Czech Academy of Sciences Publication Activity Database
Axelsson, Owe; Xin, H.; Neytcheva, M.
2015-01-01
Roč. 20, č. 2 (2015), s. 232-260 ISSN 1392-6292 Institutional support: RVO:68145535 Keywords : variable density * phase-field model * Navier-Stokes equations * preconditioning * variable viscosity Subject RIV: BA - General Mathematics Impact factor: 0.468, year: 2015 http://www.tandfonline.com/doi/abs/10.3846/13926292.2015.1021395
Shen, Guo F; Yuan, Si Y; Xie, Yu N; Xia, Si J; Li, Li; Yao, Yu K; Qiao, Yue Z; Zhang, Jie; Zhao, Qiu Y; Ding, Ai J; Li, Bin; Wu, Hai S
2014-01-01
The deteriorating air quality in eastern China including the Yangtze River Delta is attracting growing public concern. In this study, we measured the ambient PM10 and fine PM2.5 in the mega-city, Nanjing at four different times. The 24-h average PM2.5 and PM10 mass concentrations were 0.033-0.234 and 0.042-0.328 mg/m(3), respectively. The daily PM10 and PM2.5 concentrations were 2.9 (2.7-3.2, at 95% confidence interval) and 4.2 (3.8-4.6) times the WHO air quality guidelines of 0.025 mg/m(3) for PM2.5 and 0.050 mg/m(3) for PM10, respectively, which indicated serious air pollution in the city. There was no obvious weekend effect. The highest PM10 pollution occurred in the wintertime, with higher PM2.5 loadings in the winter and summer. PM2.5 was correlated significantly with PM10 and the average mass fraction of PM2.5 in PM10 was about 72.5%. This fraction varied during different sampling periods, with the lowest PM2.5 fraction in the spring but minor differences among the other three seasons.
SPARKy-Spring Ankle with Regenerative Kinematics
2011-09-01
slope of each 3846 Authorized licensed use limited to: Arizona State University. Downloaded on November 10, 2009 at 12:36 from IEEE Xplore . Restrictions... IEEE Xplore . Restrictions apply. (a) Gait percent of each curve versus the polar angle Φ (b) Inverted curves, polar angle Φ versus gait percent Fig...November 10, 2009 at 12:36 from IEEE Xplore . Restrictions apply. Fig. 8. Position of the nut in meters as a function of stride length and gait percent
Diao, Zongli; Wang, Liyan; Li, Dishan; Liu, Wenhu
2017-11-01
Severe secondary hyperparathyroidism (SHPT) is a serious problem in patients undergoing hemodialysis. The efficacy and safety of microwave ablation (MWA), a minimally invasive treatment, for severe SHPT are as yet unclear. To clarify the role of MWA, we administered it to patients with severe SHPT and assessed its efficacy and safety. This was a prospective, single-center, single-arm, clinical trial. We enrolled patients with severe SHPT attending our hemodialysis center who met the inclusion and exclusion criteria. We then assessed primary outcome measures (serum concentrations of intact parathyroid hormone) and secondary outcome measures (serum concentrations of calcium and phosphorus). Twenty-six patients were enrolled in this study, 10 of whom (38.46%) were responsive to MWA and 16 (61.54%) of whom were not. The main complication was hypocalcemia (10 cases, 38.46%), which had occurred in all cases by one week after administration of MWA. Responding patients with hypocalcemia all achieved normal serum calcium concentrations within seven months and non-responding patients within three months. There were no changes in serum phosphorus concentrations after MWA in either responders or non-responders. Microwave ablation is relatively ineffective in patients with severe SHPT undergoing maintaining hemodialysis and should not be the initial therapy in such cases.
Comparison of the actual costs during removal of concrete layer by high-speed water jets
Czech Academy of Sciences Publication Activity Database
Hela, R.; Bodnárová, L.; Novotný, M.; Sitek, Libor; Klich, Jiří; Wolf, I.; Foldyna, Josef
2012-01-01
Roč. 13, č. 4 (2012), s. 763-775 ISSN 1611-1699 R&D Projects: GA MŠk ED2.1.00/03.0082 Grant - others:GA TA ČR(CZ) TA01010948; GA MPO(CZ) FR-TI1/387 Institutional support: RVO:68145535 Keywords : computation model * total technological costs * total fixed costs * total variable costs * Triple helix model Subject RIV: JQ - Machines ; Tools Impact factor: 1.881, year: 2012 http://www.tandfonline.com/doi/pdf/10.3846/16111699.2011.645866
Sierra Leone Journal of Biomedical Research Vol. 2 (1) pp. 38-46 ...
African Journals Online (AJOL)
2010-06-01
Jun 1, 2010 ... Care Seeking Determinants among Adolescents in Lagos, Nigeria ... relationship between client facility-use status and selected individual .... youth-friendly clinic in developing nations as well ... 1034. 17.0. Source of information. Friend. 4117. 67.7. Sibling. 578 ..... perceived threat to reproduction are taken.
Protein (Viridiplantae): 850873 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available OC100796589 Glycine max MEETSWEQRVQALTHILTSPTTTPSLHSQFFIATQIPCYLNWDYPPFLCSSNPQLLK...803:12853 ... 3814:12853 ... 163735:5410 ... 3846:8024 1462606:8024 3847:8024 ... PREDICTED: uncharacterized protein L
The constancy of the ratio of the molecular hydrogen lines at 3.8 μm in Orion
International Nuclear Information System (INIS)
Brand, P.W.J.L.; Toner, M.P.; Williams, P.M.; Burton, M.G.
1989-01-01
The 1-0 O(7) and O-O S(13) lines of H 2 , at 3.807 and 3.846 μm, have been mapped over the region of the Orion molecular outflow. The intensity ratio of these lines is found to be independent of position in the outflow. From this it is inferred that the structure of the shocks and their cooling flows in Orion may be more akin to hydrodynamic shocks than the low-temperature C-shocks that are currently favoured. (author)
Protein (Viridiplantae): 356536840 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-4-like Glycine max MNNTNECCCNDENGKIVVGVPLVFNFFDKNTNNIEKSLKVQLEKKNQLEDHDCDQEDD
Protein (Viridiplantae): 356543245 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-3-like Glycine max MAQNDSNPTPPPEPHVAAEPITEDLVQDKEEEDDSSKIVIPVPESESLSLKEDSNRVS
Protein (Viridiplantae): 356506815 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 24:2780 3398:2780 71240:414 91827:414 71275:1623 91835:562 72025:981 3803:981 3814:981 163735:1026 3846:1026 3847:1026 PREDICTED: pat...ellin-6-like Glycine max MMDTTSSPLSLQTQKTTFQELPEASPKPYKKGIVATLMGGGLFKEDNYFVSLLRSSEK
Czech Academy of Sciences Publication Activity Database
Bříza, T.; Kvíčala, J.; Paleta, O.; Čermák, Jan
2002-01-01
Roč. 58, č. 20 (2002), s. 3841-3846 ISSN 0040-4020 R&D Projects: GA ČR GA203/99/0135 Keywords : fluorous * fluorophilic * fluorocyclopentadiene Subject RIV: CC - Organic Chemistry Impact factor: 2.420, year: 2002
Murray Pittock, ed., The Edinburgh Companion to Scottish Romanticism.
Directory of Open Access Journals (Sweden)
Manfred Malzahn
2013-10-01
Full Text Available Murray Pittock, ed., The Edinburgh Companion to Scottish Romanticism. Edinburgh: Edinburgh University Press, 2011. Pp. 251. ISBN 978-0-7486-3845-1 (hardback. £ 65.00. ISBN 978-0-7486-3846-8 (paperback. £ 21.99.
Oral Insulin – Fact or Fiction? - Possibilities of Achieving Oral ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education; Volume 8; Issue 5. Oral Insulin – Fact or Fiction? - Possibilities of Achieving Oral Delivery of Insulin. K Gowthamarajan Giriraj T Kulkarni. General Article Volume 8 Issue 5 May 2003 pp 38-46 ...
76 FR 59675 - Combined Notice of Filings #2
2011-09-27
...: Yuma Power Limited Liability Company. Description: Yuma Power Limited Liability Company submits notice.... Docket Numbers: ER11-3846-002. Applicants: El Paso Electric Company. Description: El Paso Electric Company submits tariff filing per 35: Compliance Filing of El Paso-Tucson Settlement to be effective 9/1...
Rahayu, P. P.; Masykuri, M.; Soeparmi
2018-04-01
Professional Physics teacher must be able to manage science learning process by associating science itself with the daily life. At first the teacher must have competency in the ability of science literacy. The target of this research is vocational school Physics teachers for the purpose to describe their ability on science literacy. This research is a survey research using test method. The test instrument is The NOSLiT by Wenning.Research results are: 1) Scientific Nomenclature : 38.46 %, 2) Basic experimental and observational abilities : 38.46 %, 3) Rules of scientific evidence : 0%, 4) Postulate science: 15.38%, 5) scientific disposition: 7. 69%.Conclusion: The result of each indicator shows that the ability of science literacy of vocational school Physics teachers has not met the expectations yet. It’s can be used as the reflection for education experts to improve their science literacy ability so that can be applied to the learning process that directly or indirectly will have an impact on improving the students’ science literacy.
Czech Academy of Sciences Publication Activity Database
Machar, I.; Kirchner, Karel; Pechanec, V.; Brus, J.; Kiliánová, H.; Šálek, L.; Buček, A.
