deployed at the four stations were recorded at 15- or 30-minute intervals by a data logger and uploaded every 1 to 4 hours to the USGS database. Most of the suspended-sediment samples were collected using automated samplers. The use of optical sensors to continuously monitor turbidity provided an accurate estimate of sediment fluctuations without the collection and analysis costs associated with intensive sampling during storms. Turbidity was used as a surrogate for suspended-sediment concentration (SSC), which is a measure of sedimentation and siltation. Regression models were developed between SSC and turbidity for each of the monitoring stations using SSC data collected from the automated samplers and turbidity data collected at each station. Instantaneous suspended-sediment loads (SSL) were computed from time-series turbidity and discharge data for the 2008 and 2009 water years using the regression equations. The instantaneous computations of SSL were summed to provide daily, storm, and water year annual loads. The annual SSL contributed from each basin was divided by the upstream drainage area to estimate the annual sediment yield. For all four basins, storms provided more than 96 percent of the annual SSL. In each basin, four storms generally provided over half the annual SSL each water year. Stormflows with the
-
Miranda, Marianella; Aramburú, Adolfo; Junco, Jorge; Campos, Miguel
2010-01-01
To evaluate the proportion of children under five with access to quality water and its behavior according to geographical location, water supply and poverty status. Continuous survey (repeated cross), with multistage random sampling, being the universe children under five years living in Peru. We evaluated the presence of free chlorine in drinking water samples in the dwellings of 3570 children (Metropolitan Lima 666, Rest of Coast 755, Urban Sierra 703, Rural Sierra 667, and Jungle 779). We evaluated the presence of total coliforms and E. coli in water samples of 2310 households (445 Metropolitan Lima, Rest of Coast 510, Urban Sierra 479, Rural Sierra Selva 393 and 483). The national proportion of children under five years living in households with adequate free chlorine in drinking water reaches 19.5% of the total, while water free of coliforms and E. coli is 38.3%. There is a marked difference in results by area of residence (the most affected areas were rural Sierra and Jungle), public network at home inside the dwelling and income quintiles. Children under five years living in households belonging to the rural areas and extreme poverty, have a great disadvantage to access quality water consumption. This situation represents a serious problem for the control of diarrheal diseases and children malnutrition.
-
Nitrate exposure from drinking water in Denmark over the last 35 years
International Nuclear Information System (INIS)
Schullehner, Jörg; Hansen, Birgitte
2014-01-01
In Denmark, drinking water quality data covering the entire country for over 35 years are registered in a publicly-accessible database. These data were analysed to determine the fraction of population exposed to elevated nitrate concentrations. Data from 2,852 water supply areas from the 98 Danish municipalities were collected in one dataset. Public water supplies are extensively registered; private wells supplying only few households are neither monitored nor registered sufficiently. The study showed that 5.1% of the Danish population was exposed to nitrate concentrations > 25 mg L −1 in 2012. Private well users were far more prone to exposure to elevated nitrate concentrations than consumers connected to public supplies. While the fraction exposed to elevated nitrate concentrations amongst public supply users has been decreasing since the 1970s, it has been increasing amongst private well users, leading to the hypothesis that the decrease in nitrate concentrations in drinking water is mainly due to structural changes and not improvement of the groundwater quality. A combination of this new drinking water quality map with extensive Danish health registers would permit an epidemiological study on health effects of nitrate, as long as the lack of data on private well users is addressed. (paper)
-
11-Year change in water chemistry of large freshwater Reservoir Danjiangkou, China
Li, Siyue; Ye, Chen; Zhang, Quanfa
2017-08-01
Danjiangkou Reservoir, an important drinking water source, has become a hot spot internationally due to its draining catchment has been increasingly affected by anthropogenic activities. However, its natural water chemistry (major elements) received little attention though it is crucial for water quality and aquatic ecology. Major ions during 2004-2014 were determined using stoichiometry to explore their shifts and the driving factors in the Danjiangkou Reservoir. Results show significant differences in monthly, spatial and annual concentrations of major ions. Waters are controlled by carbonate weathering with the dominant ions of Ca2+ and HCO3- total contributing 74% to the solutes, which are consistent with regional geography. Carbonate dissolution was produced by sulfuric acid and carbonic acid in particular. The relative abundance of Ca2+ gradually decreases, Na+ + K+ abundance, however, has doubled in the recent 11 years. Population and human activities were the major drivers for several major ions, i.e., Cl- and Na+ concentrations were explained by population and GDP, and SO42- by GDP, industrial sewage and energy consumption. Estimation indicated that domestic salts and atmospheric deposition contributed 56% and 22% to Cl-, respectively. We conclude waters in the Reservoir are naturally controlled by rock weathering whilst some key elements largely contributed by anthropogenic activities.
-
Extraction and Preference Ordering of Multireservoir Water Supply Rules in Dry Years
Directory of Open Access Journals (Sweden)
Ling Kang
2016-01-01
Full Text Available This paper presents a new methodology of combined use of the nondominated sorting genetic algorithm II (NSGA-II and the approach of successive elimination of alternatives based on order and degree of efficiency (SEABODE in identifying the most preferred multireservoir water supply rules in dry years. First, the suggested operation rules consists of a two-point type time-varying hedging policy for a single reservoir and a simple proportional allocation policy of common water demand between two parallel reservoirs. Then, the NSGA-II is employed to derive enough noninferior operation rules (design alternatives in terms of two conflicting objectives (1 minimizing the total deficit ratio (TDR of all demands of the entire system in operation horizon, and (2 minimizing the maximum deficit ratio (MDR of water supply in a single period. Next, the SEABODE, a multicriteria decision making (MCDM procedure, is applied to further eliminate alternatives based on the concept of efficiency of order k with degree p. In SEABODE, the reservoir performance indices and water shortage indices are selected as evaluation criteria for preference ordering among the design alternatives obtained by NSGA-II. The proposed methodology was tested on a regional water supply system with three reservoirs located in the Jialing River, China, where the results demonstrate its applicability and merits.
-
Joydas, Thadickal Viswanathan
2012-02-01
The 1991 Gulf oil spill heavily impacted the coastal areas of the Saudi waters of the Arabian Gulf and recent studies have indicated that even 15. years after the incident, macrobenthos had not completely recovered in the sheltered bays in the affected region such as, Manifa Bay. This study investigates the community conditions of macrobenthos in the open waters in one of the impacted areas, Al-Khafji waters, about 14. years after the spill. Diversity measures and community structure analyses indicate a healthy status of polychaete communities. The BOPA index reveals that oil sensitive amphipods were recolonized in the study area. This confirms that the benthic communities of the oil spill impacted area had taken only <14 years to recover in the open waters of the impacted areas. The study also reveals the existence of three distinct polychaete communities along the depth and sediment gradients. © 2011 Elsevier Ltd.
-
Joydas, Thadickal Viswanathan; Qurban, Mohammad Ali; Al-Suwailem, Abdulaziz M.; Krishnakumar, P. K.; Nazeer, Zahid B.; Cali, N. A.
2012-01-01
The 1991 Gulf oil spill heavily impacted the coastal areas of the Saudi waters of the Arabian Gulf and recent studies have indicated that even 15. years after the incident, macrobenthos had not completely recovered in the sheltered bays in the affected region such as, Manifa Bay. This study investigates the community conditions of macrobenthos in the open waters in one of the impacted areas, Al-Khafji waters, about 14. years after the spill. Diversity measures and community structure analyses indicate a healthy status of polychaete communities. The BOPA index reveals that oil sensitive amphipods were recolonized in the study area. This confirms that the benthic communities of the oil spill impacted area had taken only <14 years to recover in the open waters of the impacted areas. The study also reveals the existence of three distinct polychaete communities along the depth and sediment gradients. © 2011 Elsevier Ltd.
-
Garn, Herbert S.; Scudder, Barbara C.; Richards, Kevin D.; Sullivan, Daniel J.
2001-01-01
Analyses and interpretation of water quality, sediment, and biological data from water years 1986 through 1998 indicated that land use and other human activities have had only minimal effects on water quality in the Wolf River upstream from and within the Menominee Indian Reservation in northeastern Wisconsin. Relatively high concentrations of calcium and magnesium (natural hardness), iron, manganese, and aluminum were measured in Wolf River water samples during water years 1986?98 from the three sampled sites and attributed to presence of highly mineralized geologic materials in the basin. Average calcium and magnesium concentrations varied from 22?26 milligrams per liter (mg/L) and 11?13 mg/L, respectively. Average iron concentrations ranged from 290?380 micrograms per liter (?g/L); average manganese concentrations ranged from 53?56 mg/L. Average aluminum concentrations ranged from 63?67 ?g/L. Mercury was present in water samples but concentrations were not at levels of concern. Levels of Kjeldahl nitrogen, ammonia, nitrite plus nitrate, total phosphorus, and orthophosphorus in water samples were often low or below detection limits (0.01? 0.10 mg/L). Trace amounts of atrazine (maximum concentration of 0.031 ?g/L), deethylatrazine (maximum 0.032 ?g/L), and alachlor (maximum of 0.002 ?g/L) were detected. Low concentrations of most trace elements were found in streambed sediment. Tissues of fish and aquatic invertebrates collected once each year from 1995 through 1998 at the Langlade and Keshena sites, near the northern and southern boundaries of the Reservation, respectively, were low in concentrations of most trace elements. Arsenic and silver in fish livers from both sites were less than or equal to 2 ?g/g arsenic and less than 1 ?g/g silver for dry weight analysis, and concentrations of antimony, beryllium, cadmium, cobalt, lead, nickel, and uranium were all below detection limits (less than 1 ?g/g dry weight). Concentrations of most other trace elements in fish
-
Granier, A.; Reichstein, M.; Bréda, N.; Janssens, I.A.; Falge, E.; Ciais, P.; Grünwald, T.; Aubinet, M.; Berbigier, P.; Bernhofer, C.; Buchmann, N.; Facini, O.; Grassi, G.; Heinesch, B.; Ilvesniemi, H.; Keronen, P.; Knohl, A.; Köstner, B.; Lagergren, F.; Lindroth, A.; Longdoz, B.; Loustau, D.; Mateus, J.; Montagnani, L.; Nys, C.; Moors, E.J.; Papale, D.; Peiffer, M.; Pilegaard, K.; Pita, G.; Pumpanen, J.; Rambal, S.; Rebmann, C.; Rodrigues, A.; Seufert, G.; Tenhunen, J.; Vesala, T.; Wang, Q.
2007-01-01
The drought of 2003 was exceptionally severe in many regions of Europe, both in duration and in intensity. In some areas, especially in Germany and France, it was the strongest drought for the last 50 years, lasting for more than 6 months. We used continuous carbon and water flux measurements at 12
-
Two-year water degradation of self-etching adhesives bonded to bur ground enamel.
Abdalla, Ali I; Feilzer, Albert J
2009-01-01
To evaluate the effect of water storage on the microshear bond strength to ground enamel of three "all-in-one" self-etch adhesives: Futurabond DC, Clearfil S Tri Bond and Hybrid bond; a self-etching primer; Clearfil SE Bond and an etch-and-rinse adhesive system, Admira Bond. Sixty human molars were used. The root of each tooth was removed and the crown was sectioned into two halves. The convex enamel surfaces were reduced by polishing on silicon paper to prepare a flat surface that was roughened with a parallel-sided diamond bur with abundant water for five seconds. The bonding systems were applied on this surface. Prior to adhesive curing, a hollow cylinder (2.0 mm in height/0.75 mm in internal diameter) was placed on the treated surfaces and cured. A resin composite was then inserted into the tube and cured. For each adhesive, two procedures were carried out: A--the specimens were kept in water for 24 hours, then the tube was removed and the microshear bond strength was determined in a universal testing machine at a crosshead speed of 0.5 mm/minute; B--the specimens were stored in water for two-years before microshear testing. The fractured surface of the bonded specimens after each test procedure was examined by SEM. For the 24-hour control, there was no significant difference in bond strength between the tested adhesives. After two years of water storage, the bond strength of Admira Bond, Clearfil SE Bond and Futurabond DC decreased, but the reduction was not significantly different from that of 24 hours. For Clearfil S Tri Bond and Hybrid Bond, the bond strengths were significantly reduced compared to their 24-hour results.
-
The Sabethines of Northern Andean Coffee-Growing Regions of Colombia.
Suaza-Vasco, Juan; López-Rubio, Andrés; Galeano, Juan; Uribe, Sandra; Vélez, Iván; Porter, Charles
2015-06-01
Sampling for sabethine mosquitoes occurred intermittently from September 2007 to April 2013 in 17 municipalities, located in 5 departments (divisions) in the northern Andean coffee-growing regions of Colombia. Of the 9 genera within the Sabethini tribe known to occur in the Neotropical region, 6 were encountered including 15 species: Jonhbelkinia ulopus, Limatus durhamii, Sabethes ignotus, Sa. luxodens, Sa. undosus, Shannoniana fluviatilis, Trichoprosopon compressum, Tr. digitatum, Tr. evansae, Tr. pallidiventer s.l., Tr. pallidiventer s.s., Wyeomyia arthrostigma, Wy. oblita, Wy. ulocoma, and Wy. undulata. The species Sa. luxodens and Wy. undulata constitute new records for Colombia. These records broaden the knowledge of this important group that includes some important species related to the arbovirus transmission. Records are from the northern Colombian Andes, a region noted for coffee cultivation and ecotourism.
-
Water quality changes in a polluted stream over a twenty-five-year period
Energy Technology Data Exchange (ETDEWEB)
Stewart, J.; Skousen, J. [West Virginia University, Morgantown, WV (United States). Div. for Plant & Soil Science
2003-04-01
The Deckers Creek watershed in northern West Virginia (United States), containing a land area of 166 km{sup 2}, has along history of industrial development and attendant environmental abuses from both land and Water pollution practices. The water in Deckers Creek was sampled in 1974 at 9 locations along the main stem and resampled in 1999-2000 to determine water quality changes over this 25-year period. Water samples were analyzed for pH, acidity, alkalinity, iron, and calcium at both times, while aluminum, manganese, zinc, and fecal coliform (FC) bacteria densities were added in 1999-2000. Water at almost all sampling points showed lower acidity and metal contents in 1999-2600 compared with 1974. Water pH increased at the mouth from 5.4 in 1974 to 6.0 in 1999-2000. Acidity and iron concentrations, were decreased an average of 70% in the upper stretches of the creek. however, one major untreated point source of water from an abandoned underground mining complex continues to degrade the quality of-the creek in its lower stretches. In the upper section, the. water quality in Deckers Creek has improved due to decreased surface and underground coal-mining activities, reclamation of abandoned and recently permitted surface mined lands, and natural healing of past land use scars from timbering and mining over time. The decrease in mineral. extraction activities and the reclamation of disturbed lands has occurred due to the passage and enforcement of water quality and land reclamation laws and regulations.
-
Talent identification and early development of elite water-polo players: a 2-year follow-up study.
Falk, Bareket; Lidor, Ronnie; Lander, Yael; Lang, Benny
2004-04-01
The processes of talent detection and early development are critical in any sport programme. However, not much is known about the appropriate strategies to be implemented during these processes, and little scientific inquiry has been conducted in this area. The aim of this study was to identify variables of swimming, ball handling and physical ability, as well as game intelligence, which could assist in the selection process of young water-polo players. Twenty-four players aged 14-15 years underwent a battery of tests three times during a 2-year period, before selection to the junior national team. The tests included: freestyle swim for 50, 100, 200 and 400 m, 100-m breast-stroke, 100-m 'butterfly' (with breast-stroke leg motion), 50-m dribbling, throwing at the goal, throw for distance in the water, vertical 'jump' from the water, and evaluation of game intelligence by two coaches. A comparison of those players eventually selected to the team and those not selected demonstrated that, 2 years before selection, selected players were already superior on most of the swim tasks (with the exception of breast-stroke and 50-m freestyle), as well as dribbling and game intelligence. This superiority was maintained throughout the 2 years. Two-way tabulation revealed that, based on baseline scores, the prediction for 67% of the players was in agreement with the final selection to the junior national team. We recommend that fewer swim events be used in the process of selecting young water-polo players, and that greater emphasis should be placed on evaluation of game intelligence.
-
Bianchi, Thomas S; Osburn, Christopher; Shields, Michael R; Yvon-Lewis, Shari; Young, Jordan; Guo, Laodong; Zhou, Zhengzhen
2014-08-19
Recent work has shown the presence of anomalous dissolved organic matter (DOM), with high optical yields, in deep waters 15 months after the Deepwater Horizon (DWH) oil spill in the Gulf of Mexico (GOM). Here, we continue to use the fluorescence excitation-emission matrix (EEM) technique coupled with parallel factor analysis (PARAFAC) modeling, measurements of bulk organic carbon, dissolved inorganic carbon (DIC), oil indices, and other optical properties to examine the chemical evolution and transformation of oil components derived from the DWH in the water column of the GOM. Seawater samples were collected from the GOM during July 2012, 2 years after the oil spill. This study shows that, while dissolved organic carbon (DOC) values have decreased since just after the DWH spill, they remain higher at some stations than typical deep-water values for the GOM. Moreover, we continue to observe fluorescent DOM components in deep waters, similar to those of degraded oil observed in lab and field experiments, which suggest that oil-related fluorescence signatures, as part of the DOM pool, have persisted for 2 years in the deep waters. This supports the notion that some oil-derived chromophoric dissolved organic matter (CDOM) components could still be identified in deep waters after 2 years of degradation, which is further supported by the lower DIC and partial pressure of carbon dioxide (pCO2) associated with greater amounts of these oil-derived components in deep waters, assuming microbial activity on DOM in the current water masses is only the controlling factor of DIC and pCO2 concentrations.
-
Directory of Open Access Journals (Sweden)
Leščešen Igor
2014-01-01
Full Text Available The WQI method is most frequently used in expert and scientific research and basically it provides a mechanism for cumulative representation, numeric expression and defining a certain level of water quality. This paper aims to assess water quality of the Tisa River in Vojvodina (North Serbia for the 2003 - 2012 period. Serbian Water Quality Index (SWQI was used for assessment of the river water quality. WQI is expressed as a single value ranging from 0 to 100 (best quality derived from numerous physical, chemical, biological and microbiological parameters. The results of SWQI for the Tisa River were mainly rated as good. Also, in this study it is noticed a clear decrease in water quality during warmer period of the year. Also, this study shows that water quality along the Tisa River decreases slightly but steadily down- stream, from Martonoš to Titel station and all along the length of the river provides values that according to SWQI descriptive quality indicator has been defined as good (72-83. The main problem of SWQI used in this paper is that it does not involve parameters of heavy metals concentration.
-
Selected hydrologic data from Fortymile Wash in the Yucca Mountain area, Nevada, water year 1992
Energy Technology Data Exchange (ETDEWEB)
Savard, C.S.
1995-02-01
Precipitation totals of 245 and 210 mm were measured at UE-29 UZN {number_sign}91 and UE-29 UZN {number_sign}92 respectively, during the 1992 water year, October 1, 1991 to September 30, 1992. Approximately ninety percent of the precipitation fell during the period December 27 to April 2. Localized streamflow was generated in the Fortymile Wash drainage basin during the February 12-15, 1992 and March 31, 1992 precipitation, and infiltrated into the streambed materials. The streamflow went across the UE-29 UZN {number_sign}91 neutron-access borehole location and within several meters of the UE-29 UZN {number_sign}92 location. Neutron logging in these boreholes showed increases in the volumetric water content of the unsaturated alluvium and indicated streamflow infiltrated to a depth of approximately 5 meters. The volumetric water content in the upper 5 meters then gradually decreased during the remaining part of the water year. Ground-water levels rose over one meter in wells UE-29 a{number_sign}1 and UE-29 a{number_sign}2, and one-half meter in neutron-access borehole LJE-29 UZN {number_sign}91 following the streamflows. Water level declines of 0.5 meter in UE-29 a{number_sign}1 and rises of 0.2 meter in UE-29 a{number_sign}2 and 0.1 meter in UE-29 UZN {number_sign}91 coincided with a June 29, 1992 earthquake at the Little Skull Mountain, located approximately 27 kilometers southeast of the wells.
-
Selected hydrologic data from Fortymile Wash in the Yucca Mountain area, Nevada, water year 1992
International Nuclear Information System (INIS)
Savard, C.S.
1995-01-01
Precipitation totals of 245 and 210 mm were measured at UE-29 UZN number-sign 91 and UE-29 UZN number-sign 92 respectively, during the 1992 water year, October 1, 1991 to September 30, 1992. Approximately ninety percent of the precipitation fell during the period December 27 to April 2. Localized streamflow was generated in the Fortymile Wash drainage basin during the February 12-15, 1992 and March 31, 1992 precipitation, and infiltrated into the streambed materials. The streamflow went across the UE-29 UZN number-sign 91 neutron-access borehole location and within several meters of the UE-29 UZN number-sign 92 location. Neutron logging in these boreholes showed increases in the volumetric water content of the unsaturated alluvium and indicated streamflow infiltrated to a depth of approximately 5 meters. The volumetric water content in the upper 5 meters then gradually decreased during the remaining part of the water year. Ground-water levels rose over one meter in wells UE-29 a number-sign 1 and UE-29 a number-sign 2, and one-half meter in neutron-access borehole LJE-29 UZN number-sign 91 following the streamflows. Water level declines of 0.5 meter in UE-29 a number-sign 1 and rises of 0.2 meter in UE-29 a number-sign 2 and 0.1 meter in UE-29 UZN number-sign 91 coincided with a June 29, 1992 earthquake at the Little Skull Mountain, located approximately 27 kilometers southeast of the wells
-
Directory of Open Access Journals (Sweden)
Kinga Kurowska
2017-12-01
Full Text Available Zmiany społeczno-gospodarcze, jakie zachodzą we współczesnym świecie, związane z rozwojem nauki i technologii, wymagają nowych, innowacyjnych podejść do edukacji, a w tym do szkolnictwa wyższego. Egalitaryzm przejawia sięprzede wszystkim masową dostępnością do szkolnictwa wyższego. Proces ten zmusza szkoły wyższe do rozwijania, nie tylko elitarnych kursów akademickich, lecz także programów zorientowanych zawodowo. Konieczność wykorzystania nowych narzędzi i metod edukacyjnych staje się oczywistością. W artykule przedstawiono podstawy prawne profilu studiów praktycznych na kierunki akademickie w Polsce po reformie szkolnictwa wyższego w 2014 r., a także kontekst kształcenia i szkolenia zawodowego w zakresie europejskich oraz polskich ram kwalifikacji odnośnie uczenia się przez całe życie (LLL. Przedstawiono także przykłady nowych form edukacji przydatnych w rozwijaniu kompetencji i umiejętności wymaganych od dzisiejszych absolwentów szkół wyższych.
-
1991-08-01
Anny Coa" of EFnser. Teciiniciam are stil wairhing on water, -ml taken trom near the arma where several barrel werefm e Saitw- day. tbiY1 Y0wL do" wy...Army Corps Tha trfPDiCs:: *thes barres bocame~ enang..2es deunane. r hcea-;:. scra ( letal of comerc fiom - 0 cone of tssreC rlns ZeIi. -ae spwee scapes
-
Reyes, Andres; Messina, Carlos D; Hammer, Graeme L; Liu, Lu; van Oosterom, Erik; Lafitte, Renee; Cooper, Mark
2015-12-01
Breeders have successfully improved maize (Zea mays L.) grain yield for the conditions of the US corn-belt over the past 80 years, with the past 50 years utilizing single-cross hybrids. Long-term improvement for grain yield under water-limited conditions has also been reported. Grain yield under water-limited conditions depends on water use, water use efficiency, and harvest index. It has been hypothesized that long-term genetic gain for yield could be due, in part, to increased water capture from the soil. This hypothesis was tested using a set of elite single-cross hybrids that were released by DuPont Pioneer between 1963 and 2009. Eighteen hybrids were grown in the field during 2010 and 2011 growing seasons at Woodland, CA, USA. Crops grew predominantly on stored soil water and drought stress increased as the season progressed. Soil water content was measured to 300cm depth throughout the growing season. Significant water extraction occurred to a depth of 240-300cm and seasonal water use was calculated from the change in soil water over this rooting zone. Grain yield increased significantly with year of commercialization, but no such trend was observed for total water extraction. Therefore, the measured genetic gain for yield for the period represented by this set of hybrids must be related to either increased efficiency of water use or increased carbon partitioning to the grain, rather than increased soil water uptake. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.
-
Surface Water Data at Los Alamos National Laboratory 2006 Water Year
Energy Technology Data Exchange (ETDEWEB)
R.P. Romero, D. Ortiz, G. Kuyumjian
2007-08-01
The principal investigators collected and computed surface water discharge data from 44 stream-gaging stations that cover most of Los Alamos National Laboratory and one at Bandelier National Monument. Also included are discharge data from three springs--two that flow into Canon de Valle and one that flows into Water Canyon--and peak flow data for 44 stations.
-
A Two-Year Water Quality Monitoring Curriculum.
Glazer, Richard B.; And Others
The Environmental Protection Agency developed this curriculum to train technicians to monitor water quality. Graduates of the program should be able to monitor municipal, industrial, and commercial discharges; test drinking water for purity; and determine quality of aquatic environments. The program includes algebra, communication skills, biology,…
-
2011-03-15
...: University of Wyoming, Anthropology Department, Human Remains Repository, Laramie, WY AGENCY: National Park... Anthropology Department, Human Remains Repository, Laramie, WY. The human remains and associated funerary... the human remains was made by University of Wyoming, Anthropology Department, Human Remains Repository...
-
Hydrologic data for the Walker River Basin, Nevada and California, water years 2010–14
Pavelko, Michael T.; Orozco, Erin L.
2015-12-10
Walker Lake is a threatened and federally protected desert terminal lake in western Nevada. To help protect the desert terminal lake and the surrounding watershed, the Bureau of Reclamation and U.S. Geological Survey have been studying the hydrology of the Walker River Basin in Nevada and California since 2004. Hydrologic data collected for this study during water years 2010 through 2014 included groundwater levels, surface-water discharge, water chemistry, and meteorological data. Groundwater levels were measured in wells, and surface-water discharge was measured in streams, canals, and ditches. Water samples for chemical analyses were collected from wells, streams, springs, and Walker Lake. Chemical analyses included determining physical properties; the concentrations of major ions, nutrients, trace metals, dissolved gases, and radionuclides; and ratios of the stable isotopes of hydrogen and oxygen. Walker Lake water properties and meteorological parameters were monitored from a floating platform on the lake. Data collection methods followed established U.S. Geological Survey guidelines, and all data are stored in the National Water Information System database. All of the data are presented in this report and accessible on the internet, except multiple-depth Walker Lake water-chemistry data, which are available only in this report.
-
Discharge, sediment, and water chemistry in Clear Creek, western Nevada, water years 2013–16
Huntington, Jena M.; Riddle, Daniel J.; Paul, Angela P.
2018-05-01
Clear Creek is a small stream that drains the eastern Carson Range near Lake Tahoe, flows roughly parallel to the Highway 50 corridor, and discharges to the Carson River near Carson City, Nevada. Historical and ongoing development in the drainage basin is thought to be affecting Clear Creek and its sediment-transport characteristics. Previous studies from water years (WYs) 2004 to 2007 and from 2010 to 2012 evaluated discharge, selected water-quality parameters, and suspended-sediment concentrations, loads, and yields at three Clear Creek sampling sites. This report serves as a continuation of the data collection and analyses of the Clear Creek discharge regime and associated water-chemistry and sediment concentrations and loads during WYs 2013–16.Total annual sediment loads ranged from 870 to 5,300 tons during WYs 2004–07, from 320 to 1,770 tons during WYs 2010–12, and from 50 to 200 tons during WYs 2013–16. Ranges in annual loads during the three study periods were not significantly different; however, total loads were greater during 2004–07 than they were during 2013–16. Annual suspended-sediment loads in WYs 2013–16 showed no significant change since WYs 2010–12 at sites 1 (U.S. Geological Survey reference site 10310485; Clear Creek above Highway 50, near Spooner Summit, Nevada) or 2 (U.S. Geological Survey streamgage 10310500; Clear Creek above Highway 50, near Spooner Summit, Nevada), but significantly lower loads at site 3 (U.S. Geological Survey site 10310518; Clear Creek at Fuji Park, at Carson City, Nevada), supporting the theory of sediment deposition between sites 2 and 3 where the stream gradient becomes more gradual. Currently, a threshold discharge of about 3.3 cubic feet per second is required to mobilize streambed sediment (bedload) from site 2 in Clear Creek. Mean daily discharge was significantly lower in 2010–12 than in 2004–07 and also significantly lower in 2013–16 than in 2010–12. During this study, lower bedload, and
-
Lower Charles River Bathymetry: 108 Years of Fresh Water
Yoder, M.; Sacarny, M.
2017-12-01
The Lower Charles River is a heavily utilized urban river that runs between Cambridge and Boston in Massachusetts. The recreational usage of the river is dependent on adequate water depths, but there have been no definitive prior studies on the sedimentation rate of the Lower Charles River. The river transitioned from tidal to a freshwater basin in 1908 due to the construction of the (old) Charles River Dam. Water surface height on the Lower Charles River is maintained within ±1 foot through controlled discharge at the new Charles River Dam. The current study area for historical comparisons is from the old Charles River Dam to the Boston University Bridge. This study conducted a bathymetric survey of the Lower Charles River, digitized three prior surveys in the study area, calculated volumes and depth distributions for each survey, and estimated sedimentation rates from fits to the volumes over time. The oldest chart digitized was produced in 1902 during dam construction deliberations. The average sedimentation rate is estimated as 5-10 mm/year, which implies 1.8-3.5 feet sedimentation since 1908. Sedimentation rates and distributions are necessary to develop comprehensive management plans for the river and there is evidence to suggest that sedimentation rates in the shallow upstream areas are higher than the inferred rates in the study area.
-
Fulton, John W.; Risser, Dennis W.; Regan, R. Steve; Walker, John F.; Hunt, Randall J.; Niswonger, Richard G.; Hoffman, Scott A.; Markstrom, Steven
2015-08-17
This report describes the results of a study by the U.S. Geological Survey in cooperation with ClearWater Conservancy and the Pennsylvania Department of Environmental Protection to develop a hydrologic model to simulate a water budget and identify areas of greater than average recharge for the Spring Creek Basin in central Pennsylvania. The model was developed to help policy makers, natural resource managers, and the public better understand and manage the water resources in the region. The Groundwater and Surface-water FLOW model (GSFLOW), which is an integration of the Precipitation-Runoff Modeling System (PRMS) and the Modular Groundwater Flow Model (MODFLOW-NWT), was used to simulate surface water and groundwater in the Spring Creek Basin for water years 2000–06. Because the groundwater and surface-water divides for the Spring Creek Basin do not coincide, the study area includes the Nittany Creek Basin and headwaters of the Spruce Creek Basin. The hydrologic model was developed by the use of a stepwise process: (1) develop and calibrate a PRMS model and steady-state MODFLOW-NWT model; (2) re-calibrate the steady-state MODFLOW-NWT model using potential recharge estimates simulated from the PRMS model, and (3) integrate the PRMS and MODFLOW-NWT models into GSFLOW. The individually calibrated PRMS and MODFLOW-NWT models were used as a starting point for the calibration of the fully coupled GSFLOW model. The GSFLOW model calibration was done by comparing observations and corresponding simulated values of streamflow from 11 streamgages and groundwater levels from 16 wells. The cumulative water budget and individual water budgets for water years 2000–06 were simulated by using GSFLOW. The largest source and sink terms are represented by precipitation and evapotranspiration, respectively. For the period simulated, a net surplus in the water budget was computed where inflows exceeded outflows by about 1.7 billion cubic feet (0.47 inches per year over the basin area
-
Cianfrani, C. M.
2009-12-01
Teaching Sustainable Water Resources and Low Impact Development: A Project Centered Course for First-Year Undergraduates Christina M. Cianfrani Assistant Professor, School of Natural Science, Hampshire College, 893 West Avenue, Amherst, MA 01002 Sustainable water resources and low impact development principles are taught to first-year undergraduate students using an applied design project sited on campus. All students at Hampshire College are required to take at least one natural science course during their first year as part of their liberal arts education. This requirement is often met with resistance from non-science students. However, ‘sustainability’ has shown to be a popular topic on campus and ‘Sustainable Water Resources’ typically attracts ~25 students (a large class size for Hampshire College). Five second- or third-year students are accepted in the class as advanced students and serve as project leaders. The first-year students often enter the class with only basic high school science background. The class begins with an introduction to global water resources issues to provide a broad perspective. The students then analyze water budgets, both on a watershed basis and a personal daily-use basis. The students form groups of 4 to complete their semester project. Lectures on low impact design principles are combined with group work sessions for the second half of the semester. Students tour the physical site located across the street from campus and begin their project with a site analysis including soils, landcover and topography. They then develop a building plan and identify preventative and mitigative measures for dealing with stormwater. Each group completes TR-55 stormwater calculations for their design (pre- and post-development) to show the state regulations for quantity will be met with their design. Finally, they present their projects to the class and prepare a formal written report. The students have produced a wide variety of creative
-
Tekçe, Neslihan; Pala, Kansad; Demirci, Mustafa; Tuncer, Safa
2016-11-01
To evaluate changes in surface characteristics of two different resin composites after 1 year of water storage using a profilometer, Vickers hardness, scanning electron microscopy (SEM), and atomic force microscopy (AFM). A total of 46 composite disk specimens (10 mm in diameter and 2 mm thick) were fabricated using Clearfil Majesty Esthetic and Clearfil Majesty Posterior (Kuraray Medical Co, Tokyo, Japan). Ten specimens from each composite were used for surface roughness and microhardness tests (n = 10). For each composite, scanning electron microscope (SEM, n = 2) and atomic force microscope (AFM, n = 1) images were obtained after 24 h and 1 year of water storage. The data were analyzed using two-way analysis of variance and a post-hoc Bonferroni test. Microhardness values of Clearfil Majesty Esthetic decreased significantly (78.15-63.74, p = 0.015) and surface roughness values did not change after 1 year of water storage (0.36-0.39, p = 0.464). Clearfil Majesty Posterior microhardness values were quite stable (138.74-137.25, p = 0.784), and surface roughness values increased significantly (0.39-0.48, p = 0.028) over 1 year. One year of water storage caused microhardness values for Clearfil Majesty Esthetic to decrease and the surface roughness of Clearfil Majesty Posterior increased. AFM and SEM images demonstrated surface detoration of the materials after 1 year and ensured similar results with the quantitative test methods. SCANNING 38:694-700, 2016. © 2016 Wiley Periodicals, Inc. © Wiley Periodicals, Inc.
-
Directory of Open Access Journals (Sweden)
Lamis Jomaa
2016-09-01
Full Text Available This study evaluates total water intake (TWI from plain water, beverages and foods among Lebanese children and compares TWI to dietary reference intakes (DRIs. In a national cross-sectional survey, data on demographic, socioeconomic, anthropometric, and physical activity characteristics were obtained from 4 to 13-year-old children (n = 752. Food and beverage consumption patterns were assessed using a validated food-frequency questionnaire. TWI was estimated at 1651 mL/day, with beverages contributing 72% of the TWI compared to 28% from foods. Beverages with the highest contribution to TWI included plain water, fruit juice and soda. A significantly higher proportion of 9–13-year-old children failed to meet the DRIs compared to 4–8 years old (92%–98% vs. 74%. Gender differentials were observed with a significantly higher proportion of boys meeting the DRIs compared to girls. The water to energy ratio ranged between 0.84 and 0.87, which fell short of meeting the desirable recommendations. In addition, children from higher socioeconomic status had higher intakes of water from milk and bottled water, coupled with lower water intakes from sodas. The study findings show an alarming high proportion of Lebanese children failing to meet TWI recommendations, and call for culture-specific interventions to instill healthy fluid consumption patterns early in life.
-
Jomaa, Lamis; Hwalla, Nahla; Constant, Florence; Naja, Farah; Nasreddine, Lara
2016-01-01
This study evaluates total water intake (TWI) from plain water, beverages and foods among Lebanese children and compares TWI to dietary reference intakes (DRIs). In a national cross-sectional survey, data on demographic, socioeconomic, anthropometric, and physical activity characteristics were obtained from 4 to 13-year-old children (n = 752). Food and beverage consumption patterns were assessed using a validated food-frequency questionnaire. TWI was estimated at 1651 mL/day, with beverages contributing 72% of the TWI compared to 28% from foods. Beverages with the highest contribution to TWI included plain water, fruit juice and soda. A significantly higher proportion of 9–13-year-old children failed to meet the DRIs compared to 4–8 years old (92%–98% vs. 74%). Gender differentials were observed with a significantly higher proportion of boys meeting the DRIs compared to girls. The water to energy ratio ranged between 0.84 and 0.87, which fell short of meeting the desirable recommendations. In addition, children from higher socioeconomic status had higher intakes of water from milk and bottled water, coupled with lower water intakes from sodas. The study findings show an alarming high proportion of Lebanese children failing to meet TWI recommendations, and call for culture-specific interventions to instill healthy fluid consumption patterns early in life. PMID:27618092
-
Silins, U.; Bladon, K. D.; Stone, M.; Emelko, M. B.; Collins, A.; Boon, S.; Williams, C.; Wagner, M. J.; Martens, A. M.; Anderson, A.
2012-12-01
Broad regions of western North America rely on water supplies that originate from forested regions of the Rocky Mountain cordillera where landuse pressures, and stresses including changing natural disturbance regimes associated with shifting climates has been impacting critical source water supplies from this region. Increases in magnitude and severity of wildfires along with impacts on downstream water supplies has been observed along the length of the North American Rocky Mountain chain, however, the longevity of these impacts (including impacts to important water quality parameters) remain highly uncertain because processes regulating recovery from such disturbances can span a range of timescales from a few years to decades depending on both the hydro-climatic regime, and which water quality parameters are important. Studies document such long-term changes are few. The Southern Rockies Watershed Project (SRWP) was established to document the magnitude and recovery from the severe 2003 Lost Creek wildfire in the Crowsnest Pass region of southwest Alberta, Canada. Hydrology, water quality (physical & chemical) have been studies in 9 instrumented catchments (4-14 km2) encompassing burned, burned and salvage logged, prescribed burned, and unburned (reference) conditions since late winter 2004. While most important water quality parameters were strongly elevated in burned and burned-salvage logged catchments after the fire, strongly differential rates of recovery were observed for contaminant concentration, export, and yield across a range of water quality parameters (2004-2011). For example, while various nitrogen (N) species (total nitrogen, dissolved nitrogen, NO3-, NH4+) showed 2-7 fold increases in concentration the first 1-2 years after the wildfire, N recovered back to baseline concentrations 4-5 years after the wildfire. In contrast, eight full years after the wildfire (2011), no recovery of sediment or phosphorus (P) production (soluble reactive, total
-
Gas and water permeability tests of 25 year old concrete from the NPD Nuclear Generating Station
International Nuclear Information System (INIS)
Mills, R.H.
1990-05-01
Permeability tests on cores recovered from concrete which had been in service for 25 years in the Nuclear Power Demonstration (NPD) reactor showed rates of mass transfer of gas and water which were greater than young fresh concrete of the same proportions and that reported in previous AECB reports. This transparency of the concrete was also 2 orders of magnitude greater than that of comparable concrete which had been stored in the laboratory atmosphere for 19 years. Analysis of the effluent in water permeability tests revealed the presence of unusual amounts of soluble materials, mainly Na and K but little Ca, in the reactor concrete. This suggested service-related deterioration of the concrete rather than the release of soluble Ca by continuing hydration of cement
-
State of the quality of drinking water in households in children under five years in Peru, 2007-2010
Miranda, Marianella; Dirección Ejecutiva de Vigilancia Alimentaria y Nutricional, Centro Nacional de Alimentación y Nutrición, Instituto Nacional de Salud, Lima, Perú. Nutricionista.; Aramburú, Adolfo; Dirección Ejecutiva de Vigilancia Alimentaria y Nutricional, Centro Nacional de Alimentación y Nutrición, Instituto Nacional de Salud, Lima, Perú. Nutricionista.; Junco, Jorge; Asesoría en Nutrición y Salud - ASENSA SAC, Lima, Perú. Biólogo.; Campos, Miguel; Departamento de física, Informática y Matemáticas, facultad de Ciencias y filosofía, Universidad Peruana Cayetano Heredia. Lima, Perú. Médico, Doctor en Ciencias.
2010-01-01
Objective. To evaluate the proportion of children under five with access to quality water and its behavior according to geographical location, water supply and poverty status. Material and methods. Continuous survey (repeated cross), with multistage random sampling, being the universe children under five years living in Peru. We evaluated the presence of free chlorine in drinking water samples in the dwellings of 3570 children (Metropolitan Lima 666, Rest of Coast 755, Urban Sierra 703, R...
-
Instrumentation and analysis of frost heave mitigation on WY-70, Encampment, WY.
2014-05-01
This project investigated a novel procedure to reduce or prevent subgrade freezing non-destructively by injecting a two-part polymer foam at : the top of the subgrade. Controlled injection of Uretek Star, expanding structural polymer foam, created a ...
-
Packaged solar water heating technology: twenty years of progress
International Nuclear Information System (INIS)
Morrison, Graham; Wood, Byard
2000-01-01
The world market for packaged solar water heaters is reviewed, and descriptions are given of the different types of solar domestic water heaters (SDWH), design concepts for packaged SDWH, thermosyphon SDWH, evacuated insulation and excavated tube collectors, seasonally biased solar collectors, heat pump water heaters, and photovoltaic water heaters. The consumer market value for SDWHs is explained, and the results of a survey of solar water heating are summarised covering advantages, perceived disadvantages, the relative importance of purchase decision factors, experience with system components, and the most frequent maintenance problems. The durability, reliability, and performance of SDWHs are discussed
-
Year-long metagenomic study of river microbiomes across land use and water quality
Directory of Open Access Journals (Sweden)
Thea eVan Rossum
2015-12-01
Full Text Available Select bacteria, such as Escherichia coli or coliforms, have been widely used as sentinels of low water quality; however, there are concerns regarding their predictive accuracy for the protection of human and environmental health. To develop improved monitoring systems, a greater understanding of bacterial community structure, function and variability across time is required in the context of different pollution types, such as agricultural and urban contamination. Here, we present a year-long survey of free-living bacterial DNA collected from seven sites along rivers in three watersheds with varying land use in Southwestern Canada. This is the first study to examine the bacterial metagenome in flowing freshwater (lotic environments over such a time span, providing an opportunity to describe bacterial community variability as a function of land use and environmental conditions. Characteristics of the metagenomic data, such as sequence composition and average genome size, vary with sampling site, environmental conditions, and water chemistry. For example, average genome size was correlated with hours of daylight in the agricultural watershed and, across the agriculturally and urban-affected sites, k-mer composition clustering corresponded to nutrient concentrations. In addition to indicating a community shift, this change in average genome size has implications in terms of the normalisation strategies required, and considerations surrounding such strategies in general are discussed. When comparing abundances of gene functional groups between high- and low-quality water samples collected from an agricultural area, the latter had a higher abundance of nutrient metabolism and bacteriophage groups, possibly reflecting an increase in agricultural runoff. This work presents a valuable dataset representing a year of monthly sampling across watersheds and an analysis targeted at establishing a foundational understanding of how bacterial lotic communities
-
Knudsen, Nikoline N; Schullehner, Jörg; Hansen, Birgitte; Jørgensen, Lisbeth F; Kristiansen, Søren M; Voutchkova, Denitza D; Gerds, Thomas A; Andersen, Per K; Bihrmann, Kristine; Grønbæk, Morten; Kessing, Lars V; Ersbøll, Annette K
2017-06-10
Suicide is a major public health concern. High-dose lithium is used to stabilize mood and prevent suicide in patients with affective disorders. Lithium occurs naturally in drinking water worldwide in much lower doses, but with large geographical variation. Several studies conducted at an aggregate level have suggested an association between lithium in drinking water and a reduced risk of suicide; however, a causal relation is uncertain. Individual-level register-based data on the entire Danish adult population (3.7 million individuals) from 1991 to 2012 were linked with a moving five-year time-weighted average (TWA) lithium exposure level from drinking water hypothesizing an inverse relationship. The mean lithium level was 11.6 μg/L ranging from 0.6 to 30.7 μg/L. The suicide rate decreased from 29.7 per 100,000 person-years at risk in 1991 to 18.4 per 100,000 person-years in 2012. We found no significant indication of an association between increasing five-year TWA lithium exposure level and decreasing suicide rate. The comprehensiveness of using individual-level data and spatial analyses with 22 years of follow-up makes a pronounced contribution to previous findings. Our findings demonstrate that there does not seem to be a protective effect of exposure to lithium on the incidence of suicide with levels below 31 μg/L in drinking water.