2015-01-01
Roč. 23, č. 2 (2015), s. 38-46 ISSN 1210-8812 Institutional support: RVO:68145535 Keywords : Geo-ecological assessment * hydrological impact * DOE Canal * river floodplain * Czech Republic Subject RIV: DO - Wilderness Conservation Impact factor: 1.093, year: 2015 http://www.geonika.cz/CZ/CZresearch/CZMgrArchive.html
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. K Gowthamarajan. Articles written in Resonance – Journal of Science Education. Volume 8 Issue 5 May 2003 pp 38-46 General Article. Oral Insulin – Fact or Fiction? - Possibilities of Achieving Oral Delivery of Insulin · K Gowthamarajan Giriraj T Kulkarni.
Evaluation of the nuclear DNA Diffusion Assay to detect apoptosis and necrosis
Czech Academy of Sciences Publication Activity Database
Gichner, Tomáš; Mukherjee, A.; Wagner, E. D.; Plewa, M. J.
2005-01-01
Roč. 586, č. 1 (2005), s. 38-46 ISSN 1383-5718 R&D Projects: GA ČR GA521/05/0500 Institutional research plan: CEZ:AV0Z50380511 Keywords : DNase-I * Ethyl methanesulphonate * Hydrogen peroxide Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.188, year: 2005
Resonance – Journal of Science Education | Indian Academy of ...
Indian Academy of Sciences (India)
Home; Journals; Resonance – Journal of Science Education. Giriraj T Kulkarni. Articles written in Resonance – Journal of Science Education. Volume 8 Issue 5 May 2003 pp 38-46 General Article. Oral Insulin – Fact or Fiction? - Possibilities of Achieving Oral Delivery of Insulin · K Gowthamarajan Giriraj T Kulkarni.
Resonance – Journal of Science Education | News
Indian Academy of Sciences (India)
pp 38-46 General Article. Oral Insulin – Fact or Fiction? - Possibilities of Achieving Oral Delivery of Insulin · K Gowthamarajan Giriraj T Kulkarni · More Details Fulltext PDF. pp 47-51 General Article. Exploring the Atmosphere with Lidars - Types of Lidars · S Veerabuthiran · More Details Fulltext PDF. pp 52-56 General Article.
Suveg, Cynthia; Shaffer, Anne; Morelen, Diana; Thomassin, Kristel
2011-01-01
This study examined the intergenerational transmission of psychopathology symptoms with 7-12 year-old children (N = 97; 44 boys, 53 girls, M age = 9.14, SD = 1.38) and their mothers (M age = 38.46, SD = 6.86). Child emotion regulation mediated the links between maternal psychopathology and child internalizing and externalizing symptoms. In turn,…
Czech Academy of Sciences Publication Activity Database
Formanová, P.; Černý, Jiří; Černá Bolfíková, B.; Valdés, James J.; Kozlová, I.; Dzhioev, Y.; Růžek, Daniel
2015-01-01
Roč. 6, č. 1 (2015), s. 38-46 ISSN 1877-959X R&D Projects: GA ČR GAP502/11/2116; GA ČR GAP302/12/2490 Institutional support: RVO:60077344 Keywords : tick-borne encephalitis virus * tick-borne encephalitis * genome analysis * human patient s Subject RIV: EE - Microbiology, Virology Impact factor: 2.690, year: 2015
2012-10-30
...) regarding the battery terminal and charger voltages and amperage provided in SR 3.8.4.1 and SR 3.8.4.6... Requirements (SRs) regarding the battery terminal and charger voltages and amperage provided in SR 3.8.4.1 and... existing batteries. Battery circuit coordination is not adversely affected by the addition of this improved...
Czech Academy of Sciences Publication Activity Database
Blaha, Milan; Procházka, Radek; Adámková, K.; Nevoral, J.; Němcová, Lucie
2017-01-01
Roč. 130, č. 2 (2017), s. 38-46 ISSN 1098-8823 R&D Projects: GA MZe(CZ) QJ1510138; GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 Keywords : cumulus * oocyte * prostaglandin E2 * protein kinase B Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Reproductive biology (medical aspects to be 3) Impact factor: 2.640, year: 2016
Czech Academy of Sciences Publication Activity Database
Součková, Monika; Klomfar, Jaroslav; Pátek, Jaroslav
2012-01-01
Roč. 333, NOV 15 2012 (2012), s. 38-46 ISSN 0378-3812 R&D Projects: GA ČR GA101/09/0010 Institutional research plan: CEZ:AV0Z20760514 Keywords : ionic liquid * tris(pentafluoroethyl)trifluorophosphate * density * surface tension Subject RIV: BJ - Thermodynamics Impact factor: 2.379, year: 2012 http://www.sciencedirect.com/science/article/pii/S037838121200310X
Directory of Open Access Journals (Sweden)
(Brig. Pradeep Kuma
2016-05-01
Full Text Available BACKGROUND Pulmonary oedema in severe pregnancy-induced hypertension is a life threatening complication with high maternal mortality, particularly in tribal population of South Rajasthan. METHODS Thirteen cases which occurred in the duration of two and half years were analysed through medical records and findings were recorded. RESULTS Maximum cases 10(76.92% were in less than 20 years of age. 12 (92.30% cases were nulliparous. Out of 13 cases of PIH, pulmonary oedema developed in 5 (38.46% cases of eclampsia and 8 (61.54% cases of severe pregnancy-induced hypertension. 10 (76.92%cases were 28 to 30 weeks of gestation and 3 (23.08% were 31 to 34 weeks of gestation. 8 (61.54% cases were severely anaemic. 12 (92.30% were unbooked cases. CONCLUSION Regular antenatal checkups, early diagnosis, prompt treatment of hypertension and pulmonary oedema and termination of pregnancy is required to prevent maternal death.
Czech Academy of Sciences Publication Activity Database
Nieves-Aldrey, J. L.; Butterill, Philip T.
2014-01-01
Roč. 3846, č. 2 (2014), s. 221-234 ISSN 1175-5326 R&D Projects: GA ČR GA13-10486S Grant - others:European Social Fund(CZ) CZ.1.07/2.3.00/20.0064; Spanish Ministry of Science and Innovation(ES) CGL2010-15786; National Science Foundation(US) DEB 0515678 Institutional support: RVO:60077344 Keywords : Cynipidae * Synergini * new genus Subject RIV: EG - Zoology Impact factor: 0.906, year: 2014
Czech Academy of Sciences Publication Activity Database
Sedlák, Robert; Deepa, Palanisamy; Hobza, Pavel
2014-01-01
Roč. 118, č. 21 (2014), s. 3846-3855 ISSN 1089-5639 R&D Projects: GA ČR GBP208/12/G016 Grant - others:Operational Program Research and Development for Innovations(XE) CZ 1.05/2.1.00/03/0058 Institutional support: RVO:61388963 Keywords : distributed multipole analysis * density functional theory * consistent basis sets * correlated molecular calculations Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.693, year: 2014
Gambaran Pasien Tuli Mendadak di Bagian THT-KL RSUP Dr. M. Djamil Padang
Directory of Open Access Journals (Sweden)
Hedo Hidayat
2016-08-01
Full Text Available AbstrakTuli mendadak adalah penurunan pendengaran sensorineural yang berlangsung dalam waktu kurang dari 72 jam. Penyakit ini merupakan salah satu kegawatdaruratan neurotologi dan memerlukan penatalaksanaan dini untuk menghindari kecacatan yang dapat ditimbulkan. Tujuan penelitian ini adalah melihat gambaran kejadian tuli mendadak di Bagian THT-KL RSUP Dr. M.Djamil. Ini merupakan penelititan deskriptif retrospektif dengan menggunakan data rekam medik di RSUP Dr. M. Djamil Padang selama tahun 2010 sampai tahun 2013. Didapatkan hasil sebanyak 26 kasus yang masuk kriteria inklusi pada periode tersebut. Sebaran umur penderita dari 8 sampai 79 tahun, dengan distribusi terbanyak pada usia 40 – 60 tahun. Faktor resiko yang ditemukan berupa hipertensi dan diabetes melitus sama besar yaitu 11,54%. Gejala klinis terdiri atas tinitus (76,92%, diikuti vertigo (38,46%, dan rasa penuh di telinga (15,38%. Pasien terbanyak pada derajat ketulian sangat berat (38,46%, kemudian derajat sedang berat dan berat (23,08%, diikuti derajat ringan (11,54% dan sedang (3,85%. Distribusi onset terapi terbanyak pada 0 – 7 hari (50,00%, kemudian onset > 14 hari (30,77% dan onset 8 – 14 hari (19,23%. Perbaikan pendengaran ditemukan sama banyak pada kategori sangat baik dan baik sebanyak 6 kasus dan diikuti kategori sembuh satu kasus. Dari penelitian ini dapat dikatakan tidak hanya satu faktor yang menentukan perbaikan tuli mendadak.Kata kunci: tuli mendadak, retrospektif, gejala klinis1Mahasiswa FK Unand, 2Bagian Pulmonologi FK Unand, 3Bagian Patologi Anatomi FK UnandAbstractSudden deafness is a sensorineural hearing loss in less than 72 hours. Sudden deafness is a neurotological emergency and requiring an early management to avoid the defects that can be caused. The objective of this study was to see cases of sudden deafness in Dr. M. Djamil General Hospital. This was a descriptive research with retrospective design using medical record data in Dr. M. Djamil General
Isotopic exchange kinetics of zinc ions in Zn-A zeolite
Energy Technology Data Exchange (ETDEWEB)
Radak, V M; Gal, I J; Salai, J J [Belgrade Univ. (Yugoslavia)
1976-01-01
The isotopic exchange kinetics of Zn/sup 2 +/ ions in hydrated Zn-A zeolite of composition (Znsub(5.55)Nasub(0.90)(A10/sub 2/)/sub 12/(Si0/sub 2/)/sub 12/.aq) have been investigated by measuring the fractional attainment of isotopic equilibrium between a ZnCl/sub 2/ solution and a /sup 65/Zn-labelled Zn-A zeolite (30 and 45 ..mu..m particle radii) as a function of time, in the temperature range 25 to 60/sup 0/C. The exchange mechanism is a two-step process which has been resolved, using the Brown-Sherry-Krambeck model (J.Phys.Chem.;75:3846(1971)) into diffusion in the solid particles, with Zn/sup 2 +/ diffusivity of D = 10sup(-3.97 + -0.03) exp(-Esub(D)/RT)m/sup 2/ s/sup -1/, Esub(D) = 67.1 +- 0.5 kJ molee/sup -1/, and an intracrystalline first-order exchange between bound and mobile Zn/sup 2 +/ ions in the network, with a rate constant of k/sub 2/ = 10sup(3.05 +- 0.25) exp(-Esub(k)/RT)s/sup -1/, Esub(k) = 56.5 +- 1.5 kJ mol/sup -1/.
Highway Design on the Sections Affected by Aquaplaning
Directory of Open Access Journals (Sweden)
Aleksandr Reznik
2011-04-01
Full Text Available Pouring rain, snow melting, water condensing, fog and other natural phenomena cause the collection of water on roadway pavement, leading to the decrease of road-holding capacity of a tyre.When a car or a light truck is moving at a high speed on wet road pavement, the water under its wheels cannot be expelled in time.It results in raising of the front wheels of the vehicle above the road surface under the action of a hydrodynamic force and loss of vehicle control.The methods ensuring traffic safety on road sections, where vehicle’s aquaplaning is possible, should be developed by identifying and improving these sections at the stages of highway design, reconstruction and maintenance and by limiting traffic speed of vehicles.Keywords: vehicle, road, road-holding capacity, aquaplaning, reconstruction, maintenance, traffic safety.DOI: 10.3846/mla.2009.6.06
Light Armor in Deep Operational Maneuver: The New Excalibur?
1994-05-04
organizations. 29 777-P7 777777-7 Operatlon Barration . The Belorussilan Camoaign During The Russo - German War. 194& Operation Bagration took place...McLean, VA: Brassey’s Defence Publisher’s, 1984), p. 141., 35. James 3. Schneider, "V.K. Triandafillov, Military Theorist." The Journal of SoQviet...Doctrine," The_= RIjournaL (March 1976): 38-46. Barbara,~ James C. and Brown, R.F. "Deep Thrust on the Extended Battlefield," Military Review (October 1982
The Installation Restoration Program Toxicology Guide. Volume 3
1989-07-01
Cannon, C.; Bloom , A.D.; Nakamu~ra, F.; Ahmned, M.; Duk, S.; Rimpo, J.; Margolin, B~a; Resnickr. M.A; Anderson, B.; Zeiger, E. 1987. Chromosome...carbon compounds evaluated in the SCE test in vitro. Environ Mutage:. 9.401-410. 3846. Woodruff, R.& ; Mason, J.M.; Valencia , RL; Zi7nmering, S. 1984...0.2 ppm), bread, oranges and rum. This compound appears to be a r.ommon component of the diet although a total exposure from this source can not be
DEFF Research Database (Denmark)
Andersen, Johannes
2014-01-01
efter en 10+10+10 timers model. Ifølge lektor og samfundsforsker Johannes Andersen ved Institut for statskundskab på Aalborg Universitet, er antallet af stress ramte danskere steget fra 5 procent i 1989 til mere end 12 procent i 2010. Således tyder noget på, at danskerne ikke får den fornødne hvile....
Directory of Open Access Journals (Sweden)
Dean Jankuloski
2007-11-01
Full Text Available Listeria monocytogenes contamination of the environment and surfaces of the equipment was examined in seven meat processing facilities. Up to date prevalence of this foodborn pathogen in meat processing facilities facilities in Republic of Macedonia was unknown. Biofilms are composed from food spoilage microorganisms and food born pathogens. They are located on the surfaces of the equipment that come in contact with food and in facilities environment. Microorganisms in biofilm presenting micro eco system and are source of dissemination and contamination of food born pathogens in final meat products. During the preparation of this study we have covered a 7 meat processing facilities and we took a total of 39 swabs from surfaces that come in direct or indirect contact with food. Listeria monocytogenes was discovered in 10 (25,64% swabs (locations. Prevalence of other Listeria spp. compared with total number of taken samples was 15 (38,46% Listeria innocua, 3 (7,69% Listeria welshimeri and 1 (2,65% isolate Listeria seeligeri.
Directory of Open Access Journals (Sweden)
Raju Suresh Kumar
2010-08-01
Full Text Available In the title compound, C37H32N2O3, an intramolecular O—H...N hydrogen bond generates a five-membered ring, producing an S(5 motif. The piperidone ring adopts a half-chair conformation. The two fused pyrrolidine rings have similar envelope conformations. The interplanar angles between the benzene rings A/B and C/D are 75.68 (7 and 30.22 (6°, respectively. In the crystal structure, adjacent molecules are interconnected into chains propagating along the [010] direction via intermolecular C—H...O hydrogen bonds. Further stabilization is provided by weak C—H...π interactions.
2010-06-23
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, and MD-10-10F Airplanes... certain McDonnell Douglas Model DC-10-10, DC-10-10F, and MD-10-10F airplanes. That NPRM was published in... amends Sec. 39.13 by adding the following new AD: 2010-13-06 McDonnell Douglas Corporation: Amendment 39...
Directory of Open Access Journals (Sweden)
Gaurav Sanghi
2018-01-01
Full Text Available Purpose: To determine the efficacy of the online monitoring tool, WINROP (https://winrop.com/ in detecting sight-threatening type 1 retinopathy of prematurity (ROP in Indian preterm infants. Methods: Birth weight, gestational age, and weekly weight measurements of seventy preterm infants (<32 weeks gestation born between June 2014 and August 2016 were entered into WINROP algorithm. Based on weekly weight gain, WINROP algorithm signaled an alarm to indicate that the infant is at risk for sight-threatening Type 1 ROP. ROP screening was done according to standard guidelines. The negative and positive predictive values were calculated using the sensitivity, specificity, and prevalence of ROP type 1 for the study group. 95% confidence interval (CI was calculated. Results: Of the seventy infants enrolled in the study, 31 (44.28% developed Type 1 ROP. WINROP alarm was signaled in 74.28% (52/70 of all infants and 90.32% (28/31 of infants treated for Type 1 ROP. The specificity was 38.46% (15/39. The positive predictive value was 53.84% (95% CI: 39.59–67.53 and negative predictive value was 83.3% (95% CI: 57.73–95.59. Conclusion: This is the first study from India using a weight gain-based algorithm for prediction of ROP. Overall sensitivity of WINROP algorithm in detecting Type 1 ROP was 90.32%. The overall specificity was 38.46%. Population-specific tweaking of algorithm may improve the result and practical utility for ophthalmologists and neonatologists.
2010-01-19
...-0043; Directorate Identifier 2009-NM-128-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas... directive (AD) for certain McDonnell Douglas Model DC-10-10, DC-10-10F, and MD-10-10F airplanes. This... adding the following new AD: McDonnell Douglas Corporation: Docket No. FAA-2010-0043; Directorate...
2010-05-04
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10... amends Sec. 39.13 by adding the following new AD: 2010-09-12 McDonnell Douglas Corporation: Amendment 39... to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10-30F (KC-10A...
Uus valem otsustamiseks: 10-10-10 / Jack Welch, Suzy Welch
Welch, Jack
2009-01-01
Juhtimisspetsialistid Jack ja Suzy Welch tutvustavad enda loodud valemit 10-10-10, mis on elu juhtimise tööriist aitamaks langetada raskeid otsuseid, hinnates nende mõju 10 minuti, 10 kuu ja 10 aasta pärast
Directory of Open Access Journals (Sweden)
Yanyan Chen
2014-04-01
Full Text Available We cloned the gene ACM61449 from anaerobic, thermophilic Caldicellulosiruptor bescii, and expressed it in Escherichia coli origami (DE3. After purification through thermal treatment and Ni-NTA agarose column extraction, we characterized the properties of the recombinant protein (CbPelA. The optimal temperature and pH of the protein were 72 °C and 5.2, respectively. CbPelA demonstrated high thermal-stability, with a half-life of 14 h at 70 °C. CbPelA also showed very high activity for polygalacturonic acid (PGA, and released monogalacturonic acid as its sole product. The Vmax and Km of CbPelA were 384.6 U·mg−1 and 0.31 mg·mL−1, respectively. CbPelA was also able to hydrolyze methylated pectin (48% and 10% relative activity on 20%–34% and 85% methylated pectin, respectively. The high thermo-activity and methylated pectin hydrolization activity of CbPelA suggest that it has potential applications in the food and textile industry.
Directory of Open Access Journals (Sweden)
Tinelli Carmine
2007-04-01
Full Text Available Abstract Background This study evaluated the feasibility, toxicity, response rate and survival of neoadjuvant superselective intra-arterial infusion of high dose carboplatin in advanced head and neck cancer. Methods Forty-six patients with primary head and neck squamous cell carcinoma received 3 cycles of intra-arterial carboplatin (300 to 350 mg/m2 per cycle every 2 weeks, followed by radiotherapy or surgery plus radiotherapy. Results No complications or severe toxicity occurred. Sixteen patients (35% were complete responders, 20 (43% partial responders while 10 (22% did not respond to treatment. After completion of the multimodality treatment, 38/46 patients (83% were complete responders. After a 5-year follow-up period, 18/46 patients (39% are alive and disease-free, 3 (6,5% have died of a second primary tumor and 25 (54,5% have died of the disease. Conclusion Intra-arterial carboplatin induction chemotherapy is a safe, well-tolerated technique that discriminates between responders and non-responders and so may have prognostic significance in planning further integrated treatments aimed to organ preservation for advanced head and neck carcinomas.