-
Water and beverage consumption patterns among 4 to 13-year-old children in the United Kingdom
Florent Vieux; Matthieu Maillot; Florence Constant; Adam Drewnowski
2017-01-01
Abstract Background The UK government has announced a tax on sugar-sweetened beverages. The aim of this study was to assess consumption patterns for plain drinking water relative to sugary beverages among UK children. Methods Dietary intake data for 845 children aged 4–13 years came from the nationally representative cross-sectional National Diet and Nutrition Survey, 2008–2011. Beverage categories were drinking water (tap or bottled), milk, 100% fruit juices, soda, fruit drinks, tea, coffee,...
-
Sustainability: Land Management
2012-05-24
8217. .’" , .. . . . . Aqula Harbour , , MCB Quantico Notification Area MMF Legend Flight Tracks - FixedW1ng - Rot;wy Wing TBS :::_-, FIXed Wing Alea ...Rot;wy Wing Alea TBS Rotary Wing /Vea lmpuln Noise Buffer SMile APZ~l Range Safety Zone C Range Safety Zone A IZ2Zl Corr4losile Su1ace
-
Quality of surface-water supplies in the Triangle area of North Carolina, water year 2008
Giorgino, M.J.; Rasmussen, R.B.; Pfeifle, C.A.
2012-01-01
Surface-water supplies are important sources of drinking water for residents in the Triangle area of North Carolina, which is located within the upper Cape Fear and Neuse River Basins. Since 1988, the U.S. Geological Survey and a consortium of governments have tracked water-quality conditions and trends in several of the area's water-supply lakes and streams. This report summarizes data collected through this cooperative effort, known as the Triangle Area Water Supply Monitoring Project, during October 2007 through September 2008. Major findings for this period include:
-
Li, Tao; Hua, Zhendong; Meng, Xin; Liu, Cuimei
2018-03-01
Methamphetamine (MA) tablet production confers chemical and physical properties. This study developed a simple and effective physical characteristic profiling method for MA tablets with capital letter "WY" logos, which realized the discrimination between linked and unlinked seizures. Seventeen signature distances extracted from the "WY" logo were explored as factors for multivariate analysis and demonstrated to be effective to represent the features of tablets in the drug intelligence perspective. Receiver operating characteristic (ROC) curve was used to evaluate efficiency of different pretreatments and distance/correlation metrics, while "Standardization + Euclidean" and "Logarithm + Euclidean" algorithms outperformed the rest. Finally, hierarchical cluster analysis (HCA) was applied to the data set of 200 MA tablet seizures randomly selected from cases all around China in 2015, and 76% of them were classified into a group named after "WY-001." Moreover, the "WY-001" tablets occupied 51-80% tablet seizures from 2011 to 2015 in China, indicating the existence of a huge clandestine factory incessantly manufacturing MA tablets. © 2017 American Academy of Forensic Sciences.
-
Reducing diacetyl production of wine by overexpressing BDH1 and BDH2 in Saccharomyces uvarum.
Li, Ping; Guo, Xuewu; Shi, Tingting; Hu, Zhihui; Chen, Yefu; Du, Liping; Xiao, Dongguang
2017-11-01
As a byproduct of yeast valine metabolism during fermentation, diacetyl can produce a buttery aroma in wine. However, high diacetyl concentrations generate an aromatic off-flavor and poor quality in wine. 2,3-Butanediol dehydrogenase encoded by BDH1 can catalyze the two reactions of acetoin from diacetyl and 2,3-butanediol from acetoin. BDH2 is a gene adjacent to BDH1, and these genes are regulated reciprocally. In this study, BDH1 and BDH2 were overexpressed in Saccharomyces uvarum to reduce the diacetyl production of wine either individually or in combination. Compared with those in the host strain WY1, the diacetyl concentrations in the recombinant strains WY1-1 with overexpressed BDH1, WY1-2 with overexpressed BDH2 alone, and WY1-12 with co-overexpressed BDH1 and BDH2 were decreased by 39.87, 33.42, and 46.71%, respectively. BDH2 was only responsible for converting diacetyl into acetoin, but not for the metabolic pathway of acetoin to 2,3-butanediol in S. uvarum. This study provided valuable insights into diacetyl reduction in wine.
-
Rockwell, G.L.; Pope, G.L.; Agajanian, J.; Caldwell, L.A.
2003-01-01
Water-resources data for the 2002 water year for California consist of records of stage, discharge, and water quality of streams, stage and contents in lakes and reservoirs, and water levels and water quality in wells. Volume 1 contains discharge records for 188 gaging stations and 10 crest-stage partial-record stations, stage and contents for 19 lakes and reservoirs, gage-height records for 2 stations, water quality for 39 streamflow-gaging stations and 11 partial-record stations, and precipitation data for 1 station. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Pope, G.L.; Agajanian, J.; Caldwell, L.A.; Rockwell, G.L.
2004-01-01
Water-resources data for the 2003 water year for California consist of records of stage, discharge, and water quality of streams, stage and contents in lakes and reservoirs, and water levels and water quality in wells. Volume 1 contains discharge records for 193 gaging stations and 11 crest-stage partial-record stations, stage and contents for 22 lakes and reservoirs, gage-height records for 2 stations, water quality for 47 streamflow-gaging stations and 12 partial-record stations, and precipitation data for 1 station. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Agajanian, J.; Caldwell, L.A.; Rockwell, G.L.; Pope, G.L.
2005-01-01
Water-resources data for the 2004 water year for California consist of records of stage, discharge, and water quality of streams, stage and contents in lakes and reservoirs, and water levels and water quality in wells. Volume 1 contains discharge records for 195 gaging stations and 10 crest-stage partial-record stations, stage and contents for 25 lakes and reservoirs, gage-height records for 2 stations, water quality for 47 streamflow-gaging stations and 7 partial-record stations, and precipitation data for 5 stations. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Zhang, Zhuoying; Yang, Hong; Shi, Minjun
2016-04-01
The North China Plain is the most water scarce region in China. Its water security is closely relevant to interregional water movement, which can be realized by real water transfers and/or virtual water transfers. This study investigates the roles of virtual water trade and real water transfer using Interregional Input-Output model. The results show that the region is receiving 19.4 billion m3/year of virtual water from the interregional trade, while exporting 16.4 billion m3/year of virtual water in the international trade. In balance, the region has a net virtual water gain of 3 billion m3/year from outside. Its virtual water inflow is dominated by agricultural products from other provinces, totalling 16.6 billion m3/year, whilst its virtual water export is dominated by manufacturing sectors to other countries, totalling 11.7 billion m3/year. Both virtual water import and real water transfer from South to North Water Diversion Project are important water supplements for the region. The results of this study provide useful scientific references for the establishment of combating strategies to deal with the water scarcity in the future.
-
Evolution of the human-water relationships in the Heihe River basin in the past 2000 years
Lu, Z.; Wei, Y.; Xiao, H.; Zou, S.; Xie, J.; Ren, J.; Western, A.
2015-05-01
This paper quantitatively analyzed the evolution of human-water relationships in the Heihe River basin of northern China over the past 2000 years by reconstructing the catchment water balance by partitioning precipitation into evapotranspiration and runoff. The results provided the basis for investigating the impacts of societies on hydrological systems. Based on transition theory and the rates of changes of the population, human water consumption and the area of natural oases, the evolution of human-water relationships can be divided into four stages: predevelopment (206 BC-AD 1368), take-off (AD 1368-1949), acceleration (AD 1949-2000), and the start of a rebalancing between human and ecological needs (post AD 2000). Our analysis of the evolutionary process revealed that there were large differences in the rate and scale of changes and the period over which they occurred. The transition of the human-water relationship had no fixed pattern. This understanding of the dynamics of the human-water relationship will assist policy makers in identifying management practices that require improvement by understanding how today's problems were created in the past, which may lead to more sustainable catchment management in the future.
-
Two-year drinking water carcinogenicity study of methyl tertiary-butyl ether (MTBE) in Wistar rats.
Dodd, Darol; Willson, Gabrielle; Parkinson, Horace; Bermudez, Edilberto
2013-07-01
Methyl tertiary-butyl ether (MTBE) has been used as a gasoline additive to reduce tailpipe emissions and its use has been discontinued. There remains a concern that drinking water sources have been contaminated with MTBE. A two-year drinking water carcinogenicity study of MTBE was conducted in Wistar rats (males, 0, 0.5, 3, 7.5 mg ml(-1); and females, 0, 0.5, 3, and 15 mg ml(-1)). Body weights were unaffected and water consumption was reduced in MTBE-exposed males and females. Wet weights of male kidneys were increased at the end of two years of exposure to 7.5 mg ml(-1) MTBE. Chronic progressive nephropathy was observed in males and females, was more severe in males, and was exacerbated in the high MTBE exposure groups. Brain was the only tissue with a statistically significant finding of neoplasms. One astrocytoma (1/50) was found in a female rat (15 mg ml(-1)). The incidence of brain astrocytomas in male rats was 1/50, 1/50, 1/50 and 4/50 for the 0, 0.5, 3 and 7.5 mg ml(-1) exposure groups, respectively. This was a marginally significant statistical trend, but not statistically significant when pairwise comparisons were made or when multiple comparisons were taken into account. The incidence of astrocytoma fell within historical control ranges for Wistar rats, and the brain has not been identified as a target organ following chronic administration of MTBE, ethyl tert-butyl ether, or tertiary butyl alcohol (in drinking water) to mice and rats. We conclude that the astrocytomas observed in this study are not associated with exposure to MTBE. Copyright © 2011 John Wiley & Sons, Ltd.
-
Bowers, J.C.; McConaughy, C.E.; Polinoski, K.G.; Smith, G.B.
1987-01-01
Water resources data for the 1985 water year for California consists of records of stage, discharge, and water quality of streams; stage and contents in lakes and reservoirs; and water levels and water quality in wells. Volume 1 contains discharge records for 150 gaging stations; stage and contents for 17 lakes and reservoirs; water quality for 23 streams. Also included are 10 crest-stage partial-record stations, three miscellaneous measurement sites, and one waterquality partial-record station. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Bowers, J.C.; McConaughy, C.E.; Polinoski, K.G.; Smith, G.B.
1988-01-01
Water resources data for the 1986 water year for California consist of records of stage, discharge, and water quality of streams; stage and contents in lakes and reservoirs; and water levels and water quality in wells. Volume 1 contains discharge records for 144 gaging stations; stage and contents for 15 lakes and reservoirs; watet quality for 21 streams. Also included are crest-stage partial-record stations, 3 miscellaneous measurement sites, and 5 water-quality partial-record stations. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
2013-03-18
... 33, Amdt 1 Willmar, MN, Willmar Muni-John L Rice Field, RNAV (GPS) RWY 31, Amdt 1 Charlotte, NC... Seattle, WA, Seattle-Tacoma Intl, RNAV (RNP) Z RWY 34L, Orig-A Newcastle, WY, Mondell Field, RNAV (GPS) RWY 13, Orig-A Newcastle, WY, Mondell Field, RNAV (GPS) RWY 31, Orig-A Effective 2 May 2013 Dunnellon...
-
Polinoski, K.G.; Hoffman, E.B.; Smith, G.B.; Bowers, J.C.
1989-01-01
Water resources data for the 1988 water year for California consist of records of stage, discharge, and water quality of streams; stage and contents in lakes and reservoirs; and water levels and water quality in wells. Volume 1 contains discharge records for 134 gaging stations; stage and contents for 17 lakes and reservoirs; and water quality for 24 streams. Also included are 10 crest-stage partial-record stations, 5 miscellaneous measurement sites, and 16 water-quality partial-record stations. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Bowers, J.C.; McConaughy, C.E.; Polinoski, K.G.; Smith, G.B.
1988-01-01
Water resources data for the 1987 water year for California consist of records of stage, discharge, and water quality of streams; stage and contents in lakes and reservoirs; and water levels and water quality in wells. Volume 1 contains discharge records for 134 gaging stations; stage and contents for 16 lakes and reservoirs; and water quality for 16 streams. Also included are 10 crest-stage partial-record stations, 3 miscellaneous measurement sites, and 10 water-quality partial-record stations. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Merritt, M.L.
1995-01-01
A digital model of the flow system in the highly permeable surficial aquifer of southern Dade County, Florida, was constructed for the purposes of better understanding processes that influence the flow system and of supporting the construction of a subregional model of the transport of brackish water from a flowing artesian well. Problems that needed resolution in this endeavor included the development of methods to represent the influence of flowing surface water in seasonally inundated wetlands and the influence of a network of controlled canals developed in stages during the simulation time period (water years 1945-89). An additional problem was the general lack of natural aquifer boundaries near the boundaries of the study area. The model construction was based on a conceptual description of the Biscayne aquifer developed from the results of previous U.S. Geological Survey investigations. Modifications were made to an existing three- dimensional finite-difference simulator of ground- water flow to enable an upper layer of the grid to represent seasonally occurring overland sheetflow in a series of transient simulations of water levels from 1945 to 1989. A rewetting procedure was developed for the simulator that permitted resaturation of cells in this layer when the wet season recurred. An "equivalent hydraulic conductivity" coefficient was assigned to the overland flow layer that was analogous, subject to various approximations, to the use of the Manning equation. The surficial semiconfining peat and marl layers, levees, canals, and control structures were also represented as part of the model grid with the appropriate choices of hydraulic coefficient values. For most of the Biscayne aquifer grid cells, the value assigned to hydraulic conductivity for model calibration was 30,000 feet per day and the value assigned to porosity was 20 percent. Boundary conditions were specified near data sites having long-term records of surface-water stages or water
-
Fiscal Year 1988 program report: Alaska Water Research Center
International Nuclear Information System (INIS)
Kane, D.L.
1990-01-01
The contents of this study includes: water problems and issues of Alaska; program goals and priorities; research project synopses are: radium levels in, and removal from, ground waters of interior alaska; assessment of stream-flow sediment transport for engineering projects; productivity within deep glacial gravels under subarctic Alaska rivers; nitrogen-cycle dynamics in a subarctic lake; and the use of peat mounds for treatment of household waste water
-
Effects of 50-years unmanaged water resource in Southern Tuscany coastal plains (Italy)
Rossetto, R.; Debolini, M.; Galli, M. A.; Bonari, E.
2012-04-01
original 4 Mm3. Having a reduced access to water resources, most of the farms during the 90's moved to more efficient water uses (drip irrigation) to save crops from leaf burns or switched to less-water-demanding, but less profitable crops. As a consequence, less competitive areas in the production-distribution chain suffered aquifer' salinisation and were progressively abandoned. As far as drinking water supply, the area is facing water scarcity during the summer period; desalination plants are planned. In one of the plain the water utility pumps out salinised groundwater that is then desalinized with an obvious increase in energy consumption. Although water management needs have grown during the last 50 years and several studies outlined the importance of planning this resource, conflicts among stakeholders and political issues make such problems of difficult solution. Today large dam building seems to be quite unreliable both because of the construction time and the financial issues related. At the same time feasible projects, driven also by innovative and more profitable agricultural development, call for wastewater reuse and artificial aquifer recharge starting at least from pilot tests in priority areas.
-
Surface Water Data at Los Alamos National Laboratory 1998 Water Year
International Nuclear Information System (INIS)
Shaull, D.A.; Alexander, M.R.; Reynolds, R.P.; McLean, C.T.; Romero, R.P.
1999-01-01
The principal investigators collected and computed surface water discharge data from 19 stream-gaging stations that cover most of Los Alamos National Laboratory. Also included are discharge data from three springs that flow into Caiion de Vane
-
Etheridge, Alexandra B.; MacCoy, Dorene E.; Weakland, Rhonda J.
2014-01-01
Water-quality conditions were studied in selected tributaries of the lower Boise River during water years 2009–12, including Fivemile and Tenmile Creeks in 2009, Indian Creek in 2010, and Mason Creek in 2011 and 2012. Biological samples, including periphyton biomass and chlorophyll-a, benthic macroinvertebrates, and fish were collected in Mason Creek in October 2011. Synoptic water-quality sampling events were timed to coincide with the beginning and middle of the irrigation season as well as the non-irrigation season, and showed that land uses and irrigation practices affect water quality in the selected tributaries. Large increases in nutrient and sediment concentrations and loads occurred over relatively short stream reaches and affected nutrient and sediment concentrations downstream of those reaches. Escherichia coli (E. coli) values increased in study reaches adjacent to pastured lands or wastewater treatment plants, but increased E. coli values at upstream locations did not necessarily affect E. coli values at downstream locations. A spatial loading analysis identified source areas for nutrients, sediment, and E. coli, and might be useful in selecting locations for water-quality improvement projects. Effluent from wastewater treatment plants increased nutrient loads in specific reaches in Fivemile and Indian Creeks. Increased suspended-sediment loads were associated with increased discharge from irrigation returns in each of the studied tributaries. Samples collected during or shortly after storms showed that surface runoff, particularly during the winter, may be an important source of nutrients in tributary watersheds with substantial agricultural land use. Concentrations of total phosphorus, suspended sediment, and E. coli exceeded regulatory water-quality targets or trigger levels at one or more monitoring sites in each tributary studied, and exceedences occurred during irrigation season more often than during non-irrigation season. As with water
-
Vieux, Florent; Maillot, Matthieu; Constant, Florence; Drewnowski, Adam
2016-01-01
Objective To examine the consumption of plain water among children in France and compare total water intakes with guidelines issued by the European Food Safety Authority (EFSA). Design Nationally representative data were used to assess food, beverage and water consumption by sex, age group (4?8 years, 9?13 years), income-to-poverty ratio, eating occasion and location. Beverages were classified into nine groups: water (tap or bottled), milk, 100 % fruit juice, sodas, fruit drinks, hot beverage...
-
Directory of Open Access Journals (Sweden)
Pierguido Sarti
2013-06-01
Full Text Available Since 1998, the Italian Antarctic Programme has been funding space geodetic activities based on the use of episodic and permanent global positioning system (GPS observations. As well as their exploitation in geodynamics, these data can be used to sense the atmosphere and to retrieve and monitor its water vapor content and variations. The surface pressure p and temperature Ts at the GPS tracking sites are necessary to compute the zenith hydrostatic delay (ZHD, and consequently, the precipitable water. At sites where no surface information is recorded, the p and Ts values can be retrieved from, e.g., global numerical weather prediction models. Alternatively, the site-specific ZHD values can be computed by interpolation of the ZHD values provided in a grid model (2.5° × 2.0°. We have processed the data series of the permanent GPS site TNB1 (Mario Zucchelli Station, Antarctica from 1998 to 2010, with the purpose of comparing the use of grid ZHD values as an alternative to the use of real surface records. With these approaches, we estimate almost 7 × 104 hourly values of precipitable water over 13 years, and we find discrepancies that vary between 1.8 (±0.2 mm in summer and 3.3 (±0.5 mm in winter. In addition, the discrepancies of the two solutions show a clear seasonal dependency. Radiosounding measurements were used to derive an independent series of precipitable water. These agree better with the GPS precipitable water derived from real surface data. However, the GPS precipitable water time series is dry biased, as it is ca. 77% of the total moisture measured by the radiosoundings. Both the GPS and radiosounding observations are processed through the most up-to-date strategies, to reduce known systematic errors.
-
,
1981-01-01
Water-resources data for the 1979 water year for California consist of records of stage, discharge, and water quality of streams; stage, contents, and water quality of lakes and reservoirs; records of water levels in selected observation wells; and selected chemical analyses of ground water. Records for a few pertinent streamflow and water-quality stations in bordering States are also included. These data, a contribution to the National Water Data System, were collected by the Geological Survey and cooperating local, State, and Federal agencies in California.
-
,
1979-01-01
Water-resources data for the 1978 water year for California consist of records of stage, discharge, and water quality of streams; stage, contents, and water quality of lakes and reservoirs; records of water levels in selected observation wells; and selected chemical analyses of ground water. Records for a few pertinent streamflow and water-quality stations in bordering States are also included. These data, a contribution to the National water Data System, were collected by the Geological Survey and cooperating local, State, and Federal agencies in California.
-
Xu, Jie; Li, Congfeng; Liu, Huitao; Zhou, Peilu; Tao, Zhiqiang; Wang, Pu; Meng, Qingfeng; Zhao, Ming
2015-01-01
Plastic film mulching (PM) has been widely used to improve maize (Zea mays L.) yields and water use efficiency (WUE) in Northeast China, but the effects of PM in a changing climate characterized by highly variable precipitation are not well understood. Six site-year field experiments were conducted in the dry and rainy years to investigate the effects of PM on maize growth, grain yield, and WUE in Northeast China. Compared to crops grown without PM treatment (control, CK), PM significantly increased the grain yield by 15-26% in the dry years, but no significant yield increase was observed in the rainy years. Yield increase in the dry years was mainly due to a large increase in dry matter accumulation pre-silking compared to the CK, which resulted from a greater dry matter accumulation rate due to the higher topsoil temperature and water content. As a result, the WUE of the crops that underwent PM (3.27 kg m(-3)) treatment was also increased by around 16% compared to the CK, although the overall evapotranspiration was similar between the two treatments. In the rainy years, due to frequent precipitation and scant sunshine, the topsoil temperature and water content in the field that received PM treatment was improved only at some stages and failed to cause higher dry matter accumulation, except at the 8th leaf stage. Consequently, the grain yield and WUE were not improved by PM in the rainy years. In addition, we found that PM caused leaf senescence at the late growth stage in both dry and rainy years. Therefore, in practice, PM should be applied cautiously, especially when in-season precipitation is taken into account.
-
Booth, Amanda C.; Soderqvist, Lars E.
2016-12-12
Freshwater flow to the Ten Thousand Islands estuary has been altered by the construction of the Tamiami Trail and the Southern Golden Gate Estates. The Picayune Strand Restoration Project, which is associated with the Comprehensive Everglades Restoration Plan, has been implemented to improve freshwater delivery to the Ten Thousand Islands estuary by removing hundreds of miles of roads, emplacing hundreds of canal plugs, removing exotic vegetation, and constructing three pump stations. Quantifying the tributary flows and salinity patterns prior to, during, and after the restoration is essential to assessing the effectiveness of upstream restoration efforts.Tributary flow and salinity patterns during preliminary restoration efforts and prior to the installation of pump stations were analyzed to provide baseline data and preliminary analysis of changes due to restoration efforts. The study assessed streamflow and salinity data for water years1 2007–2014 for the Faka Union River (canal flow included), East River, Little Wood River, Pumpkin River, and Blackwater River. Salinity data from the Palm River and Faka Union Boundary water-quality stations were also assessed.Faka Union River was the dominant contributor of freshwater during water years 2007–14 to the Ten Thousand Islands estuary, followed by Little Wood and East Rivers. Pumpkin River and Blackwater River were the least substantial contributors of freshwater flow. The lowest annual flow volumes, the highest annual mean salinities, and the highest percentage of salinity values greater than 35 parts per thousand (ppt) occurred in water year 2011 at all sites with available data, corresponding with the lowest annual rainfall during the study. The highest annual flow volumes and the lowest percentage of salinities greater than 35 ppt occurred in water year 2013 for all sites with available data, corresponding with the highest rainfall during the study.In water year 2014, the percentage of monitored annual flow
-
Water Erosion in a Two Year Old Stand of Eucalyptus benthamii under three Plantation Methods
Padilha, J.; Bertol, I.; Marioti, J.; Ramos, J. C.; Flores, M. C.; Tanaka, M. S.; Paz González, A.
2012-04-01
The preparation of the soil is the main issue of soil management. Thus, it is also one of the main operations with regard to management of planted forest during the whole productive process. Soil preparation is thought to directly affect various processes of the hydrologic cycle, water erosion, crop productivity and, subsequently, play an important role both for the environment and for the invested capital. Therefore knowledge of the effect of each specific soil management system on forest production is viewed as an essential issue. Based on these considerations, the aim of this work was to quantify soil and water losses by water erosion during the seasons of the year with the highest rainfall intensity in the south hemisphere, i.e. spring and summer in a two year old stand planted with Eucalyptus benthamii. This tree species was planted following three different conditions: 1) soil mechanical preparation in furrows following the land slope, 2) soil mechanical preparation in furrows dug perpendicular to the slope and 3) semi-mechanical preparation by digging an individual hole for each plant. The field experiment was located in Otacílio Costa municipality, SC, Brazil, at the Gropp forest farm owned by the Kablin SA company, 841 m asl altitude. The soil was classified as a "Cambissolo Húmico Alumínico Léptico" according with the Brazilian Soil Classification System with a slope of about 0.12 m m-1. The experimental design consisted of randomly located erosion plots with 3 repetitions, thus a total of 9 plots. The surface area of the plots was 12 x 24 m and they were oriented so that the main side followed the land slope. Suspended sediments and water losses were channelled to collecting tank at the end of the plot. Runoff water and eroded sediments were weakly measured, so that they correspond to cumulative weakly rainfall. The highest soil and water losses were recorded in plots with furrows dug perpendicular to the slope and the lowest ones corresponded to the
-
Energy Technology Data Exchange (ETDEWEB)
Bern, C. R.; Boehlke, A. R.; Engle, M. A.; Geboy, N. J.; Schroeder, K. T.; Zupancic, J. W.
2013-10-04
Disposal of produced waters, pumped to the surface as part of coalbed methane (CBM) development, is a significant environmental issue in the Wyoming portion of the Powder River Basin, USA. High sodium adsorption ratios (SAR) of the waters could degrade agricultural land, especially if directly applied to the soil surface. One method of disposing of CBM water, while deriving beneficial use, is subsurface drip irrigation (SDI), where acidified CBM waters are applied to alfalfa fields year-round via tubing buried 0.92 m deep. Effects of the method were studied on an alluvial terrace with a relatively shallow depth to water table (~3 m). Excess irrigation water caused the water table to rise, even temporarily reaching the depth of drip tubing. The rise corresponded to increased salinity in some monitoring wells. Three factors appeared to drive increased groundwater salinity: (1) CBM solutes, concentrated by evapotranspiration; (2) gypsum dissolution, apparently enhanced by cation exchange; and (3) dissolution of native Na–Mg–SO{sub 4} salts more soluble than gypsum. Irrigation with high SAR (24) water has increased soil saturated paste SAR up to 15 near the drip tubing. Importantly though, little change in SAR has occurred at the surface.
-
Bern, Carleton R.; Boehlke, Adam R.; Engle, Mark A.; Geboy, Nicholas J.; Schroeder, K.T.; Zupancic, J.W.
2013-01-01
Disposal of produced waters, pumped to the surface as part of coalbed methane (CBM) development, is a significant environmental issue in the Wyoming portion of the Powder River Basin, USA. High sodium adsorption ratios (SAR) of the waters could degrade agricultural land, especially if directly applied to the soil surface. One method of disposing of CBM water, while deriving beneficial use, is subsurface drip irrigation (SDI), where acidified CBM waters are applied to alfalfa fields year-round via tubing buried 0.92 m deep. Effects of the method were studied on an alluvial terrace with a relatively shallow depth to water table (∼3 m). Excess irrigation water caused the water table to rise, even temporarily reaching the depth of drip tubing. The rise corresponded to increased salinity in some monitoring wells. Three factors appeared to drive increased groundwater salinity: (1) CBM solutes, concentrated by evapotranspiration; (2) gypsum dissolution, apparently enhanced by cation exchange; and (3) dissolution of native Na–Mg–SO4 salts more soluble than gypsum. Irrigation with high SAR (∼24) water has increased soil saturated paste SAR up to 15 near the drip tubing. Importantly though, little change in SAR has occurred at the surface.
-
Barr, Miya N.; Davis, Jerri V.
2010-01-01
The U.S. Geological Survey, in cooperation with the Missouri Department of Natural Resources, collects data pertaining to the surface-water resources of Missouri. These data are collected as part of the Missouri Ambient Water-Quality Monitoring Network and constitute a valuable source of reliable, impartial, and timely information for developing an improved understanding of water resources in the State. Six sites from the Ambient Water-Quality Monitoring Network, with data available from the 1993 through 2008 water years, were chosen to compare water-quality conditions and long-term trends of dissolved oxygen, selected physical properties, total suspended solids, dissolved nitrate plus nitrite as nitrogen, total phosphorous, fecal indicator bacteria, and selected trace elements. The six sites used in the study were classified in groups corresponding to the physiography, main land use, and drainage basin size, and represent most stream types in Missouri. Long-term trends in this study were analyzed using flow-adjusted and non-flow adjusted models. Highly censored datasets (greater than 5 percent but less than 50 percent censored values) were not flow-adjusted. Trends that were detected can possibly be related to changes in agriculture or urban development within the drainage basins. Trends in nutrients were the most prevalent. Upward flow-adjusted trends in dissolved nitrate plus nitrite (as nitrogen) concentrations were identified at the Elk River site, and in total phosphorus concentrations at the South Fabius and Grand River sites. A downward flow-adjusted trend was identified in total phosphorus concentrations from Wilson Creek, the only urban site in the study. The downward trend in phosphorus possibly was related to a phosphorus reduction system that began operation in 2001 at a wastewater treatment plant upstream from the sampling site. Total suspended solids concentrations indicated an upward non-flow adjusted trend at the two northern sites (South Fabius
-
Smith, M. M.; Liaw, J.; Hira, A.; Guha, P.; Pal, S. S.; Hore, T.; Smith, A. H.
2010-12-01
Arsenic is a carcinogen, and causes many cancers and noncancer diseases. Recent findings have shown that exposure to arsenic in drinking water as a child or before birth can cause illness and death even as an adult. In the West Bengal region of India, more than six million people are drinking crystal clear but arsenic-contaminated water from tubewells. Project Well, a non-profit organization based in California, has provided safe drinking water to villages in West Bengal since 2001 through modern modified dugwells, currently numbering 163. Along the way, Project Well has faced the challenge of persuading people to stop consuming good-tasting, arsenic-laced water and instead drink chlorinated water, which is safe but may have the smell of chlorine. Additionally, West Bengal receives abundant annual rainfall, and hence it is difficult to convince people to pay for treated water. From its inception, the Project Well program was set up with a tracking system to assess the efficacy of the modern dugwells, which has helped identify where technical improvements were needed. Continuous interaction with community-based user groups has also helped overcome many constraints and make the program sustainable. Project Well monitoring records from August 2010 show that out of 163 modern dugwells, 48 percent were being used, providing water for 2948 villagers; 23 percent were closed; 6 percent were dry (11 districts of West Bengal were in a drought); 6 percent required maintenance; and 7 percent were not used. Arsenic concentrations in the modern dugwells were measured every year during peak season when the water table was low and the median arsenic concentration of operational dugwells over the eight years between 2002 and 2010 was 15 ppb (the permissible limit in India is 50 ppb). Each year, about 6 to 10 percent of the dugwells have arsenic levels above 50 ppb during the summer season, when the water level is low. Bacterial counts, i.e., total coliform and fecal coliform, are
-
Surface-atmospheric water cycle at Gale crater through multi-year MSL/REMS observations
Harri, A. M.; Genzer, M.; McConnochie, T. H.; Savijarvi, H. I.; Smith, M. D.; Martinez, G.; de la Torre Juarez, M.; Haberle, R. M.; Polkko, J.; Gomez-Elvira, J.; Renno, N. O.; Kemppinen, O.; Paton, M.; Richardson, M. I.; Newman, C. E.; Siili, T. T.; Mäkinen, T.
2017-12-01
The Mars Science laboratory (MSL) has been successfully operating for almost three Martian years. That includes an unprecedented long time series of atmospheric observations by the REMS instrument performing measurements of atmospheric pressure, relative humidity (REMS-H), temperature of the air, ground temperature, UV and wind speed and direction. The REMS-H relative humidity device is based on polymeric capacitive humidity sensors developed by Vaisala Inc. and it makes use of three (3) humidity sensor heads. The humidity device is mounted on the REMS boom providing ventilation with the ambient atmosphere through a filter protecting the device from airborne dust. The REMS-H humidity instrument has created an unprecedented data record of more than two full Martian. REMS-H measured the relative humidity and temperature at 1.6 m height for a period of 5 minutes every hour as part of the MSL/REMS instrument package. We focus on describing the annual in situ water cycle with the REMS-H instrument data for the period of almost three Martian years. The results will be constrained through comparison with independent indirect observations and through modeling efforts. We inferred the hourly atmospheric VMR from the REMS-H observations and compared these VMR measurements with predictions of VMR from our 1D column Martian atmospheric model and regolith to investigate the local water cycle, exchange processes and the local climate in Gale Crater. The strong diurnal variation suggests there are surface-atmosphere exchange processes at Gale Crater during all seasons, which depletes moisture to the ground in the evening and nighttime and release the moisture back to the atmosphere during the daytime. On the other hand, these processes do not seem to result in significant water deposition on the ground. Hence, our modelling results presumably indicate that adsorption processes take place during the nighttime and desorption during the daytime. Other processes, e.g. convective
-
T. Ufer; M. Posner; H.-P. Wessels; S. Wagner; K. Kaminski; T. Brand; Werres S.
2008-01-01
In a four year project, three different filtration systems were tested under commercial nursery conditions to eliminate Phytophthora spp. from irrigation water. Five nurseries were involved in the project. Slow sand filtration systems were tested in three nurseries. In the fourth nursery, a filtration system with lava grains (Shieer® Bio filtration)...
-
2014-08-01
38 15 Remotely sensed images acquired from Google Earth and ground-based images from 2011 of a non-perennial stream in Teton County, WY...less confined. Debris flows and landslides are common in the region, accounting for much, if not most, of the sediment flux from headwater streams in...information is becoming in- creasingly available and easy to analyze via free, open-access resources such as Google Earth (www.earth.google.com). Where
-
,
1982-01-01
Water-resources data for the 1981 water year for California consists of records of stage, discharge, and water quality of streams; stage and contents in lakes and reservoirs; and water levels and water quality in wells. Volume 1 contains discharge records for 169 gaging stations; stage and contents for 19 lakes and reservoirs; water quality for 42 streams and 21 wells; water levels for 169 observation wells. Also included are 10 crest-stage partial-record stations. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Directory of Open Access Journals (Sweden)
Renata Piwowarczyk
2012-12-01
Full Text Available The paper presents the current distribution of Orobanche picridis in Poland and Ukraine, within the Polish borders in the interwar period, based on a critical revision of herbarium and literature data as well as the results of my field studies. The largest number of its localities is in S and SE Poland in the Wyżyna Śląsko-Krakowska, Wyżyna Małopolska, Wyżyna Lubelska uplands, Middle Roztocze, Small Polesie, the Pogórze Przemyskie foreland and in the former Tarnopol province (W Ukraine. These are the north-easternmost sites known for the species and extend its limit range. A map of its distribution in Poland and Ukraine is included. The taxonomy, biology, and ecology of O. picridis are also discussed.
-
Aziz, Edriyana A.; Malek, Marlinda Abdul; Moni, Syazwan N.; Hadi, Iqmal H.; Zulkifli, Nabil F.
2018-03-01
In this study, the assessment by using Water Footprint (WF) approach was conducted to assess water consumption within the water supply treatment process (WSTP) services of Semambu Water Treatment Plant (WTP). Identification of the type of WF at each stage of WSTP was carried out and later the WF accounting for the period 2010 – 2016 was calculated. Several factors that might influence the accounting such as population, and land use. The increasing value of total WF per year was due to the increasing water demand from population and land use activities. However, the pattern of rainfall intensity from the monsoonal changes was not majorly affected the total amount of WF per year. As a conclusion, if the value of WF per year keeps increasing due to unregulated development in addition to the occurrences of climate changing, the intake river water will be insufficient and may lead to water scarcity. The findings in this study suggest actions to reduce the WF will likely have a great impact on freshwater resources availability and sustainability.
-
International Nuclear Information System (INIS)
1993-01-01
Water resources data for the 1992 for northeast Florida include continuous or daily discharge for 140 streams, periodic discharge for 10 streams, miscellaneous discharge for 14 streams, continuous or daily stage for 32 streams, continuous or daily tide stage for 3 sites, periodic stage for 23 streams, peak discharge for 3 streams, and peak stage for 11 streams; continuous or daily elevations for 36 lakes, periodic elevations for 47 lakes; continuous ground-water levels for 75 wells, periodic ground-water levels for 123 wells, and miscellaneous water-level measurements for 864 wells; and quality-of-water data for 38 surface-water sites and 66 wells
-
Glazer, Richard B.; And Others
This learner's guide is designed to meet the training needs for technicians involved in monitoring activities related to the Federal Water Pollution Act and the Safe Drinking Water Act. In addition it will assist technicians in learning how to perform process control laboratory procedures for drinking water and wastewater treatment plant…
-
Charles River Water Quality Improvements Earns an A- for the Second Time in the Past Five Years
EPA has given the Charles River a grade of A- for bacterial water quality in the river during 2017. This is only the second time the river has earned a grade as high as an A-minus, and both have occurred within the past five years.
-
Vieux, Florent; Maillot, Matthieu; Constant, Florence; Drewnowski, Adam
2016-09-01
To examine the consumption of plain water among children in France and compare total water intakes with guidelines issued by the European Food Safety Authority (EFSA). Nationally representative data were used to assess food, beverage and water consumption by sex, age group (4-8 years, 9-13 years), income-to-poverty ratio, eating occasion and location. Beverages were classified into nine groups: water (tap or bottled), milk, 100 % fruit juice, sodas, fruit drinks, hot beverages, sports drinks and flavoured waters. Total water volume in relation to energy intake (litres/kcal) was also examined. INCA 2 study (Étude Individuelle Nationale des Consommations Alimentaires 2006-2007). French children (n 835) aged 4-13 years. Total water intakes were accounted for by plain water (34 %), beverages (26 %) and food moisture (40 %). Plain water could be tap (18 %) or bottled (16 %). Older children drank more plain water than did younger children and boys drank more plain water than did girls. No socio-economic gradient for plain water consumption was observed. About 90 % of children did not meet the EFSA water intake recommendations. The daily water shortfall ranged from 367 to 594 ml/d. Water-to-energy ratio was 0·75-0·77 litres/1000 kcal (4184 kJ). Children drank milk at breakfast and plain water during lunch and dinner. Caloric beverages provided 10 % of dietary energy; consumption patterns varied by eating location. Total water intakes among young children in France were below EFSA-recommended levels. Analyses of beverage consumption patterns by eating occasion and location can help identify ways to increase water consumption among children.
-
,
1981-01-01
Volume 1 of water resources data for the 1980 water year for California consists of records of stage, discharge, and water quality of streams; stage and contents in lake and reservoirs; and water levels in wells. This report contains discharge records for 174 gaging stations; stage and contents for 18 lakes and reservoirs; water quality for 51 stations; water levels for 165 observation wells. Also included are 9 crest-stage partial-record stations. These data represent that part of the National Water Data System operated by the U.S. Geological Survey and cooperating State and Federal agencies in California.
-
Singlet-oxygen therapy. Scientific and methodological materials
Chukhraiev, N.; Chukhraieva, E.; Gun'ko, M.; Kurik, L.; Lomeiko, S.; Marushko, Y.; Samosyuk, N.; Tkalina, A.; Vladimirov, A.; Unichenko, A.; Zavorotnaya, R.; Zukow, W.
2018-01-01
Radomska Szkoła Wyższa w Radomiu MEDICAL INNOVATIVE TECHNOLOGIES SINGLET-OXYGEN THERAPY Scientific and methodological materials 2018 This edition had extended and translated from ukrainian Edited by Chukhraiev N., Vladimirov A., Zukow W. Radom, Kyiv Radomska Szkoła Wyższa w Radomiu MEDICAL INNOVATIVE TECHNOLOGIES SINGLET-OXYGEN THERAPY Scientific and methodological materials 2018 This edition had extended and translated from ukrainian Edited by ...
-
Uetera, Yushi; Kishii, Kozue; Yasuhara, Hiroshi; Kumada, Naohito; Moriya, Kyoji; Saito, Ryoichi; Okazaki, Mitsuhiro; Misawa, Yoshiki; Kawamura, Kunio
2013-01-01
This report deals with the construction and management of the reverse osmosis (RO) water system for final rinsing of surgical instruments in the washer-disinfector. Numerous operational challenges were encountered in our RO water system and these were analyzed utilizing the Ishikawa Fishbone diagram. The aim was to find potential problems and promote preventive system management for RO water. It was found that the measures that existed were inappropriate for preventing contamination in the heat-labile RO water system. The storage tank was found to be significantly contaminated and had to be replaced with a new one equipped with a sampling port and water drainage system. Additional filters and an UV treatment lamp were installed. The whole system disinfection started 1.5 years later using a peracetic acid-based compound after confirming the material compatibility. Operator errors were found when a new water engineer took over the duty from his predecessor. It was also found that there were some deficiencies in the standard operating procedures (SOPs), and that on-the-job training was not enough. The water engineer failed to disinfect the sampling port and water drainage system. The RO membrane had been used for 4 years, even though the SOP standard specified changing it as every 3 years. Various bacteria, such as Rothia mucilaginosa, were cultured from the RO water sampled from the equipment. Because Rothia mucilaginosa is a resident in the oral cavity and upper respiratory tract, it is believed that the bacteria were introduced into the system by the maintenance personnel or working environment. Therefore, the presence of R. mucilaginosa implied the failure of sanitary maintenance procedures. This study suggests that water systems should be designed based on the plans for profound system maintenance. It also suggests that SOP and on-the job training are essential to avoid any operator errors. These results must be carefully considered when either constructing new
-
Directory of Open Access Journals (Sweden)
Meryem Beklioğlu
2017-02-01
Full Text Available Eutrophication continues to be the most important problem preventing a favorable environmental state and detrimentally impacting the ecosystem services of lakes. The current study describes the results of analyses of 20 year monitoring data from two interconnected Anatolian lakes, Lakes Mogan and Eymir, receiving sewage effluents and undergoing restoration. The first step of restoration in both lakes was sewage effluent diversion. Additionally, in hypertrophic Lake Eymir, biomanipulation was conducted, involving removal of benthi-planktivorous fish and prohibition of pike fishing. The monitoring period included high (H and low (L water levels (WL enabling elucidation of the effects of hydrological changes on lake restoration. In shallower Lake Mogan, macrophyte abundance increased after the sewage effluent diversion in periods with low water levels even at turbid water. In comparatively deeper Lake Eymir, the first biomanipulation led to a clear water state with abundant macrophyte coverage. However, shortly after biomanipulation, the water clarity declined, coinciding with low water level (LWL periods during which nutrient concentrations increased. A second biomanipulation was conducted, mostly during high water level (HWL period, resulting in a major decrease in nutrient concentrations and clearer water, but without an expansion of macrophytes. We conclude that repetitive fish removal may induce recovery but its success may be confounded by high availability of nutrients and adverse hydrological conditions.
-
Energy Technology Data Exchange (ETDEWEB)
Walt, Mike van der; Wessels, A.
2001-07-01
Natural resources are protected and saved with the new spiral reverse osmosis (SRO) plant at the Eskom Tutuka power station in the Mpumalanga province of South Africa. 7,000 m{sup 3}/day of saline underground mine water blended with 5,400 m{sup 3}/day of cooling water blowdown is pretreated and desalinated before the product water is returned to the cooling water circuit. Weir Envig designed, constructed, installed and commissioned the plant in phases between August 1998 and April 1999 with innovative use of existing infrastructure and phased removal of the live, ageing electrodialysis reversal plant. The plant performance during two years of operation is presented, which demonstrates that good pretreatment and cleaning system design allows SRO to produce consistent high-quality water from this difficult and varying feed. The result is a coal mine with no effluent problems, a new source of water for the power station and a treatment plant, which produces significantly better condenser cooling water and maintain zero liquid discharge. (orig.)
-
Lodmell, Donald L; Esposito, Joseph J; Ewalt, Larry C
2004-09-03
Presently, commercially available cell culture rabies vaccines for humans and animals consist of the five inactivated rabies virus proteins. The vaccines elicit a CD4+ helper T-cell response and a humoral B-cell response against the viral glycoprotein (G) resulting in the production of virus neutralizing antibody. Antibody against the viral nucleoprotein (N) is also present, but the mechanism(s) of its protection is unclear. HIV-infected individuals with low CD4+ T-lymphocyte counts and individuals undergoing treatment with immunosuppressive drugs have an impaired neutralizing antibody response after pre- and post-exposure immunization with rabies cell culture vaccines. Here we show the efficacy of live vaccinia-rabies virus recombinants, but not a cell culture vaccine consisting of inactivated rabies virus, to elicit elevated levels of neutralizing antibody in B-lymphocyte deficient A/WySnJ mice. The cell culture vaccine also failed to protect the mice, whereas a single immunization of a vaccinia recombinant expressing the rabies virus G or co-expressing G and N equally protected the mice up to 18 months after vaccination. The data suggest that recombinant poxviruses expressing the rabies virus G, in particular replication defective poxviruses such as canarypox or MVA vaccinia virus that undergo abortive replication in non-avian cells, or the attenuated vaccinia virus NYVAC, should be evaluated as rabies vaccines in immunocompromised individuals.
-
Shin, Mi Hee; Lee, Se-Rah; Kim, Min-Kyoung; Shin, Chang-Yup; Lee, Dong Hun; Chung, Jin Ho
2016-01-01
Peroxisome proliferator-activated receptor alpha (PPARα) is a nuclear hormone receptor involved in the transcriptional regulation of lipid metabolism, fatty acid oxidation, and glucose homeostasis. Its activation stimulates antioxidant enzymes such as catalase, whose expression is decreased in aged human skin. Here we investigated the expression of PPARα in aged and ultraviolet (UV)-irradiated skin, and whether PPARα activation can modulate expressions of matrix metalloproteinase (MMP)-1 and procollagen through catalase regulation. We found that PPARα mRNA level was significantly decreased in intrinsically aged and photoaged human skin as well as in UV-irradiated skin. A PPARα activator, Wy14643, inhibited UV-induced increase of MMP-1 and decrease of procollagen expression and caused marked increase in catalase expression. Furthermore, production of reactive oxygen species (ROS) was suppressed by Wy14643 in UV-irradiated and aged dermal fibroblasts, suggesting that the PPARα activation-induced upregulation of catalase leads to scavenging of ROS produced due to UV irradiation or aging. PPARα knockdown decreased catalase expression and abolished the beneficial effects of Wy14643. Topical application of Wy14643 on hairless mice restored catalase activity and prevented MMP-13 and inflammatory responses in skin. Our findings indicate that PPARα activation triggers catalase expression and ROS scavenging, thereby protecting skin from UV-induced damage and intrinsic aging.
-
Directory of Open Access Journals (Sweden)
Hung-Ju Shih
2018-02-01
Full Text Available A 12-year sea-state hindcast for Taiwanese waters, covering the period from 2005 to 2016, was conducted using a fully coupled tide-surge-wave model. The hindcasts of significant wave height and peak period were employed to estimate the wave power resources in the waters surrounding Taiwan. Numerical simulations based on unstructured grids were converted to structured grids with a resolution of 25 × 25 km. The spatial distribution maps of offshore annual mean wave power were created for each year and for the 12-year period. Waters with higher wave power density were observed off the northern, northeastern, southeastern (south of Green Island and southeast of Lanyu and southern coasts of Taiwan. Five energetic sea areas with spatial average annual total wave energy density of 60–90 MWh/m were selected for further analysis. The 25 × 25 km square grids were then downscaled to resolutions of 5 × 5 km, and five 5 × 5 km optimal areas were identified for wave energy converter deployments. The spatial average annual total wave energy yields at the five optimal areas (S1–(S5 were estimated to be 64.3, 84.1, 84.5, 111.0 and 99.3 MWh/m, respectively. The prevailing wave directions for these five areas lie between east and northeast.
-
Biswas, Anirban; Deb, Debasree; Ghose, Aloke; Du Laing, Gijs; De Neve, Jan; Santra, Subhas Chandra; Guha Mazumder, Debendra Nath
2014-01-01
We assessed the association between arsenic intake through water and diet, and arsenic levels in first morning-void urine under variable conditions of water contamination. This was done in a 2-year consecutive study in an endemic population. Exposure of arsenic through water and diet was assessed for participants using arsenic-contaminated water (≥50 μg L(-1)) in a first year (group I) and for participants using water lower in arsenic (water in groups I and II males was 7.44 and 0.85 μg kg body wt.(-1) day(-1) (p water were reduced to below 50 μg L(-1) (Indian permissible limit), total arsenic intake and arsenic intake through the water significantly decreased, but arsenic uptake through the diet was found to be not significantly affected. Moreover, it was found that drinking water mainly contributed to variations in urine arsenic concentrations. However, differences between male and female participants also indicate that not only arsenic uptake, but also many physiological factors affect arsenic behavior in the body and its excretion. As total median arsenic exposure still often exceeded 3.0 μg kg body wt.(-1) day(-1) (the permissible lower limit established by the Joint Expert Committee on Food Additives) after installation of the drinking water filters, it can be concluded that supplying the filtered water only may not be sufficient to minimize arsenic availability for an already endemic population.
-
Energy Technology Data Exchange (ETDEWEB)
Toichuev, R. M. [Institute of Medical Problems of the Southern Branch, Osh(Kyrgyzstan)
2012-09-15
Full text:Objective: to assess the effect of radionuclide pollution of river water on the isolation rate of S. Tuphi at different times of the year. Materials and methods: Since the number of typhoid fever cases reported in the Mayluusuu Valley (23 tailing pits and 16 tailing dumps are located in the area) tends to increase after the mudslides we collected river water specimens considering all these factors. Water specimens were collected from the Mayluusuu River, Shaidan-sai River, Kara-Unkur River and Ak-Buura River. Bacterial inoculation was performed in accordance with standard procedures. Concentration levels of pesticides (DDT, DDE, DDD, GCCG {alpha}, {beta}, {gamma} Aldrin and Dieldrin) were measured with a spectrograph. The present work was done in the framework of the ISTC Project KR-1516. Results and discussion: Out of the total of 2360 water specimens collected from the Shaidan-Sai River, S. Typhi was isolated from one (0.04%) water specimen. No cases of S. Typhi isolation from the water specimens collected from the Kara-Unkur River were reported for the past 10 years. Out of the total of 8969 water specimens collected from the Ak-Buura River, isolation of S. Typhi was reported in 4 (0.044%) cases. Starting from 2006 typhoid fever cases have been reported in the winter and spring times among the residents of the Mayluusuu Valley. A total of 1200 patients with a presumptive diagnosis of typhoid fever were admitted to the hospitals during the period. S. Typhi was isolated from 2 out of the total of 51 (3.9%) water specimens collected from the Mayluusuu River in the winter time, 4 (2.4%) out of the total 164 - in the spring time, 3.4% and 4.5% in the summer and autumn, respectively. Concentration levels of thorium (Th) and uranium (U) were 0.025-0.045 mg/l and 0.35-15.0 mg/l. No traces of the pesticides were found in water specimens. DDE at concentration of 0.024 mg/l and GCCG {alpha} (0.06 mg/l) were found in silt specimens collected downstream the Ak
-
Iaconelli, M; Muscillo, M; Della Libera, S; Fratini, M; Meucci, L; De Ceglia, M; Giacosa, D; La Rosa, G
2017-03-01
Human enteric viruses are a major cause of waterborne diseases, and can be transmitted by contaminated water of all kinds, including drinking and recreational water. The objectives of the present study were to assess the occurrence of enteric viruses (enterovirus, norovirus, adenovirus, hepatitis A and E virus) in raw and treated wastewaters, in rivers receiving wastewater discharges, and in drinking waters. Wastewater treatment plants' (WWTP) pathogen removal efficiencies by adenovirus quantitative real-time PCR and the presence of infectious enterovirus, by cell culture assays, in treated wastewaters and in surface waters were also evaluated. A total of 90 water samples were collected: raw and treated wastewaters (treated effluents and ultrafiltered water reused for industrial purposes), water from two rivers receiving treated discharges, and drinking water. Nested PCR assays were used for the identification of viral DNA/RNA, followed by direct amplicon sequencing. All raw sewage samples (21/21), 61.9 % of treated wastewater samples (13/21), and 25 % of ultrafiltered water samples (3/12) were contaminated with at least one viral family. Multiple virus families and genera were frequently detected. Mean positive PCRs per sample decreased significantly from raw to treated sewage and to ultrafiltered waters. Moreover, quantitative adenovirus data showed a reduction in excess of 99 % in viral genome copies following wastewater treatment. In surface waters, 78.6 % (22/28) of samples tested positive for one or more viruses by molecular methods, but enterovirus-specific infectivity assays did not reveal infectious particles in these samples. All drinking water samples tested negative for all viruses, demonstrating the effectiveness of treatment in removing viral pathogens from drinking water. Integrated strategies to manage water from all sources are crucial to ensure water quality.
-
,
1978-01-01
Water-resources data for the 1977 water year for California consist of records of stage, discharge, and water quality of streams; stage, contents, and water quality of lakes and reservoirs; records of water levels in selected observation wells; and selected chemical analyses of ground water. Records for a few pertinent streamflow and water-quality stations in bordering States are also included. The records were collected and computed by the Water Resources Division of the U.S. Geological Survey under the direction of Winchell Smith, Assistant District Chief for Hydrologic Data and Leonard N. Jorgensen, Chief of the Basic-Data Section. These data, a contribution to the National Water Data System, were collected by the Geological Survey and cooperating local, State, and Federal agencies in California.
-
Chemotherapy of Cutaneous Leishmaniasis
2012-10-01
WY, Milhous WK, Ohrt C, Spaventi R. Antimalarial Activity of 9a-N Substituted 15-Membered Azalides with Improved in Vitro and in Vivo Activity over... Activity Relationships of Peroxide- Based Artemisinin Antimalarials . In: Biologically Active Natural Products: Pharmaceuticals, Cutler, S.J., Cutler...Landek G, Jelić D, Hutinec A, Mesić M, Ager A, Ellis WY, Milhous WK, Ohrt C, Spaventi R. Antimalarial Activity of 9a-N Substituted 15-Membered Azalides
-
Optimal Allocation of Water Resources Based on Water Supply Security
Directory of Open Access Journals (Sweden)
Jianhua Wang
2016-06-01
Full Text Available Under the combined impacts of climate change and human activities, a series of water issues, such as water shortages, have arisen all over the world. According to current studies in Science and Nature, water security has become a frontier critical topic. Water supply security (WSS, which is the state of water resources and their capacity and their capacity to meet the demand of water users by water supply systems, is an important part of water security. Currently, WSS is affected by the amount of water resources, water supply projects, water quality and water management. Water shortages have also led to water supply insecurity. WSS is now evaluated based on the balance of the supply and demand under a single water resources condition without considering the dynamics of the varying conditions of water resources each year. This paper developed an optimal allocation model for water resources that can realize the optimal allocation of regional water resources and comprehensively evaluate WSS. The objective of this model is to minimize the duration of water shortages in the long term, as characterized by the Water Supply Security Index (WSSI, which is the assessment value of WSS, a larger WSSI value indicates better results. In addition, the simulation results of the model can determine the change process and dynamic evolution of the WSS. Quanzhou, a city in China with serious water shortage problems, was selected as a case study. The allocation results of the current year and target year of planning demonstrated that the level of regional comprehensive WSS was significantly influenced by the capacity of water supply projects and the conditions of the natural water resources. The varying conditions of the water resources allocation results in the same year demonstrated that the allocation results and WSSI were significantly affected by reductions in precipitation, decreases in the water yield coefficient, and changes in the underlying surface.
-
Manier, Daniel J.; Rover, Jennifer R.
2018-02-15
To improve understanding of the distribution of ecologically important, ephemeral wetland habitats across the Great Plains, the occurrence and distribution of surface water in playa wetland complexes were documented for four different years across the Great Plains Landscape Conservation Cooperative (GPLCC) region. This information is important because it informs land and wildlife managers about the timing and location of habitat availability. Data with an accurate timestamp that indicate the presence of water, the percent of the area inundated with water, and the spatial distribution of playa wetlands with water are needed for a host of resource inventory, monitoring, and research applications. For example, the distribution of inundated wetlands forms the spatial pattern of available habitat for resident shorebirds and water birds, stop-over habitats for migratory birds, connectivity and clustering of wetland habitats, and surface waters that recharge the Ogallala aquifer; there is considerable variability in the distribution of playa wetlands holding water through time. Documentation of these spatially and temporally intricate processes, here, provides data required to assess connections between inundation and multiple environmental drivers, such as climate, land use, soil, and topography. Climate drivers are understood to interact with land cover, land use and soil attributes in determining the amount of water that flows overland into playa wetlands. Results indicated significant spatial variability represented by differences in the percent of playas inundated among States within the GPLCC. Further, analysis-of-variance comparison of differences in inundation between years showed significant differences in all cases. Although some connections with seasonal moisture patterns may be observed, the complex spatial-temporal gradients of precipitation, temperature, soils, and land use need to be combined as covariates in multivariate models to effectively account for
-
Totaro, Michele; Valentini, Paola; Costa, Anna Laura; Frendo, Lorenzo; Cappello, Alessia; Casini, Beatrice; Miccoli, Mario; Privitera, Gaetano; Baggiani, Angelo
2017-10-26
Although the European reports highlight an increase in community-acquired Legionnaires' disease cases, the risk of Legionella spp. in private houses is underestimated. In Pisa (Italy) we performed a three-year survey on Legionella presence in 121 buildings with an independent hot water production (IB); 64 buildings with a central hot water production (CB); and 35 buildings with a solar thermal system for hot water production (TB). From all the 220 buildings Legionella spp. was researched in two hot water samples collected either at the recirculation point or on the first floor and on the last floor, while the potable water quality was analysed in three cold water samples collected at the inlet from the aqueduct network, at the exit from the autoclave, and at the most remote tap. Legionella pneumophila sg1, Legionella pneumophila sg2-16, and non- pneumophila Legionella species were detected in 26% of the hot water networks, mostly in CB and TB. In these buildings we detected correlations between the presence of Legionella and the total chlorine concentration decrease and/or the increase of the temperature. Cold water resulted free from microbiological hazards, with the exception of Serratia liquefaciens and Enterobacter cloacae isolated at the exit from two different autoclaves. We observed an increase in total microbial counts at 22 °C and 37 °C between the samples collected at the most remote taps compared to the ones collected at the inlet from the aqueduct. The study highlights a condition of potential risk for susceptible categories of population and supports the need for measures of risk assessment and control.
-
Hosein, I K; Hill, D W; Tan, T Y; Butchart, E G; Wilson, K; Finlay, G; Burge, S; Ribeiro, C D
2005-10-01
This study reports a two-year programme of attempted eradication of Legionella colonization in the potable water supply of a 1000-bed tertiary care teaching hospital in Wales. There was a simultaneous, point-of-care, sterile-water-only policy for all intensive care units (ICU) and bone marrow and renal transplant units in order to prevent acquisition of nosocomial Legionnaires' disease. The programme was initiated following a case of nosocomial pneumonia caused by Legionella pneumophila serogroup 1-Bellingham-like genotype A on the cardiac ICU. The case occurred 14 days after mitral and aortic valve replacement surgery. Clinical and epidemiological investigations implicated aspiration of hospital potable water as the mechanism of infection. Despite interventions with chlorine dioxide costing over 25000 UK pounds per annum, Legionella has remained persistently present in significant numbers (up to 20000 colony forming units/L) and with little reduction in the number of positive sites. Two further cases of nosocomial disease occurred over the following two-year period; in one case, aspiration of tap water was implicated again, and in the other case, instillation of contaminated water into the right main bronchus via a misplaced nasogastric tube was implicated. These cases arose because of inadvertent non-compliance with the sterile-water-only policy in high-risk locations. Enhanced clinical surveillance over the same two-year period detected no other cases of nosocomial disease. This study suggests that attempts at eradication of Legionella spp. from complex water systems may not be a cost-effective measure for prevention of nosocomial infections, and to the best of our knowledge is the first study from the UK to suggest that the introduction of a sterile-water-only policy for ICUs and other high-risk units may be a more cost-effective approach.
-
Davies, Kirsten; Doolan, Corinna; van den Honert, Robin; Shi, Rose
2014-09-01
In 2009-2010 Sydney Water, the primary water utility in Sydney, conducted a comprehensive Smart Metering trial in residential homes in the suburb of Westleigh, in Sydney's north. The trial involved 1923 participants residing in 630 households. A whole-of-community method of engagement was applied to capture the views of residents from 12 to 70+ years of age. The trial examined the effects of the technology on the water consumption of an intervention group compared with that of a matched control group. After removing properties that had been sold since the beginning of the trial, properties in the study group were matched with a control group property on the basis of the household size, property size and the presence (or otherwise) of a swimming pool. The effects of the technology on consumption were measured and analyzed for the period July 2009 to June 2010, coupled with qualitative information that was collected throughout the duration of the study. A key finding was that households with the in-home display (IHD) installed, reduced their consumption by an average of over 6.8% over the study period when compared to the control group. Since completion of the study the community has not had any further interventions. The trial created an opportunity to examine the longer-term effects of the technology (June 2008 to September 2013). Consumption data collected over the 3 year posttrial period revealed that the participant group consumed 6.4% per month less water when compared to the pretrial period, whilst the matched control group consumed 1.3% per month more water when compared to the pretrial period. The reduced consumption of the participant group was maintained over time, demonstrating the long-term value of this technology.
-
Inkinen, Jenni; Kaunisto, Tuija; Pursiainen, Anna; Miettinen, Ilkka T; Kusnetsov, Jaana; Riihinen, Kalle; Keinänen-Toivola, Minna M
2014-02-01
Complex interactions existing between water distribution systems' materials and water can cause a reduction in water quality and unwanted changes in materials, aging or corrosion of materials and formation of biofilms on surfaces. Substances leaching from pipe materials and water fittings, as well as the microbiological quality of water and formation of biofilms were evaluated by applying a Living Lab theme i.e. a research in a real life setting using a full scale system during its first year of operation. The study site was a real office building with one part of the building lined with copper pipes, the other with cross-linked polyethylene (PEX) pipes thus enabling material comparison; also differences within the cold and hot water systems were analysed. It was found that operational conditions, such as flow conditions and temperature affected the amounts of metals leaching from the pipe network. In particular, brass components were considered to be a source of leaching; e. g. the lead concentration was highest during the first few weeks after the commissioning of the pipe network when the water was allowed to stagnate. Assimilable organic carbon (AOC) and microbially available phosphorus (MAP) were found to leach from PEX pipelines with minor effects on biomass of the biofilm. Cultivable and viable biomass (heterotrophic plate count (HPC), and adenosine triphosphate (ATP)) levels in biofilms were higher in the cold than in the hot water system whereas total microbial biomass (total cell count (DAPI)) was similar with both systems. The type of pipeline material was not found to greatly affect the microbial biomass or Alpha-, Beta- and Gammaproteobacteria profiles (16s rRNA gene copies) after the first one year of operation. Also microbiological quality of water was found to deteriorate due to stagnation. Copyright © 2013 Elsevier Ltd. All rights reserved.
-
Some Interesting Facts about Water and Water Conservation
Narayanan, M.
2015-12-01
The total amount of water in the world today is still the same as it was hundreds of thousands of years ago. Almost 97% of the water that is on this earth is undrinkable. About two percent of world's water is locked in polar ice caps and glaciers. Only one percent of world's water is available for human consumption. Agriculture, livestock farming, irrigation, manufacturing, factories, businesses, commercial establishments, offices, communities and household all have to share this 1% of water that is available. Although we call it drinking water, humans actually drink only about 1% of water that is actually supplied to the household by the utility companies. Inside a leak-proof average American household, about 70% of the water is used in the bathroom and about 20% is utilized in kitchen and laundry. The U.S. daily average consumption of water is about 200 gallons per person. Desalinated water may typically cost about 2,000 - 3000 an acre foot. This is approximately a penny a gallon. An acre-foot or 325,851 gallons is roughly the amount of water a family of five uses in a year. 1.2 trillion gallons of industrial waste, untreated sewage and storm water are dumped into U.S. waters each year. Faster depletion of water supplies is partly due to hotter summers, which mean thirstier people, livestock, plants, trees and shrubs. In addition, hotter summers mean more evaporation from lakes, rivers, reservoirs and irrigated farmland. The median household in the U.S. spends about one of its income on water and sewerage. The human body is about 75% water. Although government agencies have taken necessary steps, water pollution levels continue to rise rapidly. It is becoming more and more difficult to clean up polluted water bodies. Water conservation and preventing water pollution is the responsibility of very human being. References: http://www.nrdc.org/water/http://www.epa.gov/greeningepa/water/http://www.waterboards.ca.gov/water_issues/programs/conservation_portal/
-
,
1977-01-01
Water-resources data for the 1976 water year for California consist of records of stage, discharge, and water quality of streams; stage, contents, and water quality of lakes and reservoirs; records of water levels in selected observation wells; and selected chemical analyses of ground water. Records for a few pertinent streamflow and water-quality stations in bordering States are also included. The records were collected and computed by the Water Resources Division of the U.S. Geological Survey under the direction of Lee R. Peterson, district chief; Winchell Smith, assistant district chief for hydrologic data; and Leonard N. Jorgensen, chief of the basic-data section. These data, a contribution to the National Water Data System, were collected by the Geological Survey and cooperating local, State, and Federal agencies in California.
-
Clean Water Act 303(d) Listed Impaired Waters and their Causes of Impairment from All Years
U.S. Environmental Protection Agency — Waters identified as impaired as well as their associated causes of impairment from all approved Clean Water Act 303(d) lists submitted by the states. Includes all...
-
International Nuclear Information System (INIS)
Madureira, Tânia Vieira; Pinheiro, Ivone; Malhão, Fernanda; Lopes, Célia; Urbatzka, Ralph; Castro, L. Filipe C.
2017-01-01
Highlights: • Brown trout hepatocytes seem to be a low responder to model peroxisome proliferators. • Most peroxisomal targets were not affected by Wy-14,643 and clofibrate exposures. • Some estrogenic-related genes were up-regulated after 150 μM of Wy-14,643. • Wy-14,643 increase VtgA and ERα mRNA levels, while ICI 182,780 revert the effect. • Cross-interference in peroxisomal and estrogenic pathways should be more explored. - Abstract: Peroxisome proliferators cause species-specific effects, which seem to be primarily transduced by peroxisome proliferator-activated receptor alpha (PPARα). Interestingly, PPARα has a close interrelationship with estrogenic signaling, and this latter has already been promptly activated in brown trout primary hepatocytes. Thus, and further exploring this model, we assess here the reactivity of two PPARα agonists in direct peroxisomal routes and, in parallel the cross-interferences in estrogen receptor (ER) mediated paths. To achieve these goals, three independent in vitro studies were performed using single exposures to clofibrate – CLF (50, 500 and 1000 μM), Wy-14,643 – Wy (50 and 150 μM), GW6471 – GW (1 and 10 μM), and mixtures, including PPARα agonist or antagonist plus an ER agonist or antagonist. Endpoints included gene expression analysis of peroxisome/lipidic related genes (encoding apolipoprotein AI – ApoAI, fatty acid binding protein 1 – Fabp1, catalase – Cat, 17 beta-hydroxysteroid dehydrogenase 4 – 17β-HSD4, peroxin 11 alpha – Pex11α, PPARαBb, PPARαBa and urate oxidase – Uox) and those encoding estrogenic targets (ERα, ERβ-1 and vitellogenin A – VtgA). A quantitative morphological approach by using a pre-validated catalase immunofluorescence technique allowed checking possible changes in peroxisomes. Our results show a low responsiveness of trout hepatocytes to model PPARα agonists in direct target receptor pathways. Additionally, we unveiled interferences in estrogenic
-
Energy Technology Data Exchange (ETDEWEB)
Madureira, Tânia Vieira, E-mail: tvmadureira@icbas.up.pt [Interdisciplinary Centre of Marine and Environmental Research (CIIMAR/CIMAR), University of Porto (U. Porto), Terminal de Cruzeiros do Porto de Leixões, Av. General Norton de Matos s/n, 4450-208 Matosinhos (Portugal); Institute of Biomedical Sciences Abel Salazar (ICBAS), University of Porto (U. Porto), Laboratory of Histology and Embryology, Department of Microscopy, Rua Jorge Viterbo Ferreira 228, P 4050-313 Porto (Portugal); Pinheiro, Ivone; Malhão, Fernanda; Lopes, Célia [Interdisciplinary Centre of Marine and Environmental Research (CIIMAR/CIMAR), University of Porto (U. Porto), Terminal de Cruzeiros do Porto de Leixões, Av. General Norton de Matos s/n, 4450-208 Matosinhos (Portugal); Institute of Biomedical Sciences Abel Salazar (ICBAS), University of Porto (U. Porto), Laboratory of Histology and Embryology, Department of Microscopy, Rua Jorge Viterbo Ferreira 228, P 4050-313 Porto (Portugal); Urbatzka, Ralph [Interdisciplinary Centre of Marine and Environmental Research (CIIMAR/CIMAR), University of Porto (U. Porto), Terminal de Cruzeiros do Porto de Leixões, Av. General Norton de Matos s/n, 4450-208 Matosinhos (Portugal); Castro, L. Filipe C. [Interdisciplinary Centre of Marine and Environmental Research (CIIMAR/CIMAR), University of Porto (U. Porto), Terminal de Cruzeiros do Porto de Leixões, Av. General Norton de Matos s/n, 4450-208 Matosinhos (Portugal); Faculty of Sciences (FCUP), University of Porto (U. Porto), Department of Biology, Rua do Campo Alegre, P 4169-007 Porto (Portugal); and others
2017-06-15
Highlights: • Brown trout hepatocytes seem to be a low responder to model peroxisome proliferators. • Most peroxisomal targets were not affected by Wy-14,643 and clofibrate exposures. • Some estrogenic-related genes were up-regulated after 150 μM of Wy-14,643. • Wy-14,643 increase VtgA and ERα mRNA levels, while ICI 182,780 revert the effect. • Cross-interference in peroxisomal and estrogenic pathways should be more explored. - Abstract: Peroxisome proliferators cause species-specific effects, which seem to be primarily transduced by peroxisome proliferator-activated receptor alpha (PPARα). Interestingly, PPARα has a close interrelationship with estrogenic signaling, and this latter has already been promptly activated in brown trout primary hepatocytes. Thus, and further exploring this model, we assess here the reactivity of two PPARα agonists in direct peroxisomal routes and, in parallel the cross-interferences in estrogen receptor (ER) mediated paths. To achieve these goals, three independent in vitro studies were performed using single exposures to clofibrate – CLF (50, 500 and 1000 μM), Wy-14,643 – Wy (50 and 150 μM), GW6471 – GW (1 and 10 μM), and mixtures, including PPARα agonist or antagonist plus an ER agonist or antagonist. Endpoints included gene expression analysis of peroxisome/lipidic related genes (encoding apolipoprotein AI – ApoAI, fatty acid binding protein 1 – Fabp1, catalase – Cat, 17 beta-hydroxysteroid dehydrogenase 4 – 17β-HSD4, peroxin 11 alpha – Pex11α, PPARαBb, PPARαBa and urate oxidase – Uox) and those encoding estrogenic targets (ERα, ERβ-1 and vitellogenin A – VtgA). A quantitative morphological approach by using a pre-validated catalase immunofluorescence technique allowed checking possible changes in peroxisomes. Our results show a low responsiveness of trout hepatocytes to model PPARα agonists in direct target receptor pathways. Additionally, we unveiled interferences in estrogenic
-
Vivar, M; Pichel, N; Fuentes, M; Martínez, F
2016-04-15
Drinking water access in the Saharawi refugee camps located in the Algerian desert is a challenge that is still an on-going problem after 40years of conflict. This work presents an analysis of the situation with emphasis on the water supply in health institutions (quantity and quality) including both sanitary inspections and a comprehensive water quality study. Results from sanitary inspections show that only half of the water supply installations at the hospitals are in adequate conditions and the rest present high risk of microbiological contamination. Water access in small medical community centres on the other hand present issues related to the non-availability of food-grade water tanks for the institutions (70%), the use of small 10l containers as the main water supply (40%), poor maintenance (60% under antihygienic conditions and 30% with damaged covers), and insufficient chlorine levels that prevent microbiological contamination. Regarding water quality analyses, raw water supply in Smara, El Aiun and Awserd camps present high conductivity and high levels of fluoride, chloride, nitrate and sulphate, but dropping to normal levels within the drinking-water standards after water treatment via reverse osmosis plants. But for the case of El Aiun and Awserd, the reverse osmosis plant only provides treated water to the population each 20days, so the population receives raw water directly and health risks should be evaluated. Finally, Dakhla water supply is the best in terms of physico-chemical parameters quality, currently providing safe drinking water after a chlorination stage. In summary, drinking water access has improved dramatically in the last years due to the efforts of local and international authorities but several issues remain to be solved: access to treated water for all the population, improved water quality controls (especially in Dakhla), expansion of distribution networks, and adequate storage systems and maintenance. Copyright © 2016 Elsevier B
-
Report for Contract W911NF-09-1-0205 (University of Wisconsin - Madison)
2014-01-18
widm. 8 M. E. Piper, J. W. Cook, T. R. Schlam, D. E. Jorenby, S. S. Smith, D. M. Bolt, W.-Y. Loh. Gender, race, and education differences in abstinence ...rates among participants in two randomized smoking cessation trials, Nicotine & Tobacco Research, (05 2010): 0. doi: 10.1093/ntr/ntq067 A. B...Kara, A. J. Wallcraft, H. E. Hurlburt, W.-Y. Loh. Which surface atmospheric variable drives the seasonal cycle of sea surface temperature over the
-
Water Footprint and Virtual Water Trade of Brazil
Directory of Open Access Journals (Sweden)
Vicente de Paulo R. da Silva
2016-11-01
Full Text Available Freshwater scarcity has increased at an alarming rate worldwide; improved water management plays a vital role in increasing food production and security. This study aims to determine the water footprint of Brazil’s national food consumption, the virtual water flows associated with international trade in the main agricultural commodities, as well as water scarcity, water self-sufficiency and water dependency per Brazilian region. While previous country studies on water footprints and virtual water trade focused on virtual water importers or water-scarce countries, this is the first study to concentrate on a water-abundant virtual water-exporting country. Besides, it is the first study establishing international virtual water trade balances per state, which is relevant given the fact that water scarcity varies across states within the country, so the origin of virtual water exports matters. The results show that the average water footprint of Brazilian food consumption is 1619 m3/person/year. Beef contributes most (21% to this total. We find a net virtual water export of 54.8 billion m3/year, mainly to Europe, which imports 41% of the gross amount of the virtual water exported from Brazil. The northeast, the region with the highest water scarcity, has a net import of virtual water. The southeast, next in terms of water scarcity, shows large virtual water exports, mainly related to the export of sugar. The north, which has the most water, does not show a high virtual water export rate.
-
CSIR Research Space (South Africa)
Du Preez, M
2010-11-01
Full Text Available This 1-year randomized controlled trial investigated the effect of SODIS of drinking water and motivation on the incidence of dysentery and nondysentery diarrhea among children of age 6 months to 5 years living in periurban communities in South...
-
Kusin, F M; Jarvis, A P; Gandy, C J
2010-01-01
Analysis of residence time distribution (RTD) has been conducted for the UK Coal Authority's mine water treatment wetland at Lambley, Northumberland, to determine the hydraulic performance of the wetland over a period of approximately 4 years since site commissioning. The wetland RTD was evaluated in accordance with moment analysis and modelled based on a tanks-in-series (TIS) model to yield the hydraulic characteristics of system performance. Greater hydraulic performance was seen during the second site monitoring after 21 months of site operation i.e. longer hydraulic residence time to reflect overall system hydraulic efficiency, compared to wetland performance during its early operation. Further monitoring of residence time during the third year of wetland operation indicated a slight reduction in hydraulic residence time, thus a lower system hydraulic efficiency. In contrast, performance during the fourth year of wetland operation exhibited an improved overall system hydraulic efficiency, suggesting the influence of reed growth over the lifetime of such systems on hydraulic performance. Interestingly, the same pattern was found for iron (which is the primary pollutant of concern in ferruginous mine waters) removal efficiency of the wetland system from the second to fourth year of wetland operation. This may therefore, reflect the maturity of reeds for maintaining efficient flow distribution across the wetland to retain a longer residence time and significant fractions of water involved to enhance the extent of treatment received for iron attenuation. Further monitoring will be conducted to establish whether such performance is maintained, or whether efficiency decreases over time due to accumulation of dead plant material within the wetland cells.
-
Dean, Derek M; Maroja, Luana S; Cottrill, Sarah; Bomkamp, Brent E; Westervelt, Kathleen A; Deitcher, David L
2015-11-27
Inositol 1,4,5-trisphosphate (IP3) regulates a host of biological processes from egg activation to cell death. When IP3-specific receptors (IP3Rs) bind to IP3, they release calcium from the ER into the cytoplasm, triggering a variety of cell type- and developmental stage-specific responses. Alternatively, inositol polyphosphate kinases can phosphorylate IP3; this limits IP3R activation by reducing IP3 levels, and also generates new signaling molecules altogether. These divergent pathways draw from the same IP3 pool yet cause very different cellular responses. Therefore, controlling the relative rates of IP3R activation vs. phosphorylation of IP3 is essential for proper cell functioning. Establishing a model system that sensitively reports the net output of IP3 signaling is crucial for identifying the controlling genes. Here we report that mutant alleles of wavy (wy), a classic locus of the fruit fly Drosophila melanogaster, map to IP3 3-kinase 2 (IP3K2), a member of the inositol polyphosphate kinase gene family. Mutations in wy disrupt wing structure in a highly specific pattern. RNAi experiments using GAL4 and GAL80(ts) indicated that IP3K2 function is required in the wing discs of early pupae for normal wing development. Gradations in the severity of the wy phenotype provide high-resolution readouts of IP3K2 function and of overall IP3 signaling, giving this system strong potential as a model for further study of the IP3 signaling network. In proof of concept, a dominant modifier screen revealed that mutations in IP3R strongly suppress the wy phenotype, suggesting that the wy phenotype results from reduced IP4 levels, and/or excessive IP3R signaling. Copyright © 2016 Dean et al.
-
Directory of Open Access Journals (Sweden)
Derek M. Dean
2016-02-01
Full Text Available Inositol 1,4,5-trisphosphate (IP3 regulates a host of biological processes from egg activation to cell death. When IP3-specific receptors (IP3Rs bind to IP3, they release calcium from the ER into the cytoplasm, triggering a variety of cell type- and developmental stage-specific responses. Alternatively, inositol polyphosphate kinases can phosphorylate IP3; this limits IP3R activation by reducing IP3 levels, and also generates new signaling molecules altogether. These divergent pathways draw from the same IP3 pool yet cause very different cellular responses. Therefore, controlling the relative rates of IP3R activation vs. phosphorylation of IP3 is essential for proper cell functioning. Establishing a model system that sensitively reports the net output of IP3 signaling is crucial for identifying the controlling genes. Here we report that mutant alleles of wavy (wy, a classic locus of the fruit fly Drosophila melanogaster, map to IP3 3-kinase 2 (IP3K2, a member of the inositol polyphosphate kinase gene family. Mutations in wy disrupt wing structure in a highly specific pattern. RNAi experiments using GAL4 and GAL80ts indicated that IP3K2 function is required in the wing discs of early pupae for normal wing development. Gradations in the severity of the wy phenotype provide high-resolution readouts of IP3K2 function and of overall IP3 signaling, giving this system strong potential as a model for further study of the IP3 signaling network. In proof of concept, a dominant modifier screen revealed that mutations in IP3R strongly suppress the wy phenotype, suggesting that the wy phenotype results from reduced IP4 levels, and/or excessive IP3R signaling.
-
Kim, Jong In; Kim, Gukbin
2016-10-01
The remaining years of healthy life expectancy (RYH) at age 65 years can be calculated as RYH (65) = healthy life expectancy-aged 65 years. This study confirms the associations between socioeconomic indicators and the RYH (65) in 148 countries. The RYH data were obtained from the World Health Organization. Significant positive correlations between RYH (65) in men and women and the socioeconomic indicators national income, education level, and improved drinking water were found. Finally, the predictors of RYH (65) in men and women were used to build a model of the RYH using higher socioeconomic indicators (R(2 )= 0.744, p educational attainment, national income level, and improved water quality influenced the RYH at 65 years. Therefore, policymaking to improve these country-level socioeconomic factors is expected to have latent effects on RYH in older age. © The Author(s) 2016.
-
Davis, Kyle W.; Putnam, Larry D.
2013-01-01
The Ogallala aquifer is an important water resource for the Rosebud Sioux Tribe in Gregory and Tripp Counties in south-central South Dakota and is used for irrigation, public supply, domestic, and stock water supplies. To better understand groundwater flow in the Ogallala aquifer, conceptual and numerical models of groundwater flow were developed for the aquifer. A conceptual model of the Ogallala aquifer was used to analyze groundwater flow and develop a numerical model to simulate groundwater flow in the aquifer. The MODFLOW–NWT model was used to simulate transient groundwater conditions for water years 1985–2009. The model was calibrated using statistical parameter estimation techniques. Potential future scenarios were simulated using the input parameters from the calibrated model for simulations of potential future drought and future increased pumping. Transient simulations were completed with the numerical model. A 200-year transient initialization period was used to establish starting conditions for the subsequent 25-year simulation of water years 1985–2009. The 25-year simulation was discretized into three seasonal stress periods per year and used to simulate transient conditions. A single-layer model was used to simulate flow and mass balance in the Ogallala aquifer with a grid of 133 rows and 282 columns and a uniform spacing of 500 meters (1,640 feet). Regional inflow and outflow were simulated along the western and southern boundaries using specified-head cells. All other boundaries were simulated using no-flow cells. Recharge to the aquifer occurs through precipitation on the outcrop area. Model calibration was accomplished using the Parameter Estimation (PEST) program that adjusted individual model input parameters and assessed the difference between estimated and model-simulated values of hydraulic head and base flow. This program was designed to estimate parameter values that are statistically the most likely set of values to result in the
-
Bidlake, William R.; Josberger, Edward G.; Savoca, Mark E.
2010-01-01
Winter snow accumulation and summer snow and ice ablation were measured at South Cascade Glacier, Washington, to estimate glacier mass balance quantities for balance years 2006 and 2007. Mass balances were computed with assistance from a new model that was based on the works of other glacier researchers. The model, which was developed for mass balance practitioners, coupled selected meteorological and glaciological data to systematically estimate daily mass balance at selected glacier sites. The North Cascade Range in the vicinity of South Cascade Glacier accumulated approximately average to above average winter snow packs during 2006 and 2007. Correspondingly, the balance years 2006 and 2007 maximum winter snow mass balances of South Cascade Glacier, 2.61 and 3.41 meters water equivalent, respectively, were approximately equal to or more positive (larger) than the average of such balances since 1959. The 2006 glacier summer balance, -4.20 meters water equivalent, was among the four most negative since 1959. The 2007 glacier summer balance, -3.63 meters water equivalent, was among the 14 most negative since 1959. The glacier continued to lose mass during 2006 and 2007, as it commonly has since 1953, but the loss was much smaller during 2007 than during 2006. The 2006 glacier net balance, -1.59 meters water equivalent, was 1.02 meters water equivalent more negative (smaller) than the average during 1953-2005. The 2007 glacier net balance, -0.22 meters water equivalent, was 0.37 meters water equivalent less negative (larger) than the average during 1953-2006. The 2006 accumulation area ratio was less than 0.10, owing to isolated patches of accumulated snow that endured the 2006 summer season. The 2006 equilibrium line altitude was higher than the glacier. The 2007 accumulation area ratio and equilibrium line altitude were 0.60 and 1,880 meters, respectively. Accompanying the glacier mass losses were retreat of the terminus and reduction of total glacier area. The
-
Selbig, William R.; Balster, Nicholas
2010-01-01
The U.S. Geological Survey, in cooperation with a consortium of 19 cities, towns, and villages in Dane County, Wis., undertook a study to compare the capability of rain gardens with different vegetative species and soil types to infiltrate stormwater runoff from the roof of an adjacent structure. Two rain gardens, one planted with turf grass and the other with native prairie species, were constructed side-by-side in 2003 at two locations with different dominant soil types, either sand or clay. Each rain garden was sized to a ratio of approximately 5:1 contributing area to receiving area and to a depth of 0.5 foot. Each rain garden, regardless of vegetation or soil type, was capable of storing and infiltrating most of the runoff over the 5-year study period. Both rain gardens in sand, as well as the prairie rain garden in clay, retained and infiltrated 100 percent of all precipitation and snowmelt events during water years 2004-07. The turf rain garden in clay occasionally had runoff exceed its confining boundaries, but was still able to retain 96 percent of all precipitation and snowmelt events during the same time period. Precipitation intensity and number of antecedent dry days were important variables that influenced when the storage capacity of underlying soils would become saturated, which resulted in pooled water in the rain gardens. Because the rooftop area that drained runoff to each rain garden was approximately five times larger than the area of the rain garden itself, evapotranspiration was a small percentage of the annual water budget. For example, during water year 2005, the maximum evapotranspiration of total influent volume ranged from 21 percent for the turf rain garden in clay to 25 percent for the turf rain garden in sand, and the minimum ranged from 12 percent for the prairie rain garden in clay to 19 percent for the prairie rain garden in sand. Little to no runoff left each rain garden as effluent and a small percentage of runoff returned to the
-
Wasserman, Gail A; Liu, Xinhua; Parvez, Faruque; Factor-Litvak, Pam; Kline, Jennie; Siddique, Abu B; Shahriar, Hasan; Uddin, Mohammed Nasir; van Geen, Alexander; Mey, Jacob L; Balac, Olgica; Graziano, Joseph H
2016-07-01
Arsenic (As) exposure from drinking water is associated with modest intellectual deficits in childhood. It is not known whether reducing exposure is associated with improved intelligence. We aimed to determine whether reducing As exposure is associated with improved child intellectual outcomes. Three hundred three 10-year-old children drinking from household wells with a wide range of As concentrations were enrolled at baseline. In the subsequent year, deep community wells, low in As, were installed in villages of children whose original wells had high water As (WAs ≥ 50 μg/L). For 296 children, intelligence was assessed by WISC-IV (Wechsler Intelligence Scale for Children, 4th ed.), with a version modified for the study population, at baseline and approximately 2 years later; analyses considered standardized scores for both Full Scale IQ and Verbal Comprehension, Perceptual Reasoning, Working Memory, and Processing Speed Indices. Creatinine-adjusted urinary arsenic (UAs/Cr), blood As (BAs), and blood manganese (BMn) were assessed at both times. UAs/Cr concentrations declined significantly by follow-up for both the high (≥ 50 μg/L) and low (intelligence, plasma ferritin, head circumference, home environment quality, school grade, and BMn, UAs/Cr was significantly negatively associated with Full Scale IQ, and with all Index scores (except Processing Speed). After adjustment for baseline Working Memory scores and school grade, each 100-μg/g reduction in UAs/Cr from baseline to follow-up was associated with a 0.91 point increase in Working Memory (95% CI: 0.14, 1.67). The change in UAs/Cr across follow-up was not significantly associated with changes in Full Scale IQ or Index scores. Installation of deep, low-As community wells lowered UAs, BAs, and BMn. A greater decrease in UAs/Cr was associated with greater improvements in Working Memory scores, but not with a greater improvement in Full Scale IQ. Wasserman GA, Liu X, Parvez F, Factor-Litvak P, Kline J
-
The Effect of Talking Drawings on Five-Year-Old Turkish Children's Mental Models of the Water Cycle
Ahi, Berat
2017-01-01
The purpose of the current study is to determine the effect of talking drawings on Turkish preschool children's mental models of the water cycle. The study was conducted in the city of Kastamonu, located in the north-west of Turkey. A total of 40 five-year-old preschool children participated in the study in the spring term of the 2015-2016 school…
-
Jaeger, Kristin L.; Curran, Christopher A.; Anderson, Scott W.; Morris, Scott T.; Moran, Patrick W.; Reams, Katherine A.
2017-11-01
The Sauk River is a federally designated Wild and Scenic River that drains a relatively undisturbed landscape along the western slope of the North Cascade Mountain Range, Washington, which includes the glaciated volcano, Glacier Peak. Naturally high sediment loads characteristic of basins draining volcanoes like Glacier Peak make the Sauk River a dominant contributor of sediment to the downstream main stem river, the Skagit River. Additionally, the Sauk River serves as important spawning and rearing habitat for several salmonid species in the greater Skagit River system. Because of the importance of sediment to morphology, flow-conveyance, and ecosystem condition, there is interest in understanding the magnitude and timing of suspended sediment and turbidity from the Sauk River system and its principal tributaries, the White Chuck and Suiattle Rivers, to the Skagit River.Suspended-sediment measurements, turbidity data, and water temperature data were collected at two U.S. Geological Survey streamgages in the upper and middle reaches of the Sauk River over a 4-year period extending from October 2011 to September 2015, and at a downstream location in the lower river for a 5-year period extending from October 2011 to September 2016. Over the collective 5-year study period, mean annual suspended-sediment loads at the three streamgages on the upper, middle, and lower Sauk River streamgages were 94,200 metric tons (t), 203,000 t, and 940,000 t streamgages, respectively. Fine (smaller than 0.0625 millimeter) total suspended-sediment load averaged 49 percent at the upper Sauk River streamgage, 42 percent at the middle Sauk River streamgage, and 34 percent at the lower Sauk River streamgage.