Studies and Analysis of the Effectiveness of Stormwater Runoff Purification Equipment in Vilnius
Directory of Open Access Journals (Sweden)
Egidija Jaruševičiūtė
2011-02-01
Full Text Available In order to protect the natural environment from pollution, pollutant reduction in the stormwater runoff of urban areas is a particularly relevant factor. Uneven surface water flow and changes in pollutant concentration complicate conventional matching techniques and processes as well as prolong the duration of time which requires a comprehensive study in this area. Therefore, experiments on inflow stormwater turbidity and impurity with suspended solids and petroleum products were carried out according to the prepared sample collecting methodology. The study evaluated the effectiveness of cleaning a stormwater treatment plant along the settlement chamber in the chosen points. The settling time of impurities found in stormwater was analyzed under the presence of ideal conditions in the laboratory. The conducted experiments established dependence between suspended solids and turbidity. Stormwater pollution by SS was reduced only to 21–35% after heavy rain or a snow melting period in treatment plants. Keywords: storm water runoff, cleaning stormwater treatment plant, pollutants, turbidity, suspended solids, petrol products.DOI: 10.3846/mla.2010.087
2010-07-07
...-0672; Directorate Identifier 2010-NM-047-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas...: McDonnell Douglas Corporation: Docket No. FAA-2010-0672; Directorate Identifier 2010-NM-047-AD. Comments Due... applies to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-30, DC-10-30F (KDC-10), DC-10...
2010-02-08
...-0032; Directorate Identifier 2009-NM-213-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas...: McDonnell Douglas Corporation: Docket No. FAA-2010-0032; Directorate Identifier 2009-NM-213-AD. Comments Due... applies to McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10-30F (KC-10A...
2010-10-14
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-30, DC-10-30F (KDC-10... following new airworthiness directive (AD): 2010-21-13 McDonnell Douglas Corporation: Amendment 39-16473... November 18, 2010. Affected ADs (b) None. Applicability (c) This AD applies to McDonnell Douglas...
2010-10-01
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-10, DC-10-10F, DC-10-15, DC-10-30, DC-10... adding the following new AD: 2010-20-14 McDonnell Douglas Corporation: Amendment 39-16449. Docket No. FAA... the airplanes identified in paragraphs (c)(1) and (c)(2) of this AD. (1) McDonnell Douglas Corporation...
CHEMOTHERAPY OF GASTRO-INTESTINAL NAMATODES IN COMMON PEAFOWL (PAVO CRISTATUS
Directory of Open Access Journals (Sweden)
M. Ashraf, Faisal Noman Waraich, I.G. Ahmad and K. Pervez
2002-04-01
Full Text Available The present study was undertaken to find out the prevalence of gastro-intestinal nematodes in common peafowl (Pavo cristatus at Lahore Zoo and to evaluate the comparative efficacy of albendazole, levamisole HCI and oxfendazole. Fifty-two faecal samples of the birds were examined in Medicine Laboratory, College of Veterinary Sciences, Lahore, with direct smear method for the identification of nematode ova. Forty two samples out of 52 were found positive (80.77% for single or mixed infection of Capillaria spp., Ascaridia galliand Heterakis gallinae, and the individual percentages being 59.62, 38.46 and 13.46 respectively. Out of 42 infected birds 40 were chosen for medication and divided into four groups, each consisting of 10 birds (A= treated with albendazole, B=treated with levamisole, C = treated with oxfendazole and group D= untreated control. Faecal samples of experimental birds were examined for counting of eggs per gram of faeces on day '0' (pre-medication. Faecal egg counts were again carried out on day 5 and 10 post-medication and percentage reduction of EPG was calculated. Oxfendazole was found to be the most effective (98.88% among the three anthelmintics, followed by levamisole (97.3% and albendazole (95.60%.
Abatement of Azo Dye from Wastewater Using Bimetal-Chitosan
Directory of Open Access Journals (Sweden)
Ghorban Asgari
2013-01-01
Full Text Available We introduce a new adsorbent, bimetallic chitosan particle (BCP that is successfully synthesized and applied to remove the orange II dye from wastewater. The effects of pH, BCP quantity, and contact time are initially verified on the basis of the percentage of orange II removed from the wastewater. Experimental data reveal that the Cu/Mg bimetal and chitosan have a synergistic effect on the adsorption process of the adsorbate, where the dye adsorption by Cu/Mg bimetal, chitosan alone, and bimetal-chitosan is 10, 49, and 99.5%, respectively. The time required for the complete decolorization of orange II by 1 mg/L of BCP is 10 min. The Langmuir model is the best fit for the experimental data, which attains a maximum adsorption capacity of 384.6 mg/g. The consideration of the kinetic behavior indicates that the adsorption of orange II onto the BCP fits best with the pseudo-second-order and Elovich models. Further, the simulated azo dye wastewater can be effectively treated using a relatively low quantity of the adsorbent, 1 mg/L, within a short reaction time of 20 min. Overall, the use of BCP can be considered a promising method for eliminating the azo dye from wastewater effectively.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Location. 190.10-10 Section 190.10-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT Means of Escape § 190.10-10 Location. (a) The two means of escape shall be as remote as...
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Location. 72.10-10 Section 72.10-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS CONSTRUCTION AND ARRANGEMENT Means of Escape § 72.10-10 Location. (a) The two means of escape shall be as remote as practicable so as to minimize...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Location. 92.10-10 Section 92.10-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS CONSTRUCTION AND ARRANGEMENT Means of Escape § 92.10-10 Location. (a) The two means of escape shall be as remote as practicable so as...
DEFF Research Database (Denmark)
10x10 collects personal essays by ten leading contemporary social science scholars on the ten works they each find have formed their own academic development the most. Based on the insights and experiences of people who have formed their various fields in important ways, it offers personal reviews...
1 CFR 10.10 - Publication required.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication required. 10.10 Section 10.10 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER PRESIDENTIAL PAPERS Annual Publication § 10.10 Publication required. The Director of the Federal...
2010-11-05
...-1044; Directorate Identifier 2010-NM-033-AD] RIN 2120-AA64 Airworthiness Directives; McDonnell Douglas..., 2007) and adding the following new AD: McDonnell Douglas Corporation: Docket No. FAA-2010-1044.... Applicability (c) This AD applies to all McDonnell Douglas Corporation Model DC-10-10, DC-10-10F, DC-10-15, DC...
10 CFR 451.10 - Administrative appeals.
2010-01-01
... 10 Energy 3 2010-01-01 2010-01-01 false Administrative appeals. 451.10 Section 451.10 Energy DEPARTMENT OF ENERGY ENERGY CONSERVATION RENEWABLE ENERGY PRODUCTION INCENTIVES § 451.10 Administrative... application in whole or in part shall appeal, on or before 45 days from date of the notice issued by the DOE...
10 CFR 904.10 - Excess energy.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Excess energy. 904.10 Section 904.10 Energy DEPARTMENT OF ENERGY GENERAL REGULATIONS FOR THE CHARGES FOR THE SALE OF POWER FROM THE BOULDER CANYON PROJECT Power Marketing § 904.10 Excess energy. (a) If excess Energy is determined by the United States to be available...
46 CFR 58.10-10 - Diesel engine installations.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Diesel engine installations. 58.10-10 Section 58.10-10... MACHINERY AND RELATED SYSTEMS Internal Combustion Engine Installations § 58.10-10 Diesel engine installations. (a) The requirements of § 58.10-5 (a), (c), and (d) shall apply to diesel engine installations...
10 CFR 72.10 - Employee protection.
2010-01-01
... adverse action occurs because the employee has engaged in protected activities. An employee's engagement... 10 Energy 2 2010-01-01 2010-01-01 false Employee protection. 72.10 Section 72.10 Energy NUCLEAR... Employee protection. (a) Discrimination by a Commission licensee, certificate holder, an applicant for a...
10B-NMR determination of 10B-BPA, 10B-BPA–fructose complex and total 10B in blood for BNCT
International Nuclear Information System (INIS)
Yoshino, K.; Yabe, T.; Hattori, T.; Saito, K.; Ishikawa, A.; Ohki, H.
2014-01-01
First spontaneous, noninvasive determination method of 10 B-BPA, 10 B-BPA–fructose complex, and total 10 B in blood is described. 10 B-NMR measurement with 100,000 FT accumulation enables us to obtain the result within 100 min/sample. The detection limits for the simultaneous analysis were 3 ppm, 3 ppm and 6 ppm for 10 B-BPA, 10 B-BPA–fructose complex and total 10 B respectively in this study. By this method, we can actually discuss behavior of the 10 B-BPA–fructose complex in blood. - Highlights: • First 10 B-NMR determination of 10 B-BPA and 10 B-BPA–fructose complex in blood. • Total 10 B concentration in blood could be obtained by this method • The detection limit was 3 ppm for total 10 B
International Nuclear Information System (INIS)
Hurtado-Lopez, Luis Mauricio; Arellano-Montano, Sara; Torres-Acosta, Evelyn Migdalia; Zaldivar-Ramirez, Felipe Rafael; Duarte-Torres, Reyna Margarita; Alonso-de-Ruiz, Patricia; Martinez-Duncker, Ivan; Martinez-Duncker, Carlos
2004-01-01
The probability of malignancy is increased in hypofunctioning solitary thyroid nodules (HFNs). Fine-needle aspiration biopsy (FNA), 99m Tc-methoxyisobutylisonitrile (MIBI) and frozen section biopsy (FS) have limited independent diagnostic accuracy for the differential diagnosis of HFNs. The goal of this study was to assess the accuracy of the three independent diagnostic methods in distinguishing between benign and malignant disease. A total of 130 patients with an HFN on the 99m Tc-pertechnetate scan were included in this study. FNA, MIBI scans, FS, thyroidectomy and histological analysis of surgical specimens for final diagnosis were performed in all patients. Of the 130 patients, 80 (61.54%) had benign lesions and 50 (38.46%), malignant lesions. FNA was diagnostic in 78/130 (60%) patients and non-diagnostic in 52/130 (40%) patients. None of the patients with a negative MIBI scan had a final histological diagnosis of malignancy, and MIBI scans were negative in 38.46% of patients with non-diagnostic FNA results. FS was diagnostic in 104/130 (80%) patients and non-diagnostic in 26/130 (20%) patients. Sensitivity, specificity, positive and negative predictive values and positive and negative likelihood ratios were 81.3%, 97.8%, 96%, 88%, 36.95 and 0.19 respectively for FNA; 100%, 61.3%, 61.7%, 100%, 2.58 and 0 respectively for MIBI; and 80.5%, 100%, 100%, 89%, 0 and 0.2 respectively for FS. Use of both MIBI scans and FS in patients with non-diagnostic FNA rendered a specificity and sensitivity of 100%. MIBI scans exclude malignancy in a significant proportion of patients with non-diagnostic FNAs (38% in this study). Cystic nodules with a positive MIBI scan should be further investigated even when the FNA result indicates a benign lesion. Combined use of FNA, MIBI and FS offers the best diagnostic accuracy. (orig.)