-
Mullaney, John R.; Martin, Joseph W.; Morrison, Jonathan
2018-03-20
The daily and annual loads of nitrate plus nitrite and total nitrogen for the Connecticut River at Middle Haddam, Connecticut, were determined for water years 2009 to 2014. The analysis was done with a combination of methods, which included a predefined rating curve method for nitrate plus nitrite and total nitrogen for water years 2009 to 2011 and a custom rating curve method that included sensor measurements of nitrate plus nitrite nitrogen concentration and turbidity along with mean daily flow to determine total nitrogen loads for water years 2011 to 2014. Instantaneous concentrations of total nitrogen were estimated through the use of a regression model based on sensor measurements at 15-minute intervals of nitrate plus nitrite nitrogen and turbidity for water years 2011 to 2014.Annual total nitrogen loads at the Connecticut River at Middle Haddam ranged from 12,900 to 19,200 metric tons, of which about 42 to 49 percent was in the form of nitrate plus nitrite. The mean 95-percent prediction intervals on daily total nitrogen load estimates were smaller from the custom model, which used sensor data, than those calculated by the predefined model.Annual total nitrogen load estimates at the Connecticut River at Middle Haddam were compared with the upstream load estimates at the Connecticut River at Thompsonville, Conn. Annual gains in total nitrogen loads between the two stations ranged from 3,430 to 6,660 metric tons. These increases between the two stations were attributed to the effects of increased urbanization and to combined annual discharges of 1,540 to 2,090 metric tons of nitrogen from 24 wastewater treatment facilities in the drainage area between the two stations. The contribution of total nitrogen from wastewater discharge between the two stations had declined substantially before the beginning of this study and accounted for from 31 to 52 percent of the gain in nitrogen load between the Thompsonville and Middle Haddam sites.
-
Water neutral: reducing and ofsetting water footprints
Hoekstra, Arjen Ysbert
2008-01-01
During the past few years the concept of the ‘water footprint’ has started to receive recognition within governments, non-governmental organizations, businesses and media as a useful indicator of water use. The increased interest in the water-footprint concept has prompted the question about what
-
Buchanan, Paul A.; Downing-Kunz, Maureen; Schoellhamer, David H.; Shellenbarger, Gregory; Weidich, Kurt
2014-01-01
The U.S. Geological Survey (USGS) monitors water quality and suspended-sediment transport in the San Francisco Bay. The San Francisco Bay area is home to millions of people, and the bay teems with both resident and migratory wildlife, plants, and fish. Fresh water mixes with salt water in the bay, which is subject both to riverine and marine (tides, waves, influx of salt water) influences. To understand this environment, the USGS, along with its partners, has been monitoring the bay’s waters continuously since 1988. Several water-quality variables are of particular importance to State and Federal resource managers and are monitored at key locations throughout the bay. Salinity, which indicates the relative mixing of fresh and ocean waters in the bay, is derived from specific conductance measurements. Water temperature, along with salinity, affects the density of water, which causes gravity driven circulation patterns and stratification in the water column. Turbidity is measured using light-scattering from suspended solids in water, and is used as a surrogate for suspended-sediment concentration (SSC). Suspended sediment often carries adsorbed contaminants; attenuates sunlight in the water column; deposits on tidal marsh and intertidal mudflats, which can help sustain these habitats as sea level rises; and deposits in ports and shipping channels, which can necessitate dredging. Dissolved oxygen, which is essential to a healthy ecosystem, is a fundamental indicator of water quality, and its concentration is affected by water temperature, salinity, ecosystem metabolism, tidal currents, and wind. Tidal currents in the bay reverse four times a day, and wind direction and intensity typically change on a daily cycle: consequently, salinity, water temperature, suspendedsediment concentration, and dissolvedoxygen concentration vary spatially and temporally throughout the bay, and continuous measurements are needed to observe these changes. The purpose of this fact sheet
-
,
1977-01-01
Water-resources data for the 1975 water year for California consist of records of streamflow and contents of reservoirs at gaging stations, partial-record stations, and miscellaneous sites; records of water quality including the physical, chemical, and biological characteristics of surface and ground water; and records of water levels in selected observation wells. Records for a few pertinent streamflow and water-quality stations in bordering States are also included. The records were collected and computed by the Water Resources Division of the U.S. Geological Survey under the direction of Lee R. Peterson, district chief; Winchell Smith, assistant district chief for hydrologic data; and Leonard N. Jorgensen, chief of the basic data section. These data represent that part of the National Water Data System collected by the Geological Survey and cooperating local, State, and Federal agencies in California.
-
Irrigation methods for efficient water application: 40 years of South ...
African Journals Online (AJOL)
The purpose of an irrigation system is to apply the desired amount of water, at the correct application rate and uniformly to the whole field, at the right time, with the least amount of non-beneficial water consumption (losses), and as economically as possible. We know that irrigated agriculture plays a major role in the ...
-
International Nuclear Information System (INIS)
Chovanec, A.; Grath, J.; Kralik, M.; Vogel, W.
2002-01-01
An up-date overview of the situation of the Austrian waters is given by analyzing the status of the water quality (groundwater, surface waters) and water protection measures. Maps containing information of nitrate and atrazine in groundwaters (analyses at monitoring stations), nitrate contents and biological water quality of running waters are included. Finally, pollutants (nitrate, orthophosphate, ammonium, nitrite, atrazine etc.) trends in annual mean values and median values for the whole country for the years 1992-1999 are presented in tables. Figs. 5. (nevyjel)
-
Wright, Peter R.
2013-01-01
The hydrogeology and water quality of the Snake River alluvial aquifer at the Jackson Hole Airport in northwest Wyoming was studied by the U.S. Geological Survey, in cooperation with the Jackson Hole Airport Board, during water years 2011 and 2012 as part of a followup to a previous baseline study during September 2008 through June 2009. Hydrogeologic conditions were characterized using data collected from 19 Jackson Hole Airport wells. Groundwater levels are summarized in this report and the direction of groundwater flow, hydraulic gradients, and estimated groundwater velocity rates in the Snake River alluvial aquifer underlying the study area are presented. Analytical results of groundwater samples collected from 10 wells during water years 2011 and 2012 are presented and summarized. The water table at Jackson Hole Airport was lowest in early spring and reached its peak in July or August, with an increase of 12.5 to 15.5 feet between April and July 2011. Groundwater flow was predominantly horizontal but generally had the hydraulic potential for downward flow. Groundwater flow within the Snake River alluvial aquifer at the airport was from the northeast to the west-southwest, with horizontal velocities estimated to be about 25 to 68 feet per day. This range of velocities slightly is broader than the range determined in the previous study and likely is due to variability in the local climate. The travel time from the farthest upgradient well to the farthest downgradient well was approximately 52 to 142 days. This estimate only describes the average movement of groundwater, and some solutes may move at a different rate than groundwater through the aquifer. The quality of the water in the alluvial aquifer generally was considered good. Water from the alluvial aquifer was fresh, hard to very hard, and dominated by calcium carbonate. No constituents were detected at concentrations exceeding U.S. Environmental Protection Agency maximum contaminant levels or health
-
Energy Technology Data Exchange (ETDEWEB)
Lordan, J.; Pascual, M.; Villar, J.M.; Fonseca, F.; Papió, J.; Montilla, V.; Rufat, J.
2015-07-01
Mulching techniques have emerged in recent years to overcome soil constraints and improve fruit tree productivity. The object of this study was to evaluate the effects of a low-cost organic mulch application in a newly planted peach orchard under a ridge planting system. Three treatments were performed in 12 elementary plots using a randomized complete block design. The orchard was drip-irrigated. Mulch was applied in two treatments, which differed in fertigation (none vs. multi-nutrient fertigation), while the third treatment did not include either mulch or fertigation and served as the control. Treatments were compared in terms of their effects on the physical properties of the soil, crop response, and water-use efficiency. Mulch treatments did not alter the soil bulk density. However, the mulch significantly (p=0.0004) increased the water infiltration rate (2.21 mm/h vs. 121 mm/h), which is a key issue when working in high frequency irrigation systems under soil limiting conditions. Similarly, mulched treatments showed a more favorable water status both in the second and the third year, which was translated in a better crop response. Thus, mulched treatments recorded higher yields both in the second (+155%, p=0.0005) and the third year (+53%, p=0.0007) of the experiment. Water use efficiency (WUEagr) was higher in the mulch treatments (+50% in average, p=0.0007) than in the control in the third year of the study. On the basis of our results, we propose that organic-mulching techniques should be considered as a beneficial practice to apply in fruit-trees production under limiting soil conditions.(Author)
-
Directory of Open Access Journals (Sweden)
Joan Lordan
2015-12-01
Full Text Available Mulching techniques have emerged in recent years to overcome soil constraints and improve fruit tree productivity. The object of this study was to evaluate the effects of a low-cost organic mulch application in a newly planted peach orchard under a ridge planting system. Three treatments were performed in 12 elementary plots using a randomized complete block design. The orchard was drip-irrigated. Mulch was applied in two treatments, which differed in fertigation (none vs. multi-nutrient fertigation, while the third treatment did not include either mulch or fertigation and served as the control. Treatments were compared in terms of their effects on the physical properties of the soil, crop response, and water-use efficiency. Mulch treatments did not alter the soil bulk density. However, the mulch significantly (p=0.0004 increased the water infiltration rate (2.21 mm/h vs. 121 mm/h, which is a key issue when working in high frequency irrigation systems under soil limiting conditions. Similarly, mulched treatments showed a more favorable water status both in the second and the third year, which was translated in a better crop response. Thus, mulched treatments recorded higher yields both in the second (+155%, p=0.0005 and the third year (+53%, p=0.0007 of the experiment. Water use efficiency (WUEagr was higher in the mulch treatments (+50% in average, p=0.0007 than in the control in the third year of the study. On the basis of our results, we propose that organic-mulching techniques should be considered as a beneficial practice to apply in fruit-trees production under limiting soil conditions.
-
4R Water Quality Impacts: An Assessment and Synthesis of Forty Years of Drainage Nitrogen Losses.
Christianson, L E; Harmel, R D
2015-11-01
The intersection of agricultural drainage and nutrient mobility in the environment has led to multiscale water quality concerns. This work reviewed and quantitatively analyzed nearly 1,000 site-years of subsurface tile drainage nitrogen (N) load data to develop a more comprehensive understanding of the impacts of 4R practices (application of the right source of nutrients, at the right rate and time, and in the right place) within drained landscapes across North America. Using drainage data newly compiled in the "Measured Annual Nutrient loads from AGricultural Environments" (MANAGE) database, relationships were developed across N application rates for nitrate N drainage loads and corn ( L.) yields. The lack of significant differences between N application timing or application method was inconsistent with the current emphasis placed on application timing, in particular, as a water quality improvement strategy ( = 0.934 and 0.916, respectively). Broad-scale analyses such as this can help identify major trends for water quality, but accurate implementation of the 4R approach will require site-specific knowledge to balance agronomic and environmental goals. Copyright © by the American Society of Agronomy, Crop Science Society of America, and Soil Science Society of America, Inc.
-
DEFF Research Database (Denmark)
Granier, A.; Reichstein, M.; Breda, N.
2007-01-01
stand to estimate the water balance terms: trees and understorey transpiration, rainfall interception, throughfall, drainage in the different soil layers and soil water content. This model calculated the onset date, duration and intensity of the soil water shortage (called water stress) using measured...... measured and modelled soil water content. Our analysis showed a wide spatial distribution of drought stress over Europe, with a maximum intensity within a large band extending from Portugal to NE Germany. Vapour fluxes in all the investigated sites were reduced by drought, due to stomatal closure, when...... the relative extractable water in soil (REW) dropped below ca. 0.4. Rainfall events during the drought, however, typically induced rapid restoration of vapour fluxes. Similar to the water vapour fluxes, the net ecosystem production decreased with increasing water stress at all the sites. Both gross primary...
-
Buchanan, Paul A.; Downing-Kunz, Maureen; Schoellhamer, David H.; Livsey, Daniel N.
2018-03-08
The U.S. Geological Survey (USGS) monitors water quality and suspended-sediment transport in the San Francisco Bay (bay) as part of a multi-agency effort to address management, water supply, and ecological concerns. The San Francisco Bay area is home to millions of people, and the bay teems both with resident and with migratory wildlife, plants, and fish. Freshwater mixes with salt water in the bay, which is subject both to riverine influences (floods, droughts, managed reservoir releases and freshwater diversions) and to marine influences (tides, waves, effects of salt water). To understand this environment, the USGS, along with its partners (see “Acknowledgements”), has been monitoring the bay’s waters continuously since 1988. Several water-quality variables are of particular importance to State and Federal resource managers and are monitored at key locations throughout the bay (fig. 1). Salinity, which indicates the relative mixing of fresh and ocean waters in the bay, is derived from specific conductance measurements. Water temperature, along with salinity, affects the density of water, which controls gravity-driven circulation patterns and stratification in the water column. Turbidity, a measure of light scattered from suspended particles in the water, is used to estimate suspended-sediment concentration (SSC). Suspended sediment affects the bay in multiple ways: attenuation of sunlight in the water column, affecting phytoplankton growth; deposition on tidal marsh and intertidal mudflats, which can help sustain these habitats as sea level rises; deposition in ports and shipping channels, which can necessitate dredging; and often, adsorption of contaminants, affecting their distribution and concentrations in the environment. Dissolved oxygen concentration, essential to a healthy ecosystem and a fundamental indicator of water quality, is affected by water temperature, salinity, ecosystem metabolism, tidal currents, and wind. Tidal currents in the bay
-
Directory of Open Access Journals (Sweden)
Ávila Rosas Héctor
2014-07-01
Full Text Available While no solid, structured studies were found to support specific recommendations of water consumption, the main problem seems to be the excessive intake of sugary beverages. The recommended figure of 1-1.5 mL of water per kcal of energy intake is a reference value that must consider weather, physical activity, and dietary varia- tions. At ages up to six months, all water must come from maternal milk, of which an intake of 100-190 mL/kg/day is recommended; at ages 6-12 months, 800-1000 mL/day, considering milk and a gradual introduction of water. Children aged 2-3 years old must have 1,300 mL/day, and those aged 4-8 years old, 1,600 mL/day. Females aged 9-13 years old must consume 1,900 mL/day while the water intake of males must be 2,100 mL/day. For those aged 14 years old or more, adult recommendations apply.
-
Comparative evaluation of recent water hammer events in light water reactors
International Nuclear Information System (INIS)
House, R.K.; Sursock, J.P.; Kim, J.H.
1987-01-01
Water hammer events that occurred in commercial U.S. light water reactors in the five-year period from 1981 to 1985 were surveyed, and a preliminary evaluation of the events was conducted. The information developed supplements a previous study which evaluated water hammer events in the twelve-year period from 1969 to 1981. The current study of water hammer events in the 1980's confirms that the rate of events remains relatively constant (less than 0.25 events per plant year) in both PWRs and BWRs. Although water hammer events are not normally considered a safety issue, the economic impact of the events on plant operations can be significant. One particular severe water hammer event is estimated to have cost the plant owner $10 million for repair and evaluation alone. A variety of key characteristics of the recent water hammer events are summarized to establish a basis for further study of preventative methods
-
Harris, Ted D.; Graham, Jennifer L.
2017-01-01
Cyanobacterial blooms degrade water quality in drinking water supply reservoirs by producing toxic and taste-and-odor causing secondary metabolites, which ultimately cause public health concerns and lead to increased treatment costs for water utilities. There have been numerous attempts to create models that predict cyanobacteria and their secondary metabolites, most using linear models; however, linear models are limited by assumptions about the data and have had limited success as predictive tools. Thus, lake and reservoir managers need improved modeling techniques that can accurately predict large bloom events that have the highest impact on recreational activities and drinking-water treatment processes. In this study, we compared 12 unique linear and nonlinear regression modeling techniques to predict cyanobacterial abundance and the cyanobacterial secondary metabolites microcystin and geosmin using 14 years of physiochemical water quality data collected from Cheney Reservoir, Kansas. Support vector machine (SVM), random forest (RF), boosted tree (BT), and Cubist modeling techniques were the most predictive of the compared modeling approaches. SVM, RF, and BT modeling techniques were able to successfully predict cyanobacterial abundance, microcystin, and geosmin concentrations <60,000 cells/mL, 2.5 µg/L, and 20 ng/L, respectively. Only Cubist modeling predicted maxima concentrations of cyanobacteria and geosmin; no modeling technique was able to predict maxima microcystin concentrations. Because maxima concentrations are a primary concern for lake and reservoir managers, Cubist modeling may help predict the largest and most noxious concentrations of cyanobacteria and their secondary metabolites.
-
International Nuclear Information System (INIS)
Elcombe, Clifford R.; Elcombe, Barbara M.; Foster, John R.; Chang, Shu-Ching; Ehresman, David J.; Butenhoff, John L.
2012-01-01
Highlights: ► The mechanism of K + PFOS-induced hepatic hypertrophy and tumors was studied in rats. ► Plasma ALT and AST values and histology indicated a lack of overt hepatotoxicity. ► Plasma cholesterol and triglycerides were lowered by K + PFOS treatment. ► K + PFOS increased proliferation index and decreased apoptotic index in liver. ► Liver effects of K + PFOS result from increased expression of PPARα and CAR/PXR. -- Abstract: The present study investigated the potential role for activation of PPARα and CAR/PXR by potassium PFOS (K + PFOS) with respect to the etiology of hepatic hypertrophy and hepatocellular adenoma in rats. Male Sprague–Dawley rats were fed K + PFOS (20 or 100 ppm) for either 1, 7, or 28 days. Wyeth 14,643 (Wy 14,643, 50 ppm) and phenobarbital (PB, 500 ppm) were the controls for PPARα and CAR/PXR activation, respectively. Measurements included: plasma ALT, AST, cholesterol, triglycerides, and glucose; liver protein and DNA content; liver activities of palmitoyl CoA oxidase (ACOX), Cyp4A, CYP2B, and CYP3A; induction of liver CYP4A1, CYP2E1, CYP2B1/2, and CYP3A1 proteins (SDS-PAGE and Western blots); liver and thyroid microscopic histopathology, apoptotic index, and cell proliferation index. Terminal body weight was decreased by K + PFOS (100 ppm) and Wy 14,643. All test-compound treatments increased liver weight. Plasma lipids were decreased by both PFOS and Wy 14,643. After treatment for 1 day, K + PFOS (100 ppm), PB, and Wy 14,643 increased mean hepatic DNA concentration and total hepatic DNA, and total DNA remained elevated after treatment for 7 days and 28 days (PB and Wy 14,643 only). Hepatic P450 concentration was elevated after 7 and 28 days by K + PFOS and by PB. K + PFOS and Wy 14,643 increased liver activities of ACOX and CYP4A as well as increased liver CYP4A1 protein. By 28 days of treatment, K + PFOS and PB increased liver activities of CYP2B and CYP3A as well as increased liver CYP2B1/2 and CYP3A1 proteins, and Wy
-
[100 years of drinking water regulation. Retrospective review, current situation and prospects].
Rakhmanin, Yu A; Krasovsky, G N; Egorova, N A; Mikhailova, R I
2014-01-01
There is considered the history of the development of legislative requirements to the regulation of the quality of drinking water in different countries and international organizations during the period from 1912 to the present time. In terms of comparative analysis there is analyzed the current state of regulatory frameworks of the Russian Federation, WHO, EU, Finland, the UK, Singapore, Australia, Japan, China, Nigeria, the United States and Canada in the field of providing favorable conditions of population drinking water use. There has been noted the significant progress in standardization of the content of the biogenic elements and chemical pollution of drinking water in the absence of uniform requirements to the composition and properties of drinking water globally, that is bound to the need to take into account the national peculiarities of drinking water supply within the separate countries. As promising directions for improving regulation of drinking water quality there are noted: the development of new standards for prioritized water pollution, periodic review ofstandards after appearance of the new scientific data on the biological action of substances, the use of the concept of risk, the harmonization of the normative values and the assessment of the possibility of introduction into the practice the one more criterion of profitableness of population water use--the bioenergetic state of the water.
-
Zhang, Yulan; Yang, Lijie; Yu, Chunxiao; Yin, Guanghua; Doane, Timothy A.; Wu, Zhijie; Zhu, Ping; Ma, Xingzhu
2016-01-01
A field experiment was carried out to evaluate the effect of organic amendments on soil organic carbon, total nitrogen, bulk density, aggregate stability, field capacity and plant available water in a representative Chinese Mollisol. Four treatments were as follows: no fertilization (CK), application of inorganic fertilizer (NPK), combined application of inorganic fertilizer with maize straw (NPK+S) and addition of biochar with inorganic fertilizer (NPK+B). Our results showed that after three consecutive years of application, the values of soil bulk density were significantly lower in both organic amendment-treated plots than in unamended (CK and NPK) plots. Compared with NPK, NPK+B more effectively increased the contents of soil organic carbon, improved the relative proportion of soil macro-aggregates and mean weight diameter, and enhanced field capacity as well as plant available water. Organic amendments had no obvious effect on soil C/N ratio or wilting coefficient. The results of linear regression indicated that the improvement in soil water retention could be attributed to the increases in soil organic carbon and aggregate stability. PMID:27191160
-
Ma, Ningning; Zhang, Lili; Zhang, Yulan; Yang, Lijie; Yu, Chunxiao; Yin, Guanghua; Doane, Timothy A; Wu, Zhijie; Zhu, Ping; Ma, Xingzhu
2016-01-01
A field experiment was carried out to evaluate the effect of organic amendments on soil organic carbon, total nitrogen, bulk density, aggregate stability, field capacity and plant available water in a representative Chinese Mollisol. Four treatments were as follows: no fertilization (CK), application of inorganic fertilizer (NPK), combined application of inorganic fertilizer with maize straw (NPK+S) and addition of biochar with inorganic fertilizer (NPK+B). Our results showed that after three consecutive years of application, the values of soil bulk density were significantly lower in both organic amendment-treated plots than in unamended (CK and NPK) plots. Compared with NPK, NPK+B more effectively increased the contents of soil organic carbon, improved the relative proportion of soil macro-aggregates and mean weight diameter, and enhanced field capacity as well as plant available water. Organic amendments had no obvious effect on soil C/N ratio or wilting coefficient. The results of linear regression indicated that the improvement in soil water retention could be attributed to the increases in soil organic carbon and aggregate stability.
-
Directory of Open Access Journals (Sweden)
Ningning Ma
Full Text Available A field experiment was carried out to evaluate the effect of organic amendments on soil organic carbon, total nitrogen, bulk density, aggregate stability, field capacity and plant available water in a representative Chinese Mollisol. Four treatments were as follows: no fertilization (CK, application of inorganic fertilizer (NPK, combined application of inorganic fertilizer with maize straw (NPK+S and addition of biochar with inorganic fertilizer (NPK+B. Our results showed that after three consecutive years of application, the values of soil bulk density were significantly lower in both organic amendment-treated plots than in unamended (CK and NPK plots. Compared with NPK, NPK+B more effectively increased the contents of soil organic carbon, improved the relative proportion of soil macro-aggregates and mean weight diameter, and enhanced field capacity as well as plant available water. Organic amendments had no obvious effect on soil C/N ratio or wilting coefficient. The results of linear regression indicated that the improvement in soil water retention could be attributed to the increases in soil organic carbon and aggregate stability.
-
Directory of Open Access Journals (Sweden)
Adel Zahraei
2014-09-01
Full Text Available drinking water and the reduction in the risk of blood pressure (P value<0.05. Also, the results showed that the degree of correlation (R between the two variables for drinking water hardness levels and the percentage of high blood pressure in men was (-0.496 and in women was (-0.512 and in the total population over 30 years was (-0.61. Conclusion: Use of water with medium to high degree of hardness can reduce the risk of high blood pressure and consequently the risk of cardiovascular disease.
-
Directory of Open Access Journals (Sweden)
Darcy M. Anderson
2018-06-01
Full Text Available Sustainable access to safe drinking water protects against infectious disease and promotes overall health. Despite considerable progress toward increasing water access, safe water quality and reliable service delivery remain a challenge. Traditional financing strategies pay implementers based on inputs and activities, with minimal incentives for water quality monitoring and sustained service operation. Pay-for-performance offers an alternative financing strategy that delivers all or a portion of payment based on performance indicators of desired outputs or outcomes. A pay-for-performance approach in the water sector could quantify and incentivize health impact. Averted disability-adjusted life years (ADALYs have been used as a performance indicator to measure the burden of disease averted due to environmental health interventions. Water-related disease burden can be measured for application as an ADALYs performance indicator following either comparative risk assessment or quantitative microbial risk assessment. Comparative risk assessment models disease burden using water source type as a proxy indicator of microbial water quality, while quantitative microbial risk assessment models disease burden using concentrations of indicator pathogens. This paper compares these risk assessment methodologies, and summarizes the limitations of applying these approaches toward quantifying ADALYs as a performance indicator for water quality interventions.
-
A review of boiling water reactor water chemistry: Science, technology, and performance
International Nuclear Information System (INIS)
Fox, M.J.
1989-02-01
Boiling water reactor (BWR) water chemistry (science, technology, and performance) has been reviewed with an emphasis on the relationships between BWR water quality and corrosion fuel performance, and radiation buildup. A comparison of Nuclear Regulatory Commission (NRC) Regulatory Guide 1.56, the Boiling Water Reactor Owners Group (BWROG) Water Chemistry Guidelines, and Plant Technical Specifications showed that the BWROG Guidelines are more stringent than the NRC Regulatory Guide, which is almost identical to Plant Technical Specifications. Plant performance with respect to BWR water chemistry has shown dramatic improvements in recent years. Up until 1979 BWRs experienced an average of 3.0 water chemistry incidents per reactor-year. Since 1979 the water chemistry technical specifications have been violated an average of only 0.2 times per reactor-year, with the most recent data from 1986-1987 showing only 0.05 violations per reactor-year. The data clearly demonstrate the industry-wide commitment to improving water quality in BWRs. In addition to improving water quality, domestic BWRs are beginning to switch to hydrogen water chemistry (HWC), a remedy for intergranular stress corrosion cracking. Three domestic BWRs are presently operating on HWC, and fourteen more have either performed HWC mini tests or are in various stages of HWC implementation. This report includes a detailed review of HWC science and technology as well as areas in which further research on BWR chemistry may be needed. 43 refs., 30 figs., 8 tabs
-
Water pH and temperature in Lake Biwa from MBT'/CBT indices during the last 280 000 years
Ajioka, T.; Yamamoto, M.; Takemura, K.; Hayashida, A.; Kitagawa, H.
2014-10-01
We generated a 280 000 yr record of water pH and temperature in Lake Biwa, central Japan, by analysing the methylation index (MBT') and cyclisation ratio (CBT) of branched tetraethers in sediments from piston and borehole cores. Our aim was to understand the responses of precipitation and air temperature in central Japan to the East Asian monsoon variability on orbital timescales. Because the water pH in Lake Biwa is determined by phosphorus and alkali cation inputs, the record of water pH should indicate the changes in precipitation and temperature in central Japan. Comparison with a pollen assemblage in a Lake Biwa core suggests that lake water pH was determined by summer temperature in the low-eccentricity period before 55 ka, while it was determined by summer precipitation in the high-eccentricity period after 55 ka. From 130 to 55 ka, the variation in lake pH (summer precipitation) lagged behind that in summer temperature by several thousand years. This perspective is consistent with the conclusions of previous studies (Igarashi and Oba, 2006; Yamamoto, 2009), in that the temperature variation preceded the precipitation variation in central Japan.
-
Sloto, Ronald A.; Gellis, Allen C.; Galeone, Daniel G.
2012-01-01
Laurel Hill Creek is a watershed of 125 square miles located mostly in Somerset County, Pennsylvania, with small areas extending into Fayette and Westmoreland Counties. The upper part of the watershed is on the Pennsylvania Department of Environmental Protection 303(d) list of impaired streams because of siltation, nutrients, and low dissolved oxygen concentrations. The objectives of this study were to (1) estimate the annual sediment load, (2) estimate the annual nitrogen load, and (3) identify the major sources of fine-grained sediment using the sediment-fingerprinting approach. This study by the U.S. Geological Survey (USGS) was done in cooperation with the Somerset County Conservation District. Discharge, suspended-sediment, and nutrient data were collected at two streamflow-gaging stations—Laurel Hill Creek near Bakersville, Pa., (station 03079600) and Laurel Hill Creek at Ursina, Pa., (station 03080000)—and one ungaged stream site, Laurel Hill Creek below Laurel Hill Creek Lake at Trent (station 03079655). Concentrations of nutrients generally were low. Concentrations of ammonia were less than 0.2 milligrams per liter (mg/L), and concentrations of phosphorus were less than 0.3 mg/L. Most concentrations of phosphorus were less than the detection limit of 0.02 mg/L. Most water samples had concentrations of nitrate plus nitrite less than 1.0 mg/L. At the Bakersville station, concentrations of total nitrogen ranged from 0.63 to 1.3 mg/L in base-flow samples and from 0.57 to 1.5 mg/L in storm composite samples. Median concentrations were 0.88 mg/L in base-flow samples and 1.2 mg/L in storm composite samples. At the Ursina station, concentrations of total nitrogen ranged from 0.25 to 0.92 mg/L in base-flow samples; the median concentration was 0.57 mg/L. The estimated total nitrogen load at the Bakersville station was 262 pounds (lb) for 11 months of the 2010 water year (November 2009 to September 2010) and 266 lb for the 2011 water year. Most of the total
-
DEFF Research Database (Denmark)
Skov, Christian; Perrow, M.R.; Berg, Søren
2002-01-01
evaluated between predatory fish and potential prey and between zooplanktivorous or benthivorous fish and water quality parameters. In addition, potential consumption of piscivorous fishes was calculated. 3. The density of fish feeding on larger zooplankton or benthos (roach >15 cm, crucian carp >15 cm......1. Piscivores (annual stocking of 1000 individuals ha(-1) of 0+ pike and a single stocking of 30 kg ha(-1) of large 20-30 cm perch) were stocked in seven consecutive years in a shallow eutrophic lake in Denmark. The stocking programme aimed at changing food-web structure by reducing...... zooplanktivorous and benthivorous fish, with resultant effects on lower trophic levels and ultimately water quality. 2. The fish community and water quality parameters (Secchi depth, concentrations of total phosphorus, chlorophyll a and suspended solids) were monitored between 1996 and 2000 and relationships were...
-
Sofia, Giulia; Pizzulli, Federica; Tarolli, Paolo
2017-04-01
Agriculture and land-use management has changed drastically in Italy since the end of the Second World War, driven by local but also European agricultural policies. As a result of these changes in farming practices and land use, many drainage networks have changed producing a greater exposure to flooding with a broad range of impacts on society, also because of climate inputs coupling with the human drivers. This study focuses on two main points: which kind of land use and farming changes have been observed in the most recent years ( 30 years)? How do these changes interact with climate and soil conditions? An open challenge to understand how these changes influence the watershed response, is, in fact, to understand if rainfall characteristics and climate have a synergistic effect, if their interaction matters, or to understand what element has the greatest influence on the watershed response connected to agricultural changes. The work is based on a simple model of water infiltration due to soil properties, and a connected evaluation of the distributed surface water storage offered by artificial drainage networks in a study area in Veneto (north-eastern Italy). The analysis shows that economic changes control the development of agro-industrial landscapes, with effects on the hydrological response. However, these changes deeply interact with antecedent soil conditions and climate characteristics. Intense and irregular rainfall events and events with a high recurrence should be expected to be the most critical. The presented outcomes highlight the importance of understanding how agricultural practices can be the driver of or can be used to avoid, or at least mitigate, flooding. The proposed methods can be valuable tools in evaluating the costs and benefits of the management of water in agriculture to inform better policy decision-making. References Sofia G, Tarolli P. 2017. Hydrological Response to 30 years of Agricultural Surface Water Management. Land 6 (1): 3 DOI
-
Cost effective water treatment program in Heavy Water Plant (Manuguru)
International Nuclear Information System (INIS)
Mohapatra, C.; Prasada Rao, G.
2002-01-01
Water treatment technology is in a state of continuous evolution. The increasing urgency to conserve water and reduce pollution has in recent years produced an enormous demand for new chemical treatment programs and technologies. Heavy water plant (Manuguru) uses water as raw material (about 3000 m 3 /hr) and its treatment and management has benefited the plant in a significant way. It is a fact that if the water treatment is not proper, it can result in deposit formation and corrosion of metals, which can finally leads to production losses. Therefore, before selecting treatment program, complying w.r.t. quality requirements, safety and pollution aspects cost effectiveness shall be examined. The areas where significant benefits are derived, are raw water treatment using polyelectrolyte instead of inorganic coagulant (alum), change over of regenerant of cation exchangers from hydrochloric acid to sulfuric acid and in-house development of cooling water treatment formulation. The advantages and cost effectiveness of these treatments are discussed in detail. Further these treatments has helped the plant in achieving zero discharge and indirectly increased cost reduction of final product (heavy water); the dosage of 3 ppm of polyelectrolyte can replace 90 ppm alum at turbidity level of 300 NTU of raw water which has resulted in cost saving of Rs. 15-20 lakhs in a year beside other advantages; the change over of regenerant from HCl to H 2 SO 4 will result in cost saving of at least Rs.1.4 crore a year besides other advantages; the change over to proprietary formulation to in-house formulation in cooling water treatment has resulted in a saving about Rs.11 lakhs a year. To achieve the above objectives in a sustainable way the performance results are being monitored. (author)
-
Beets, Michael W.; Tilley, Falon; Weaver, Robert G.; Turner-McGrievy, Gabrielle M.; Moore, Justin B.
2014-01-01
The objective of this study was to describe the 3-year outcomes (2011-2013) from the healthy lunchbox challenge (HLC) delivered in the US-based summer day camps (SDC) (8-10 hours day-1, 10-11 weeks summer-1, SDC) to increase children and staff bringing fruit, vegetables and water (FVW) each day. A single group pre- with multiple post-test design…
-
Directory of Open Access Journals (Sweden)
Monika Pawlak-Bratkowska
2013-06-01
Full Text Available Wstęp i cele pracy: Idiopatyczny zespół nerczycowy w wieku rozwojowym przebiega nawrotowo i trwale zmie‑ nia życie dzieci oraz ich rodziców. Celem badania była ocena poziomu lęku i depresji u rodziców dzieci z zespo‑ łem nerczycowym. Materiał i metodyka: Badanie zaplanowano jako przekrojową próbę kliniczną wśród rodzi‑ ców dzieci chorujących na zespół nerczycowy w odniesieniu do rodziców dzieci zdrowych. Wszyscy badani (46 rodziców wypełniali: ankietę dotyczącą przebiegu choroby u dziecka, kwestionariusz STAI (Inwentarz stanu i cechy lęku, kwestionariusz Skali depresji Becka, kwestionariusz Skali kontroli emocji (CECS. Grupę kontrolną stanowiło 20 rodziców dzieci zdrowych. Wyniki: Rodzice dzieci z zespołem nerczycowym charakteryzowali się istotnie wyższym poziomem depresji (Skala depresji Becka 8,7 vs 4,9, t = 2,18, p < 0,05. U ojców zaobserwo‑ wano wyższe subiektywne uczucie kontrolowania własnych reakcji w porównaniu z matkami – wyższy wynik CECS, suma u ojców (55,1 vs 47,2, t = 2,53, p < 0,05. U matek odnotowano wyższe wskaźniki zarówno w ska‑ lach mierzących poziom lęku jako cechy (STAI – cecha 45,7 vs 36,1, t = 3,19, p < 0,05 i stanu (STAI – stan 42,8 vs 33,4, t = 2,8, p < 0,05, jak i w kwestionariuszu badającym poziom depresji (10,62 vs 4,86, t = 2,66, p < 0,05. Rodzice, którzy wykazywali tendencję do obwiniania się o chorobę dziecka, podczas jej pierwszego epizodu uzyskali statystycznie istotny wyższy wynik w testach badających poziom depresji. Wnioski: Rodzice dzieci cierpiących na zespół nerczycowy charakteryzowali się istotnie wyższym poziomem depresji niż rodzice dzieci zdrowych. Ważne wydaje się objęcie szczególną opieką matek, mającą na celu obniżenie poziomu lęku i objawów depresji, oraz ojców skłonnych do tłumienia przeżywanych emocji.
-
Directory of Open Access Journals (Sweden)
Ke Chen
2016-12-01
Full Text Available Vegetation deterioration and soil loss are the main causes of more precipitation leakages and surface water shortages in degraded karst areas. In order to improve the utilization of water resources in such regions, water storage engineering has been considered; however, site selection and cost associated with the special karstic geological structure have made this difficult. According to the principle of the Soil Plant Atmosphere Continuum, increasing both vegetation cover and soil thickness would change water cycle process, resulting in a transformation from leaked blue water (liquid form into green water (gas or saturated water form for terrestrial plant ecosystems, thereby improving the utilization of water resources. Using the Soil Vegetation Atmosphere Transfer model and the geographical distributed approach, this study simulated the conversion from leaked blue water (leakage into green water in the environs of Guiyang, a typical degraded karst area. The primary results were as follows: (1 Green water in the area accounted for <50% of precipitation, well below the world average of 65%; (2 Vegetation growth played an important role in converting leakage into green water; however, once it increased to 56%, its contribution to reducing leakage decreased sharply; (3 Increasing soil thickness by 20 cm converted the leakage considerably. The order of leakage reduction under different precipitation scenarios was dry year > normal year > rainy year. Thus, increased soil thickness was shown effective in improving the utilization ratio of water resources and in raising the amount of plant ecological water use; (4 The transformation of blue water into green water, which avoids constructions of hydraulic engineering, could provide an alternative solution for the improvement of the utilization of water resources in degraded karst area. Although there are inevitable uncertainties in simulation process, it has important significance for overcoming similar
-
International Nuclear Information System (INIS)
Haaland, Leif
2001-01-01
Ballast water discharged into harbours and coastal waters often brings unwanted organisms from distant regions (non-indigenous species). Some of the species that have come this way and that are now threatening Norwegian coasts and rivers are red algae, ghost shrimps (Caprella linearis) and the Japanese alga Sargassum muticum. Norway receives between 15 and 30 million tonnes of ballast water each year. International regulations about ballast water will not appear for many years, and in the meantime Norway is evaluating national immediate measures. Some ship owners in some countries are purifying the ballast water. However, harmful non-indigenous species may also come from mariculture
-
Hickman, R. Edward
1987-01-01
Loads of suspended sediment, phosphorus, nitrogen, biochemical oxygen demand, and dissolved silica discharged to the tidal Potomac River and Estuary during the !979-81 water years from three local nonpoint sources have been calculated. The loads in rain falling directly upon the tidal water surface and from overflows of the combined sewer system of the District of Columbia were determined from available information. Loads of materials in the streamflow from local watersheds draining directly to the tidal Potomac River and Estuary downstream from Chain Bridge in Washington, D.C., were calculated from samples of streamflow leaving five monitored watersheds. Average annual yields of substances leaving three urban watersheds (Rock Creek and the Northwest and Northeast Branches of the Anacostia River) and the rural Saint Clements Creek watershed were calculated either by developing relationships between concentration and streamflow or by using the mean of measured concentrations. Yields calculated for the 1979-81 water years are up to 2.3 times period-of-record yields because of greater than average streamflow and stormflow during this 3-year period. Period-of-record yields of suspended sediment from the three urban watersheds and the Saint Clements Creek watershed do not agree with yields reported by other studies. The yields from the urban watersheds are 17 to 51 percent of yields calculated using sediment-concentration data collected during the 1960-62 water years. Previous studies suggest that this decrease is at least partly due to the imposition of effective sediment controls at construction sites and to the construction of two multipurpose reservoirs. The yield calculated for the rural Saint Clements Creek watershed is at least twice the yields calculated for other rural watersheds, a result that may be due to most of the samples of this stream being taken during the summer of the 1981 water year, a very dry period. Loads discharged from all local tributary
-
International Nuclear Information System (INIS)
Dominguez Calle, Efrain Antonio; Gonzalo Rivera, Hebert; Vanegas, Sarmiento Raquel; Moreno, Pedro
2008-01-01
This paper shows updated results about Colombian water resources and their requirements by the economic sectors. Water demand water availability relationship is used as a pressure index on water resources. This relationship is expressed through the water scarcity index, which applies constraints over water availability; due to the runoff temporal variability and to the low levels of water during the dry season each year and for each geographic region to characterize average and low runoff years. Different water availability scenarios were building. One for modal runoff values and another for 95 percents for 2025 also were prepared. To the results call our attention to problems caused by the concentration of high density settlements and the presence of economics sectors in regions with low water availability. The infrastructure lag for management of a scarce high variable and over pressured resources emerges as a key factor to avoid a looming crisis in the process of water management
-
Lunchtime School Water Availability and Water Consumption Among California Adolescents.
Bogart, Laura M; Babey, Susan H; Patel, Anisha I; Wang, Pan; Schuster, Mark A
2016-01-01
To examine the potential impact of California SB 1413, which required school districts to provide free, fresh drinking water during mealtimes in food service areas by July 1, 2011, on greater water consumption among California adolescents. Data were drawn from the 2012 and 2013 state-representative California Health Interview Survey. A total of 2,665 adolescents aged 12-17 years were interviewed regarding their water consumption and availability of free water during lunchtime at their school. Three-fourths reported that their school provided free water at lunchtime, mainly via fountains. In a multivariate model that controlled for age, gender, income, race/ethnicity, body mass index, and school type, adolescents in schools that provided free water consumed significantly more water than adolescents who reported that water was not available, bivariate (standard error) = .67 (.28), p = .02. School water access did not significantly vary across the 2 years. Lunchtime school water availability was related to water consumption, but a quarter of adolescents reported that their school did not provide free water at lunch. Future research should explore what supports and inducements might facilitate provision of drinking water during school mealtimes. Copyright © 2016 Society for Adolescent Health and Medicine. All rights reserved.
-
Dettinger, M.; Cayan, D.; Redmond, K.
2002-01-01
During the course of spring and summer 2002, tropical sea-surface temperatures in the eastern Pacific Ocean have warmed and the wind and pressure fields have shifted, so that by August, there was considerable confidence that water year (October–September) 2003 will be characterized by a weak to mild El Niño climate (http://iri.columbia.edu/climate/ENSO/currentinfo/archive/200208/QuickLook.html). At the same time, the Pacific Decadal Oscillation pattern of sea-surface temperatures in the North Pacific (Mantua et al., 1997) has shifted towards a more neutral state than in the past several years and will not be considered in detail here. Previous studies of the connections between El Niños and streamflow in the United States by the authors (e.g., Redmond and Koch, 1991; Cayan and Webb, 1992; Cayan et al., 1999; Dettinger et al., 2001) indicate that El Niño conditions influence historical streamflow distributions to varying extents. These conclusions, along with those of other researchers, suggest that foreknowledge of El Niño conditions can inform seasonal outlooks for streamflows throughout the Americas and elsewhere. For example, Dettinger et al. (2001), as distilled here into Fig. 1, showed that historical annual streamflow totals have correlated negatively with the Southern Oscillation Index (SOI, which is negatively associated with El Niños) in the U.S. Southwest as well as in the subtropics of South America, and correlate positively in the U.S. Northwest, in much of tropical South America, and, perhaps, in southernmost South America. These interhemispheric bands of El Niño influence are a matter of considerable concern for water- and land-managers throughout the Americas, and expand upon results from previous studies in the western United States (e.g., Redmond and Koch, 1991; Cayan and Webb, 1992), including a recent analysis by Pizarro and Lall (2002), where water availability and hydrologic extremes are particularly pressing issues.
-
Schools water efficiency and awareness project | Wilson | Water SA
African Journals Online (AJOL)
The City of Cape Town's Water Demand Management (WDM) department has been involved in school projects for several years, although these have generally been restricted to educational activities during Water Week and school competitions, due mainly to limited resources. Cape Town is a water scarce area, and ...
-
Czech Academy of Sciences Publication Activity Database
Jurajda, Pavel; Slavík, O.; White, S.M.; Adámek, Zdeněk
2010-01-01
Roč. 644, č. 1 (2010), s. 89-101 ISSN 0018-8158 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60930519 Keywords : 0+ Fish * Water Framework Directive * Rivers * Biological quality element Subject RIV: EH - Ecology, Behaviour Impact factor: 1.964, year: 2010
-
Czech Academy of Sciences Publication Activity Database
Jurajda, Pavel; Adámek, Zdeněk; Janáč, Michal; Roche, Kevin Francis; Mikl, Libor; Rederer, L.; Zapletal, T.; Koza, V.; Špaček, J.
2016-01-01
Roč. 173, č. 1 (2016), s. 101-108 ISSN 0165-7836 R&D Projects: GA ČR GBP505/12/G112 Institutional support: RVO:68081766 Keywords : Biomanipulation * Drinking water reservoir * Fish removal * Trophic interactions * Zooplankton density Subject RIV: EH - Ecology, Behaviour Impact factor: 2.185, year: 2016
-
One-year assessment of a solar space/water heater--Clinton, Mississippi
1981-01-01
Unit called "System 4" integrated into space-heating and hot-water systems of dormitory satisfied 32 percent of building heat load. System 4 includes flat-plate air collectors, circulation blowers, rock storage bed with heat exchanger, two hot water tanks, and auxiliary heaters. Report describes performance of system and subsystems, operating-energy requirements and savings, and performance parameters.
-
Global monthly water scarcity: blue water footprints versus blue water availability.
Hoekstra, Arjen Y; Mekonnen, Mesfin M; Chapagain, Ashok K; Mathews, Ruth E; Richter, Brian D
2012-01-01
Freshwater scarcity is a growing concern, placing considerable importance on the accuracy of indicators used to characterize and map water scarcity worldwide. We improve upon past efforts by using estimates of blue water footprints (consumptive use of ground- and surface water flows) rather than water withdrawals, accounting for the flows needed to sustain critical ecological functions and by considering monthly rather than annual values. We analyzed 405 river basins for the period 1996-2005. In 201 basins with 2.67 billion inhabitants there was severe water scarcity during at least one month of the year. The ecological and economic consequences of increasing degrees of water scarcity--as evidenced by the Rio Grande (Rio Bravo), Indus, and Murray-Darling River Basins--can include complete desiccation during dry seasons, decimation of aquatic biodiversity, and substantial economic disruption.
-
Water management, agriculture, and ground-water supplies
Nace, Raymond L.
1960-01-01
Encyclopedic data on world geography strikingly illustrate the drastic inequity in the distribution of the world's water supply. About 97 percent of the total volume of water is in the world's oceans. The area of continents and islands not under icecaps, glaciers, lakes, and inland seas is about 57.5 million square miles, of which 18 million (36 percent) is arid to semiarid. The total world supply of water is about 326.5 million cubic miles, of which about 317 million is in the oceans and about 9.4 million is in the land areas. Atmospheric moisture is equivalent to only about 3,100 cubic miles of water. The available and accessible supply of ground water in the United States is somewhat more than 53,000 cubic miles (about 180 billion acre ft). The amount of fresh water on the land areas of the world at any one time is roughly 30,300 cubic miles and more than a fourth of this is in large fresh-water lakes on the North American Continent. Annual recharge of ground water in the United States may average somewhat more than 1 billion acre-feet yearly, but the total volume of ground water in storage is equivalent to all the recharge in about the last 160 years. This accumulation of ground water is the nation's only reserve water resource, but already it is being withdrawn or mined on a large scale in a few areas. The principal withdrawals of water in the United States are for agriculture and industry. Only 7.4 percent of agricultural land is irrigated, however; so natural soil moisture is the principal source of agricultural water, and on that basis agriculture is incomparably the largest water user. In view of current forecasts of population and industrial expansion, new commitments of water for agriculture should be scrutinized very closely, and thorough justification should be required. The 17 Western States no longer contain all the large irrigation developments. Nearly 10 percent of the irrigated area is in States east of the western bloc, chiefly in several
-
PPARα is a key regulator of hepatic FGF21
International Nuclear Information System (INIS)
Lundasen, Thomas; Hunt, Mary C.; Nilsson, Lisa-Mari; Sanyal, Sabyasachi; Angelin, Bo; Alexson, Stefan E.H.; Rudling, Mats
2007-01-01
The metabolic regulator fibroblast growth factor 21 (FGF21) has antidiabetic properties in animal models of diabetes and obesity. Using quantitative RT-PCR, we here show that the hepatic gene expression of FGF21 is regulated by the peroxisome proliferator-activated receptor alpha (PPARα). Fasting or treatment of mice with the PPARα agonist Wy-14,643 induced FGF21 mRNA by 10-fold and 8-fold, respectively. In contrast, FGF21 mRNA was low in PPARα deficient mice, and fasting or treatment with Wy-14,643 did not induce FGF21. Obese ob/ob mice, known to have increased PPARα levels, displayed 12-fold increased hepatic FGF21 mRNA levels. The potential importance of PPARα for FGF21 expression also in human liver was shown by Wy-14,643 induction of FGF21 mRNA in human primary hepatocytes, and PPARα response elements were identified in both the human and mouse FGF21 promoters. Further studies on the mechanisms of regulation of FGF21 by PPARα in humans will be of great interest
-
Grøndahl-Rosado, Ricardo C; Yarovitsyna, Ekaterina; Trettenes, Elin; Myrmel, Mette; Robertson, Lucy J
2014-12-01
Enteric viruses transmitted via the faecal-oral route occur in high concentrations in wastewater and may contaminate drinking water sources and cause disease. In order to quantify enteric adenovirus and norovirus genotypes I and II (GI and GII) impacting a drinking source in Norway, samples of surface water (52), wastewater inlet (64) and outlet (59) were collected between January 2011 and April 2012. Samples were concentrated in two steps, using an electropositive disc filter and polyethylene glycol precipitation, followed by nucleic acid extraction and analysis by quantitative polymerase chain reaction. Virus was detected in 47/52 (90.4%) of surface water, 59/64 (92%) of wastewater inlet and 55/59 (93%) of wastewater outlet samples. Norovirus GI occurred in the highest concentrations in surface water (2.51e + 04) and adenovirus in wastewater (2.15e + 07). While adenovirus was the most frequently detected in all matrices, norovirus GI was more frequently detected in surface water and norovirus GII in wastewater. This study is the first in Norway to monitor both sewage and a drinking water source in parallel, and confirms the year-round presence of norovirus and adenovirus in a Norwegian drinking water source.
-
Saint-Jacques, Nathalie; Parker, Louise; Brown, Patrick; Dummer, Trevor Jb
2014-06-02
Arsenic in drinking water is a public health issue affecting hundreds of millions of people worldwide. This review summarizes 30 years of epidemiological studies on arsenic exposure in drinking water and the risk of bladder or kidney cancer, quantifying these risks using a meta-analytical framework. Forty studies met the selection criteria. Seventeen provided point estimates of arsenic concentrations in drinking water and were used in a meta-analysis of bladder cancer incidence (7 studies) and mortality (10 studies) and kidney cancer mortality (2 studies). Risk estimates for incidence and mortality were analyzed separately using Generalized Linear Models. Predicted risks for bladder cancer incidence were estimated at 10, 50 and 150 μg/L arsenic in drinking water. Bootstrap randomizations were used to assess robustness of effect size. Twenty-eight studies observed an association between arsenic in drinking water and bladder cancer. Ten studies showed an association with kidney cancer, although of lower magnitude than that for bladder cancer. The meta-analyses showed the predicted risks for bladder cancer incidence were 2.7 [1.2-4.1]; 4.2 [2.1-6.3] and; 5.8 [2.9-8.7] for drinking water arsenic levels of 10, 50, and 150 μg/L, respectively. Bootstrapped randomizations confirmed this increased risk, but, lowering the effect size to 1.4 [0.35-4.0], 2.3 [0.59-6.4], and 3.1 [0.80-8.9]. The latter suggests that with exposures to 50 μg/L, there was an 83% probability for elevated incidence of bladder cancer; and a 74% probability for elevated mortality. For both bladder and kidney cancers, mortality rates at 150 ug/L were about 30% greater than those at 10 μg/L. Arsenic in drinking water is associated with an increased risk of bladder and kidney cancers, although at lower levels (water may double the risk of bladder cancer, or at the very least, increase it by about 40%. With the large number of people exposed to these arsenic concentrations worldwide the public health
-
2014-01-01
Background Arsenic in drinking water is a public health issue affecting hundreds of millions of people worldwide. This review summarizes 30 years of epidemiological studies on arsenic exposure in drinking water and the risk of bladder or kidney cancer, quantifying these risks using a meta-analytical framework. Methods Forty studies met the selection criteria. Seventeen provided point estimates of arsenic concentrations in drinking water and were used in a meta-analysis of bladder cancer incidence (7 studies) and mortality (10 studies) and kidney cancer mortality (2 studies). Risk estimates for incidence and mortality were analyzed separately using Generalized Linear Models. Predicted risks for bladder cancer incidence were estimated at 10, 50 and 150 μg/L arsenic in drinking water. Bootstrap randomizations were used to assess robustness of effect size. Results Twenty-eight studies observed an association between arsenic in drinking water and bladder cancer. Ten studies showed an association with kidney cancer, although of lower magnitude than that for bladder cancer. The meta-analyses showed the predicted risks for bladder cancer incidence were 2.7 [1.2–4.1]; 4.2 [2.1–6.3] and; 5.8 [2.9–8.7] for drinking water arsenic levels of 10, 50, and 150 μg/L, respectively. Bootstrapped randomizations confirmed this increased risk, but, lowering the effect size to 1.4 [0.35–4.0], 2.3 [0.59–6.4], and 3.1 [0.80–8.9]. The latter suggests that with exposures to 50 μg/L, there was an 83% probability for elevated incidence of bladder cancer; and a 74% probability for elevated mortality. For both bladder and kidney cancers, mortality rates at 150 ug/L were about 30% greater than those at 10 μg/L. Conclusion Arsenic in drinking water is associated with an increased risk of bladder and kidney cancers, although at lower levels (water may double the risk of bladder cancer, or at the very least, increase it by about 40%. With the large number of people exposed to these
-
Strock, K.; Saros, J. E.
2017-12-01
Interannual climate variability is expected to increase over the next century, but the extent to which hydroclimatic variability influences biogeochemical processes is unclear. To determine the effects of extreme weather on surface water chemistry, a 30-year record of surface water geochemistry for 84 lakes in the northeastern U.S. was combined with landscape data and watershed-specific weather data. With these data, responses in sulfate and dissolved organic carbon (DOC) concentrations were characterized during extreme wet and extreme dry conditions. Episodic acidification during drought and episodic brownification (increased DOC) during wet years were detected broadly across the northeastern U.S. Episodic chemical response was linearly related to wetland coverage in lake watersheds only during extreme wet years. The results of a redundancy analysis suggest that topographic features also need to be considered and that the interplay between wetlands and their degree of connectivity to surface waters could be driving episodic acidification in this region. A subset of lakes located in Acadia National Park, Maine U.S.A. were studied to better understand the implications of regional increases of DOC in lakes. Water transparency declined across six study sites since 1995 as DOC increased. As clarity declined, some lakes experienced reduced epilimnion thickness. The degree to which transparency changed across the lakes was dependent on DOC concentration, with a larger decline in transparency occurring in clear water lakes than brown water lakes. The results presented here help to clarify the variability observed in long-term recovery from acidification and regional increases in DOC. Specifically, an increased frequency of extreme wet years may be contributing to a recent acceleration in the recovery of lake ecosystems from acidification; however, increased frequency of wet years may also lead to reduced water clarity and altered physical lake habitat. Clarifying the
-
International Nuclear Information System (INIS)
Monteith, D.T.; Evans, C.D.
2005-01-01
The United Kingdom Acid Waters Monitoring Network (AWMN) was established in 1988 to determine the ecological impact of acidic emissions control policy on acid-sensitive lakes and streams. AWMN data have been used to explore a range of causal linkages necessary to connect changes in emissions to chemical and, ultimately, biological recovery. Regional scale reductions in sulphur (S) deposition have been found to have had an immediate influence on surface water chemistry, including increases in acid neutralising capacity, pH and alkalinity and declines in aluminium toxicity. These in turn can be linked to changes in the aquatic biota which are consistent with 'recovery' responses. A continuation of the current programme is essential in order to better understand apparent non-linearity between nitrogen (N) in deposition and runoff, the substantial rise in organic acid concentrations, and the likely impacts of forecast climate change and other potential constraints on further biological improvement. - After 15 years of the UK Acid Waters Monitoring Network, we can now draw clear conclusions regarding the impact of emission reductions on acidified UK fresh waters
-
Water-Borne Illnesses. Water in Africa.
Garrett, Carly Sporer
The Water in Africa Project was realized over a 2-year period by a team of Peace Corps volunteers. As part of an expanded, detailed design, resources were collected from over 90 volunteers serving in African countries, photos and stories were prepared, and standards-based learning units were created for K-12 students. This unit, "Water-Borne…
-
Measurement of age of underground water, using tritium
International Nuclear Information System (INIS)
Chatani, Kunio; Kagami, Tadaaki; Tomita, Ban-ichi; Onuma, Akiko; Shoka, Yasushi
1978-01-01
Age of four kinds of underground water in Aichi prefecture was estimated by measuring a concentration of tritium. The tritium concentration was measured by the usual method. The first water-bearing zone of the shallow part, about 50m in depth, of Nobi plain is a new underground water cultivated within 20 years, whereas second water-bearing zone is an old underground water of 20 years old or more. No relationship of water flow between the first and the second water-bearing zone was observed. A very deep underground about 100m or more in depth, of the Nobi plain is confirmed to be infinite years old fossil water by measuring of tritium. The underground water in Atsumi peninsula is mostly a new underground water within 20 years. Only one out of eight showed the existence of old underground water before 20 years or more. The underground water of the granite area at Mikawa district is confirmed to be old underground water before 20 years or more. Alkaline underground water in the granite zone is considered to be very old in view of composition of water. The origin of underground water can be learned by tritium concentration, which shows whether the water is new water in the neighborhood of earth's surface or very old cultivated water. (Iwakiri, K.)
-
Clark, Melanie L.; Mason, Jon P.
2007-01-01
Water-quality sampling was conducted regularly at stream sites within or near the Powder River structural basin in northeastern Wyoming and southeastern Montana during water years 2001-05 (October 1, 2000, to September 30, 2005) to characterize water quality in an area of coalbed natural gas development. The U.S. Geological Survey, in cooperation with the Wyoming Department of Environmental Quality, characterized the water quality at 22 sampling sites in the Tongue, Powder, Cheyenne, and Belle Fourche River drainage basins. Data for general hydrology, field measurements, major-ion chemistry, and selected trace elements were summarized, and specific conductance and sodium-adsorption ratios were evaluated for relations with streamflow and seasonal variability. Trend analysis for water years 1991-2005 was conducted for selected sites and constituents to assess change through time. Average annual runoff was highly variable among the stream sites. Generally, streams that have headwaters in the Bighorn Mountains had more runoff as a result of higher average annual precipitation than streams that have headwaters in the plains. The Powder River at Moorhead, Mont., had the largest average annual runoff (319,000 acre-feet) of all the sites; however, streams in the Tongue River drainage basin had the highest runoff per unit area of the four major drainage basins. Annual runoff in all major drainage basins was less than average during 2001-05 because of drought conditions. Consequently, water-quality samples collected during the study period may not represent long-term water-quality con-ditions for all sites. Water-quality characteristics were highly variable generally because of streamflow variability, geologic controls, and potential land-use effects. The range of median specific-conductance values among sites was smallest in the Tongue River drainage basin. Median values in that basin ranged from 643 microsiemens per centimeter at 25 degrees Celsius (?S/cm at 25?C) on the
-
Postel, S
1993-01-01
Many cities worldwide have gone beyond the limits of their water supply. Growing urban populations increase their demand for water, thereby straining local water supplies and requiring engineers to seek our even more distant water sources. It is costly to build and maintain reservoirs, canals, pumping stations, pipes, sewers, and treatment plants. Water supply activities require much energy and chemicals, thereby contributing to environmental pollution. Many cities are beginning to manage the water supply rather than trying to keep up with demand. Pumping ground water for Mexico City's 18 million residents (500,000 people added/year) surpasses natural replenishment by 50% to 80%, resulting in falling water tables and compressed aquifers. Mexico City now ambitiously promotes replacement of conventional toilets with 1.6 gallon toilets (by late 1991, this had saved almost 7.4 billion gallons of water/year). Continued high rural-urban migration and high birth rates could negate any savings, however. Waterloo, Ontario, has also used conservation efforts to manage water demand. These efforts include retrofit kits to make plumbing fixtures more efficient, efficiency standards for plumbing fixtures, and reduction of water use outdoors. San Jose, California, has distributed water savings devices to about 220,000 households with a 90% cooperation rate. Boston, Massachusetts, not only promoted water saving devices but also repaired leaks and had an information campaign. Increasing water rates to actually reflect true costs also leads to water conservation, but not all cities in developing countries use water meters. All households in Edmonton, Alberta, are metered and its water use is 1/2 of that of Calgary, where only some households are metered. Tucson, Arizona, reduced per capita water use 16% by raising water rates and curbing water use on hot days. Bogor, Indonesia, reduced water use almost 30% by increasing water rates. In the US, more and more states are mandating use
-
Light Water Reactor Sustainability Research and Development Program Plan. Fiscal Year 2009-2013
International Nuclear Information System (INIS)
2009-01-01
Nuclear power has reliably and economically contributed almost 20% of electrical generation in the United States over the past two decades. It remains the single largest contributor (more than 70%) of non-greenhouse-gas-emitting electric power generation in the United States. By the year 2030, domestic demand for electrical energy is expected to grow to levels of 16 to 36% higher than 2007 levels. At the same time, most currently operating nuclear power plants will begin reaching the end of their 60-year operating licenses. If current operating nuclear power plants do not operate beyond 60 years, the total fraction of generated electrical energy from nuclear power will begin to decline - even with the expected addition of new nuclear generating capacity. The oldest commercial plants in the United States reached their 40th anniversary this year. U.S. regulators have begun considering extended operations of nuclear power plants and the research needed to support long-term operations. The Light Water Reactor Sustainability (LWRS) Research and Development (R and D) Program, developed and sponsored by the Department of Energy, is performed in close collaboration with industry R and D programs. The purpose of the LWRS R and D Program is to provide technical foundations for licensing and managing long-term, safe and economical operation of the current operating nuclear power plants. The LWRS R and D Program vision is captured in the following statements: Existing operating nuclear power plants will continue to safely provide clean and economic electricity well beyond their first license- extension period, significantly contributing to reduction of United States and global carbon emissions, enhancement of national energy security, and protection of the environment. There is a comprehensive technical basis for licensing and managing the long-term, safe, economical operation of nuclear power plants. Sustaining the existing operating U.S. fleet also will improve its
-
International Nuclear Information System (INIS)
Palkar, Prajakta S.; Anderson, Cherie R.; Ferry, Christina H.; Gonzalez, Frank J.; Peters, Jeffrey M.
2010-01-01
Recent work indicates that PPARα is required for perfluorooctanoic acid (PFOA)-induced postnatal lethality resulting from prenatal exposure. The present study tested the hypothesis that relatively modest activation of PPARα during prenatal development will cause postnatal lethality, similar to that observed with PFOA, a relatively low affinity PPARα agonist. Female wild-type and Pparα-null mice were mated overnight with males of the same genotype. The presence of a copulatory plug on the morning after mating was indicative of pregnancy and considered gestation day (GD) 0. Plugged female mice were fed either a control diet or one containing clofibrate (0.5%) or Wy-14,643 (0.005%) until GD18 or until parturition. Mice were examined on GD18 or on postnatal day (PND) 20 following the prenatal exposure period. Dietary administration of clofibrate or Wy-14,643 did not affect maternal weight or weight gain, the average number of implantations, the percentage of litter loss, the average number of live/dead fetuses, average crown-rump length, or the average fetal weight on GD18 in either genotype. An increase in relative maternal liver weight and elevated expression of PPARα target genes in maternal and fetal livers on GD18 were observed, indicative of PPARα-dependent changes in both the maternal and fetal compartments. However, no defects in postnatal development were observed by either clofibrate or Wy-14,643 in either genotype by PND20. These results demonstrate that relatively low level activation of PPARα by clofibrate or Wy-14,643 during prenatal development does not cause postnatal lethality.
-
International Nuclear Information System (INIS)
2010-01-01
This document proposes a set of tables containing different information and data regarding measurements of gamma radioactivity, of tritium level in different marine and water environments (algae, sands, sea water, molluscs, sediments, water mosses, vegetal) in different locations for the second half-year 2008: a bay close to the AREVA plant in La Hague, different locations on the Normandy coast, around the AREVA plant in La Hague, waterways in Normandy and near the Brennilis nuclear power station in Brittany. These tables contain information about the sampling (date, location, quantity, analysed fraction, and so on) and results of measurements of artificial (isotopes of cobalt, ruthenium-rhodium, silver, iodine, caesium, americium, europium) and natural (potassium, beryllium, lead, bismuth, etc.) radionuclides
-
Karlsen, R. H.; Smits, F. J. C.; Stuyfzand, P. J.; Olsthoorn, T. N.; van Breukelen, B. M.
2012-08-01
SummaryThis article describes the post audit and inverse modeling of a 1-D forward reactive transport model. The model simulates the changes in water quality following artificial recharge of pre-treated water from the river Rhine in the Amsterdam Water Supply Dunes using the PHREEQC-2 numerical code. One observation dataset is used for model calibration, and another dataset for validation of model predictions. The total simulation time of the model is 50 years, from 1957 to 2007, with recharge composition varying on a monthly basis and the post audit is performed 26 years after the former model simulation period. The post audit revealed that the original model could reasonably predict conservative transport and kinetic redox reactions (oxygen and nitrate reduction coupled to the oxidation of soil organic carbon), but showed discrepancies in the simulation of cation exchange. Conceptualizations of the former model were inadequate to accurately simulate water quality changes controlled by cation exchange, especially concerning the breakthrough of potassium and magnesium fronts. Changes in conceptualization and model design, including the addition of five flow paths, to a total of six, and the use of parameter estimation software (PEST), resulted in a better model to measurement fit and system representation. No unique parameter set could be found for the model, primarily due to high parameter correlations, and an assessment of the predictive error was made using a calibration constrained Monte-Carlo method, and evaluated against field observations. The predictive error was found to be low for Na+ and Ca2+, except for greater travel times, while the K+ and Mg2+ error was restricted to the exchange fronts at some of the flow paths. Optimized cation exchange coefficients were relatively high, especially for potassium, but still within the observed range in literature. The exchange coefficient for potassium agrees with strong fixation on illite, a main clay mineral in
-
Modelling of water and chloride transport in concrete during yearly wetting/drying cycles
Van Der Zanden, A.J.J.; Taher, A.; Arends, T.
2015-01-01
The simultaneous transport of water and chloride in concrete has been modelled. The water transport is described with a concentration dependent diffusion coefficient. The chloride transport is modelled with a convective part, caused by the water transport, and a diffusive part, caused by the
-
Managing Water Scarcity: Why Water Conservation Matters to Business
Spiwak, Stephen M.
2013-01-01
The issue of water scarcity has often hit the headlines in the past several years. Some states have gone to court over water rights and access even as others have agonized over scarce supplies. University presidents and their staff of directors understand that the days of unlimited, inexpensive water are almost over. While it remains inexpensive…
-
Directory of Open Access Journals (Sweden)
María Carrasco Poyatos
2010-01-01
Full Text Available The aim of the present study was to investigate the effect of a water-based calisthenics and resistance program on jump height in postmenopausal women with moderate hip risk fracture. 39 women were divided into three groups: swimming group (GN; n = 17, calisthenics and resistance group (GIR; n = 14, and control group (GC; n = 8. Body composition test included body mass index (IMC and waist to hip ratio (ICC. Jump height was assessed by a countermovement jump (CMJ. GN showed a significant (p<0.05 decrease in ICC (5.81%. GIR showed a significant decrease in IMC (3.65% and a significant increase in CMJ (15.5%. Two years of water-based calisthenics and resistance training can offer significant benefits in jump height in postmenopausal women with moderate hip risk fracture. Both exercise programs can also improve body composition.
-
SYSTEM WYŚWIETLANIA PARAMETRÓW LOTU DLA ŚMIGŁOWCA TYPU Mi-17 – WYNIKI BADAŃ
Directory of Open Access Journals (Sweden)
Bęczkowski Grzegorz
2015-08-01
Full Text Available Przedmiotem artykułu są badania w locie nowo opracowanego systemu wyświetlania parametrów lotu (SWPL. Omawiany system przeznaczony jest do zobrazowania na wyświetlaczu przeziernym umieszczonym przed okiem pilota pełnej informacji pilotażowo-nawigacyjnej, ostrzeganiu o sytuacji niebezpiecznej na pokładzie śmigłowca i sygnalizacji błędów pracy systemów pokładowych. System przystosowany jest do pracy w warunkach dziennych i nocnych, przy czym w warunkach nocnych współpracuje z goglami noktowizyjnymi stosowanymi w lotnictwie Sił Zbrojnych RP.
-
Municipal water reclamation of industrial water use in Mexico
International Nuclear Information System (INIS)
Gamez, G.; Ramos, R.; Aerts, P.; Guzman, E.; Pachecho, J. c.
2009-01-01
This article describes how treated domestic wastewater in a Mexican desert area is reused by a local mining and metallurgical company for process water make-up. With increasing production of treated domestic wastewater, the company's water reuse facilities were continuously expanded over the last ten years. Today, four water reuse plants run with reverse osmosis membranes. With water being a limiting factor, they have enabled the scale-up of mining operations. (Author)
-
Directory of Open Access Journals (Sweden)
Hrytsku V.S.
2016-06-01
Full Text Available The results of the Prut River water quality monitoring in the last 7 years are dealt with. Attention is paid to situation of water quality worsening and to the reasons that caused it. Application of the method of water quality index’s integrated assessment has confirmed that it is not solely the degree of anthropogenic impact that affects the water quality, but also the effects of natural factors.
-
Carter, Janet M.; Driscoll, Daniel G.; Hamade, Ghaith R.; Jarrell, Gregory J.
2001-01-01
The Madison and Minnelusa aquifers are two of the most important aquifers in the Black Hills area of South Dakota and Wyoming. Quantification and evaluation of various hydrologic budget components are important for managing and understanding these aquifers. Hydrologic budgets are developed for two scenarios, including an overall budget for the entire study area and more detailed budgets for subareas. Budgets generally are combined for the Madison and Minnelusa aquifers because most budget components cannot be quantified individually for the aquifers. An average hydrologic budget for the entire study area is computed for water years 1987-96, for which change in storage is approximately equal to zero. Annual estimates of budget components are included in detailed budgets for nine subareas, which consider periods of decreasing storage (1987-92) and increasing storage (1993-96). Inflow components include recharge, leakage from adjacent aquifers, and ground-water inflows across the study area boundary. Outflows include springflow (headwater and artesian), well withdrawals, leakage to adjacent aquifers, and ground-water outflow across the study area boundary. Leakage, ground-water inflows, and ground-water outflows are difficult to quantify and cannot be distinguished from one another. Thus, net ground-water flow, which includes these components, is calculated as a residual, using estimates for the other budget components. For the overall budget for water years 1987-96, net ground-water outflow from the study area is computed as 100 ft3/s (cubic feet per second). Estimates of average combined budget components for the Madison and Minnelusa aquifers are: 395 ft3/s for recharge, 78 ft3/s for headwater springflow, 189 ft3/s for artesian springflow, and 28 ft3/s for well withdrawals. Hydrologic budgets also are quantified for nine subareas for periods of decreasing storage (1987-92) and increasing storage (1993-96), with changes in storage assumed equal but opposite. Common
-
Application of the water footprinting method and water accounting ...
African Journals Online (AJOL)
... water usage, as well as report its usage using global tools and frameworks. ... Using information from the survey, monthly and yearly water balances were ... The WAF models assisted in reporting data in a universally consistent manner. Blue ...
-
2016-12-01
that Fort Drum uses water from two sources: (1) treated groundwater from its on-post wells and (2) treated surface water supplied by the Development...Complete replacement of distribution system piping $21 million Year 10 and Year 30 Leak repair $40,000 Annual Bottled water for drinking $20,000 per...about effects of the instal- lation’s dual water supplies on operation of the water -distribution system. 5.2 Recommendations 5.2.1 Applicability Model
-
Khoir, A. N.; Rohmah, M.; Nuryadi
2018-03-01
Hydrometeorological factor causes most disaster in Indonesia, and two of them are drought and flood. This study aims to correlate Standardized Precipitation Index (SPI) 3-monthly to water debit and water level in the Cisadane River. The monthly rainfall data from Serpong and Pasar Baru rain station from 2009 to 2011 when moderate El Niño and moderate La Niña happened. The correlation analysis between debit and water level to SPI 3-monthly used rain post of Serpong to represent the condition of the upstream area and rain post of Pasar Baru to represent the condition of the downstream area. The results showed that during La Niña year, the rainfall on the upstream area of the Cisadane River influenced the increase and the decrease in water debit and water level. Meanwhile, the rainfall on the downstream area of the river has an opposite effect on the increase and the decrease of debit and water level of the Pasar Baru. On the upstream area, the correlation between rainfall and water debit is 0.8, and the correlation between rainfall and water level is also 0.8. During El Niño year, the correlation was less than 0.5.
-
Huttinger, Alexandra; Brunson, Laura; Moe, Christine L; Roha, Kristin; Ngirimpuhwe, Providence; Mfura, Leodomir; Kayigamba, Felix; Ciza, Philbert; Dreibelbis, Robert
2017-12-16
Small water enterprises (SWEs) have lower capital expenditures than centralized systems, offering decentralized solutions for rural markets. This study evaluated SWEs in rural Rwanda, where nine health care facilities (HCF) owned and operated water kiosks supplying water from onsite water treatment systems (WTS). SWEs were monitored for 12 months. Spearman's Rank Correlation Coefficient (r s ) was used to evaluate correlations between demand for kiosk water and community characteristics, and between kiosk profit and factors influencing the cost model. On average, SWEs distributed 15,300 L/month. One SWE ran at a loss, four had profit margins of ≤10% and four had profit margins of 45-75%. Factors influencing SWE performance were intermittent water supply (87% of SWE closures were due to water shortage), consumer demand (demand was high where populations already used improved water sources (r s = 0.81, p = 0.02)), price sensitivity (demand was lower where SWEs had high prices (r s = -0.65, p = 0.08)), and production cost (water utility tariffs negatively impacted SWE profits (r s = -0.52, p Future research is needed to assess the extent to which kiosk revenue can support ongoing operational costs of WTS and kiosks both at HCF and in other contexts.
-
Directory of Open Access Journals (Sweden)
Alexandra Huttinger
2017-12-01
Full Text Available Small water enterprises (SWEs have lower capital expenditures than centralized systems, offering decentralized solutions for rural markets. This study evaluated SWEs in rural Rwanda, where nine health care facilities (HCF owned and operated water kiosks supplying water from onsite water treatment systems (WTS. SWEs were monitored for 12 months. Spearman’s Rank Correlation Coefficient (rs was used to evaluate correlations between demand for kiosk water and community characteristics, and between kiosk profit and factors influencing the cost model. On average, SWEs distributed 15,300 L/month. One SWE ran at a loss, four had profit margins of ≤10% and four had profit margins of 45–75%. Factors influencing SWE performance were intermittent water supply (87% of SWE closures were due to water shortage, consumer demand (demand was high where populations already used improved water sources (rs = 0.81, p = 0.02, price sensitivity (demand was lower where SWEs had high prices (rs = −0.65, p = 0.08, and production cost (water utility tariffs negatively impacted SWE profits (rs = −0.52, p < 0.01. Sustainability was more favorable in circumstances where recovery of capital expenditures was not expected, and the demand for treated water was sufficient to fund operational expenditures. Future research is needed to assess the extent to which kiosk revenue can support ongoing operational costs of WTS and kiosks both at HCF and in other contexts.
-
Directory of Open Access Journals (Sweden)
Ivanildo Hespanhol
2009-08-01
Full Text Available DALYs are a measure of the health of a population or burden of disease due to a specific disease or risk factor. It evaluates the time lost because of disability or death from diseases compared with a long life free of disability in the absence of disease. DALYs are calculated as the sum of years of life lost by premature mortality (YLL and years of healthy life lost in states of less than fully health, i.e., years lived with a disability (YDL, which are standardized by means of severity weights, thus: DALY=YLL+YLD. WHO has established for wastewater use in irrigation the same reference level of health protection as established for drinking water quality, i.e., the additional burden of disease from consuming water irrigated food should not exceed 10-6 DALY (Disability-Adjusted Life Years loss per person per year (pppy. Such a restrictive risk is almost impossible to be attained in most developing countries which may not be able to afford the cost of wastewater treatment and of other protective measures, even for restrict irrigation. This paper analyses which protective measures are able to be implemented in developing countries and proposes a tolerable disease burden of no more than 10-4 DALY per person per year. In order to evaluate this proposal it is mandatory to adopt a methodology of cost/benefit, through the development of epidemiologic studies and the identification of local characteristics and constraints, particularly the ones related to public health, technical, socio economical and environmental conditions.
-
Fiscal Year 1987 program report: Rhode Island Water Resource Research Center
International Nuclear Information System (INIS)
Poon, P.C.
1988-07-01
The 1987 program objective was to conduct studies and research of value to the New England region as well as to assist in the solution of problems in the State of Rhode Island. Current and anticipated state and regional-water problems are contamination of surface and groundwater by natural radioactivity such as radon, by chemicals from industrial and agricultural activities, septic tank and leach field, improperly managed landfills and the lack of public awareness and public participation in water-quality protection and management. It was found in the 1987 program that an epithermal neutron-activation analysis was best suitable for measuring uranium and thorium of which radon is the decayed product. Lower U and Th were found in calc-alkalic and mafic volcanic rocks while higher concentrations were found in the alkalic and peraluminous rocks. A computer model using finite-element method to simulate fluid flows through fractured porous media was developed for predicting the extent of ground-water contamination in the State
-
John E. Major; Kurt H. Johnsen
1996-01-01
Gas exchange and water potential were measured in 22-year-old black spruce (Piceamariana (Mill.) BSP) trees from four full-sib families on two sites (one drier and one wetter) at the Petawawa National Forestry Institute, Ontario. Based on an observed genotype à environment interaction and earlier work with seedlings, a...
-
Swancar, Amy; Lee, T.M.; O'Hare, T. M.
2000-01-01
of wet and dry seasons, and provided evidence for ground-water inflow generated from the upper basin. Annual water budgets showed how differences in timing of rainfall and pumping stresses affected lake stage and lake ground-water interactions. Lake evaporation measurements made during the study suggest that, on average, annual lake evaporation exceeds annual precipitation in the basin. Rainfall was close to the long-term average of 51.99 inches per year for the 2 years of the study (50.68 and 54.04 inches, respectively). Lake evaporation was 57.08 and 55.88 inches per year for the same 2 years, making net precipitation (rainfall minus evaporation) negative during both years. If net precipitation to seepage lakes in this area is negative over the long-term, then the ability to generate net ground-water inflow from the surrounding basin plays an important role in sustaining lake levels. Evaporation exceeded rainfall by a similar amount for both years of the study, but net ground-water flow differed substantially between the 2 years. The basin contributed net ground-water inflow to the lake in both years, however, net ground-water inflow was not sufficient to make up for the negative net precipitation during the first year, and the lake fell 4.9 inches. During the second year, net ground-water inflow exceeded the difference between evaporation and rainfall and the lake rose by 12.7 inches. The additional net ground-water inflow in the second year was due to both an increase in the amount of gross ground-water inflow and a decrease in lake leakage (ground-water outflow). Ground-water inflow was greater during the second year because more rain fell during the winter, when evaporative losses were low, resulting in greater ground-water recharge. However, decreased lake leakage during this year was probably at least as important as increased ground-water inflow in explaining the difference in net ground-water flow to the lake between the 2 years. Estimates of lake leakage
-
Water pH and temperature in Lake Biwa from MBT'/CBT indices during the last 282 000 years
Ajioka, T.; Yamamoto, M.; Takemura, K.; Hayashida, A.
2014-03-01
We generated a 282 000-year record of water pH and temperature in Lake Biwa, central Japan, by analysing the methylation index (MBT') and cyclisation ratio (CBT) of branched tetraethers in sediments from piston and borehole cores to understand the responses of precipitation and air temperature in central Japan to the East Asian monsoon variability on the orbital timescale. Because water pH in Lake Biwa is determined by phosphorus input driven by precipitation, the record of water pH should indicate changes in summer precipitation in central Japan. The estimated pH showed significant periodicity at 19 and 23 ka (precession) and at 41 ka (obliquity). The variation in the estimated pH agrees with variation in the pollen temperature index. This indicates synchronous variation in summer air temperature and precipitation in central Japan, which contradicts the conclusions of previous studies. The variation in estimated pH was also synchronous with the variation of oxygen isotopes in stalagmites in China, suggesting that East Asian summer monsoon precipitation was governed by Northern Hemisphere summer insolation on orbital timescales. However, the estimated winter temperatures were higher during interglacials and lower during glacials, showing an eccentricity cycle. This suggests that the temperature variation reflected winter monsoon variability.
-
International Nuclear Information System (INIS)
Gustafsson, David; Jansson, Per-Erik; Gaerdenaes, Annemieke; Eckersten, Henrik
2006-12-01
The Swedish Nuclear Fuel and Waste Management Co (SKB) is currently investigating the Forsmark and Oskarshamn areas for possible localisation of a repository for spent nuclear fuel. Important components of the investigations are characterizations of the land surface ecosystems in the areas with respect to hydrological and biological processes, and their implications for the fate of radionuclide contaminants entering the biosphere from a shallow groundwater contamination. In this study, we simulate water balance and carbon turnover processes in forest ecosystems representative for the Forsmark and Oskarshamn areas for a 100-year period using the ecosystem process model CoupModel. The CoupModel describes the fluxes of water and matter in a one-dimensional soil-vegetation-atmosphere system, forced by time series of meteorological variables. The model has previously been parameterized for many of the vegetation systems that can be found in the Forsmark and Oskarshamn areas: spruce/pine forests, willow, grassland and different agricultural crops. This report presents a platform for further use of models like CoupModel for investigations of radionuclide turnover in the Forsmark and Oskarshamn area based on SKB data, including a data set of meteorological forcing variables for Forsmark 1970-2004, suitable for simulations of a 100-year period representing the present day climate, a hydrological parameterization of the CoupModel for simulations of the forest ecosystems in the Forsmark and Oskarshamn areas, and simulated carbon budgets and process descriptions for Forsmark that correspond to a possible steady state of the soil storage of the forest ecosystem
-
Energy Technology Data Exchange (ETDEWEB)
Gustafsson, David; Jansson, Per-Erik [Royal Inst. of Technology, Stockholm (Sweden). Dept. of Land and Water Resources Engineering; Gaerdenaes, Annemieke [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Soil Sciences; Eckersten, Henrik [Swedish Univ. of Agricultural Sciences, Uppsala (Sweden). Dept. of Crop Production Ecology
2006-12-15
The Swedish Nuclear Fuel and Waste Management Co (SKB) is currently investigating the Forsmark and Oskarshamn areas for possible localisation of a repository for spent nuclear fuel. Important components of the investigations are characterizations of the land surface ecosystems in the areas with respect to hydrological and biological processes, and their implications for the fate of radionuclide contaminants entering the biosphere from a shallow groundwater contamination. In this study, we simulate water balance and carbon turnover processes in forest ecosystems representative for the Forsmark and Oskarshamn areas for a 100-year period using the ecosystem process model CoupModel. The CoupModel describes the fluxes of water and matter in a one-dimensional soil-vegetation-atmosphere system, forced by time series of meteorological variables. The model has previously been parameterized for many of the vegetation systems that can be found in the Forsmark and Oskarshamn areas: spruce/pine forests, willow, grassland and different agricultural crops. This report presents a platform for further use of models like CoupModel for investigations of radionuclide turnover in the Forsmark and Oskarshamn area based on SKB data, including a data set of meteorological forcing variables for Forsmark 1970-2004, suitable for simulations of a 100-year period representing the present day climate, a hydrological parameterization of the CoupModel for simulations of the forest ecosystems in the Forsmark and Oskarshamn areas, and simulated carbon budgets and process descriptions for Forsmark that correspond to a possible steady state of the soil storage of the forest ecosystem.
-
Fourth Tennessee water resources symposium
International Nuclear Information System (INIS)
Sale, M.J.; Presley, P.M.
1991-01-01
The annual Tennessee Water Resources Symposium was initiated in 1988 as a means to bring together people with common interests in the state's important water-related resources at a technical, professional level. Initially the symposium was sponsored by the American Institute of Hydrology and called the Hydrology Symposium, but the Tennessee Section of the American Water Resources Association (AWRA) has taken on the primary coordination role for the symposium over the last two years and the symposium name was changed in 1990 to water resources to emphasize a more inter-disciplinary theme. This year's symposium carries on the successful tradition of the last three years. Our goal is to promote communication and cooperation among Tennessee's water resources professionals: scientists, engineers, and researchers from federal, state, academic, and private institutions and organizations who have interests and responsibilities for the state's water resources. For these conference proceedings, individual papers are processed separately for the Energy Data Base
-
Irrigation methods for efficient water application: 40 years of South ...
African Journals Online (AJOL)
at farm level requires careful consideration of the implications of decisions made during both development (planning and design), and .... water if the emitter package is properly designed and the wind speed is less .... The structure and con-.
-
PPARα activators down-regulate CYP2C7, a retinoic acid and testosterone hydroxylase
International Nuclear Information System (INIS)
Fan Liqun; Brown-Borg, Holly; Brown, Sherri; Westin, Stefan; Mode, Agneta; Corton, J. Christopher
2004-01-01
Peroxisome proliferators (PP) are a large class of structurally diverse chemicals that mediate their effects in the liver mainly through the peroxisome proliferator-activated receptor α (PPARα). Exposure to PP results in down-regulation of CYP2C family members under control of growth hormone and sex steroids including CYP2C11 and CYP2C12. We hypothesized that PP exposure would also lead to similar changes in CYP2C7, a retinoic acid and testosterone hydroxylase. CYP2C7 gene expression was dramatically down-regulated in the livers of rats treated for 13 weeks by WY-14,643 (WY; 500 ppm) or gemfibrozil (GEM; 8000 ppm). In the same tissues, exposure to WY and GEM and to a lesser extent di-n-butyl phthalate (20 000 ppm) led to decreases in CYP2C7 protein levels in both male and female rats. An examination of the time and dose dependence of CYP2C7 protein changes after PP exposure revealed that CYP2C7 was more sensitive to compound exposure compared to other CYP2C family members. Protein expression was decreased after 1, 5 and 13 weeks of PP treatment. CYP2C7 protein expression was completely abolished at 5 ppm WY, the lowest dose tested. GEM and DBP exhibited dose-dependent decreases in CYP2C7 protein expression, becoming significant at 1000 ppm or 5000 ppm and above, respectively. These results show that PP exposure leads to changes in CYP2C7 mRNA and protein levels. Thus, in addition to known effects on steroid metabolism, exposure to PP may alter retinoic acid metabolism
-
Czech Academy of Sciences Publication Activity Database
Helliwell, R. C.; Wright, R. F.; Jackson-Blake, L.A.; Ferrier, R. C.; Aherne, J.; Cosby, B. J.; Evans, C. D.; Forsius, M.; Hruška, J.; Jenkins, A.; Krám, P.; Kopáček, Jiří; Majer, V.; Moldan, F.; Posch, M.; Potts, J. M.; Rogora, M.; Schöpp, W.
2014-01-01
Roč. 48, č. 22 (2014), s. 13280-13288 ISSN 0013-936X Grant - others:EC(XE) RECOVER:2010 EVK1-CT-1999-00018 Institutional support: RVO:60077344 Keywords : atmospheric acidification * sulphur * nitrogen * Tatra Mountains Subject RIV: DJ - Water Pollution ; Quality Impact factor: 5.330, year : 2014
-
International Nuclear Information System (INIS)
2002-01-01
The report entitled Climate Change Impacts and Adaptation : A Canadian Perspective, presents a summary of research regarding the impacts of climate change on key sectors over the past five years as it relates to Canada. This chapter on water resources describes how climate change will affect the supply of water in Canada. Water is one of Canada's greatest resources, which contributes about $7.5 to 23 billion per year to the Canadian economy. The decisions taken to adapt to climate change within the water resources sector will have profound implications in many other areas such as agriculture, human health, transportation and industry. The water related problems include water quality issues that relate to water shortages from droughts, or excesses from floods. The Intergovernmental Panel on Climate Change forecasts an increase in global average surface air temperatures of 1.4 to 5.8 degrees C by 2100. Such a change would impact the hydrological cycle, affecting runoff, evaporation patterns, and the amount of water stored in glaciers, lakes, wetlands and groundwater. The uncertainty as to the magnitude of these changes is due to the difficulty that climate models have in projecting future changes in regional precipitation patterns and extreme events. This chapter presents potential impacts of climate change on water resources in the Yukon, British Columbia, the Prairies, the Great Lakes basin, the Atlantic provinces, and the Arctic and Subarctic. The associated concerns for each region were highlighted. Adaptation research has focused on the impacts of supply and demand, and on options to adapt to these impacts. 60 refs., 2 tabs., 1 fig
-
Identifying water price and population criteria for meeting future urban water demand targets
Ashoori, Negin; Dzombak, David A.; Small, Mitchell J.