10 CFR 10.22 - Notice to individual.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Notice to individual. 10.22 Section 10.22 Energy NUCLEAR... NATIONAL SECURITY INFORMATION OR AN EMPLOYMENT CLEARANCE Procedures § 10.22 Notice to individual. A... Counsel, and signed by the Director, Office of Administration, must be presented to each individual whose...
Stimulus-responsive hydrogels based on associative polymers
DEFF Research Database (Denmark)
Hietala, Sami; Hvilsted, Søren; Jankova Atanasova, Katja
2008-01-01
An important group of water soluble polymers are associative ones in which hydrophobic parts of the polymer molecules interact, self-assemble and enhance the viscosity of aqueous solutions even at low polymer concentrations. For many applications it would be beneficial to be able to combine the a......, in press. 3. S. Hietala, P. Mononen, S. Strandman, P. Jarvi, M. Torkkeli, K. Jankova, S. Hvilsted, H. Tenhu Polymer, 48 (2007) 4087-4096........ The resulting hydrogels were studied with respect to the polymer concentration, temperature and ionic strength.3 REFERENCES 1. Nuopponen M.; Kalliomaki K.; Laukkanen A.; Hietala S.; Tenhu H. 1. Polym. Sci. Polym. Chern. 2008, 46, 38-46. 2. Hietala S.; Nuopponen M.; Kalliomaki K.; Tenhu H. Macromolecules...
Ghadge, Shrinath Dattatray; Patel, Prasad P.; Datta, Moni K.; Velikokhatnyi, Oleg I.; Shanthi, Pavithra M.; Kumta, Prashant N.
2018-07-01
One dimensional (1D) vertically aligned nanotubes (VANTs) of (Sn0.8Ir0.2)O2:10F are synthesized for the first time by a sacrificial template assisted approach. The aim is to enhance the electrocatalytic activity of F doped (Sn,Ir)O2 solid solution electrocatalyst for oxygen evolution reaction (OER) in proton exchange membrane (PEM) based water electrolysis by generating (Sn0.8Ir0.2)O2:10F nanotubes (NTs). The 1D vertical channels and the high electrochemically active surface area (ECSA ∼38.46 m2g-1) provide for facile electron transport. This results in low surface charge transfer resistance (4.2 Ω cm2), low Tafel slope (58.8 mV dec-1) and excellent electrochemical OER performance with ∼2.3 and ∼2.6 fold higher electrocatalytic activity than 2D thin films of (Sn0.8Ir0.2)O2:10F and benchmark IrO2 electrocatalysts, respectively. Furthermore, (Sn0.8Ir0.2)O2:10F NTs exhibit excellent mass activity (21.67 A g-1), specific activity (0.0056 mAcm-2) and TOF (0.016 s-1), which is ∼2-2.6 fold higher than thin film electrocatalysts at an overpotential of 270 mV, with a total mass loading of 0.3 mg cm-2. In addition, (Sn0.8Ir0.2)O2:10F NTs demonstrate remarkable electrochemical durability - comparable to thin films of (Sn0.8Ir0.2)O2:10F and pure IrO2, operated under identical testing conditions in PEM water electrolysis. These results therefore indicate promise of (Sn0.8Ir0.2)O2:10F NTs as OER electrocatalysts for efficient and sustainable hydrogen production.
10 CFR 960.5-2-10 - Hydrology.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Hydrology. 960.5-2-10 Section 960.5-2-10 Energy DEPARTMENT OF ENERGY GENERAL GUIDELINES FOR THE PRELIMINARY SCREENING OF POTENTIAL SITES FOR A NUCLEAR WASTE... Hydrology. (a) Qualifying condition. The site shall be located such that the geohydrologic setting of the...
International Nuclear Information System (INIS)
Marthinez-Miranda, L.J.; Santiago-Aviles, J.J.; Siegal, M.P.; Graham, W.R.; Heiney, P.A.
1990-01-01
The authors have used high resolution grazing incidence x-ray scattering (GIXS) to study the in- plane and out-of-plane structure of epitaxial YSi 2-x films grown on Si(111), with thicknesses ranging from 85 Angstrom to 510 Angstrom. Their results indicate that the films are strained, and that film strain increases as a function of thickness, with lattice parameters varying from a = 3.846 Angstrom/c = 4.142 Angstrom for the 85 Angstrom film to a = 3.877 Angstrom/c = 4.121 Angstrom for the 510 Angstrom film. The authors correlate these results with an increase in pinhole areal coverage as a function of thickness. In addition, the authors' measurements show no evidence for the existence of ordered silicon vacancies in the films
Fast Neutron Radiation Effects on Bacillus Subtili
International Nuclear Information System (INIS)
Chen Xiaoming; Zhang Jianguo; Chu Shijin; Ren Zhenglong; Zheng Chun; Yang Chengde; Tan Bisheng
2009-01-01
To examine the sterilizing effect and mechanism of neutron radiation, Bacillus subtilis var. niger. strain (ATCC 9372) spores were irradiated with the fast neutron from the Chinese fast burst reactor II(CFBR-II). The plate-count results indicated that the D 10 value was 384.6 Gy with a neutron radiation dose rate of 7.4 Gy/min. The rudimental catalase activity of the spores declined obviously with the increase in the radiation dose. Meanwhile, under the scanning electron microscope, no visible influence of the neutron radiation on the spore configuration was detected even if the dose was increased to 4 kGy. The content and distribution of DNA double-strand breaks induced by neutron radiation at different doses were measured and quantified by pulsed-field gel electrophoresis (PFGE). Further analysis of the DNA release percentage (PR), the DNA breakage level (L), and the average molecular weight, indicated that DNA fragments were obviously distributed around the 5 kb regions at different radiation doses, which suggests that some points in the DNA molecule were sensitive to neutron radiation. Both PR and L varied regularly to some extent with the increase in radiation dose. Thus neutron radiation has a high sterilization power, and can induce falling enzyme activity and DNA breakage in Bacillus subtilis spores
Su, Tin Tin; Amiri, Mohammadreza; Mohd Hairi, Farizah; Thangiah, Nithiah; Bulgiba, Awang; Majid, Hazreen Abdul
2015-01-01
We aimed to predict the ten-year cardiovascular disease (CVD) risk among low-income urban dwellers of metropolitan Malaysia. Participants were selected from a cross-sectional survey conducted in Kuala Lumpur. To assess the 10-year CVD risk, we employed the Framingham risk scoring (FRS) models. Significant determinants of the ten-year CVD risk were identified using General Linear Model (GLM). Altogether 882 adults (≥30 years old with no CVD history) were randomly selected. The classic FRS model (figures in parentheses are from the modified model) revealed that 20.5% (21.8%) and 38.46% (38.9%) of respondents were at high and moderate risk of CVD. The GLM models identified the importance of education, occupation, and marital status in predicting the future CVD risk. Our study indicated that one out of five low-income urban dwellers has high chance of having CVD within ten years. Health care expenditure, other illness related costs and loss of productivity due to CVD would worsen the current situation of low-income urban population. As such, the public health professionals and policy makers should establish substantial effort to formulate the public health policy and community-based intervention to minimize the upcoming possible high mortality and morbidity due to CVD among the low-income urban dwellers.
Directory of Open Access Journals (Sweden)
Tin Tin Su
2015-01-01
Full Text Available We aimed to predict the ten-year cardiovascular disease (CVD risk among low-income urban dwellers of metropolitan Malaysia. Participants were selected from a cross-sectional survey conducted in Kuala Lumpur. To assess the 10-year CVD risk, we employed the Framingham risk scoring (FRS models. Significant determinants of the ten-year CVD risk were identified using General Linear Model (GLM. Altogether 882 adults (≥30 years old with no CVD history were randomly selected. The classic FRS model (figures in parentheses are from the modified model revealed that 20.5% (21.8% and 38.46% (38.9% of respondents were at high and moderate risk of CVD. The GLM models identified the importance of education, occupation, and marital status in predicting the future CVD risk. Our study indicated that one out of five low-income urban dwellers has high chance of having CVD within ten years. Health care expenditure, other illness related costs and loss of productivity due to CVD would worsen the current situation of low-income urban population. As such, the public health professionals and policy makers should establish substantial effort to formulate the public health policy and community-based intervention to minimize the upcoming possible high mortality and morbidity due to CVD among the low-income urban dwellers.
ESWL treatment of urinary stones in children--the overview of 14 years of experience.