2017-12-01
Predictive models for urban water demand can help identify the set of factors that must be satisfied in order to meet future targets for water demand. Some of the explanatory variables used in such models, such as service area population and changing temperature and rainfall rates, are outside the immediate control of water planners and managers. Others, such as water pricing and the intensity of voluntary water conservation efforts, are subject to decisions and programs implemented by the water utility. In order to understand this relationship, a multiple regression model fit to 44 years of monthly demand data (1970-2014) for Los Angeles, California was applied to predict possible future demand through 2050 under alternative scenarios for the explanatory variables: population, price, voluntary conservation efforts, and temperature and precipitation outcomes predicted by four global climate models with two CO2 emission scenarios. Future residential water demand in Los Angeles is projected to be largely driven by price and population rather than climate change and conservation. A median projection for the year 2050 indicates that residential water demand in Los Angeles will increase by approximately 36 percent, to a level of 620 million m3 per year. The Monte Carlo simulations of the fitted model for water demand were then used to find the set of conditions in the future for which water demand is predicted to be above or below the Los Angeles Department of Water and Power 2035 goal to reduce residential water demand by 25%. Results indicate that increases in price can not ensure that the 2035 water demand target can be met when population increases. Los Angeles must rely on furthering their conservation initiatives and increasing their use of stormwater capture, recycled water, and expanding their groundwater storage. The forecasting approach developed in this study can be utilized by other cities to understand the future of water demand in water-stressed areas
-
Directory of Open Access Journals (Sweden)
Anthony Érico Guimarães
2000-01-01
Full Text Available The mosquito (Diptera: Culicidae ecology was studied in areas of Serra do Mar State Park, State of São Paulo, Brazil. Systematized biweekly human bait collections were made three times a day, for periods of 2 or 3 h each, in sylvatic and rural areas for 24 consecutive months (January 1991 to December 1992. A total of 24,943 adult mosquitoes belonging to 57 species were collected during 622 collective periods. Aedes scapularis, Coquillettidia chrysonotum, Cq. venezuelensis, Wyeomyia dyari, Wy. longirostris, Wy. theobaldi and Wy. palmata were more frequently collected at swampy and at flooded areas. Anopheles mediopunctatus, Culex nigripalpus, Ae. serratus, Ae. fulvus, Psorophora ferox, Ps. albipes and the Sabethini in general, were captured almost exclusively in forested areas. An. cruzii, An. oswaldoi and An. fluminensis were captured more frequently in a residence area. However, Cx. quinquefasciatus was the only one truly eusynanthropic. An. cruzii and Ae. scapularis were captured feeding on blood inside and around the residence, indicating that both species, malaria and arbovirus vectors respectively, may be involved in the transmission of these such diseases in rural areas.
-
Fiscal Year 1988 program report: Rhode Island Water Resources Center
International Nuclear Information System (INIS)
Poon, C.P.C.
1989-07-01
The State of Rhode Island is active in water resources planning, development, and management activities which include legislation, upgrading of wastewater treatment facilities, upgrading and implementing pretreatment programs, protecting watersheds and aquifers throughout the state. Current and anticipated state water problems are contamination and clean up of aquifers to protect the valuable groundwater resources; protection of watersheds by controlling non-point source pollution; development of pretreatment technologies; and deterioring groundwater quality from landfill leachate or drainage from septic tank leaching field. Seven projects were included covering the following subjects: (1) Radon and its nuclei parents in bedrocks; (2) Model for natural flushing of aquifer; (3) Microbial treatment of heavy metals; (4) Vegetative uptake of nitrate; (5) Microbial process in vegetative buffer strips; (6) Leachate characterization in landfills; and (7) Electrochemical treatment of heavy metals and cyanide
-
International Nuclear Information System (INIS)
Teste du Bailler, A.; Vedrinne, J.F.
1978-01-01
In the paper the experience gained over ten years' operation of the Ardennes (Chooz) nuclear power station is summarized from the point of view of monitoring and control equipment. The reactor was the first pressurized water reactor to be installed in France; it is operated jointly by France and Belgium. The equipment, which in many cases consists of prototypes, was developed for industrial use and with the experience that has now been gained it is possible to evaluate its qualities and defects, the constraints which it imposes and the action that has to be taken in the future. (author)
-
Sustainability of agricultural water use worldwide
Tuninetti, M.; Tamea, S.; Dalin, C.
2017-12-01
Water is a renewable but limited resource. Most human use of freshwater resources is for agriculture, and global water demand for agriculture is increasing because of the growth in food demand, driven by increasing population and changing diets. Hence, measuring the pressure exerted by agriculture on freshwater sources is a key issue. The sustainability of water use depends on the water source renewability rate: the water use is not sustainable (depleting the water storage) where/when it exceeds the renewable freshwater availability. In this study, we explore the sustainability of rain and irrigation water use for the production of nine major crops, globally at a 5'x5' spatial resolution. We split the crop water use into soil moisture (from rainfall) and irrigation, with, for the first time, separating ground- and surface-water sources, which is a key distinction because the renewability of these two water sources can be very different. In order to physically quantify the extent to which crop water use is sustainable, we measure the severity of the source depletion as the number of years required for the hydrological cycle to replenish the water resource used by the annual crop production, namely the Water Debt. This newly developed indicator allows one to compare the depletion level of the three water sources at a certain location for a specific crop. Hence, we mapped, for each crop, the number of years required to replenish the water withdrawn from soil-, surface- and ground-water resources. Each map identifies the hotspots for each water source, highlighting regions and crops that threaten most the water resource. We found that the water debt with soil moisture is heterogeneous in space but always lower than one year indicating a non-surprising sustainability of rain-fed agriculture. Rice and sugarcane make the largest contribution to global soil moisture depletion. Water debt in surface water is particularly high in areas of intense wheat and cotton production
-
Six-Year Review Contaminant Occurrence Data
U.S. Environmental Protection Agency — The Safe Drinking Water Act (SDWA) requires EPA to review each National Primary Drinking Water Regulation (NPDWR) at least once every six years and revise them, if...
-
Ye, Xuchun; Xu, Chong-Yu; Zhang, Qi
2017-04-01
In recent years, dramatic decline of water level of the Poyang Lake, China's largest freshwater lake, has raised wide concerns about the water security and wetland ecosystem. This remarkable hydrological change coincided with several factors like the initial operation of the Three Gorges Dam (TGD) in 2003, the big change of lake bottom topography due to extensive sand mining in the lake since 2000, and also climate change and other human activities in the Yangtze River basin may add to this complexity. Questions raised to what extent that the lake hydrological changes is caused by climate change and/or human activities. In this study, quantitative assessment was conducted to clarify the magnitude and mechanism of specific influencing factors on recent lake decline (2003-2014), with reference to the period of 1980-1999. The attempts were achieved through the reconstruction of lake water level scenarios by the framework of neural network. Major result indicates that the effect of lake bottom topography change due to sand mining activities has became the dominant factor for the recent lake decline, especially in winter season with low water level. However, the effect of TGD regulation shows strong seasonal features, its effect can accounts for 33%-42% of the average water level decline across the lake during the impoundment period of September-October. In addition, the effect of climate change and other human activities over the Yangtze River basin needs to be highly addressed, which is particularly prominent on reducing lake water level during the summer flood season and autumn recession period. The result also revealed that due to different mechanism, the responses of the lake water level to the three influencing factors are not consistent and show great spatial and temporal differences.
-
International Nuclear Information System (INIS)
Tyler, S.W.; Chapman, J.B.; Conrad, S.H.; Hammermeister, D.P.; Blout, D.O.; Miller, J.J.; Sully, M.J.; Ginanni, J.M.
1996-01-01
The disposal of hazardous and radioactive waste in arid regions requires a thorough understanding of the occurrence of soil-water flux and recharge. Soil-water chemistry and isotopic data are presented from three deep vadose zone boreholes (> 230 m) at the Nevada Test Site, located in the Great Basin geographic province of the southwestern United States, to quantify soil-water flux and its relation to climate. The low water contents found in the soils significantly reduce the mixing of tracers in the subsurface and provide a unique opportunity to examine the role of climate variation on recharge in arid climates. Tracing techniques and core data are examined in this work to reconstruct the paleohydrologic conditions existing in the vadose zone well beyond the timescales typically investigated. Stable chloride and chlorine 36 profiles indicate that the soil waters deep in the vadose zone range in age from approximately 20,000 to 120,000 years. Secondary chloride bulges that are present in two of the three profiles support the concept of recharge occurring at or near the last two glacial maxima, when the climate of the area was considerably wetter and cooler. The stable isotopic composition of the soil water in the profiles is significantly more depleted in heavy isotopes than is modern precipitation, suggesting that recharge under the current climate is not occurring at this arid site. Past and present recharge appears to have been strongly controlled by surface topography, with increased incidence of recharge where runoff from the surrounding mountains may have been concentrated. The data obtained from this detailed drilling and sampling program shed new light on the behavior of water in thick vadose zones and, in particular, show the sensitivity of arid regions to the extreme variations in climate experienced by the region over the last two glacial maxima
-
Light Water Reactor Sustainability Research and Development Program Plan -- Fiscal Year 2009–2013
Energy Technology Data Exchange (ETDEWEB)
Idaho National Laboratory
2009-12-01
Nuclear power has reliably and economically contributed almost 20% of electrical generation in the United States over the past two decades. It remains the single largest contributor (more than 70%) of non-greenhouse-gas-emitting electric power generation in the United States. By the year 2030, domestic demand for electrical energy is expected to grow to levels of 16 to 36% higher than 2007 levels. At the same time, most currently operating nuclear power plants will begin reaching the end of their 60-year operating licenses. If current operating nuclear power plants do not operate beyond 60 years, the total fraction of generated electrical energy from nuclear power will begin to decline—even with the expected addition of new nuclear generating capacity. The oldest commercial plants in the United States reached their 40th anniversary this year. U.S. regulators have begun considering extended operations of nuclear power plants and the research needed to support long-term operations. The Light Water Reactor Sustainability (LWRS) Research and Development (R&D) Program, developed and sponsored by the Department of Energy, is performed in close collaboration with industry R&D programs. The purpose of the LWRS R&D Program is to provide technical foundations for licensing and managing long-term, safe and economical operation of the current operating nuclear power plants. The LWRS R&D Program vision is captured in the following statements: Existing operating nuclear power plants will continue to safely provide clean and economic electricity well beyond their first license- extension period, significantly contributing to reduction of United States and global carbon emissions, enhancement of national energy security, and protection of the environment. There is a comprehensive technical basis for licensing and managing the long-term, safe, economical operation of nuclear power plants. Sustaining the existing operating U.S. fleet also will improve its international engagement
-
Buchwald, Cheryl A.
2009-01-01
The U.S. Geological Survey (USGS) Wisconsin Water Science Center is responsible for presenting data collected or estimated for water withdrawals and diversions every 5 years to the National Water-Use Information Program (NWUIP). This program serves many purposes such as quantifying how much, where, and for what purpose water is used; tracking and documenting water-use trends and changes; and providing these data to other agencies to support hydrologic projects. In 2005, data at both the county and subbasin levels were compiled into the USGS national water-use database system; these data are published in a statewide summary report and a national circular. This publication, Water Use in Wisconsin, 2005, presents the water-use estimates for 2005; this publication also describes how these water-use data were determined (including assumptions used), limitations of using these data, and trends in water-use data presented to the NWUIP. Estimates of water use in Wisconsin indicate that about 8,608 million gallons per day (Mgal/d) were withdrawn during 2005. Of this amount, about 7,622 Mgal/d (89 percent) were from surface-water sources and about 986 Mgal/d (11 percent) were from ground-water sources. Surface water used for cooling at thermoelectric-power plants constituted the largest portion of daily use at 6,898 Mgal/d. Water provided by public-supply water utilities is the second largest use of water and totaled 552 Mgal/d. Public supply served approximately 71 percent of the estimated 2005 Wisconsin population of 5.54 million people; two counties - Milwaukee and Dane - accounted for more than one-third of the public-supply withdrawal. Industrial and irrigation were the next major water uses at 471 and 402 Mgal/d, respectively. Non-irrigational agricultural (livestock and aquaculture) accounted for approximately 155 Mgal/d and is similar to the combined withdrawal for the remaining water-use categories of domestic, commercial, and mining (131 Mgal/d). Data on water use
-
Change in the southern U.S. water demand and supply over the next forty years
Steven C. McNulty; Ge Sun; Erika C. Cohen; Jennifer A. Moore Myers
2008-01-01
Water shortages are often considered a problem in the western United States, where water supply is limited compared to the eastern half of the country. However, periodic water shortages are also common in the southeastern United States due to high water demand and periodic drought. Southeastern U.S. municipalities spend billions of dollars to develop water storage...
-
Yu, L.; Gu, H.; Lou, C. H.; Zhang, L.; Meng, Q. Y.
2016-08-01
As the main primary producers in aquatic ecosystems, macrophytes affect the structure and function of aquatic ecosystems, and their distribution is controlled by water depth. Miyun Reservoir in Beijing will have to experience substantial changes in water level and surface area as it begins to receive water transferred by the South-to-North Water Diversion Project, which will have an adverse impact on the macrophytes growing there. In this study, a hydrodynamic model was constructed with MIKE21 and then used in a simulation in three scenarios: dry year, normal year and wet year. The results suggest that during water diversion, the annual and interannual water level fluctuations will be too significant for them to adapt and as a result, the original macrophytes in the reservoir tend to die and disappear completely. The area of the zone suitable for macrophyte growth, or suitable growth zone (SGZ), fluctuated. Restricted by the main dam and auxiliary dam to its south, the overall suitable growth zone moved toward the northeast and northwest of the reservoir, with a northeastward movement of its centroid. The distance and path of movement varied between scenarios. After the water diversion was completed, the suitable growth zone shrunk in the three scenarios. It is predicted that the macrophyte species diversity and richness of the reservoir can recover to the levels recorded before water diversion only in dry year. These results suggest that manual interventions should be implemented after water diversion to speed up the natural recovery of aquatic plant communities in Miyun Reservoir and thereby maintain the stability of the aquatic ecosystem.
-
Directory of Open Access Journals (Sweden)
Guangwei Huang
2015-07-01
Full Text Available A water allocation policy that aimed to balance water demand with water availability to ensure sustainability was implemented in an arid region of China over ten years ago. This policy’s success was assessed across three dimensions: society, the environment, and the economy. While the assessment was not intended to be comprehensive, it highlighted the best outcomes of the policy intervention while revealing some hidden issues. It was found that although the policy was successful in placing a ceiling on water use in the middle reaches of the Heihe River, the Water User Association, one of the main actors in water policy implementation, was under-recognized, even though it functioned well. Moreover, the economic structural adjustment at the macro level had not led to any significant reduction in water use, the reasons for which were explored.
-
Mariusz Korytowski; Czesław Szafrański
2014-01-01
The paper presents the results of the researches carried out at the catchment of water pond number one, located at Wielosławice Forestry of Siemianice Experimental Farm. The researches were carried out in three hydrological years 2002/2003, 2003/2004 i 2009/2010 of a different precipitation sums. The area of investigated catchment of pond number one is about 7,5 ha and its forestation totals 100 % and it is situated in a part of Niesób catchment - left-side tributary of Prosna River. Fresh ha...
-
Indian Academy of Sciences (India)
year undergraduate student at Ashoka University,. Sonipat, Haryana. This article studies how the height of water varies with time when water ... Experiment using a one-bottle system with a small bore tube at- tached to .... restricting free flow.
-
Deep subsurface drip irrigation using coal-bed sodic water: part I. water and solute movement
Bern, Carleton R.; Breit, George N.; Healy, Richard W.; Zupancic, John W.; Hammack, Richard
2013-01-01
Water co-produced with coal-bed methane (CBM) in the semi-arid Powder River Basin of Wyoming and Montana commonly has relatively low salinity and high sodium adsorption ratios that can degrade soil permeability where used for irrigation. Nevertheless, a desire to derive beneficial use from the water and a need to dispose of large volumes of it have motivated the design of a deep subsurface drip irrigation (SDI) system capable of utilizing that water. Drip tubing is buried 92 cm deep and irrigates at a relatively constant rate year-round, while evapotranspiration by the alfalfa and grass crops grown is seasonal. We use field data from two sites and computer simulations of unsaturated flow to understand water and solute movements in the SDI fields. Combined irrigation and precipitation exceed potential evapotranspiration by 300-480 mm annually. Initially, excess water contributes to increased storage in the unsaturated zone, and then drainage causes cyclical rises in the water table beneath the fields. Native chloride and nitrate below 200 cm depth are leached by the drainage. Some CBM water moves upward from the drip tubing, drawn by drier conditions above. Chloride from CBM water accumulates there as root uptake removes the water. Year over year accumulations indicated by computer simulations illustrate that infiltration of precipitation water from the surface only partially leaches such accumulations away. Field data show that 7% and 27% of added chloride has accumulated above the drip tubing in an alfalfa and grass field, respectively, following 6 years of irrigation. Maximum chloride concentrations in the alfalfa field are around 45 cm depth but reach the surface in parts of the grass field, illustrating differences driven by crop physiology. Deep SDI offers a means of utilizing marginal quality irrigation waters and managing the accumulation of their associated solutes in the crop rooting zone.
-
Clark, Melanie L.; Davidson, Seth L.
2009-01-01
Southwestern Wyoming is an area of diverse scenery, wildlife, and natural resources that is actively undergoing energy development. The U.S. Department of the Interior's Wyoming Landscape Conservation Initiative is a long-term science-based effort to assess and enhance aquatic and terrestrial habitats at a landscape scale, while facilitating responsible energy development through local collaboration and partnerships. Water-quality monitoring has been conducted by the U.S. Geological Survey on the Green River near Green River, Wyoming, and Muddy Creek near Baggs, Wyoming. This monitoring, which is being conducted in cooperation with State and other Federal agencies and as part of the Wyoming Landscape Conservation Initiative, is in response to concerns about potentially increased dissolved solids in the Colorado River Basin as a result of energy development. Because of the need to provide real-time dissolved-solids concentrations for the Green River and Muddy Creek on the World Wide Web, the U.S. Geological Survey developed regression equations to estimate dissolved-solids concentrations on the basis of continuous specific conductance using relations between measured specific conductance and dissolved-solids concentrations. Specific conductance and dissolved-solids concentrations were less varied and generally lower for the Green River than for Muddy Creek. The median dissolved-solids concentration for the site on the Green River was 318 milligrams per liter, and the median concentration for the site on Muddy Creek was 943 milligrams per liter. Dissolved-solids concentrations ranged from 187 to 594 milligrams per liter in samples collected from the Green River during water years 1999-2008. Dissolved-solids concentrations ranged from 293 to 2,485 milligrams per liter in samples collected from Muddy Creek during water years 2006-08. The differences in dissolved-solids concentrations in samples collected from the Green River compared to samples collected from Muddy
-
International Nuclear Information System (INIS)
Stefanescu, Ion; Steflea, Dumitru; Saros-Rogobete, Irina; Titescu, Gheorghe; Tamaian, Radu
2001-01-01
Deuterium-depleted water represents water that has an isotopic content smaller than 145 ppm D/(D+H) which is the natural isotopic content of water. Deuterium depleted water is produced by vacuum distillation in columns equipped with structured packing made from phosphor bronze or stainless steel. Deuterium-depleted water, the production technique and structured packing are patents of National Institute of Research - Development for Cryogenics and Isotopic Technologies at Rm. Valcea. Researches made in the last few years showed the deuterium-depleted water is a biological active product that could have many applications in medicine and agriculture. (authors)
-
Chung, W S; Yu, M J; Lee, H D
2004-01-01
The drinking water network serving Korea has been used for almost 100 years. Therefore, pipelines have suffered various degrees of deterioration due to aggressive environments. The pipe breaks were caused by in-external corrosion, water hammer, surface loading, etc. In this paper, we focused on describing corrosion status in water distribution pipes in Korea and reviewing some methods to predict corrosion rates. Results indicate that corrosive water of lakes was more aggressive than river water and the winter was more aggressive compared to other seasons. The roughness growth rates of Dongbok lake showed 0.23 mm/year. The high variation of corrosion rates is controlled by the aging pipes and smaller diameter. Also the phenolphthalein test on a cementitious core of cement mortar lined ductile cast iron pipe indicated the pipes over 15 years old had lost 50-100% of their lime active cross sectional area.
-
Padhye, Lokesh P; Yao, Hong; Kung'u, Francis T; Huang, Ching-Hua
2014-03-15
The occurrence and removal of thirty representative pharmaceutical and personal care products (PPCPs) and endocrine disrupting chemicals (EDCs) in an urban drinking water treatment plant (DWTP) were investigated for a period of one year to evaluate current system's treatment efficacy and assess occurrence of PPCPs and EDCs in finished drinking water. Results showed that the average total PPCPs and EDCs concentration in the surface water source was around 360 ng/L (median concentration = 340 ng/L) with 57% coefficient of variation (CV). The median concentrations of most of the individual PPCPs and EDCs in the surface water were below 15 ng/L except for N,N-diethyltoluamide (DEET) and nonylphenol, which were at 122 and 83 ng/L, respectively. The compounds DEET, nonylphenol, ibuprofen, triclosan, atrazine, tris(2-chloroethyl)-phosphate (TCEP), bisphenol-A, and caffeine (in the order of decreasing median concentration) were among twenty compounds detected at least once in the surface water, while all of the above detected compounds, except two, were also detected in the finished drinking water. The average total PPCPs and EDCs concentration in the finished drinking water was around 98 ng/L (median concentration = 96 ng/L) with 66% CV. The median concentrations of most detected PPCPs and EDCs in drinking water were below 5 ng/L except for DEET and nonylphenol, which were at 12 and 20 ng/L, respectively. There was a strong correlation (r = 0.97) between PPCPs and EDCs' concentrations in the source water and in the drinking water over the one-year study period when data points from two sampling events with unusual removals were excluded. Individual water treatment unit processes showed greater temporal variations of PPCPs and EDCs removal efficiencies than the overall treatment processes. The removal efficiencies also varied greatly among different PPCPs and EDCs. The average removal for total PPCPs and EDCs was 76 ± 18% at the DWTP, with ozonation
-
2012-02-29
... Water Treatment Rule: Uncovered Finished Water Reservoirs; Public Meeting AGENCY: Environmental... review of the uncovered finished water reservoir requirement in the Long Term 2 Enhanced Surface Water... uncovered finished water reservoir requirement and the agency's Six Year Review process. EPA also plans to...
-
International Nuclear Information System (INIS)
2005-01-01
The symposium on world water day for the year 2005 was held on 22nd March by the Pakistan Engineering congress in collaboration with Water and Power Development Authority (WAPDA). Six technical papers by engineers/experts presented on the diverse fields from large dams to drinking water and public hygiene. Paper published in this volume are open for written discussion. (orig./A.B.)
-
Effects of Water Level Increase on Phytoplankton Assemblages in a Drinking Water Reservoir
Directory of Open Access Journals (Sweden)
Yangdong Pan
2018-03-01
Full Text Available Excessive water level fluctuation may affect physico-chemical characteristics, and consequently ecosystem function, in lakes and reservoirs. In this study, we assessed the changes of phytoplankton assemblages in response to water level increase in Danjiangkou Reservoir, one of the largest drinking water reservoirs in Asia. The water level increased from a low of 137 m to 161 m in 2014 as a part of the South–North Water Diversion Project. Phytoplankton assemblages were sampled four times per year before, during and after the water level increase, at 10 sites. Environmental variables such as total nitrogen as well as phytoplankton biomass decreased after the water level increase. Non-metric multi-dimensional scaling analysis indicated that before the water level increase, phytoplankton assemblages showed distinct seasonal variation with diatom dominance in both early and late seasons while such seasonal variation was much less evident after the water level increase. Month and year (before and after explained 13% and 6% of variance in phytoplankton assemblages (PERMANOVA, p < 0.001 respectively, and phytoplankton assemblages were significantly different before and after the water level increase. Both chlorophytes and cyanobacteria became more abundant in 2015. Phytoplankton compositional change may largely reflect the environmental changes, such as hydrodynamics mediated by the water level increase.
-
Applicability of adapted reservoir operation for water stress mitigation under dry year conditions
Olsson, O.; Ikramova, M.; Bauer, M.; Froebrich, J.
2010-01-01
This paper introduces the conjunctive use of a deterministic water quality model and water balance criteria for supporting the assessment of simulation and to evaluate the effectiveness of proposed operation strategies. By this, the applicability of enhanced reservoir operation strategies addressing
-
International Nuclear Information System (INIS)
Tansel, B.; Fuentes, C.; Sanchez, M.; Predoi, K.; Acevedo, M.
2011-01-01
Highlights: ► The half-lives of PAHs in the deep waters (over 1000 m) are about twice longer than the shallow areas (100–150 m). ► In the water column, anthracene levels can decrease by 50% within 1–2 days. ► The half-lives of the PAHs in the sediments are significantly longer than those in the water column. ► The half-life of pyrene in the shallow and deep sediments is 9 and 16 years, respectively. - Abstract: Persistence profiles of selected polyaromatic hydrocarbons (PAHs) were analyzed depending on temperature variations in the water column and water–sediment interactions in the Gulf of Mexico. The PAHs studied include anthracene, fluoranthene, pyrene, and chrysene. The half-lives of PAHs in the deep waters (over 1000 m) are about twice as long as those in the shallow areas (100–150 m), and almost 2.5 times as long as those in the top layer (0–10 m) of the water column. The half-lives of the PAHs in the sediments are significantly longer. Among the PAHs studied, chrysene is the most persistent in the water column, and pyrene is the most persistent in the sediments. The half-life of chrysene in the shallow and deep waters is over 2.5 and about 5 years, respectively. For pyrene, the half-life in the shallow and deep sediments is about 9 and 16 years, respectively.
-
Chanat, Jeffrey G.; Moyer, Douglas L.; Blomquist, Joel D.; Hyer, Kenneth E.; Langland, Michael J.
2016-01-13
In the Chesapeake Bay watershed, estimated fluxes of nutrients and sediment from the bay’s nontidal tributaries into the estuary are the foundation of decision making to meet reductions prescribed by the Chesapeake Bay Total Maximum Daily Load (TMDL) and are often the basis for refining scientific understanding of the watershed-scale processes that influence the delivery of these constituents to the bay. Two regression-based flux and trend estimation models, ESTIMATOR and Weighted Regressions on Time, Discharge, and Season (WRTDS), were compared using data from 80 watersheds in the Chesapeake Bay Nontidal Water-Quality Monitoring Network (CBNTN). The watersheds range in size from 62 to 70,189 square kilometers and record lengths range from 6 to 28 years. ESTIMATOR is a constant-parameter model that estimates trends only in concentration; WRTDS uses variable parameters estimated with weighted regression, and estimates trends in both concentration and flux. WRTDS had greater explanatory power than ESTIMATOR, with the greatest degree of improvement evident for records longer than 25 years (30 stations; improvement in median model R2= 0.06 for total nitrogen, 0.08 for total phosphorus, and 0.05 for sediment) and the least degree of improvement for records of less than 10 years, for which the two models performed nearly equally. Flux bias statistics were comparable or lower (more favorable) for WRTDS for any record length; for 30 stations with records longer than 25 years, the greatest degree of improvement was evident for sediment (decrease of 0.17 in median statistic) and total phosphorus (decrease of 0.05). The overall between-station pattern in concentration trend direction and magnitude for all constituents was roughly similar for both models. A detailed case study revealed that trends in concentration estimated by WRTDS can operationally be viewed as a less-constrained equivalent to trends in concentration estimated by ESTIMATOR. Estimates of annual mean flow
-
Null, S. E.; Elmore, L.; Mouzon, N. R.; Wood, J. R.
2016-12-01
More than 25 million cubic meters (20,000 acre feet) of water has been purchased from willing agricultural sellers for environmental flows in Nevada's Walker River to improve riverine habitat and connectivity with downstream Walker Lake. Reduced instream flows limit native fish populations, like Lahontan cutthroat trout, through warm daily stream temperatures and low dissolved oxygen concentrations. Environmental water purchases maintain instream flows, although effects on water quality are more varied. We use multi-year water quality monitoring and physically-based hydrodynamic and water quality modeling to estimate streamflow, water temperature, and dissolved oxygen concentrations with alternative environmental water purchases. We simulate water temperature and dissolved oxygen changes from increased streamflow to prioritize the time periods and locations that environmental water purchases most enhance trout habitat as a function of water quality. Monitoring results indicate stream temperature and dissolved oxygen limitations generally exist in the 115 kilometers upstream of Walker Lake (about 37% of the study area) from approximately May through September, and this reach acts as a water quality barrier for fish passage. Model results indicate that low streamflows generally coincide with critically warm stream temperatures, water quality refugia exist on a tributary of the Walker River, and environmental water purchases may improve stream temperature and dissolved oxygen conditions for some reaches and seasons, especially in dry years and prolonged droughts. This research supports environmental water purchase decision-making and allows water purchase decisions to be prioritized with other river restoration alternatives.
-
Water Label to Improve Water Billing in Spanish Households
Directory of Open Access Journals (Sweden)
Ana Castillo-Martinez
2014-05-01
Full Text Available A significant decrease in water consumption has been achieved in recent years thanks to different campaigns run by different institutions in Spain. However, most citizens do not have a very clear idea about whether or not they are efficiently using water. To solve this situation, this paper aims is to develop two water labels in order to improve the current water billing. These water labels evaluate the total water consumption and the domestic hot water consumption. To make the tags, several research studies were tackled for establishing consumer trends and behavior patterns. Furthermore, a survey and data collection were conducted to obtain updated values to validate information obtained from previous studies. The result are two water labels that establish six different levels to graphically show the efficiency, and they also include a comparison with the average consumption by customers of the same province. To ensure that the benefits of this evaluation are available to citizens, its inclusion on the water bill is proposed.
-
Experimental Research of a Water-Source Heat Pump Water Heater System
Zhongchao Zhao; Yanrui Zhang; Haojun Mi; Yimeng Zhou; Yong Zhang
2018-01-01
The heat pump water heater (HPWH), as a portion of the eco-friendly technologies using renewable energy, has been applied for years in developed countries. Air-source heat pump water heaters and solar-assisted heat pump water heaters have been widely applied and have become more and more popular because of their comparatively higher energy efficiency and environmental protection. Besides use of the above resources, the heat pump water heater system can also adequately utilize an available wat...
-
Leopold, Luna Bergere; Langbein, Walter Basil
1960-01-01
When you open the faucet you expect water to flow. And you expect it to flow night or day, summer or winter, whether you want to fill a glass or water the lawn. It should be clean and pure, without any odor.You have seen or read about places where the water doesn't have these qualities. You may have lived in a city where you were allowed to water the lawn only during a few hours of certain days. We know a large town where the water turns brown after every big rainstorm.Beginning shortly after World War II, large areas in the Southwestern United States had a 10-year drought, and newspapers published a lot of information about its effects. Some people say that the growing demand for water will cause serious shortages over much of the country in the next 10 to 40 years. But it has always been true that while water wells and springs dry up in some places, floods may be occurring in other places at the same time.Nearly every month news stories are published describing floods somewhere in the country. In fact, every year, on the average, 75,000 persons are forced from their homes by floods. In some years, as in 1951 when the lower Kansas River experienced a great flood, half a million people are affected. To understand the reasons for such recurring distress, it is necessary to know something about rivers and about the flat land or flood plain that borders the river.Interest in water and related problems is growing as our population increases and as the use of water becomes steadily greater. To help meet this heightened interest in general information about water and its use and control is the reason this primer was written. The primer is in two parts. The first part tells about hydrology, or the science that concerns the relation of water to our earth, and the second part describes the development of water supplies and the use of water. The Geological Survey is publishing this primer in nontechnical language in the hope that it will enable the general reader to
-
Water and waste water management Generation Victoria - Latrobe Valley
Energy Technology Data Exchange (ETDEWEB)
Longmore, G. [Hazelwood Power Corporation, VIC (Australia); Pacific Power (International) Pty. Ltd., Sydney, NSW (Australia)
1995-12-31
Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled `SECV Latrobe Valley Water and Wastewater Management Strategy`. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs.
-
Water and waste water management Generation Victoria - Latrobe Valley
International Nuclear Information System (INIS)
Longmore, G.
1995-01-01
Water is a necessary resource for coal fired power plant and waste water is generated. The efficient management of water and waste water systems becomes an important operational environmental factor. This paper describes the development and implementation of a ten year water and waste water management strategy for the Latrobe Valley Group of brown coal fired power stations in Victoria. In early 1991, a team was put together of representatives from each power site to develop the strategy entitled 'SECV Latrobe Valley Water and Wastewater Management Strategy'. The strategy was developed with extensive public consultation, which was a factor in protracting the process such that the final document was not promulgated until late 1992. However, the final comprehensive document endorsed and agreed by management, has since attracted favourable comment as a model of its type. (author). 2 figs
-
Summary of West Virginia Water-Resource Data through September 2008
Evaldi, R.D.; Ward, S.M.; White, J.S.
2009-01-01
The West Virginia Water Science Center of the U.S. Geological Survey, in cooperation with State and Federal agencies, obtains a large amount of data pertaining to the water resources of West Virginia each water year. A water year is the 12-month period beginning October 1 and ending September 30. These data, accumulated during many years, constitute a valuable database for developing an improved understanding of the water resources of the State. These data are maintained in the National Water Information System (NWIS) and are available through its World-Wide Web interface, NWISWeb, at http://waterdata.usgs.gov/wv/nwis. Data can be retrieved in a variety of common formats, and a tutorial is available at http://nwis.waterdata.usgs.gov/tutorial. Location information for all continuous-record gaging stations operated in West Virginia through September 2008 is provided in this report, as well as statistical summaries of the available daily records. This report can serve as an index to the daily records data available on the World-Wide Web. Hydrologic data for nearly all of the gaging stations identified in this report are also available in the annual publication series titled Water-Resources Data - West Virginia. This series of annual reports for West Virginia began with the 1961 water year with a report that contained only data relating to quantities of surface water. For the 1964 water year, a similar report was introduced that contained only data relating to water quality. Beginning with the 1975 water year, the report format was changed to include data on quantities of surface water, quality of surface water and groundwater, and groundwater levels. Prior to the introduction of the Water-Resources Data - West Virginia series and for several water years concurrent with it, water-resources data for West Virginia were published in U.S. Geological Survey Water-Supply Papers. Data on stream discharge and stage and on lake or reservoir contents and stage through September
-
Energy Technology Data Exchange (ETDEWEB)
Goffin, C.; Duvivier, L.; Girasa, E. [LABORELEC, Chemistry of Water (Belgium); Brognez, J. [ELECTRABEL, TIHANGE Nuclear Power Station (Belgium)
2002-07-01
In the late 1970's and early 1980's, with the development of the nuclear programme in many European countries, the recirculation of cooling water in power stations became an issue which required urgent attention. The concentration of several plants of 1000 MW or more on sites along inland waterways actually made simple once-through cooling impossible, owing to the risk of an unacceptable rise in the river's water temperature. The chemical composition of natural freshwater in western European waterways is such that when it becomes slightly concentrated, scale is rapidly formed. The relatively low solubility of calcium carbonate and the degassing of the carbon dioxide during close contact between the water and air in the heat exchangers of the cooling tower explain this precipitation tendency. Fairly soon, experts in the electricity power generation companies highlighted the need for on-site, pilot loop simulations, in order to foresee the physico-chemical phenomena that could arise in industrial installations. The number of financially justifiable processing possibilities could be briefly summarised by the following three solutions: to adapt the concentration factor in order to be under the calcium carbonate solubility limit and thereby avoid the need for any water conditioning; to accept concentration factors of between 1.4 and 1.9 and control the calcium carbonate precipitation through controlled acid injection in the circulation water; to raise the concentration factor over 5 and soften the makeup water through the addition of lime and flocculant. The last of these solutions was rarely ever used in Belgium and France. It was however widely used in Germany. Its application requires a greater investment and leads to higher operating costs than acid injection. Furthermore, it leads to the problem of daily drying and disposal of several dozen tonnes of sludge, which have to be recycled or dumped. In an increasingly stringent environmental context, this
-
International Nuclear Information System (INIS)
Goffin, C.; Duvivier, L.; Girasa, E.; Brognez, J.
2002-01-01
In the late 1970's and early 1980's, with the development of the nuclear programme in many European countries, the recirculation of cooling water in power stations became an issue which required urgent attention. The concentration of several plants of 1000 MW or more on sites along inland waterways actually made simple once-through cooling impossible, owing to the risk of an unacceptable rise in the river's water temperature. The chemical composition of natural freshwater in western European waterways is such that when it becomes slightly concentrated, scale is rapidly formed. The relatively low solubility of calcium carbonate and the degassing of the carbon dioxide during close contact between the water and air in the heat exchangers of the cooling tower explain this precipitation tendency. Fairly soon, experts in the electricity power generation companies highlighted the need for on-site, pilot loop simulations, in order to foresee the physico-chemical phenomena that could arise in industrial installations. The number of financially justifiable processing possibilities could be briefly summarised by the following three solutions: to adapt the concentration factor in order to be under the calcium carbonate solubility limit and thereby avoid the need for any water conditioning; to accept concentration factors of between 1.4 and 1.9 and control the calcium carbonate precipitation through controlled acid injection in the circulation water; to raise the concentration factor over 5 and soften the makeup water through the addition of lime and flocculant. The last of these solutions was rarely ever used in Belgium and France. It was however widely used in Germany. Its application requires a greater investment and leads to higher operating costs than acid injection. Furthermore, it leads to the problem of daily drying and disposal of several dozen tonnes of sludge, which have to be recycled or dumped. In an increasingly stringent environmental context, this solution is no
-
Water mineralization and its importance for health
N. Babio; C. Ferreira-Pêgo; F. Maraver Eyzaguirre; I. Vitoria Miñana; J. Salas-Salvadó
2016-01-01
Water mineralization and its importance for health La mineralización del agua y su importancia para la salud. Water is essential for life, participating in the metabolism of all the living organisms. In recent years, the consumption of tap water has decreased and the consumption of bottled water has increased worldwide. The mineral quality and composition of natural mineral water is known and constantly over the year, and their potential effects on health must be determined. Only magnes...
-
International Nuclear Information System (INIS)
Johnson, Timothy E.; Zhang, Xiaohua; Shi, Shu; Umbenhauer, Diane R.
2005-01-01
Statins and fibrates (weak PPARα agonists) are prescribed for the treatment of lipid disorders. Both drugs cause myopathy, but with a low incidence, 0.1-0.5%. However, combined statin and fibrate therapy can enhance myopathy risk. We tested the myotoxic potential of PPAR subtype selective agonists alone and in combination with statins in a differentiated rat myotube model. A pharmacologically potent experimental PPARα agonist, Compound A, induced myotoxicity as assessed by TUNEL staining at a minimum concentration of 1 nM, while other weaker PPARα compounds, for example, WY-14643, Gemfibrozil and Bezafibrate increased the percentage of TUNEL-positive nuclei at micromolar concentrations. In contrast, the PPARγ agonist Rosiglitazone caused little or no cell death at up to 10 μM and the PPARδ ligand GW-501516 exhibited comparatively less myotoxicity than that seen with Compound A. An experimental statin (Compound B) and Atorvastatin also increased the percentage of TUNEL-positive nuclei and co-treatment with WY-14643, Gemfibrozil or Bezafibrate had less than a full additive effect on statin-induced cell killing. The mechanism of PPARα agonist-induced cell death was different from that of statins. Unlike statins, Compound A and WY-14643 did not activate caspase 3/7. In addition, mevalonate and geranylgeraniol reversed the toxicity caused by statins, but did not prevent the cell killing induced by WY-14643. Furthermore, unlike statins, Compound A did not inhibit the isoprenylation of rab4 or rap1a. Interestingly, Compound A and Compound B had differential effects on ATP levels. Taken together, these observations support the hypothesis that in rat myotube cultures, PPARα agonism mediates in part the toxicity response to PPARα compounds. Furthermore, PPARα agonists and statins cause myotoxicity through distinct and independent pathways
-
Energy Technology Data Exchange (ETDEWEB)
Johnson, Timothy E [Department of Safety Assessment, Merck Research Laboratories, WP45-319, Merck Research Laboratories, West Point, PA 19486 (United States); Zhang, Xiaohua [Department of Biometrics Research, Merck Research Laboratories, West Point, PA 19486 (United States); Shi, Shu [Department of Safety Assessment, Merck Research Laboratories, WP45-319, Merck Research Laboratories, West Point, PA 19486 (United States); Umbenhauer, Diane R [Department of Safety Assessment, Merck Research Laboratories, WP45-319, Merck Research Laboratories, West Point, PA 19486 (United States)
2005-11-01
Statins and fibrates (weak PPAR{alpha} agonists) are prescribed for the treatment of lipid disorders. Both drugs cause myopathy, but with a low incidence, 0.1-0.5%. However, combined statin and fibrate therapy can enhance myopathy risk. We tested the myotoxic potential of PPAR subtype selective agonists alone and in combination with statins in a differentiated rat myotube model. A pharmacologically potent experimental PPAR{alpha} agonist, Compound A, induced myotoxicity as assessed by TUNEL staining at a minimum concentration of 1 nM, while other weaker PPAR{alpha} compounds, for example, WY-14643, Gemfibrozil and Bezafibrate increased the percentage of TUNEL-positive nuclei at micromolar concentrations. In contrast, the PPAR{gamma} agonist Rosiglitazone caused little or no cell death at up to 10 {mu}M and the PPAR{delta} ligand GW-501516 exhibited comparatively less myotoxicity than that seen with Compound A. An experimental statin (Compound B) and Atorvastatin also increased the percentage of TUNEL-positive nuclei and co-treatment with WY-14643, Gemfibrozil or Bezafibrate had less than a full additive effect on statin-induced cell killing. The mechanism of PPAR{alpha} agonist-induced cell death was different from that of statins. Unlike statins, Compound A and WY-14643 did not activate caspase 3/7. In addition, mevalonate and geranylgeraniol reversed the toxicity caused by statins, but did not prevent the cell killing induced by WY-14643. Furthermore, unlike statins, Compound A did not inhibit the isoprenylation of rab4 or rap1a. Interestingly, Compound A and Compound B had differential effects on ATP levels. Taken together, these observations support the hypothesis that in rat myotube cultures, PPAR{alpha} agonism mediates in part the toxicity response to PPAR{alpha} compounds. Furthermore, PPAR{alpha} agonists and statins cause myotoxicity through distinct and independent pathways.
-
A 2-D process-based model for suspended sediment dynamics: a first step towards ecological modeling
Achete, F. M.; van der Wegen, M.; Roelvink, D.; Jaffe, B.
2015-06-01
In estuaries suspended sediment concentration (SSC) is one of the most important contributors to turbidity, which influences habitat conditions and ecological functions of the system. Sediment dynamics differs depending on sediment supply and hydrodynamic forcing conditions that vary over space and over time. A robust sediment transport model is a first step in developing a chain of models enabling simulations of contaminants, phytoplankton and habitat conditions. This works aims to determine turbidity levels in the complex-geometry delta of the San Francisco estuary using a process-based approach (Delft3D Flexible Mesh software). Our approach includes a detailed calibration against measured SSC levels, a sensitivity analysis on model parameters and the determination of a yearly sediment budget as well as an assessment of model results in terms of turbidity levels for a single year, water year (WY) 2011. Model results show that our process-based approach is a valuable tool in assessing sediment dynamics and their related ecological parameters over a range of spatial and temporal scales. The model may act as the base model for a chain of ecological models assessing the impact of climate change and management scenarios. Here we present a modeling approach that, with limited data, produces reliable predictions and can be useful for estuaries without a large amount of processes data.
-
A 2-D process-based model for suspended sediment dynamics: A first step towards ecological modeling
Achete, F. M.; van der Wegen, M.; Roelvink, D.; Jaffe, B.