Kuvezdić, Hrvoje; Tucak, Antun; Perić, Nikica; Prlić, Damir; Zorić, Ivan; Galić, Radoslav
2003-01-01
Extracorporeal shock wave lithotripsy (ESWL) treatment has been used at Department of Urology, University Hospital "Osijek", Croatia, since July 1988. Until December 2001 seven thousand and eight hundred patients underwent ESWL for urinary stones, 68 of them were children (0.87%). Sixty-eight children aged 4 to 15 years (average 10.14 years) underwent ESWL. They were treated for the total of 91 stones: 35 (38.46%) caliceal, 23 (25.27%) in pyelon, 7 (7.69%) in pyeloureteric segment and 14 (15.38%) ureteral. Staghorn calculi were found in 6 (6.59%) patients and multiple stones (four or more stones in the same kidney) in 6 (6.59%). There was total of 95 ESWL sessions performed in 68 patients (1.39 session per patient). Fifty-six patients (82.35%) without residual stones found at the control plain film and sonography of urinary tract were considered "stone free". Addition of 5 patients with clinically insignificant residual fragments (less than 4 mm) increases overall success rate to 89.70%. ESWL is a simple, safe and effective procedure in the management of urolithiasis in childhood. Clinical experience of our institution confirms ESWL as the first line treatment for kidney stones in the pediatric age patients.
10 CFR 10.12 - Interview and other investigation.
2010-01-01
... 10 Energy 1 2010-01-01 2010-01-01 false Interview and other investigation. 10.12 Section 10.12... Interview and other investigation. (a) The Director, Division of Facilities and Security, Office of... the information in the possession of the NRC or may authorize an interview with the individual, if the...
Ciuladaite, Zivile; Preiksaitiene, Egle; Utkus, Algirdas; Kučinskas, Vaidutis
2014-01-01
Large pericentric inversions in chromosome 10 are rare chromosomal aberrations with only few cases of familial inheritance. Such chromosomal rearrangements may lead to production of unbalanced gametes. As a result of a recombination event in the inversion loop, 2 recombinants with duplicated and deficient chromosome segments, including the regions distal to the inversion, may be produced. We report on 2 relatives in a family with opposite terminal chromosomal rearrangements of chromosome 10, i.e. rec(10)dup(10p)inv(10) and rec(10)dup(10q)inv(10), due to familial pericentric inversion inv(10)(p15.1q26.12). Based on array-CGH results, we characterized the exact genomic regions involved and compared the clinical features of both patients with previous reports on similar pericentric inversions and regional differences within 10p and 10q. The fact that both products of recombination are viable indicates a potentially high recurrence risk of unbalanced offspring. This report of unbalanced rearrangements in chromosome 10 in 2 generations confirms the importance of screening for terminal imbalances in patients with idiopathic intellectual disability by molecular cytogenetic techniques such as FISH, MLPA or microarrays. It also underlines the necessity for FISH to define structural characteristics of such cryptic intrachromosomal rearrangements and the underlying cytogenetic mechanisms. © 2014 S. Karger AG, Basel.
An IP-10 (CXCL10)-Derived Peptide Inhibits Angiogenesis
Yates-Binder, Cecelia C.; Rodgers, Margaret; Jaynes, Jesse; Wells, Alan; Bodnar, Richard J.; Turner, Timothy
2012-01-01
Angiogenesis plays a critical role in processes such as organ development, wound healing, and tumor growth. It requires well-orchestrated integration of soluble and matrix factors and timely recognition of such signals to regulate this process. Previous work has shown that newly forming vessels express the chemokine receptor CXC receptor 3 (CXCR3) and, activation by its ligand IP-10 (CXCL10), both inhibits development of new vasculature and causes regression of newly formed vessels. To identify and develop new therapeutic agents to limit or reverse pathological angiogenesis, we identified a 21 amino acid fragment of IP-10, spanning the α-helical domain residues 77–98, that mimic the actions of the whole IP-10 molecule on endothelial cells. Treatment of the endothelial cells with the 22 amino acid fragment referred to as IP-10p significantly inhibited VEGF-induced endothelial motility and tube formation in vitro, properties critical for angiogenesis. Using a Matrigel plug assay in vivo, we demonstrate that IP-10p both prevented vessel formation and induced involution of nascent vessels. CXCR3 neutralizing antibody was able to block the inhibitory effects of the IP-10p, demonstrating specificity of the peptide. Inhibition of endothelial function by IP-10p was similar to that described for IP-10, secondary to CXCR3-mediated increase in cAMP production, activation of PKA inhibiting cell migration, and inhibition of VEGF-mediated m-calpain activation. IP-10p provides a novel therapeutic agent that inhibits endothelial cell function thus, allowing for the modulation of angiogenesis. PMID:22815829
Energy Technology Data Exchange (ETDEWEB)
Van Zurk, R [Commissariat a l' Energie Atomique, Lab. de Physique Nucleaire, Grenoble (France).Centre d' Etudes Nucleaires; [Grenoble-1 Univ., 38 (France); [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires
1960-07-01
A coincidence circuit of low resolution time using the differential coincidence Bay principle is described. It uses three 6BN6 tubes ordered to chronotron structure. Results with Radiotechnique 56 AVP photomultipliers and for {sup 60}Co {gamma}-{gamma} coincidences are 4,6.10{sup -10} s (full width at half maximum) if the efficiency is {epsilon} = 40 per cent and also 7,2.10{sup -10} s if {epsilon} = 85 per cent. (author) [French] Un circuit de coincidence differentiel du type de Bay, utilise en selecteur en temps a canal mobile, a ete construit pour la mesure des periodes {gamma} et des periodes d'annihilation du positon dans differents materiaux. Il comporte trois tubes 6BN6 disposes en structure chronotron. On a utilise les nouveaux photomultiplicateurs 56 AVP avec scintillateur plastique. Avec les coincidences {gamma}-{gamma} du {sup 60}Co, on obtient 2T 4,6.10{sup -10} s avec une efficacite de 40 pour cent et 2T = 7,2.10{sup -10} s avec une efficacite de 85 pour cent. (auteur)
46 CFR 54.10-10 - Standard hydrostatic test (modifies UG-99).
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Standard hydrostatic test (modifies UG-99). 54.10-10... PRESSURE VESSELS Inspection, Reports, and Stamping § 54.10-10 Standard hydrostatic test (modifies UG-99). (a) All pressure vessels shall satisfactorily pass the hydrostatic test prescribed by this section...
Development of 10×10 Matrix-anode MCP-PMT
Yang, Jie; Li, Yongbin; Xu, Pengxiao; Zhao, Wenjin
2018-02-01
10×10 matrix-anode is developed by high-temperature co-fired ceramics (HTCC) technology. Based on the new matrix-anode, a new kind of photon counting imaging detector - 10×10 matrix-anode MCP-PMT is developed, and its performance parameters are tested. HTCC technology is suitable for the MCP-PMT's air impermeability and its baking process. Its response uniformity is better than the metal-ceramic or metal-glass sealing anode, and it is also a promising method to realize a higher density matrix-anode.
A 16-bit sigma-delta modulator applied in micro-machined inertial sensors
Honglin, Xu; Qiang, Fu; Hongna, Liu; Liang, Yin; Pengfei, Wang; Xiaowei, Liu
2014-04-01
A fourth-order low-distortion low-pass sigma-delta (ΣΔ) modulator is presented for micro-machined inertial sensors. The proposed single-loop single-bit feedback modulator is optimized with a feed-forward path to decrease the nonlinearities and power consumption. The IC is implemented in a standard 0.6 μm CMOS technology and operates at a sampling frequency of 3.846 MHz. The chip area is 2.12 mm2 with 23 pads. The experimental results indicate a signal-to-noise ratio (SNR) of 100 dB and dynamic range (DR) of 103 dB at an oversampling rate (OSR) of 128 with the input signal amplitude of -3.88 dBFS at 9.8 kHz; the power consumption is 15 mW at a 5 V supply.
A 16-bit sigma–delta modulator applied in micro-machined inertial sensors
International Nuclear Information System (INIS)
Xu Honglin; Fu Qiang; Liu Hongna; Yin Liang; Wang Pengfei; Liu Xiaowei
2014-01-01
A fourth-order low-distortion low-pass sigma–delta (ΣΔ) modulator is presented for micro-machined inertial sensors. The proposed single-loop single-bit feedback modulator is optimized with a feed-forward path to decrease the nonlinearities and power consumption. The IC is implemented in a standard 0.6 μm CMOS technology and operates at a sampling frequency of 3.846 MHz. The chip area is 2.12 mm 2 with 23 pads. The experimental results indicate a signal-to-noise ratio (SNR) of 100 dB and dynamic range (DR) of 103 dB at an oversampling rate (OSR) of 128 with the input signal amplitude of −3.88 dBFS at 9.8 kHz; the power consumption is 15 mW at a 5 V supply. (semiconductor integrated circuits)
Organic dyes removal using magnetically modified rye straw
Energy Technology Data Exchange (ETDEWEB)
Baldikova, Eva, E-mail: baldie@email.cz [Department of Nanobiotechnology, Institute of Nanobiology and Structural Biology of GCRC, Na Sadkach 7, 370 05 Ceske Budejovice (Czech Republic); Safarikova, Mirka [Department of Nanobiotechnology, Institute of Nanobiology and Structural Biology of GCRC, Na Sadkach 7, 370 05 Ceske Budejovice (Czech Republic); Safarik, Ivo, E-mail: ivosaf@yahoo.com [Department of Nanobiotechnology, Institute of Nanobiology and Structural Biology of GCRC, Na Sadkach 7, 370 05 Ceske Budejovice (Czech Republic); Regional Centre of Advanced Technologies and Materials, Palacky University, Slechtitelu 11, 783 71 Olomouc (Czech Republic)
2015-04-15
Rye straw, a very low-cost material, was employed as a biosorbent for two organic water-soluble dyes belonging to different dye classes, namely acridine orange (acridine group) and methyl green (triarylmethane group). The adsorption properties were tested for native and citric acid–NaOH modified rye straw, both in nonmagnetic and magnetic versions. The adsorption equilibrium was reached in 2 h and the adsorption isotherms data were analyzed using the Langmuir model. The highest values of maximum adsorption capacities were 208.3 mg/g for acridine orange and 384.6 mg/g for methyl green. - Highlights: • Rye derivatives can be considered as efficient adsorbents for organic dyes. • Magnetic modification of straw by microwave-synthesized magnetic iron oxides. • Citric acid–NaOH modification increased the maximum adsorption capacities.