2015-01-01
In estuaries suspended sediment concentration (SSC) is one of the most important contributors to turbidity, which influences habitat conditions and ecological functions of the system. Sediment dynamics differs depending on sediment supply and hydrodynamic forcing conditions that vary over space and over time. A robust sediment transport model is a first step in developing a chain of models enabling simulations of contaminants, phytoplankton and habitat conditions. This works aims to determine turbidity levels in the complex-geometry delta of the San Francisco estuary using a process-based approach (Delft3D Flexible Mesh software). Our approach includes a detailed calibration against measured SSC levels, a sensitivity analysis on model parameters and the determination of a yearly sediment budget as well as an assessment of model results in terms of turbidity levels for a single year, water year (WY) 2011. Model results show that our process-based approach is a valuable tool in assessing sediment dynamics and their related ecological parameters over a range of spatial and temporal scales. The model may act as the base model for a chain of ecological models assessing the impact of climate change and management scenarios. Here we present a modeling approach that, with limited data, produces reliable predictions and can be useful for estuaries without a large amount of processes data.
-
Energy Technology Data Exchange (ETDEWEB)
Sehgal, B.R.; Park, H.S.; Nayak, A.K.; Hansson, R.C.; Chiferaw, D.; Stepanyan, A.; Rao, R.S.; Karbojian, A. [Royal Inst. of Technology, Stockholm (Sweden). Div. of Nuclear Power Safety
2005-04-01
This report presents descriptions of the major results obtained in the research program 'Melt-Structure-Water Interaction (MSWI)' at NPS/RIT during the year 2004. The primary objectives of the MSWI Project in year 2004 were to study (1) the in-vessel and exvessel melt/debris bed coolability process when melt is flooded with water, and (2) the energetics and characteristics of steam explosions. Our general approaches are to establish scaling relationships so that the data obtained in the experiments could be extended to prototypical accident geometries and conditions, develop phenomenological or computational models for the processes under investigation and validate the existing and newly developed models against data obtained at RIT and at other laboratories. In 2004, several experimental programs, such as the COMECO (Corium MElt COolability), POMECO (POrous MEdia COolability) and MISTEE (Micro-Interactions in STeam Explosion Experiments) programs were continued. The SIMECO (Simulation of MElt Coolability) program was restarted in 2004. The construction of the POMECO-GRAND (POrous MEdia COolability) facility was delayed due to lack of finances. However, existing POMECO facility was modified to study 3-D effects on debris coolability. In this report, the results from the COMECO experiment with high temperature oxidic melt, from the POMECO experiments for the multi-dimensional effects on debris bed coolability, from the SIMECO experiment for three-layer pool configuration and from the MISTEE experiments for steam explosion characteristics and loads are described. For analytical efforts, results from the COMETA code for the entire process of the steam explosions are discussed.
-
75 FR 11881 - Environmental Impacts Statements; Notice of Availability
2010-03-12
... No. 20100069, Draft EIS, BLM, WY, Buckskin Mine Hay Creek II Project, Coal Lease Application WYW..., Wallops Flight Facility, Shoreline Restoration and Infrastructure Protection Program, Implementation...
-
Barton, H
2010-03-01
Zinc (Zn) exposure in pre-school children via household drinking water collected by a double sampling method (morning, evening) was evaluated in a sample of the Polish population. Zn concentration was measured by flame atomic absorption spectrometry. Rural and suburban Krakow sites were non-distinguishable in respect of Zn concentrations. However, significantly lower Zn was found in urban as compared with non-urban sites [geometric mean (95% confidence interval) 0.14 (0.01-1.95) mg l(-1) versus 0.52 (0.03-10.2) mg l(-1), p water standing overnight in pipelines were higher in all sites by 0.36 mg l(-1) on average, but observed really contaminations were higher. The Zn limit based on the taste and colour of drinking water (3 mg l(-1)) was exceeded in 1% and 10% of households from urban and non-urban sites, respectively. The Zn intake predictions for evening water samples for 6-year-old children averaged between 2% and 9% of the recommended dietary allowance (RDA, 10 mg day(-1)) for urban and non-urban sites, respectively. Mean Zn intake prediction for the exceedance fraction was 64% of RDA. In conclusion, overnight contamination of drinking water from in-house pipelines was significant and common to all sites investigated. Secondly, drinking water can be considered a significant contributor to dietary Zn intake by children in non-urban sites and may shift the population borderline of deficiency.
-
Automated Water-Purification System
Ahlstrom, Harlow G.; Hames, Peter S.; Menninger, Fredrick J.
1988-01-01
Reverse-osmosis system operates and maintains itself with minimal human attention, using programmable controller. In purifier, membranes surround hollow cores through which clean product water flows out of reverse-osmosis unit. No chemical reactions or phase changes involved. Reject water, in which dissolved solids concentrated, emerges from outer membrane material on same side water entered. Flow controls maintain ratio of 50 percent product water and 50 percent reject water. Membranes expected to last from 3 to 15 years.
-
Baker, S.; Berryman, E.; Hawbaker, T. J.; Ewers, B. E.
2015-12-01
While much attention has been focused on large scale forest disturbances such as fire, harvesting, drought and insect attacks, small scale forest disturbances that create gaps in forest canopies and below ground root and mycorrhizal networks may accumulate to impact regional scale carbon budgets. In a lodgepole pine (Pinus contorta) forest near Fox Park, WY, clusters of 15 and 30 trees were removed in 1988 to assess the effect of tree gap disturbance on fine root density and nitrogen transformation. Twenty seven years later the gaps remain with limited regeneration present only in the center of the 30 tree plots, beyond the influence of roots from adjacent intact trees. Soil respiration was measured in the summer of 2015 to assess the influence of these disturbances on carbon cycling in Pinus contorta forests. Positions at the centers of experimental disturbances were found to have the lowest respiration rates (mean 2.45 μmol C/m2/s, standard error 0.17 C/m2/s), control plots in the undisturbed forest were highest (mean 4.15 μmol C/m2/s, standard error 0.63 C/m2/s), and positions near the margin of the disturbance were intermediate (mean 3.7 μmol C/m2/s, standard error 0.34 C/m2/s). Fine root densities, soil nitrogen, and microclimate changes were also measured and played an important role in respiration rates of disturbed plots. This demonstrates that a long-term effect on carbon cycling occurs when gaps are created in the canopy and root network of lodgepole forests.
-
Norton, Parker A.; Anderson, Mark T.; Stamm, John F.
2014-01-01
The Missouri River and its tributaries are an important resource that serve multiple uses including agriculture, energy, recreation, and municipal water supply. Understanding historical streamflow characteristics provides relevant guidance to adaptive management of these water resources. Streamflow records in the Missouri River watershed were examined for trends in time series of annual, seasonal, and monthly streamflow. A total of 227 streamgages having continuous observational records for water years 1960–2011 were examined. Kendall’s tau nonparametric test was used to determine statistical significance of trends in annual, seasonal, and monthly streamflow. A trend was considered statistically significant for a probability value less than or equal to 0.10 that the Kendall’s tau value equals zero. Significant trends in annual streamflow were indicated for 101 out of a total of 227 streamgages. The Missouri River watershed was divided into six watershed regions and trends within regions were examined. The western and the southern parts of the Missouri River watershed had downward trends in annual streamflow (56 streamgages), whereas the eastern part of the watershed had upward trends in streamflow (45 streamgages). Seasonal and monthly streamflow trends reflected prevailing annual streamflow trends within each watershed region.
-
The seawater desalination needs of Tunisia after the year 2010
International Nuclear Information System (INIS)
Ben-Kraiem, H.
2000-01-01
The supply of drinking water for north and central Tunisia is guaranteed from surface water resources in the north and other subsurface resources. These resources will satisfy the water demand in this region until the year 2010 and 100000 m 3 /d by the year 2015. In the south of Tunisia, the water supply comes from local subsurface resources, including the lake water of the chotts. Maximum exploitation of these lakes, whose average salinity exceeds 2 g/l, has already been reached. Therefore, non-conventional resources such as desalination have become unavoidable if the water quality is to be improved and the resources are to be maximized. The needs of this region will reach 80000 m 3 /d by the year 2010. This deficit can only be met by the desalination of seawater. At present, about 60000 m 3 /d of water is desalinated in the country using the reverse osmosis process and electric energy. (author)
-
Directory of Open Access Journals (Sweden)
Bartosz Piwowarski
2012-06-01
Full Text Available Glyceria striata (Lam. Hitchc. is a North American species that has been recorded in most, semi-natural habitats in Europe, e.g. in meadows, bog springs, margins of water bodies. It is circumscribed within two taxa of lower rank: G. striata subsp. striata and G. striata subsp. stricta. Only G. striata subsp. stricta has been reported from Europe. This paper gives a list of the European locali- ties of the species (48 and describes two newly discovered localities in Poland (the Wyżyna Małopolska upland and the Western Carpathian Mts.. The distribution of G. striata in Europe is mapped and potential migration routes of the species are discussed.
-
A continuing 30-year decline in water quality of Jiaojiang Estuary, China
Directory of Open Access Journals (Sweden)
Chun-ye Wang
2015-01-01
Full Text Available A quantitative description of a long-term series of aquatic environmental factors and their spatial distributions was generated using measured data from the Jiaojiang Estuary from 1982 to 2011. The aquatic environmental factors included suspended matter, salinity, and nutrients. Based on these factors, the aquatic ecosystem health in the Jiaojiang Estuary over the last 30 years was analyzed. The results indicated that the suspended matter concentration in the estuary was mainly affected by the amounts of suspended sediment and solid waste, with the value fluctuating over a long period, and the range of high concentration expanded continually; the salinity was mainly affected by precipitation and surface water resources, showing an overall decreasing trend, and the region with low salinity moved seaward and toward the reclamation areas; and the nutritional status, mainly affected by discharge of industrial wastewater and domestic sewage, was satisfactory in the 1980s and 1990s, but the status became severe in recent years. Reclamation had a great influence on these three factors: high reclamation strength led to a significant increase in the suspended matter concentration and a deterioration of the nutritional status, and the reclamation rate was negatively related with the salinity in the estuary. There was a significant positive correlation between the health status of the aquatic ecosystem and salinity, with a correlation coefficient of 0.93. The correlation coefficient between the health status and nutritional status was −0.71, while the correlation between the suspended matter concentration and health status was not as significant as that of the other two factors. The dynamics of the aquatic environment could be divided into four stages: sustainable health from the 1980s to the 1990s, continued deterioration from 2000 to 2003, improvement from 2004 to 2005, and secondary deterioration from 2006 to 2011. The Jiaojiang Estuary is faced with
-
Improving the water use efficiency of olive trees growing in water harvesting systems
Berliner, Pedro; Leake, Salomon; Carmi, Gennady; Agam, Nurit
2017-04-01
Water is a primary limiting factor for agricultural development in many arid and semi-arid regions in which a runoff generation is a rather frequent event. If conveyed to dyke surrounded plots and ponded, runoff water can thereafter be used for tree production. One of the most promising runoff collection configurations is that of micro-catchments in which water is collected close to the area in which runoff was generated and stored in adjacent shallow pits. The objective of this work was to assess the effect of the geometry of runoff water collection area (shallow pit or trench) on direct evaporative water losses and on the water use efficiency of olive trees grown in them. The study was conducted during the summer of 2013 and 2014. In this study regular micro-catchments with basins of 9 m2 (3 x 3 m) by 0.1 m deep were compared with trenches of one meter deep and one meter wide. Each configuration was replicated three times. One tree was planted in each shallow basin and the distance between trees in the 12 m long trench was four meters. Access tubes for neutron probes were installed in the micro-catchments and trenches (four and seven, respectively) to depths of 2.5 m. Soil water content in the soil profile was monitored periodically throughout drying periods in between simulated runoff events. Transpiration of the trees was estimated from half-hourly sap flow measurements using a Granier system. Total transpiration fluxes were computed for time intervals corresponding to consecutive soil water measurements. During the first year, a large runoff event was simulated by applying once four cubic meters to each plot; and in the second year the same volume of water was split into four applications, simulating a series of small runoff events. In both geometries, trees received the same amount of water per tree. Evaporation from trenches and micro-catchments was estimated as the difference between evapotranspiration obtained computing the differences in total soil water
-
Chemical composition and water quality of Tashlyk Water-cooling reservoir of South-Ukraine NPP
International Nuclear Information System (INIS)
Kosheleva, S.I.; Gajdar, E.M.
1995-01-01
Information about water quality in Tashlyk water reservoir (cooler of South-Ukrainian NPP) during 9 years (1980-1992) is presented. Comparative data about Water Quality of South Bug (its source of water nutrition) and this reservoir point on the periodical pollution by surface waters and industrial wastes with a great contain of sulphates and chlorides. The class of water has been changed from hydrocarbonat calcium to sulfur-chlorine-magnesium or chlorine-natrium. The contain of biogenic and organic components in reservoir's water has been corresponded to the main class of waters satisfactory cleanliness
-
International Nuclear Information System (INIS)
1999-01-01
This plan provides a description of the groundwater and surface water quality monitoring activities planned for calendar year (CY) 2000 at the U.S. Department of Energy (DOE) Y-12 Plant that will be managed by tie Y-12 Plant Groundwater Protection Program (GWPP). Groundwater and surface water monitoring during CY 2000 will be performed in three hydrogeologic regimes at the Y-12 Plant: the Bear Creek Hydrogeologic Regime (Bear Creek Regime), the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime), and the Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime). The Bear Creek and East Fork regimes are located in Bear Creek Valley, and the Chestnut Ridge Regime is located south of the Y-12 Plant (Figure 1). Groundwater and surface water monitoring performed under the auspices of the Y-12 Plant GWPP during CY 2000 will comply with: Tennessee Department of Environment and Conservation regulations governing detection monitoring at nonhazardous Solid Waste Disposal Facilities (SWDF); and DOE Order 5400.1 surveillance monitoring and exit pathway/perimeter monitoring. Some of the data collected for these monitoring drivers also will be used to meet monitoring requirements of the Integrated Water Quality Program, which is managed by Bechtel Jacobs Company LLC. Data from five wells that are monitored for SWDF purposes in the Chestnut Ridge Regime will be used to comply with requirements specified in the Resource Conservation and Recovery Act post closure permit regarding corrective action monitoring. Modifications to the CY 2000 monitoring program may be necessary during implementation. Changes in regulatory or programmatic requirements may alter the analytes specified for selected monitoring wells, or wells could be added or removed from the planned monitoring network. All modifications to the monitoring program will be approved by the Y-12 Plant GWPP manager and documented as addenda to this sampling and analysis plan
-
Directory of Open Access Journals (Sweden)
Igor Štirn
2010-09-01
Full Text Available Young water polo players at age 13 to 14 years were examined once a year in a four- year period using three morphological and eight specific skill tests: body height and mass, vital capacity, swimming at distances 5, 25 and 200 meters, swimming 4x5 meters with changing directions, ball dribbling, vertical jump and reach, vertical eggbeater kick and velocity of a throw at the goal. From the sum of 139 players tested, a group of 73 non-selected and of 66 selected players to the national team (U16, wider selection were formed and checked for differences. Differences in all observed variables (except body mass were found between the groups (P<0.05. One significant discriminant function was revealed (canonical R = 0.52 and the accounted variance was 100 %, P = 0.000. The variables that most differentiated the groups were swimming tests at distances of 25 and 200 meters, followed by vertical-egg beater kick and throwing velocity, while morphological variables differentiated the groups least.
-
Water quality and management of private drinking water wells in Pennsylvania.
Swistock, Bryan R; Clemens, Stephanie; Sharpe, William E; Rummel, Shawn
2013-01-01
Pennsylvania has over three million rural residents using private water wells for drinking water supplies but is one of the few states that lack statewide water well construction or management standards. The study described in this article aimed to determine the prevalence and causes of common health-based pollutants in water wells and evaluate the need for regulatory management along with voluntary educational programs. Water samples were collected throughout Pennsylvania by Master Well Owner Network volunteers trained by Penn State Extension. Approximately 40% of the 701 water wells sampled failed at least one health-based drinking water standard. The prevalence of most water quality problems was similar to past studies although both lead and nitrate-N were reduced over the last 20 years. The authors' study suggests that statewide water well construction standards along with routine water testing and educational programs to assist water well owners would result in improved drinking water quality for private well owners in Pennsylvania.
-
1992-01-01
After 18 years of research into air/water pollution at Stennis Space Center, Dr. B. C. Wolverton formed his own company, Wolverton Environmental Services, Inc., to provide technology and consultation in air and water treatment. Common houseplants are used to absorb potentially harmful materials from bathrooms and kitchens. The plants are fertilized, air is purified, and wastewater is converted to clean water. More than 100 U.S. communities have adopted Wolverton's earlier water hyacinth and artificial marsh applications. Catfish farmers are currently evaluating the artificial marsh technology as a purification system.
-
Stable water isotopes suggest sub-canopy water recycling in a northern forested catchment
Mark B. Green; Bethany K. Laursen; John L. Campbell; Kevin J. McGuire; Eric P. Kelsey
2015-01-01
Stable water isotopes provide a means of tracing many hydrologic processes, including poorly understood dynamics like soil water interactions with the atmosphere. We present a four-year dataset of biweekly water isotope samples from eight fluxes and stores in a headwater catchment at the Hubbard Brook Experimental Forest, New Hampshire, USA. We use Dansgaard's...
-
Zhao, Xu; Yang, Hong; Yang, Zhifeng; Chen, Bin; Qin, Yan
2010-12-01
The virtual water strategy which advocates importing water intensive products and exporting products with low water intensity is gradually accepted as one of the options for solving water crisis in severely water scarce regions. However, if we count the virtual water embodied in imported products as the water saved for a region, we might overestimate the saving by including the virtual water that is later re-exported in association with the proceeded products made from the originally imported products. This problem can be avoided by accounting for the saved water through calculating water footprint (WF) in domestic final consumptive products. In this paper, an input-output analysis (IOA) based on the water footprint accounting framework is built to account for WF and virtual water trade of final consumptive products in the water stressed Haihe River basin in China for the year 1997, 2000, and 2002. The input-output transaction tables of the three years are constructed. The results show WF of 46.57, 44.52, and 42.71 billion m(3) for the three years, respectively. These volumes are higher than the water used directly in the corresponding years in the basin. A WF intensity (WFI) indicator is then used to assess if the economic activities in the basin are consistent with the virtual water strategy. The temporal change of the WFI is also decomposed by the index number analysis method. The results showed that the basin was silently importing virtual water through the trade of raw and processed food commodities under the background of the whole economic circulation.
-
Liu, Dedi; Guo, Shenglian; Shao, Quanxi; Liu, Pan; Xiong, Lihua; Wang, Le; Hong, Xingjun; Xu, Yao; Wang, Zhaoli
2018-01-01
Human activities and climate change have altered the spatial and temporal distribution of water availability which is a principal prerequisite for allocation of different water resources. In order to quantify the impacts of climate change and human activities on water availability and optimal allocation of water resources, hydrological models and optimal water resource allocation models should be integrated. Given that increasing human water demand and varying water availability conditions necessitate adaptation measures, we propose a framework to assess the effects of these measures on optimal allocation of water resources. The proposed model and framework were applied to a case study of the middle and lower reaches of the Hanjiang River Basin in China. Two representative concentration pathway (RCP) scenarios (RCP2.6 and RCP4.5) were employed to project future climate, and the Variable Infiltration Capacity (VIC) hydrological model was used to simulate the variability of flows under historical (1956-2011) and future (2012-2099) conditions. The water availability determined by simulating flow with the VIC hydrological model was used to establish the optimal water resources allocation model. The allocation results were derived under an extremely dry year (with an annual average water flow frequency of 95%), a very dry year (with an annual average water flow frequency of 90%), a dry year (with an annual average water flow frequency of 75%), and a normal year (with an annual average water flow frequency of 50%) during historical and future periods. The results show that the total available water resources in the study area and the inflow of the Danjiangkou Reservoir will increase in the future. However, the uneven distribution of water availability will cause water shortage problems, especially in the boundary areas. The effects of adaptation measures, including water saving, and dynamic control of flood limiting water levels (FLWLs) for reservoir operation, were
-
Abu Amr, S S; Yassin, M M
2008-11-01
To assess total and faecal coliform contamination in water wells and distribution networks over the past 7 years, and their association with human health in Khan Yunis Governorate, Gaza Strip. Historical data and interview questionnaire. Data were obtained from the Palestinian Ministry of Health on total and faecal coliform contamination in water wells and distribution networks, and on the incidence of water-related diseases in Khan Yunis Governorate. An interview questionnaire was conducted with 210 residents of Khan Yunis Governorate. Total and faecal coliform contamination exceeded the World Health Organization's limit for water wells and networks. However, the contamination percentages were higher in networks than in wells. Diarrhoeal diseases were strongly correlated with faecal coliform contamination in water networks (r=0.98). This is consistent with the finding that diarrhoeal diseases were the most common self-reported diseases among the interviewees. Such diseases were more prevalent among subjects who drank municipal water than subjects who drank desalinated or home-filtered water (odds ratio=2.03). Intermittent water supply, insufficient chlorination and sewage flooding seem to be associated with self-reported diseases. Residents in the Gaza Strip have a good level of knowledge about drinking water contamination, and this is reflected in good practice. Water quality has deteriorated in the Gaza Strip, and this may contribute to the prevalence of water-related diseases. Self-reported diseases among interviewees in Khan Yunis Governorate were associated with source of drinking water, intermittent water supply, insufficient chlorination, sewage flooding and age of water networks.
-
Garrett, Jessica D.
2012-01-01
suspended sediment, increased with streamflow. Nitrogen concentrations (total nitrogen and nitrate plus nitrite) increased with low and moderate streamflows, but decreased with high streamflows. Seasonal patterns observed in constituent concentrations were affected by streamflow, algae blooms, and pesticide application. The various landform regions produced different water-quality responses across the study basins; for example, total phosphorus, suspended sediment, and turbidity were greatest from the steep, loess-dominated southwestern Iowa basins. Nutrient concentrations, though not regulated for drinking water at the study sites, were high compared to drinking-water limits and criteria for protection of aquatic life proposed for other Midwestern states (Iowa criteria for aquatic life have not been proposed). Nitrate plus nitrite concentrations exceeded the drinking-water limit [10 milligrams per liter (mg/L)] in 11 percent of all samples at the 10 sites, and exceeded Minnesota's proposed aquatic life criteria (4.9 mg/L) in 68 percent of samples. The Wisconsin standard for total phosphorus (0.1 mg/L) was exceeded in 92 percent of samples. Ammonia standards, current during sample collection and at publication of this report, for protection of aquatic life were met for all samples, but draft criteria proposed in 2009 to protect more sensitive species like mussels, were exceeded at three sites. Loads and yields also differed among sites and years. The Big Sioux, Little Sioux, and Des Moines Rivers produced the greatest sulfate yields. Mississippi River tributaries had greater chloride yields than Missouri River tributaries. The Big Sioux River also had the lowest silica yields and total nitrogen and nitrate yields, whereas nitrogen yields were greater in the northeastern rivers. The Boyer and Nishnabotna River total phosphorus yields were the greatest in the study. The Boyer River orthophosphate yields were greatest except in 2008, when the Maquoketa River produced the
-
,; Fairfax County, VA
1977-01-01
The United States uses huge quantities of water. In 1976, for example, it was estimated that for each person in the U.S., about 2,000 gallons of water were used daily in homes, offices, farms, and factories. This means that roughly 420 billion gallons of water were pumped, piped, or diverted each day—about 15 percent more than in 1970. By the year 2000, our daily water needs will probably exceed 800 billion gallons.
-
Water: A Source of Life and Culture. Water in Africa.
McKoski, David
The Water in Africa Project was realized over a 2-year period by a team of Peace Corps volunteers. As part of an expanded, detailed design, resources were collected from over 90 volunteers serving in African countries, photos and stories were prepared, and standards-based learning units were created for K-12 students. This unit, "Water as a…
-
Energy Technology Data Exchange (ETDEWEB)
D.R. Coyle; J. Blake; K. Britton; M.; R.G. Campbell; J. Cox; B. Cregg; D. Daniels; M. Jacobson; K. Johnsen; T. McDonald; K. McLeod; E.; D. Robison; R. Rummer; F. Sanchez; J.; B. Stokes; C. Trettin; J. Tuskan; L. Wright; S. Wullschleger
2003-12-31
Coleman, M.D., et. al. 2003. Production of Short-Rotation Woody Crops Grown with a Range of Nutrient and Water Availability: Establishment Report and First-Year Responses. Report. USDA Forest Service, Savannah River, Aiken, SC. 26 pp. Abstract: Many researchers have studied the productivity potential of intensively managed forest plantations. However, we need to learn more about the effects of fundamental growth processes on forest productivity; especially the influence of aboveground and belowground resource acquisition and allocation. This report presents installation, establishment, and first-year results of four tree species (two cottonwood clones, sycamore, sweetgum, and loblolly pine) grown with fertilizer and irrigation treatments. At this early stage of development, irrigation and fertilization were additive only in cottonwood clone ST66 and sweetgum. Leaf area development was directly related to stem growth, but root production was not always consistent with shoot responses, suggesting that allocation of resources varies among treatments. We will evaluate the consequences of these early responses on resource availability in subsequent growing seasons. This information will be used to: (1) optimize fiber and bioenergy production; (2) understand carbon sequestration; and (3) develop innovative applications such as phytoremediation; municipal, industrial, and agricultural wastes management; and protection of soil, air, and water resources.
-
Four billion people facing severe water scarcity.
Mekonnen, Mesfin M; Hoekstra, Arjen Y
2016-02-01
Freshwater scarcity is increasingly perceived as a global systemic risk. Previous global water scarcity assessments, measuring water scarcity annually, have underestimated experienced water scarcity by failing to capture the seasonal fluctuations in water consumption and availability. We assess blue water scarcity globally at a high spatial resolution on a monthly basis. We find that two-thirds of the global population (4.0 billion people) live under conditions of severe water scarcity at least 1 month of the year. Nearly half of those people live in India and China. Half a billion people in the world face severe water scarcity all year round. Putting caps to water consumption by river basin, increasing water-use efficiencies, and better sharing of the limited freshwater resources will be key in reducing the threat posed by water scarcity on biodiversity and human welfare.
-
Improved method of degassing of feed water at Heavy Water Plant, Kota
International Nuclear Information System (INIS)
Krishnan, G.K.; Agrawal, A.K.
1994-01-01
Heavy Water Plant (Kota) processes 450 MT/hr of feed water as the source of deuterium using water/hydrogen sulphide exchange process for the production of heavy water. Plant design has limited the ingress of dissolved oxygen in feed water to 0.2 ppm. However, even this low limit on dissolved oxygen has been found unacceptable during plant operation as over an operational period of 3-4 years accumulation of sulphur due to oxidation of hydrogen sulphide on exchange tower trays poses major operational problems. This paper discusses the results of nitrogen injection used for reducing the ingress of dissolved oxygen in the feed water system of the plant. (author)
-
Chen, Yi
2018-03-01
The comprehensive water quality identification index method is able to assess the general water quality situation comprehensively and represent the water quality classification; water environment functional zone achieves pollution level and standard objectively and systematically. This paper selects 3 representative zones along deep-water channel of Guangzhou port and applies comprehensive water quality identification index method to calculate sea water quality monitoring data for different selected zones from year 2006 to 2014, in order to investigate the temporal variation of water quality along deep-water channel of Guangzhou port. The comprehensive water quality level from north to south presents an increased trend, and the water quality of the three zones in 2014 is much better than in 2006. This paper puts forward environmental protection measurements and suggestions for Pearl River Estuary, provides data support and theoretical basis for studied sea area pollution prevention and control.
-
Lifescience Database Archive (English)
Full Text Available ity*ptrkcyrnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin ...rnnqnry*w *lhvlsiing*ilsqcnnsirynssnr*qrfsih*wsvlc*ikwsyti*qh*c*srfrin t*ywsicldrke**wy*rir*tiitrcfsfivltkwn
-
Tritium concentrations of environmental waters in Aichi Prefecture
International Nuclear Information System (INIS)
Ohnuma, Shoko; Chaya, Kunio
1992-01-01
Tritium concentrations of environmental waters in Aichi Prefecture were determined from 1973 to 1989. They are rain water, river waters and sea waters. In 1970's, tritium concentrations of environmental waters were more than the natural levels under the influence of the atmospheric nuclear tests. However, atmospheric nuclear tests have not been carried out after Oct. 1980 and the tritium concentrations are going to return to the natural levels. Annual means of tritium concentration in 1989 were as follows: 0.67 Bq/l for rain water, 1.1 Bq/l for Kiso river and Shonai river, 0.85 Bq/l for Yahagi river, 0.70 Bq/l for Toyo river, and 0.41 Bq/l for surface sea water. Also tritium concentration of sea bottom water was 0.50±0.28 Bq/l and rather constant yearly. Among environmental waters, only rain water was previously having seasonal variation of tritium concentration and it was showing 'spring peak' when the troposphere and the stratosphere were mixed actively. At present, tritium concentration of rain water has a little seasonal variation, and is slightly lower in summer under the influence of the atmosphere coming over from the ocean. With regard to the direct influence of rain water to river waters, it was found by means of time series analysis that Kiso river was the least affected of river waters and Yahagi river was the most. The apparent residence time, in which rain water stayed in the underground before it flowed out as river water, was presumed to be 4.9 years for Kiso river, 3.6 years for Yahagi river, 2.0 years for Toyo river, respectively. (author)
-
Tritium concentrations of environmental waters in Aichi Prefecture
Energy Technology Data Exchange (ETDEWEB)
Ohnuma, Shoko; Chaya, Kunio (Aichi Prefectural Inst. of Public Health, Nagoya (Japan))
1992-09-01
Tritium concentrations of environmental waters in Aichi Prefecture were determined from 1973 to 1989. They are rain water, river waters and sea waters. In 1970's, tritium concentrations of environmental waters were more than the natural levels under the influence of the atmospheric nuclear tests. However, atmospheric nuclear tests have not been carried out after Oct. 1980 and the tritium concentrations are going to return to the natural levels. Annual means of tritium concentration in 1989 were as follows: 0.67 Bq/l for rain water, 1.1 Bq/l for Kiso river and Shonai river, 0.85 Bq/l for Yahagi river, 0.70 Bq/l for Toyo river, and 0.41 Bq/l for surface sea water. Also tritium concentration of sea bottom water was 0.50[+-]0.28 Bq/l and rather constant yearly. Among environmental waters, only rain water was previously having seasonal variation of tritium concentration and it was showing 'spring peak' when the troposphere and the stratosphere were mixed actively. At present, tritium concentration of rain water has a little seasonal variation, and is slightly lower in summer under the influence of the atmosphere coming over from the ocean. With regard to the direct influence of rain water to river waters, it was found by means of time series analysis that Kiso river was the least affected of river waters and Yahagi river was the most. The apparent residence time, in which rain water stayed in the underground before it flowed out as river water, was presumed to be 4.9 years for Kiso river, 3.6 years for Yahagi river, 2.0 years for Toyo river, respectively. (author).
-
Lévite, Hervé; Sally, Hilmy; Cour, Julien
Like many river basins in South Africa, water resources in the Olifants river basin are almost fully allocated. Respecting the so-called “reserve” (water flow reservation for basic human needs and the environment) imposed by the Water Law of 1998 adds a further dimension, if not difficulty, to water resources management in the basin, especially during the dry periods. Decision makers and local stakeholders (i.e. municipalities, water users’ associations, interest groups), who will soon be called upon to work together in a decentralized manner within Catchment Management Agencies (CMAs) and Catchment Management Committees (CMCs), must therefore be able to get a rapid and simple understanding of the water balances at different levels in the basin. This paper seeks to assess the pros and cons of using the Water Evaluation and Planning (WEAP) model for this purpose via its application to the Steelpoort sub-basin of the Olifants river. This model allows the simulation and analysis of various water allocation scenarios and, above all, scenarios of users’ behavior. Water demand management is one of the options discussed in more detail here. Simulations are proposed for diverse climatic situations from dry years to normal years and results are discussed. It is evident that the quality of data (in terms of availability and reliability) is very crucial and must be dealt with carefully and with good judgment. Secondly, credible hypotheses have to be made about water uses (losses, return flow) if the results are to be meaningfully used in support of decision-making. Within the limits of data availability, it appears that some water users are not able to meet all their requirements from the river, and that even the ecological reserve will not be fully met during certain years. But the adoption of water demand management procedures offers opportunities for remedying this situation during normal hydrological years. However, it appears that demand management alone will not
-
Water pollution control: Twenty-five years of progress and challenges for the new millennium
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-06-01
Consistent with the goals of the new Clean Water Action Plan, the Office of Wastewater Management (OWM) has renewed its commitment to improving the quality of water in the United States for the benefit of all citizens.
-
Process for the preparation of ammonia and heavy water
International Nuclear Information System (INIS)
Mandrin, C.
1980-01-01
A process for the production of ammonia and heavy water comprises the steps of enriching a flow of water with deuterium in a monothermal isotropic process; supplying a first portion of the deuterium-enriched water to a heavy water preparation plant to produce heavy water and hydrogen; storing a second portion of the deuterium-enriched water substantially without interruption during the colder half of a year; electrolytically dissociating the stored deuterium-enriched water substantially without interruption during the wamer half of a year to form hydrogen; storing a portion of the electrolytically-produced hydrogen during said warmer half of a year while supplying the remainder to a synthesis circuit of a synthesizing plant and subsequently supplying the stored hydrogen to the synthesis circuit during said colder half of a year; removing some of the synthesis gas mixture from the synthesis circuit of the synthesizing plant; burning the removed synthesis gas mixture with air to produce a mixture consisting mainly of water and nitrogen; thereafter condensing and separating the water from the mixture of water and nitrogen; supplying the nitrogen of the mixture of water and nitrogen, the hydrogen from the heavy water preparation plant and the electrolytically-produced hydrogen to the synthesis circuit of the synthesizing plant to produce ammonia; and collecting deuterium-depleted water resulting from said burning step and feeding the collected deuterium-depleted water into the monothermal process
-
Robertson, Franklin; Goodman, Steven J.; Christy, John R.; Fitzjarrald, Daniel E.; Chou, Shi-Hung; Crosson, William; Wang, Shouping; Ramirez, Jorge
1993-01-01
This research is the MSFC component of a joint MSFC/Pennsylvania State University Eos Interdisciplinary Investigation on the global water cycle extension across the earth sciences. The primary long-term objective of this investigation is to determine the scope and interactions of the global water cycle with all components of the Earth system and to understand how it stimulates and regulates change on both global and regional scales. Significant accomplishments in the past year are presented and include the following: (1) water vapor variability; (2) multi-phase water analysis; (3) global modeling; and (4) optimal precipitation and stream flow analysis and hydrologic processes.
-
Walker, J.F.; Graczyk, D.J.; Corsi, S.R.; Owens, D.W.; Wierl, J.A.
1995-01-01
The objective of the watershed-management evaluation monitoring program in Wisconsin is to evaluate the effectiveness of best-management practices (BMP) for controlling nonpoint-source contamination in rural and urban watersheds. This report is an annual summary of the data collected for the program by the U.S Geological Survey and a report of the results of several different detailed analyses of the data. A land-use and BMP inventory is ongoing for 12 evaluation monitoring projects to track the sources of nonpoint-source pollution in each watershed and to document implementation of BMP's that may cause changes in the water quality of streams. Updated information is gathered each year, mapped, and stored in a geographic-information-system data base. Summaries of data collected during water years 1989-94 are presented. A water year is the period beginning October 1 and ending September 30; the water year is designated by the calendar year in which it ends. Suspended-sediment and total-phosphorus data (storm loads and annual loads) are summarized for eight rural sites. For all sites, the annual suspended-sediment or suspended-solids load for water year 1993 exceeded the average for the period of data collection; the minimum annual loads were transported in water year 1991 or 1992. Continuous dissolved-oxygen data were collected at seven rural sites during water year 1994. Data for water years 1990-93 are summarized and plotted in terms of percentage of time that a particular concentration is equaled or exceeded. Dissolved-oxygen concentrations in four streams were less than 9 mg/L at least 50 percent of the time, a condition that fails to meet suggested criterion for coldwater streams. The dissolved-oxygen probability curve for one of the coldwater streams is markedly different than the curves for the other streams, perhaps because of differences in aquatic biomass. Blank quality-assurance samples were collected at two of the urban evaluation monitoring sites to
-
Verhagen, H.J.
2000-01-01
Some twenty years ago WIS-dredging has been developed in the Netherlands. By injecting water into the mud layer, the water content of the mud becomes higher, it becomes fluid mud and will start to flow. The advantages of this system are that there is no need of transporting the mud in a hopper, and
-
DCS Hydraulics Submission for Fremont County, WY
Federal Emergency Management Agency, Department of Homeland Security — Recent developments in digital terrain and geospatial database management technology make it possible to protect this investment for existing and future projects to...
-
76 FR 45643 - Wyoming Disaster #WY-00017
2011-07-29
.../2011. Effective Date: 07/22/2011. Physical Loan Application Deadline Date: 09/20/2011. Economic Injury...- Profit organizations that provide essential services of governmental nature may file disaster loan... Elsewhere For Economic Injury: Non-Profit Organizations without Credit Available 3.000 Elsewhere The number...
-
Energy Technology Data Exchange (ETDEWEB)
Elvado Environmental, LLC
2011-09-01
This plan provides a description of the groundwater and surface water quality monitoring activities planned for calendar year (CY) 2012 at the U.S. Department of Energy (DOE) Y-12 National Security Complex (Y-12) that will be managed by the Y-12 Groundwater Protection Program (GWPP). Groundwater and surface water monitoring performed by the GWPP during CY 2012 is in accordance with the following goals: (1) to protect the worker, the public, and the environment; (2) to maintain surveillance of existing and potential groundwater contamination sources; (3) to provide for the early detection of groundwater contamination and determine the quality of groundwater and surface water where contaminants are most likely to migrate beyond the Oak Ridge Reservation property line; (4) to identify and characterize long-term trends in groundwater quality at Y-12; and (5) to provide data to support decisions concerning the management and protection of groundwater resources. Groundwater and surface water monitoring will be performed in three hydrogeologic regimes at Y-12: the Bear Creek Hydrogeologic Regime (Bear Creek Regime), the Upper East Fork Poplar Creek Hydrogeologic Regime (East Fork Regime), and the Chestnut Ridge Hydrogeologic Regime (Chestnut Ridge Regime). The Bear Creek and East Fork regimes are located in Bear Creek Valley and the Chestnut Ridge Regime is located south of Y-12 (Figure A.1). Additional surface water monitoring will be performed north of Pine Ridge along the boundary of the Oak Ridge Reservation. Modifications to the CY 2012 monitoring program may be necessary during implementation. Changes in programmatic requirements may alter the analytes specified for selected monitoring wells or may add or remove wells from the planned monitoring network. Each modification to the monitoring program will be approved by the Y-12 GWPP manager and documented as an addendum to this sampling and analysis plan. The following sections of this report provide details regarding
-
Water-hammer in the feed-water pipes for PWR steam generators
International Nuclear Information System (INIS)
Gonnet, Bernard; Leroy, Claude; Oullion, Jean; Yazidjian, J.-C.
1979-01-01
PWR boiler water feed pipes have been known for several years to be affected by violent water-hammer during start-ups and operation of the plant. In view of the varying results of corrective design modifications in America and Europe, FRAMATOME undertook an experimental research programme which resulted in the adoption of cruciform tubes on the feed-water distributor as the most reliable solution. Subsequent tests at Fessenheim I confirmed the effectiveness of this device [fr
-
Directory of Open Access Journals (Sweden)
Michael J. Lathuillière
2018-03-01
Full Text Available We performed a Water Footprint Sustainability Assessment (WFSA in the Xingu Basin of Mato Grosso (XBMT, Brazil, with the objectives of (1 tracking blue (as surface water and green water (as soil moisture regenerated by precipitation consumption in recent years (2000, 2014; and (2 evaluating agricultural intensification options for future years (2030, 2050 considering the effects of deforestation and climate change on water availability in the basin. The agricultural sector was the largest consumer of water in the basin despite there being almost no irrigation of cropland or pastures. In addition to water use by crops and pasture grass, water consumption attributed to cattle production included evaporation from roughly 9463 ha of small farm reservoirs used to provide drinking water for cattle in 2014. The WFSA showed that while blue and green water consumptive uses were within sustainable limits in 2014, deforestation, cattle confinement, and the use of irrigation to increase cropping frequency could drive water use to unsustainable levels in the future. While land management policies and practices should strive for protection of the remaining natural vegetation, increased agricultural production will require reservoir and irrigation water management to reduce the potential threat of blue water scarcity in the dry season. In addition to providing general guidance for future water allocation decisions in the basin, our study offers an interpretation of blue and green water scarcities with changes in land use and climate in a rapidly evolving agricultural frontier.
-
Surface water, particulate matter, and sediments of inland waters
International Nuclear Information System (INIS)
Mundschenk, H.
1985-01-01
The Bundesanstalt fuer Gewaesserkunde (BfG) since 1958 runs a system for monitoring the surface water and sediments of Federal German waterways in its capacity as a directing water monitoring centre. The data recorded over the years show that the radioactivity released by the various emission sources leads to radionuclide concentrations in water, particulate matter, or sediments that generally are below the detection limits defined in the relevant legal provisions governing monitoring and surveillance of nuclear facilities effluents. Representative examples of measuring methods and results (as for e.g. for H-3) are given. (DG) [de
-
Determinanty przestrzennego zróżnicowania płodności w Polsce w latach 1999-2009
Małgorzata Podogrodzka
2012-01-01
Obserwowane od lat zmiany w natężeniu dzietności oraz wzorca płodności w Polsce nie przebiegają podobnie według województw. Celem artykułu jest ukazanie tych przekształceń oraz określenie czynników je determinujących. Zakładamy, że w regionach charakteryzujących się wyższym zagrożeniem bezrobocia oraz „nowoczesnym” stylem życia będziemy mogli zaobserwować niższą płodność oraz wyższe zaawansowanie wzorca płodności. W przypadku zmiennych określających stabilność zatrudnienia oraz lepszą dostępn...
-
Directory of Open Access Journals (Sweden)
Paś Jacek
2016-10-01
Full Text Available W artykule przedstawiono metodę określenia czasu dyspozycyjnego TD elektronicznego systemu bezpieczeństwa, który porażony jest impulsem przepięcia lub wyładowania atmosferycznego. Czas dyspozycyjny to czas od chwili porażenia elektronicznego sytemu bezpieczeństwa do chwili jego przejścia do stanu zawodności bezpieczeństwa, przy założeniu braku oddziaływania przeciwdziałającego. Zakłóceniem (porażeniem, które występuje w paśmie częstotliwości (0-100 kHz, a skutki działania na ESB mogą być katastroficzne jest wyładowanie atmosferyczne.
-
International Nuclear Information System (INIS)
Wang Shaowei; Liu Zhenyan; Li Yuan; Zhao Keke; Wang Zhigang
2005-01-01
This paper presents a split air conditioner with a new hybrid equipment of energy storage and water heater all year round (ACWES). The authors made a special design on the storage tank to adjust the refrigerant capacity in the storage coils under different functions, instead of adding an accumulator to the system. An ACWES prototype, rebuilt from an original split air conditioner, has been finished, and experimental study of the operation processes of the prototype was done from which some important conclusions and suggestions have been made, which were helpful in the primary design and improvement of an ACWES system for potential users
-
Improved method of degassing of feed water at Heavy Water Plant, Kota
Energy Technology Data Exchange (ETDEWEB)
Krishnan, G K; Agrawal, A K [Heavy Water Plant, Kota (India)
1994-06-01
Heavy Water Plant (Kota) processes 450 MT/hr of feed water as the source of deuterium using water/hydrogen sulphide exchange process for the production of heavy water. Plant design has limited the ingress of dissolved oxygen in feed water to 0.2 ppm. However, even this low limit on dissolved oxygen has been found unacceptable during plant operation as over an operational period of 3-4 years accumulation of sulphur due to oxidation of hydrogen sulphide on exchange tower trays poses major operational problems. This paper discusses the results of nitrogen injection used for reducing the ingress of dissolved oxygen in the feed water system of the plant. (author). 1 fig.
-
Carlson, Carl S.; Desimone, Leslie A.; Weiskel, Peter K.