Epidemiology of haemonchosis in sheep and goats under different managemental conditions
Directory of Open Access Journals (Sweden)
Muhammad Fiaz Qamar
Full Text Available Epidemiological studies were undertaken at slaughterhouses, livestock farms and veterinary hospitals under the different climatic conditions existing in Punjab province. Infection rate of haemonchosis was 35.44, 38.04 and 36.83 per cent, respectively in slaughtered sheep and goats, sheep and goats at livestock farms and at veterinary hospitals. Overall the highest (43.69% seasonal prevalence in all types of sheep and Goats was recorded during summer; followed by autumn (38.46%, spring (37.12%, while the lowest (28.79% was recorded during winter. It was noticed that animals of either sex are equally affected. A higher infection rate was recorded in animals below 9 months than above 9 months of age and did not show any significant difference. [Vet World 2009; 2(11.000: 413-417
Cosmic rays: the spectrum and chemical composition from 10{sup 10} to 10{sup 20} eV
Energy Technology Data Exchange (ETDEWEB)
Peixoto, C.J. Todero; De Souza, Vitor [Instituto de Física de São Carlos, Universidade de São Paulo, Av. Trabalhador São-carlense 400, São Carlos (Brazil); Biermann, Peter L., E-mail: toderocj@usp.br, E-mail: vitor@ifsc.usp.br, E-mail: plbiermann@mpifr-bonn.mpg.de [Max-Planck-Institute for Radioastronomy, Auf dem Hügel 69, 53121 Bonn (Germany)
2015-07-01
The production of energetic particles in the universe remains one of the great mysteries of modern science. The mechanisms of acceleration in astrophysical sources and the details about the propagation through the galactic and extragalactic media are still to be defined. In recent years, the cosmic ray flux has been measured with high precision in the energy range from 10{sup 10} to 10{sup 20.5} eV by several experiments using different techniques. In some energy ranges, it has been possible to determine the flux of individual elements (hydrogen to iron nuclei). This paper explores an astrophysical scenario in which only our Galaxy and the radio galaxy Cen A produce all particles measured on Earth in the energy range from 10{sup 10} to 10{sup 20.5} eV . Data from AMS-02, CREAM, KASCADE, KASCADE-Grande and the Pierre Auger Observatories are considered. The model developed here is compared to the total and if available to the individual particle flux of the experiments considered.The flux of each element as determined by AMS-02, CREAM, KASCADE and KASCADE-Grande and the mass sensitivity parameter X{sub max} measured by the Pierre Auger Observatory above 10 eV are also explored within the framework of the model. The transition from 10{sup 16} to 10{sup 18} eV is carefully analyzed. It is shown that the flux measured in this energy range suggest the existence of an extra component of cosmic rays yet to be understood.
Mountain erosion over 10 yr, 10 k.y., and 10 m.y. time scales
James W. Kirchner; Robert C. Finkel; Clifford S. Riebe; Darryl E. Granger; James L. Clayton; John G. King; Walter F. Megahan
2001-01-01
We used cosmogenic 10Be to measure erosion rates over 10 k.y. time scales at 32 Idaho mountain catchments, ranging from small experimental watersheds (0.2 km2) to large river basins (35 000 km2). These long-term sediment yields are, on average, 17 times higher than stream sediment fluxes measured over...
Differential coincidence circuit in the 10-10 second region (1960)
International Nuclear Information System (INIS)
Van Zurk, R.; Grenoble-1 Univ., 38; Commissariat a l'Energie Atomique, Saclay
1960-01-01
A coincidence circuit of low resolution time using the differential coincidence Bay principle is described. It uses three 6BN6 tubes ordered to chronotron structure. Results with Radiotechnique 56 AVP photomultipliers and for 60 Co γ-γ coincidences are 4,6.10 -10 s (full width at half maximum) if the efficiency is ε = 40 per cent and also 7,2.10 -10 s if ε = 85 per cent. (author) [fr
Application of ''elektronika 10-10'' electron linac for food irradiation
International Nuclear Information System (INIS)
Migdal, W.; Maciszewski, W.; Gryzlow, A.
1995-01-01
The industrial electron linac ''Elektronica 10-10'' has been installed in Experimental Plant for Food Irradiation (INCT) in 1990. The accelerator is a prototype unit, prior the use for food treatment a period of optimization was involved in its experimental operation during 1993. The accelerator is capable to produce scanned beam of electrons with the energy 10 MeV and beam power of 10 kW. Radiation dose at minimal conveyer speed of 0.25 m/min reaches 50 kGy. The role of the plant is to promote food irradiation in Poland. (Author)
2010-10-05
... Airworthiness Directives; McDonnell Douglas Corporation Model DC- 10-30, DC-10-30F, DC-10-30F (KC-10A and KDC-10...-13 McDonnell Douglas Corporation: Amendment 39-16448; Docket No. FAA-2010-0553; Directorate.... Applicability (c) This AD applies to McDonnell Douglas Corporation Model DC- 10-30, DC-10-30F, DC-10-30F (KC-10A...
The 10-item Remembered Relationship with Parents (RRP10) scale
DEFF Research Database (Denmark)
Denollet, Johan; Smolderen, Kim G E; van den Broek, Krista C
2007-01-01
Dysfunctional parenting styles are associated with poor mental and physical health. The 10-item Remembered Relationship with Parents (RRP(10)) scale retrospectively assesses Alienation (dysfunctional communication and intimacy) and Control (overprotection by parents), with an emphasis...... on deficiencies in empathic parenting. We examined the 2-factor structure of the RRP(10) and its relationship with adult depression....
Access to a Loaded Gun Without Adult Permission and School-Based Bullying.
Simckes, Maayan S; Simonetti, Joseph A; Moreno, Megan A; Rivara, Frederick P; Oudekerk, Barbara A; Rowhani-Rahbar, Ali
2017-09-01
Gun access and bullying are risk factors for sustaining or perpetrating violence among adolescents. Our knowledge of gun access among bullied students is limited. We used data on students, aged 12-18 years, from the 2011 and 2013 School Crime Supplement to the National Crime Victimization Survey to assess the association between self-reported bullying victimization (traditional and cyber) and access to a loaded gun without adult permission. Prevalence ratios (PRs) and confidence intervals (CIs) were obtained from multivariable Poisson regression using the Taylor series after controlling for student age, sex, family income, public/private school, and race. Of 10,704 participants, 4.2% (95% CI: 3.8%-4.6%) reported gun access. Compared with nonbullied students, those who reported traditional bullying (PR = 2.2; 95% CI: 1.7-2.4), cyberbullying (PR = 2.8; 95% CI: 1.6-4.9), and both (PR = 5.9; 95% CI: 4.6-7.7) were more likely to also report gun access. Adolescents who experience bullying, particularly those who report both traditional bullying and cyberbullying, are more likely to report access to a loaded gun without adult permission. These findings highlight the importance of developing interventions focused on these modifiable risk factors for preventing self-directed or interpersonal violence among youth. Copyright © 2017 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Wellstein, J.
2008-01-01
This article takes a look at how geothermal energy can not only be used to supply heating energy, but also be used to provide cooling too. The article reports on a conference on heating and cooling with geothermal energy that was held in Duebendorf, Switzerland, in March 2008. The influence of climate change on needs for heating and cooling and the need for additional knowledge and data on deeper rock layers is noted. The seasonal use of geothermal systems to provide heating in winter and cooling in summer is discussed. The planning of geothermal probe fields and their simulation is addressed. As an example, the geothermal installations under the recently renewed and extended 'Dolder Grand' luxury hotel in Zurich are quoted. The new SIA 384/6 norm on geothermal probes issued by the Swiss Association of Architects SIA is briefly reviewed.
TAF10 and TAF10b partially redundant roles during Drosophila melanogaster morphogenesis.
Pahi, Z; Borsos, B N; Vedelek, B; Shidlovskii, Y V; Georgieva, S G; Boros, I M; Pankotai, T
2017-01-01
Transcription of eukaryotic genes requires the cooperative action of the RNA polymerase complex, the general transcription factors (TFIIB, TFIID, TFIIE, TFIIF and TFIIH) and chromatin modifiers. The TFIID complex contributes to transcriptional activation by several mechanisms and has a subunit with associated histone acetyltransferase (HAT) activity. The histone modifier SAGA complex has both HAT and deubiquitylase (DUB) activities. TFIID and SAGA share several TBP-associated factors (TAFs), but not their HAT subunit. Recently, several duplicated TAF proteins have been identified in higher eukaryotes, but their functional diversity has been so far poorly characterized. Here, we report the functional similarities and differences of TAF10 and TAF10b, the two TAF10 orthologs of Drosophila melanogaster. Results from in silico modeling suggest that dTAF10 and dTAF10b have similar secondary structures characterized by the presence of a histone-fold domain. Additionally, dTAF10 and dTAF10b share interaction partners and show similar expression patterns in neuronal tissues. Nonetheless, dTAF10 and dTAF10b seem to have partly distinct functions. To investigate their roles, we generated dTaf10-dTaf10b double-mutants and rescued the mutant flies with transgenes, which allowed the translation of either dTAF10 or dTAF10b protein. We found that the loss of dTAF10b resulted in pupal lethality, while animals lacking dTAF10 were able to form puparium. dTaf10 mutant adults showed distorted eye morphology. During DNA repair, dTAF10 and dTAF10b act redundantly, suggesting that these proteins have distinct but partially overlapping functions.