2008-01-01
Continued population growth and land development for commercial, industrial, and residential uses have created concerns regarding the future supply of potable water and the quantity of ground water discharging to streams in the area of Interstate 495 in eastern Massachusetts. Two ground-water models developed in 2002-2004 for the Assabet and Upper Charles River Basins were used to simulate water supply and land-use scenarios relevant for the entire Interstate-495 corridor. Future population growth, water demands, and commercial and residential growth were projected for year 2030 by the Metropolitan Area Planning Council. To assess the effects of future development on subbasin streamflows, seven scenarios were simulated by using existing computer-based ground-water-flow models with the data projected for year 2030. The scenarios incorporate three categories of projected 2030 water- and land-use data: (1) 2030 water use, (2) 2030 land use, and (3) a combination of 2030 water use and 2030 land use. Hydrologic, land-use, and water-use data from 1997 through 2001 for the Assabet River Basin study and 1989 through 1998 for the Upper Charles River Basin study were used to represent current conditions - referred to as 'basecase' conditions - in each basin to which each 2030 scenario was compared. The effects of projected 2030 land- and water-use change on streamflows in the Assabet River Basin depended upon the time of year, the hydrologic position of the subbasin in the larger basin, and the relative areas of new commercial and residential development projected for a subbasin. Effects of water use and land use on streamflow were evaluated by comparing average monthly nonstorm streamflow (base flow) for March and September simulated by using the models. The greatest decreases in streamflow (up to 76 percent in one subbasin), compared to the basecase, occurred in September, when streamflows are naturally at their lowest level. By contrast, simulated March streamflows
-
AECB staff annual report of Bruce Heavy Water Plant operation for the year 1991
International Nuclear Information System (INIS)
1992-11-01
Bruce Heavy Water Plant operation was acceptably safe in 1991. There were no breaches of any of the regulations issued under the authority of the Atomic Energy Control Act. There was one violation of the operating licence. For one hour on October 30, 1991, water leaving the plant contained more hydrogen sulphide than Ontario regulations allow. There was no threat to public health or safety or harm to the environment as a result of this violation. One worker was overcome by hydrogen sulphide. The worker did not lose consciousness, but had the symptoms of H 2 S poisoning. Ontario Hydro took actions to increase awareness of the Operating Policy and Principles at Bruce Heavy Water Plant during 1991. All personnel attended a training course, and Ontario Hydro is reviewing all Bruce Heavy Water Plant documentation to ensure it is consistent with the Operating Policies and Principles. Ontario Hydro met 13 of 15 safety-related system availability targets. The AECB is satisfied appropriate action is being taken to improve the performance of the other two systems. Ontario Hydro continued to put heavy emphasis on safety training; however, they did not meet some of their other training targets. Ontario Hydro completed all of the planned emergency exercises at Bruce Heavy Water Plant in 1991. (Author)
-
Water Pressure. Water in Africa.
Garrett, Carly Sporer
The Water in Africa Project was realized over a 2-year period by a team of Peace Corps volunteers. As part of an expanded, detailed design, resources were collected from over 90 volunteers serving in African countries, photos and stories were prepared, and standards-based learning units were created for K-12 students. This unit, "Water…
-
Directory of Open Access Journals (Sweden)
Yi Li
2017-02-01
Full Text Available The rapid development of China’s textile industry has led to consumption and pollution of large volumes of water. Therefore, the textile industry has been the focus of water conservation and waste reduction in China’s 13th Five-Year Plan (2016–2020. The premise of sustainable development is to achieve decoupling of economic growth from water consumption and wastewater discharge. In this work, changes in the blue water footprint, grey water footprint, and the total water footprint of the textile industry from 2001 to 2014 were calculated. The relationship between water footprint and economic growth was then examined using the Tapio decoupling model. Furthermore, factors influencing water footprint were determined through logarithmic mean Divisia index (LMDI method. Results show that the water footprint of China’s textile industry has strongly decoupled for five years (2003, 2006, 2008, 2011, and 2013 and weakly decoupled for four years (2005, 2007, 2009, and 2010. A decoupling trend occurred during 2001–2014, but a steady stage of decoupling had not been achieved yet. Based on the decomposition analysis, the total water footprint mainly increased along with the production scale. On the contrary, technical level is the most important factor in inhibiting the water footprint. In addition, the effect of industrial structure adjustment is relatively weak.
-
Directory of Open Access Journals (Sweden)
Renata Piwowarczyk
2012-12-01
Full Text Available The Polish localities of Orobanche ramosa L., branched broomrape, are either extinct or have not been confirmed for many years. This paper presents two new localities of O. ramosa in Poland from the Płaskowyż Proszowicki plateau (Wyżyna Małopolska upland and the Nizina Nadwiślańska lowland (Kotlina Sandomierska basin. Habitat preferences and the abundance at the sites are described. A revised map of the distribution and a historical analysis of preferred hosts in Poland are included. The taxonomy, biology, ecology and control methods of O. ramosa are also discussed.
-
A study of Cirus heavy water system isotopic purity
International Nuclear Information System (INIS)
Thomas, Shibu; Sahu, A.K.; Unni, V.K.P.; Pant, R.C.
2000-01-01
Cirus uses heavy water as moderator and helium as cover gas. Approximately one tonne of heavy water was added to the system every year for routine make up. Isotopic purity (IP) of this water used for addition was always higher than that of the system. Though this should increase IP of heavy water in the system, it has remained almost at the same level, over the years. A study was carried out to estimate the extent of improvement in IP of heavy water in the system that should have occurred because of this and other factors in last 30 years. Reasons for non-occurrence of such an improvement were explored. Ion exchange resins used for purification of heavy water and air ingress into helium cover gas system appear to be the principal sources of entry of light water into heavy water system. (author)
-
Vahmani, P.; Jones, A. D.
2017-12-01
Urban areas are at the forefront of climate mitigation and adaptation efforts given their high concentration of people, industry, and infrastructure. Many cities globally are seeking strategies to counter the consequences of both a hotter and drier climate. While urban heat mitigation strategies have been shown to have beneficial effects on health, energy consumption, and greenhouse gas emissions, their implications for water conservation have not been widely examined. Here we show that broad implementation of cool roofs, an urban heat mitigation strategy, not only results in significant cooling of air temperature, but also meaningfully decreases outdoor water consumption by reducing evaporative and irrigation water demands. Based on a suite of satellite-supported, multiyear regional climate simulations, we find that cool roof adoption has the potential to reduce outdoor water consumption across the major metropolitan areas in California by up to 9%. Irrigation water savings per capita, induced by cool roofs, range from 1.8 to 15.4 gallons per day across 18 counties examined. Total water savings in Los Angeles county alone is about 83 million gallons per day. While this effect is robust across the 15 years examined (2001-2015), including both drought and non-drought years, we find that cool roofs are most effective during the hottest days of the year, indicating that they could play an even greater role in reducing outdoor water use in a hotter future climate. We further show that this synergistic relationship between heat mitigation and water conservation is asymmetrical - policies that encourage direct reductions in irrigation water use can lead to substantial regional warming, potentially conflicting with heat mitigation efforts designed to counter the effects of the projected warming climate.
-
Harmonious Parents and Their Preschool Children
Baumrind, Diana
1971-01-01
This brief report describes harmonious parents and their children. The six preschool daughters whose parents were harmonious were outstandingly competent but the opposite was true of the two sons. (Author/WY)
-
Implementing PlanCheyenne: Strategies and Opportunities for Smarter Growth in Cheyenne
This report is from a technical assistance project with Cheyenne, WY, to identify policy options that would implement PlanCheyenne and illustrate development that would help to achieve the community's goals.
-
75 FR 55539 - Shoshone Resource Advisory Committee
2010-09-13
...-5112. All comments, including names and addresses when provided, are placed in the record and are..., USDA, Shoshone National Forest, Wind River Ranger District, 1403 W Ramshorn, Dubois, WY 82513; (307...
-
75 FR 18088 - Changes in Flood Elevation Determinations
2010-04-09
... 0491P). November 17, 2009; Nolan, Mayor, City of Press-Enterprise. Corona, 400 South Vincentia Avenue..., City of Casper Star-Tribune. Casper, 200 North David Street, Casper, WY 82601. Natrona Unincorporated...
-
STATE OF WATER SUPPLY INFRASTRUCTURE IN THE SUBCARPATHIAN CITIES
Directory of Open Access Journals (Sweden)
Katarzyna PIETRUCHA-URBANIK
Full Text Available The characteristics of equipping the Subcarpathian province cities with water supply infrastructure was made on the basis of data collected from the Provincial Office, Statistical Office, reports submitted by water companies regarding the functioning of water supply infrastructure and literature data. The indicators characterizing water supply infrastructure were determined for the years 1995-2014. In the paper the indicators of equipping cities with water supply systems were presented. Also water consumption and changes in the length of the water supply network in the cities of the Subcarpathian Province were examined. The analysis shows that the water consumption for the years 1995-2014 decreased by almost 6 m3∙year-1 per capita. The reason for such situation was the increasing price of water and the ecological awareness of the inhabitants of the Subcarpathian region. In the last year of the analysis the water supply system in urban areas of the Subcarpathian province was used by 95% of the population and, for comparison, in rural areas by 77% of the population. In the paper also changes in prices for water in the Subcarpathian region were shown, on the basis of data from the water tariffs in individual water companies. The important element of urban development is the technical infrastructure which reduces the investment costs. The determined indicators of equipping cities with water supply systems show an upward trend in the development of technical infrastructure. Based on the operational data from the water companies the failure rates in selected water supply networks were determined.
-
Water Footprint and Impact of Water Consumption for Food, Feed, Fuel Crops Production in Thailand
Directory of Open Access Journals (Sweden)
Shabbir H. Gheewala
2014-06-01
Full Text Available The proliferation of food, feed and biofuels demands promises to increase pressure on water competition and stress, particularly for Thailand, which has a large agricultural base. This study assesses the water footprint of ten staple crops grown in different regions across the country and evaluates the impact of crop water use in different regions/watersheds by the water stress index and the indication of water deprivation potential. The ten crops include major rice, second rice, maize, soybean, mungbean, peanut, cassava, sugarcane, pineapple and oil palm. The water stress index of the 25 major watersheds in Thailand has been evaluated. The results show that there are high variations of crop water requirements grown in different regions due to many factors. However, based on the current cropping systems, the Northeastern region has the highest water requirement for both green water (or rain water and blue water (or irrigation water. Rice (paddy farming requires the highest amount of irrigation water, i.e., around 10,489 million m3/year followed by the maize, sugarcane, oil palm and cassava. Major rice cultivation induces the highest water deprivation, i.e., 1862 million m3H2Oeq/year; followed by sugarcane, second rice and cassava. The watersheds that have high risk on water competition due to increase in production of the ten crops considered are the Mun, Chi and Chao Phraya watersheds. The main contribution is from the second rice cultivation. Recommendations have been proposed for sustainable crops production in the future.
-
Elbel, Brian; Mijanovich, Tod; Abrams, Courtney; Cantor, Jonathan; Dunn, Lillian; Nonas, Cathy; Cappola, Kristin; Onufrak, Stephen; Park, Sohyun
2015-02-01
We determined the influence of "water jets" on observed water and milk taking and self-reported fluid consumption in New York City public schools. From 2010 to 2011, before and 3 months after water jet installation in 9 schools, we observed water and milk taking in cafeterias (mean 1000 students per school) and surveyed students in grades 5, 8, and 11 (n=2899) in the 9 schools that received water jets and 10 schools that did not. We performed an observation 1 year after implementation (2011-2012) with a subset of schools. We also interviewed cafeteria workers regarding the intervention. Three months after implementation we observed a 3-fold increase in water taking (increase of 21.63 events per 100 students; Pschools. At 1 year, relative to baseline, there was a similar increase in water taking and no decrease in milk taking. Cafeteria workers reported that the water jets were simple to clean and operate. An environmental intervention in New York City public schools increased water taking and was simple to implement.
-
Mijanovich, Tod; Abrams, Courtney; Cantor, Jonathan; Dunn, Lillian; Nonas, Cathy; Cappola, Kristin; Onufrak, Stephen; Park, Sohyun
2015-01-01
Objectives. We determined the influence of “water jets” on observed water and milk taking and self-reported fluid consumption in New York City public schools. Methods. From 2010 to 2011, before and 3 months after water jet installation in 9 schools, we observed water and milk taking in cafeterias (mean 1000 students per school) and surveyed students in grades 5, 8, and 11 (n = 2899) in the 9 schools that received water jets and 10 schools that did not. We performed an observation 1 year after implementation (2011–2012) with a subset of schools. We also interviewed cafeteria workers regarding the intervention. Results. Three months after implementation we observed a 3-fold increase in water taking (increase of 21.63 events per 100 students; P schools. At 1 year, relative to baseline, there was a similar increase in water taking and no decrease in milk taking. Cafeteria workers reported that the water jets were simple to clean and operate. Conclusions. An environmental intervention in New York City public schools increased water taking and was simple to implement. PMID:25521867
-
Shtull-Trauring, E; Bernstein, N
2018-05-01
Agriculture is the largest global consumer of freshwater. As the volume of international trade continues to rise, so does the understanding that trade of water-intensive crops from areas with high precipitation, to arid regions can help mitigate water scarcity, highlighting the importance of crop water accounting. Virtual-Water, or Water-Footprint [WF] of agricultural crops, is a powerful indicator for assessing the extent of water use by plants, contamination of water bodies by agricultural practices and trade between countries, which underlies any international trade of crops. Most available studies of virtual-water flows by import/export of agricultural commodities were based on global databases, which are considered to be of limited accuracy. The present study analyzes the WF of crop production, import, and export on a country level, using Israel as a case study, comparing data from two high-resolution local databases and two global datasets. Results for local datasets demonstrate a WF of ~1200Million Cubic Meters [MCM]/year) for total crop production, ~1000MCM/year for import and ~250MCM/year for export. Fruits and vegetables comprise ~80% of Export WF (~200MCM/year), ~50% of crop production and only ~20% of the imports. Economic Water Productivity [EWP] ($/m 3 ) for fruits and vegetables is 1.5 higher compared to other crops. Moreover, the results based on local and global datasets varied significantly, demonstrating the importance of developing high-resolution local datasets based on local crop coefficients. Performing high resolution WF analysis can help in developing agricultural policies that include support for low WF/high EWP and limit high WF/low EWP crop export, where water availability is limited. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Year-class formation of upper St. Lawrence River northern pike
Smith, B.M.; Farrell, J.M.; Underwood, H.B.; Smith, S.J.
2007-01-01
Variables associated with year-class formation in upper St. Lawrence River northern pike Esox lucius were examined to explore population trends. A partial least-squares (PLS) regression model (PLS 1) was used to relate a year-class strength index (YCSI; 1974-1997) to explanatory variables associated with spawning and nursery areas (seasonal water level and temperature and their variability, number of ice days, and last day of ice presence). A second model (PLS 2) incorporated four additional ecological variables: potential predators (abundance of double-crested cormorants Phalacrocorax auritus and yellow perch Perca flavescens), female northern pike biomass (as a measure of stock-recruitment effects), and total phosphorus (productivity). Trends in adult northern pike catch revealed a decline (1981-2005), and year-class strength was positively related to catch per unit effort (CPUE; R2 = 0.58). The YCSI exceeded the 23-year mean in only 2 of the last 10 years. Cyclic patterns in the YCSI time series (along with strong year-classes every 4-6 years) were apparent, as was a dampening effect of amplitude beginning around 1990. The PLS 1 model explained over 50% of variation in both explanatory variables and the dependent variable, YCSI first-order moving-average residuals. Variables retained (N = 10; Wold's statistic ??? 0.8) included negative YCSI associations with high summer water levels, high variability in spring and fall water levels, and variability in fall water temperature. The YCSI exhibited positive associations with high spring, summer, and fall water temperature, variability in spring temperature, and high winter and spring water level. The PLS 2 model led to positive YCSI associations with phosphorus and yellow perch CPUE and a negative correlation with double-crested cormorant abundance. Environmental variables (water level and temperature) are hypothesized to regulate northern pike YCSI cycles, and dampening in YCSI magnitude may be related to a
-
National Research Council Canada - National Science Library
Brown, James G
2005-01-01
In 1992 the National Park Service began a Level 1 Water Quality Data Inventory program to make available to park managers the water-resource information with which to best manage each park and plan for the future...
-
Fulazzaky, Mohamad Ali
2010-09-01
Water quality degradation in the Citarum river will increase from the year to year due to increasing pollutant loads when released particularly from Bandung region of the upstream areas into the river without treatment. This will be facing the problems on water quality status to use for multi-purposes in the downstream areas. The water quality evaluation system is used to evaluate the available water condition that distinguishes into two categories, i.e., the water quality index (WQI) and water quality aptitude (WQA). The assessment of water quality for the Citarum river from 10 selected stations was found that the WQI situates in the bad category generally and the WQA ranges from the suitable quality for agriculture and livestock watering uses to the unsuitable for biological potential function, drinking water production, and leisure activities and sports in the upstream areas of Saguling dam generally.
-
Extraction of Water from Lunar Permafrost
Ethridge, Edwin C.; Kaukler, William
2009-01-01
Remote sensing indicates the presence of hydrogen rich regions associated with the lunar poles. The logical hypothesis is that there is cryogenically trapped water ice located in craters at the lunar poles. Some of the craters have been in permanent darkness for a billion years. The presence of water at the poles as well as other scientific advantages of a polar base, have influenced NASA plans for the lunar outpost. The lunar outpost has water and oxygen requirements on the order of 1 ton per year scaling up to as much as 5 tons per year. Microwave heating of the frozen permafrost has unique advantages for water extraction. Proof of principle experiments have successfully demonstrated that microwaves will couple to the cryogenic soil in a vacuum and the sublimed water vapor can be successfully captured on a cold trap. Dielectric property measurements of lunar soil simulant have been measured. Microwave absorption and attenuation in lunar soil simulant has been correlated with measured dielectric properties. Future work will be discussed.
-
Energy performance of air-to-water and water-to-water heat pumps in hotel applications
International Nuclear Information System (INIS)
Lam, Joseph C.; Chan, Wilco W.
2003-01-01
We present work on measurement of the energy performance of heat pumps for hotel operations in subtropical climates. Two city hotels in Hong Kong were investigated. The first case was an application of an air-to-water heat pump to provide heating for an outdoor swimming pool during the heating season. The second case was the installation of three water-to-water heat pumps to complement an existing boiler system for hot water supply. The heating energy output and corresponding electricity use were measured. The heat pump energy efficiency was evaluated in terms of the coefficient of performance (COP), defined as the heating energy output to the electrical energy use. The air-to-water heat pump provided 49.1 MW h heating while consuming 24.6 MW h electricity during the 6((1)/(2))-month heating season from mid-October to April. For the water-to-water heat pumps, the estimated annual heating output and the electricity use were 952 and 544 MW h, respectively. It was found that the heat pumps generally operated in a COP range of 1.5-2.4, and the payback period was about two years, which was considered financially attractive
-
Directory of Open Access Journals (Sweden)
Hakan Istanbulluoglu
2011-06-01
Full Text Available Water is one of our most critical resources. Civilization has historically flourished around major waterways. The most important uses of water are; agricultural, industrial and domestic use. This critical resource is under threat around the world. In the next 20 years, the quantity of water available to everyone is predicted to decrease by 30%. 40% of the world\\\\\\\\\\\\\\'s inhabitants currently have insufficient fresh water for minimal hygiene. In 2000 more than 2.2 million people died from waterborne diseases. Water politics is politics affected by water and water resources. There are connections between water resources, water systems, and international security and conflict. Today, water is a strategic resource in the globe and an important element in many political conflicts. Turkey can be faced severe water-stress in the near future. Therefore Turkey has to develop realistic and feasible water policy for future generations. [TAF Prev Med Bull 2011; 10(3.000: 327-338
-
The application of water poverty mapping in water management
Directory of Open Access Journals (Sweden)
Charles van der Vyver
2012-07-01
Full Text Available Water management has been carried out for many centuries wherever there has been a need to provide water to large numbers of people. Complex social norms have developed around water management and competing users have established political (governance and economic cooperative relationships. For example, community-managed irrigation schemes in Bali and the cloud-collection canals built by the Incas at Inca Pirca in Peru are examples of water management systems which still currently supply water to people (Sullivan et al., 2005. Water resources will steadily decline because of population growth, pollution and expected climate change (Hemson et al., 2008. It has been estimated that the global demand for water doubles approximately every two decades (Meyer, 2007 and that water will even become as expensive as oil in the future (Holland, 2005. “In the year 2000, global water use was twice as high as it was in 1960” (Clarke and King, 2004:19. Unfortunately this trend is expected to continue. The aim of this paper is to describe how water poverty mapping as a process can be used to assist the management of our already scarce water resources. It constructs a water poverty map after which it describes its application at various management levels. The research indicates that the mapping process can be used to obtain more accurate predictions, as well as to form part of the master plan and integrated development plan documents. Keywords: Water management, water poverty mapping Disciplines: Water management, geographical information systems (GIS, poverty studies, decision support
-
Evaluation method for regional water cycle health based on nature-society water cycle theory
Zhang, Shanghong; Fan, Weiwei; Yi, Yujun; Zhao, Yong; Liu, Jiahong
2017-08-01
Regional water cycles increasingly reflect the dual influences of natural and social processes, and are affected by global climate change and expanding human activities. Understanding how to maintain a healthy state of the water cycle has become an important proposition for sustainable development of human society. In this paper, natural-social attributes of the water cycle are synthesized and 19 evaluation indices are selected from four dimensions, i.e., water-based ecosystem integrity, water quality, water resource abundance and water resource use. A hierarchical water-cycle health evaluation system is established. An analytic hierarchy process is used to set the weight of the criteria layer and index layer, and the health threshold for each index is defined. Finally, a water-cycle health composite-index assessment model and fuzzy recognition model are constructed based on the comprehensive index method and fuzzy mathematics theory. The model is used to evaluate the state of health of the water cycle in Beijing during 2010-2014 and in the planning year (late 2014), considering the transfer of 1 billion m3 of water by the South-to-North Water Diversion Project (SNWDP). The results show health scores for Beijing of 2.87, 3.10, 3.38, 3.11 and 3.02 during 2010-2014. The results of fuzzy recognition show that the sub-healthy grade accounted for 54%, 49%, 61% and 49% of the total score, and all years had a sub-healthy state. Results of the criteria layer analysis show that water ecosystem function, water quality and water use were all at the sub-healthy level and that water abundance was at the lowest, or sick, level. With the water transfer from the SNWDP, the health score of the water cycle in Beijing reached 4.04. The healthy grade accounted for 60% of the total score, and the water cycle system was generally in a healthy state. Beijing's water cycle health level is expected to further improve with increasing water diversion from the SNWDP and industrial
-
Experimental Research of a Water-Source Heat Pump Water Heater System
Directory of Open Access Journals (Sweden)
Zhongchao Zhao
2018-05-01
Full Text Available The heat pump water heater (HPWH, as a portion of the eco-friendly technologies using renewable energy, has been applied for years in developed countries. Air-source heat pump water heaters and solar-assisted heat pump water heaters have been widely applied and have become more and more popular because of their comparatively higher energy efficiency and environmental protection. Besides use of the above resources, the heat pump water heater system can also adequately utilize an available water source. In order to study the thermal performance of the water-source heat pump water heater (WSHPWH system, an experimental prototype using the cyclic heating mode was established. The heating performance of the water-source heat pump water heater system, which was affected by the difference between evaporator water fluxes, was investigated. The water temperature unfavorably exceeded 55 °C when the experimental prototype was used for heating; otherwise, the compressor discharge pressure was close to the maximum discharge temperature, which resulted in system instability. The evaporator water flux allowed this system to function satisfactorily. It is necessary to reduce the exergy loss of the condenser to improve the energy utilization of the system.
-
International Nuclear Information System (INIS)
Berenbrock, C.; Kjelstrom, L.C.
1997-01-01
Delineation of areas at the Idaho National Engineering and Environmental Laboratory that would be inundated by a 100-year peak flow in Birch Creek is needed by the US Department of Energy to fulfill flood-plain regulatory requirements. Birch Creek flows southward about 40 miles through an alluvium-filled valley onto the northern part of the Idaho National Engineering and Environmental laboratory site on the eastern Snake River Plain. The lower 10-mile reach of Birch Creek that ends in Birch Creek Playa near several Idaho National Engineering and Environmental Laboratory facilities is of particular concern. Twenty-six channel cross sections were surveyed to develop and apply a hydraulic model to simulate water-surface elevations for a hypothetical 100-year peak flow in Birch Creek. Model simulation of the 100-year peak flow (700 cubic feet per second) in reaches upstream from State Highway 22 indicated that flow was confined within channels even when all flow was routed to one channel. Where the highway crosses Birch Creek, about 315 cubic feet per second of water was estimated to move downstream--115 cubic feet per second through a culvert and 200 cubic feet per second over the highway. Simulated water-surface elevation at this crossing was 0.8 foot higher than the elevation of the highway. The remaining 385 cubic feet per second flowed southwestward in a trench along the north side of the highway. Flow also was simulated with the culvert removed. The exact location of flood boundaries on Birch Creek could not be determined because of the highly braided channel and the many anthropogenic features (such as the trench, highway, and diversion channels) in the study area that affect flood hydraulics and flow. Because flood boundaries could not be located exactly, only a generalized flood-prone map was developed
-
75 FR 7956 - Changes in Flood Elevation Determinations
2010-02-23
... Executive Order 12866 of September 30, 1993, Regulatory Planning and Review, 58 FR 51735. Executive Order... Springs, 212 D Rocket Miner. Street, Rock Springs, WY 82901. (Catalog of Federal Domestic Assistance No...
-
Developmental Aspects of Reaction to Positive Inducements
Lindskold, Svenn; And Others
1970-01-01
Probes children's behavioral sensitivity to variation in reward probability and magnitude (bribes) and suggests that preadolescent children do respond to promises of positive inducements for cooperation in a mixed-motive situation. (WY)
-
Water Sovereignty: Social impact of the phenomenon of “water stress” in Colombia
Diana Gabriela Beltrán Gordillo; Luisa Fernanda Beltrán Gordillo; Elías Guevara Molano; Andrea Paola Quintero Oviedo; Alexi Johanna Sandoval Aparicio
2015-01-01
Introduction: In Colombia, where each person would have the right to access 50.000 m3 of water per year, a 50% of population does not have access to potable water, 10 millions of Colombians do not own an aqueduct system and at least 800 municipal headers are about to disappear. In this article are presented the political factors that take over the water resources in state sovereignty terms; which could canalize the appearance of water stress phenomenon in the country, which is reality to Mexi...
-
Sherson, Lauren R.; Rice, Steven E.
2015-07-16
Stakeholders and water-resource managers in Lincoln County, New Mexico, have had long-standing concerns over the impact of population growth and groundwater withdrawals. These concerns have been exacerbated in recent years by extreme drought conditions and two major wildfires in the upper Rio Hondo Basin, located in south-central New Mexico. The U.S. Geological Survey (USGS), in cooperation with Lincoln County, initiated a study in 2006 to assess and characterize water resources in the upper Rio Hondo Basin. Data collected during water years 2010–13 are presented and interpreted in this report. All data presented in this report are described in water years unless stated otherwise.
-
Ten years after the Chernobyl Accident
International Nuclear Information System (INIS)
Sandberg, E.; Moberg, L.; Brasch, A.; Bengtsson, Aa.; Johansson, J.Aa.; Holmgren, S.
1996-01-01
About 5 percent of the total amount of cesium released from the Chernobyl reactor accident deposited in Sweden. The middle part of Sweden received the highest fallout. During the first period after the accident, cows in these areas were not allowed to graze. Due to the time of the year there were very few problems with cultivated crops, even during the first summer. Game, reindeer, fresh water fish, wild berries and mushrooms, however, were contaminated to a great extent and still after 10 years high concentrations of 137 Cs can be found in these animals and in mushrooms, but to a lesser extent in wild berries. Intensive controls of the Cs content are still being carried out in reindeer at the time of slaughtering. During the last few years, hand instruments for estimation of the Cs content of live animals (reindeer mostly) has been available. This makes it possible to slaughter only animals estimated to have levels of Cs below the limit value. When offered for sale, the limit value for 137 Cs is 300 Bq/kg for the 'basic foodstuffs' and for meat from game, reindeer, fresh water fish, nuts, wild berries and mushrooms 1500 Bq/kg. High levels of 137 Cs will be found in reindeer and fresh water fish from some areas for many years in the future. 8 refs, 11 figs
-
van der Hoek, J P
2012-01-01
Waternet is responsible for drinking water treatment and distribution, wastewater collection and treatment, and surface water management and control (quality and quantity) in and around Amsterdam. Waternet has the ambition to operate climate neutral in 2020. To realise this ambition, measures are required to compensate for the emission of 53,000 ton CO(2)-eq/year. Energy recovery from the water cycle looks very promising. First, calculations reveal that energy recovery from the water cycle in and around Amsterdam may contribute to a total reduction in greenhouse gas emissions up to 148,000 ton CO(2)-eq/year. The challenge for the coming years is to choose combinations of all the possibilities to fulfil the energy demand as much as possible. Only then the use of fossil fuel can be minimized and inevitable greenhouse gas emissions can be compensated, supporting the target to operate climate neutral in 2020.
-
Managing water to protect fish: A review of California's environmental water account, 2001-2005
Brown, L.R.; Kimmerer, W.; Brown, R.
2009-01-01
The Sacramento-San Joaquin Delta, the landward reach of the San Francisco Estuary, provides habitat for threatened delta smelt, endangered winter-run Chinook salmon, and other species of concern. It is also the location of huge freshwater diversion facilities that entrain large numbers of fish. Reducing the entrainment of listed fishes into these facilities has required curtailment of pumping, reducing the reliability of water deliveries. We reviewed the first 5 years (2001-2005) of the Environmental Water Account (EWA), a program instituted to resolve conflicts between protecting listed fishes and providing a reliable water supply. The EWA provided fishery agencies with control over 0.2-0.4 km3 of water to be used for fish protection at no cost to users of exported water, and fish agencies guaranteed no disruption of water supply for fish protection. The EWA was successful in reducing uncertainty in water supply; however, its contribution to the recovery of listed fishes was unclear. We estimated the effectiveness of the EWA to be modest, increasing the survival of winter-run Chinook salmon by 0-6% (dependent on prescreen mortality), adult delta smelt by 0-1%, and juvenile delta smelt by 2-4%. Allocating EWA water for a single life stage of one species could provide larger gains in survival. An optimally allocated EWA of equal size to the median of the first 5 years could increase abundance of juvenile delta smelt up to 7% in the springs of dry years. If the EWA is to become a long-term program, estimates of efficacy should be refined. If the program is to be held accountable for quantitative increases in fish populations, it will be necessary to integrate scientific, possibly experimental, approaches. ?? 2008 Springer Science+Business Media, LLC.
-
Fog Water Collection: Challenges beyond Technology
Manzoor Qadir; Gabriela C. Jiménez; Rebecca L. Farnum; Leslie L. Dodson; Vladimir Smakhtin
2018-01-01
The Sustainable Development Goal (SDG) 6, calling for access to safe water and sanitation for all by the year 2030 supports the efforts in water-scarce countries and regions to go beyond conventional resources and tap unconventional water supplies to narrow the water demand-supply gap. Among the unconventional water resources, the potential to collect water from the air, such as fog harvesting, is by far the most under-explored. Fog water collection is a passive, low maintenance, and sustaina...
-
PPARα-Independent Arterial Smooth Muscle Relaxant Effects of PPARα Agonists
Directory of Open Access Journals (Sweden)
Neerupma Silswal
2012-01-01
Full Text Available We sought to determine direct vascular effects of peroxisome proliferator-activated receptor alpha (PPARα agonists using isolated mouse aortas and middle cerebral arteries (MCAs. The PPARα agonists GW7647, WY14643, and gemfibrozil acutely relaxed aortas held under isometric tension and dilated pressurized MCAs with the following order of potency: GW7647≫WY14643>gemfibrozil. Responses were endothelium-independent, and the use of PPARα deficient mice demonstrated that responses were also PPARα-independent. Pretreating arteries with high extracellular K+ attenuated PPARα agonist-mediated relaxations in the aorta, but not in the MCA. In the aorta, the ATP sensitive potassium (KATP channel blocker glibenclamide also impaired relaxations whereas the other K+ channel inhibitors, 4-aminopyridine and Iberiotoxin, had no effect. In aortas, GW7647 and WY14643 elevated cGMP levels by stimulating soluble guanylyl cyclase (sGC, and inhibition of sGC with ODQ blunted relaxations to PPARα agonists. In the MCA, dilations were inhibited by the protein kinase C (PKC activator, phorbol 12,13-dibutyrate, and also by ODQ. Our results demonstrated acute, nonreceptor-mediated relaxant effects of PPARα agonists on smooth muscle of mouse arteries. Responses to PPARα agonists in the aorta involved KATP channels and sGC, whereas in the MCA the PKC and sGC pathways also appeared to contribute to the response.
-
International Nuclear Information System (INIS)
Kummu, Matti; Varis, Olli; Ward, Philip J; De Moel, Hans
2010-01-01
In this letter we analyse the temporal development of physical population-driven water scarcity, i.e. water shortage, over the period 0 AD to 2005 AD. This was done using population data derived from the HYDE dataset, and water resource availability based on the WaterGAP model results for the period 1961-90. Changes in historical water resources availability were simulated with the STREAM model, forced by climate output data of the ECBilt-CLIO-VECODE climate model. The water crowding index, i.e. Falkenmark water stress indicator, was used to identify water shortage in 284 sub-basins. Although our results show a few areas with moderate water shortage (1000-1700 m 3 /capita/yr) around the year 1800, water shortage began in earnest at around 1900, when 2% of the world population was under chronic water shortage ( 3 /capita/yr). By 1960, this percentage had risen to 9%. From then on, the number of people under water shortage increased rapidly to the year 2005, by which time 35% of the world population lived in areas with chronic water shortage. In this study, the effects of changes in population on water shortage are roughly four times more important than changes in water availability as a result of long-term climatic change. Global trends in adaptation measures to cope with reduced water resources per capita, such as irrigated area, reservoir storage, groundwater abstraction, and global trade of agricultural products, closely follow the recent increase in global water shortage.
-
Directory of Open Access Journals (Sweden)
Stefan Panaiotov
2015-06-01
Full Text Available The coast of the Bulgarian Black Sea is a popular summer holiday destination. The Dam of Iskar is the largest artificial dam in Bulgaria, with a capacity of 675 million m3. It is the main source of tap water for the capital Sofia and for irrigating the surrounding valley. There is a close relationship between the quality of aquatic ecosystems and human health as many infections are waterborne. Rapid molecular methods for the analysis of highly pathogenic bacteria have been developed for monitoring quality. Mycobacterial species can be isolated from waste, surface, recreational, ground and tap waters and human pathogenicity of nontuberculose mycobacteria (NTM is well recognized. The objective of our study was to perform molecular analysis for key-pathogens, with a focus on mycobacteria, in water samples collected from the Black Sea and the Dam of Iskar. In a two year period, 38 water samples were collected—24 from the Dam of Iskar and 14 from the Black Sea coastal zone. Fifty liter water samples were concentrated by ultrafiltration. Molecular analysis for 15 pathogens, including all species of genus Mycobacterium was performed. Our results showed presence of Vibrio spp. in the Black Sea. Rotavirus A was also identified in four samples from the Dam of Iskar. Toxigenic Escherichia coli was present in both locations, based on markers for stx1 and stx2 genes. No detectable amounts of Cryptosporidium were detected in either location using immunomagnetic separation and fluorescence microscopy. Furthermore, mass spectrometry analyses did not detect key cyanobacterial toxins. On the basis of the results obtained we can conclude that for the period 2012–2014 no Mycobacterium species were present in the water samples. During the study period no cases of waterborne infections were reported.
-
Sustainable use of Brackish water for crop production
International Nuclear Information System (INIS)
Chaudhry, M.R.; Iqbal, M.; Subhani, K.M.
2005-01-01
The good quality surface-water is not sufficient to meet the crop water requirement for potential crop production. To augment the inadequate supplies of good quality water the only alternative is the use of poor quality , ground water. To explore sustainable use of brackish water a study was conducted in Fordwah Eastern Sadiqia South, Bahawalnagar, Punjab during the year 1998-99 to 2000-2001 with the objective to evaluate the impact of different irrigation treatments on physical and chemical properties of soil and crops yield. The experiment was conducted on farmer's field with his collaboration. The initial soil pH was about 8.0 while ECe and SAR ranged between 2.0 to 4.1 dS m/sup -/1 and 7.1 to 15.1 (mmol/sub c/ L/sup -1/)1/2, respectively with sandy loam texture. The brackish water used for irrigation had ECiw, SAR and RSC between 5.6 to 6.7 dS m/sup -/1, 15.1 to 16.4 (mmolc L/sup -1/sup 1/2/ and 1.52 to 1.64 (mmol/sub c/ L/sup -1/.The crops tested were wheat during Rabi and cotton during Kharif season. The treatments tested were: irrigation with canal water (T/sub 1/), canal water during Rabi and drainage water during Kharif (T/sub 2/), drainage water for two years and canal water for one season(T/sub 3/); and drainage water for three years + application of gypsum at the rate of 25% of CWR and thereafter canal water for one season(T 4). Fertilizers were applied at the rate of 120-60-50 N, P/sub 2/O/sub 5/ and K20 kg ha/sup -1/, respectively in the form of urea, diammonium phosphate and sulfate of potash. Crops irrigated with drainage water visualized yield reduction depending upon the share of drainage water in the irrigation delta. Application of gypsum provided reasonable check against salinity build-up with brackish water irrigation besides a nominal boost of 3 and 5% in yield of wheat and cotton, respectively over comparable treatment of year-round brackish water irrigation lacking gypsum application. Drainage water in alternate arrangement of seasonal
-
Effects of water gymnastics on anthropometric variables of women aged 60 - 80 years
Directory of Open Access Journals (Sweden)
Adair da Silva Lopes
2001-12-01
Full Text Available This study aimed to analyze the effects of eight months of water gymnastics on the anthropometric variables of women aged 60 - 80 years. The sample comprised formed by 62 women (Experimental Group, EG, n = 50; Control Group, CG, n = 12, who were measured for body mass (kg, stature (cm, circumferences in cm (arms, normal chest, abdomen waist, hip, mid-thigh and calf and sum of skinfolds representing regional fat (trunk, limbs, central and peripheral, and total fat. The EG participated at all water activities for 32 weeks which, a total of 64 sessions, each lasting for about 45 min. Alpha level was set at p ≤ 0.05 for all comparisons. For pre-and-post test comparison of the EG, Student’s t test for dependent samples was used. The independent t test was used to compare both groups at the beginning and at the end of the experiment. According to the results the following can be stated: the water gymnastics program followed for 8 months, helped to statistically reduce body mass and body circumferences at waist, hip, mid-thigh and calf levels. Signifi cant differences in the distribution of regional body fat and total fat were observed found (p ≤ 0.05 at trunk and limbs and in peripheral and total body fat. ABSTRACT O presente estudo teve como objetivo analisar os efeitos de oito meses de hidroginástica sobre indicadores antropométricos de mulheres entre 60 e 80 anos de idade. Participaram da amostra 62 mulheres, divididas em dois grupos: experimental (GE, n = 50 e controle (GC, n = 12. Mediu-se a massa corporal (kg, estatura corporal (cm, perímetros, cm (tronco normal, abdômen na região da cintura, glútea, coxa e panturrilha e somatórios de dobras cutâneas (mm, representando a gordura por região (tronco, membros, central e periférica e a gordura total. O grupo experimental participou das atividades de hidroginástica durante 32 semanas, totalizando 64 sessões, com duração aproximada de 45 minutos. Para a análise dos dados entre o
-
Energy Technology Data Exchange (ETDEWEB)
Komissarov, S V
1980-10-01
This article discusses composition of chemical compounds dissolved or suspended in mine waters in various coal basins of the USSR: Moscow basin, Kuzbass, Pechora, Kizelovsk, Karaganda, Donetsk and Chelyabinsk basins. Percentage of suspended materials in water depending on water source (water from water drainage system of dust suppression system) is evaluated. Pollution of mine waters with oils and coli bacteria is also described. Recommendations on construction, capacity of water settling tanks, and methods of mine water treatment are presented. In mines where coal seams 2 m or thicker are mined a system of two settling tanks should be used: in the upper one large grains are settled, in the lower one finer grains. The upper tank should be large enough to store mine water discharged during one month, and the lower one to store water discharged over two months. Salty waters from coal mines mining thin coal seams should be treated in a system of water reservoirs from which water evaporates (if climatic conditions permit). Mine waters from mines with thin coal seams but without high salt content can be treated in a system of long channels with water plants, which increase amount of oxygen in treated water. System of biological treatment of waste waters from mine wash-houses and baths is also described. Influence of temperature, sunshine and season of the year on efficiency of mine water treatment is also assessed. (In Russian)
-
Hargrove, W. L.; Del Rio, M.; Korc, M.
2017-12-01
Using Health Impact Assessment methods, we determined: 1) the impact of water and sanitation infrastructure installed about 15 years ago in two Texas border communities; 2) the impact of failing septic tanks in a neighborhood where septic systems are more than 20 years old and failing; and 3) the impacts of hauled water as the main household water source in a colonia. We obtained a total of 147 household surveys related to water and sanitation in four communities. Households who had obtained water and sanitation infrastructure had less skin problems, neuropathy, gastrointestinal illness, and stomach infections compared to an earlier time when they relied on local domestic wells or hauled water and septic tanks. Hepatitis A incidence in El Paso County, TX dropped precipitously after the implementation of water and sanitation infrastructure. Hauling water contributed to mental stress and anxiety and was risky in terms of road safety. We also assessed the economic and community development impacts of water and sanitation infrastructure. Communities benefitted from higher property values, expanded health care services, more parks and recreation, more local businesses, and improved fire safety. We argue that though water and sanitation infrastructure is a significant contributor to addressing inequities in the border region, much remains to be done to achieve water justice in this challenging region.
-
Harvey, Judson W.; Newlin, Jessica T.; Krupa, Steven L.
2006-04-01
Surface-water and ground-water flow are coupled in the central Everglades, although the remoteness of this system has hindered many previous attempts to quantify interactions between surface water and ground water. We modeled flow through a 43,000 ha basin in the central Everglades called Water Conservation Area 2A. The purpose of the model was to quantify recharge and discharge in the basin's vast interior areas. The presence and distribution of tritium in ground water was the principal constraint on the modeling, based on measurements in 25 research wells ranging in depth from 2 to 37 m. In addition to average characteristics of surface-water flow, the model parameters included depth of the layer of 'interactive' ground water that is actively exchanged with surface water, average residence time of interactive ground water, and the associated recharge and discharge fluxes across the wetland ground surface. Results indicated that only a relatively thin (8 m) layer of the 60 m deep surfical aquifer actively exchanges surface water and ground water on a decadal timescale. The calculated storage depth of interactive ground water was 3.1 m after adjustment for the porosity of peat and sandy limestone. Modeling of the tritium data yielded an average residence time of 90 years in interactive ground water, with associated recharge and discharge fluxes equal to 0.01 cm d -1. 3H/ 3He isotopic ratio measurements (which correct for effects of vertical mixing in the aquifer with deeper, tritium-dead water) were available from several wells, and these indicated an average residence time of 25 years, suggesting that residence time was overestimated using tritium measurements alone. Indeed, both residence time and storage depth would be expected to be overestimated due to vertical mixing. The estimate of recharge and discharge (0.01 cm d -1) that resulted from tritium modeling therefore is still considered reliable, because the ratio of residence time and storage depth (used to
-
Energy Technology Data Exchange (ETDEWEB)
Looney, Brain B. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Denham, Miles E. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Eddy-Dilek, Carol A. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2014-04-01
The U.S. Department of Energy Office of Legacy Management (DOE-LM) manages the legacy contamination at the Riverton, WY, Processing Site – a former uranium milling site that operated from 1958 to 1963. The tailings and associated materials were removed in 1988-1989 and contaminants are currently flushing from the groundwater. DOE-LM commissioned an independent technical team to assess the status of the contaminant flushing, identify any issues or opportunities for DOE-LM, and provide key recommendations. The team applied a range of technical frameworks – spatial, temporal, hydrological and geochemical – in performing the evaluation. In each topic area, an in depth evaluation was performed using DOE-LM site data (e.g., chemical measurements in groundwater, surface water and soil, water levels, and historical records) along with information collected during the December 2013 site visit (e.g., plant type survey, geomorphology, and minerals that were observed, collected and evaluated).
-
International Development Research Centre (IDRC) Digital Library (Canada)
IDRC CRDI
The Millennium Development Goals identify lack of clean water supply as a key factor in the lives of the ... provides a foundation to motivate investment by ... participate in decision-making, and have ... water years, allowing farmers to invest in.