Energy Technology Data Exchange (ETDEWEB)
Reboul, S. H. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2017-07-19
Two surface samples (HTF-10-17-30 and HTF-10-17-31) and two variable depth samples (HTF-10-17-32 and HTF-10-17-33) were collected from SRS Tank 10 during March 2017 and submitted to SRNL for characterization. At SRNL, the two surface samples were combined in one container, the two variable depth samples (VDSs) were combined in another container, and then the two composite samples were each characterized by a series of physical, ionic, radiological, and elemental analysis methods. The surface sample composite was characterized primarily for Tank Farm corrosion control purposes, while the VDS composite was characterized primarily for Tank Closure Cesium Removal (TCCR) purposes.
International Nuclear Information System (INIS)
Kleinschmidt, Axel; Nicolai, Hermann
2006-01-01
We construct simple exact solutions to the E 10 /K(E 10 ) coset model by exploiting its integrability. Using the known correspondences with the bosonic sectors of maximal supergravity theories, these exact solutions translate into exact cosmological solutions. In this way, we are able to recover some recently discovered solutions of M-theory exhibiting phases of accelerated expansion, or, equivalently, S-brane solutions, and thereby accommodate such solutions within the E 10 /K(E 10 ) model. We also discuss the situation regarding solutions with non-vanishing (constant) curvature of the internal manifold
VHI-10 and SVHI-10 Differences in Singers' Self-perception of Dysphonia Severity.
Renk, Elizabeth; Sulica, Lucian; Grossman, Chad; Georges, Jenny; Murry, Thomas
2017-05-01
Previous investigations of the Voice Handicap Index (VHI)-10 in clinical practice noted that specific information relevant to singers was not forthcoming. Consequently, a second index, the Singing Voice Handicap Index (SVHI) as well as its shortened counterpart the SVHI-10, was developed. The purpose of this study was to directly compare the differences in scores between the VHI-10 and the SVHI-10 in a group of 50 singers. A retrospective chart review of 50 singers (26 women, 24 men) was performed between June 2014 and November 2014 at Weill Cornell Medical College, New York. Subjects completed both the VHI-10 and the SVHI-10 at their initial evaluation. The results from the VHI-10 and the SVHI-10 were then compared using paired t test and two-way analysis of variance. The SVHI-10 scores from the performers were significantly higher than those of the VHI-10 (P < 0.0001). The mean score on the VHI-10 was 12.1 compared with 20.4 on the SVHI-10 (maximum score for each questionnaire is 40). There were no significant gender differences when comparing the VHI-10 and the SVHI-10 on the overall scores or for individual items. The analysis of variance also found no significant gender difference (P = 0.865) and confirmed a significant difference between VHI-10 and SVHI-10 (P = 0.0003). Whereas singers may have general complaints about their voice, they also have specific complaints that relate only to their singing voice. Finding a significant difference between the scores of the VHI-10 and the SVHI-10 suggests the importance of assessing the singer's perception of voice severity using a tool that focuses on the singing voice. Copyright © 2017 The Voice Foundation. Published by Elsevier Inc. All rights reserved.
Weekly dose-dense paclitaxel and carboplatin in recurrent ovarian carcinoma: A phase II trial
International Nuclear Information System (INIS)
Shawky, H.; Tawfik, H.; Hewidy, M.
2014-01-01
Purpose: The aim of this study was to investigate efficacy and toxicity of the dose-dense weekly paclitaxel (T) and carboplatin (C) in the management of platinum-resistant/sensitive recurrent epithelial ovarian cancer (EOC) previously treated with 3 weekly paclitaxel/carboplatin. Methods: Thirty two patients with recurrent EOC who had received 3 weekly TC before were enrolled. Nine patients relapsed within 6 months (platinum-resistant), 13 patients relapsed after 12 months (platinum-sensitive) and in 10 patients recurrence occurred between 6 and 12 months (intermediate platinum-sensitive). Weekly (T) at a dose of 80 mg/m2, followed by weekly (C) AUC 2 on day 1, 8, and 15 of a 28-day cycle for 6 planned cycles were administrated. End-points were overall response rate (ORR), progression free survival (PFS), overall survival (OS) and toxicity. Results: The ORR was 62.5%. For the platinum-resistant, intermediate platinum-sensitive and platinum-sensitive patients the ORR was 44.4% (4/9), 60% (6/10) and 76.9% (10/13), respectively, and 1 (11.1%), 2 (20%) and 5 (38.46%) patients, respectively had CR. PFS was 9.1 months (6.13, 9.1 and 12.17 months, for the 3 groups, respectively) (P < 0.001). OS was 14 months (9.17, 15.2, and 19.23 months, for the 3 groups, respectively) (P < 0.001). Treatment-related adverse events were manageable with only 1 patient (3.1%) suffering from grade 4 neutropenia. Grade 3 hematological and non-hematological toxicities were neutropenia in 8 (25%), and peripheral neuropathy in 4 (12.5%) patients, respectively. Conclusion: Weekly TC is active and well-tolerated in platinum-resistant and platinum-sensitive patients with recurrent EOC previously treated with TC given every 3 weeks
McFedries, Paul
2015-01-01
Learn Windows 10 quickly and painlessly with this beginner's guide Windows 10 Simplified is your absolute beginner's guide to the ins and outs of Windows. Fully updated to cover Windows 10, this highly visual guide covers all the new features in addition to the basics, giving you a one-stop resource for complete Windows 10 mastery. Every page features step-by-step screen shots and plain-English instructions that walk you through everything you need to know, no matter how new you are to Windows. You'll master the basics as you learn how to navigate the user interface, work with files, create
Exploration of {sup 10}Be analysis using 10 μg of Be carrier
Energy Technology Data Exchange (ETDEWEB)
Horiuchi, Kazuho, E-mail: kh@hirosaki-u.ac.jp [Graduate School of Science and Technology, Hirosaki University, 3, Bunkyo-chou, Hirosaki, Aomori 036-8561 (Japan); Matsuzaki, Hiroyuki, E-mail: hmatsu@um.u-tokyo.ac.jp [Micro Analysis Laboratory, Tandem Accelerator (MALT), The University Museum, The University of Tokyo, 2-11-16, Yayoi, Bunkyo-ku, Tokyo 113-0032 (Japan)
2015-10-15
A {sup 10}Be analysis using only 10 μg of commercially available Be carrier was explored using Accelerator Mass Spectrometry (AMS) at the Micro Analysis Laboratory, Tandem accelerator, The University of Tokyo. A combination of sample pretreatment and AMS analysis dedicated to this limited-carrier experiment enabled us to achieve reproducible measurements linear up to 10{sup −14} ({sup 10}Be/{sup 9}Be ratio). Using this method we determined an order of 10{sup 5} atoms g{sup −110}Be concentrations in sub-gram natural quartz samples taken from low (0.5–1 km) altitudes in Asian mid to high latitudes, and with apparent {sup 10}Be ages of 10–60 ka. Concentrations determined with the limited-carrier analysis were fairly consistent with those of previous ordinary analysis with tens of grams of quartz. Therefore, {sup 10}Be analysis using 10 μg of Be carrier was demonstrated for natural samples with an order of 10{sup 5} atoms g{sup −1}, with an error of about 10%.
Differential gene expression in ADAM10 and mutant ADAM10 transgenic mice
Directory of Open Access Journals (Sweden)
Postina Rolf
2009-02-01
Full Text Available Abstract Background In a transgenic mouse model of Alzheimer disease (AD, cleavage of the amyloid precursor protein (APP by the α-secretase ADAM10 prevented amyloid plaque formation, and alleviated cognitive deficits. Furthermore, ADAM10 overexpression increased the cortical synaptogenesis. These results suggest that upregulation of ADAM10 in the brain has beneficial effects on AD pathology. Results To assess the influence of ADAM10 on the gene expression profile in the brain, we performed a microarray analysis using RNA isolated from brains of five months old mice overexpressing either the α-secretase ADAM10, or a dominant-negative mutant (dn of this enzyme. As compared to non-transgenic wild-type mice, in ADAM10 transgenic mice 355 genes, and in dnADAM10 mice 143 genes were found to be differentially expressed. A higher number of genes was differentially regulated in double-transgenic mouse strains additionally expressing the human APP[V717I] mutant. Overexpression of proteolytically active ADAM10 affected several physiological pathways, such as cell communication, nervous system development, neuron projection as well as synaptic transmission. Although ADAM10 has been implicated in Notch and β-catenin signaling, no significant changes in the respective target genes were observed in adult ADAM10 transgenic mice. Real-time RT-PCR confirmed a downregulation of genes coding for the inflammation-associated proteins S100a8 and S100a9 induced by moderate ADAM10 overexpression. Overexpression of the dominant-negative form dnADAM10 led to a significant increase in the expression of the fatty acid-binding protein Fabp7, which also has been found in higher amounts in brains of Down syndrome patients. Conclusion In general, there was only a moderate alteration of gene expression in ADAM10 overexpressing mice. Genes coding for pro-inflammatory or pro-apoptotic proteins were not over-represented among differentially regulated genes. Even a decrease of
Directory of Open Access Journals (Sweden)
Mirna Albuquerque Frota
2010-09-01
Full Text Available O estudo objetivou avaliar a qualidade de vida de crianças com insuficiência renal crônica e identificar os domínios mais relevantes. É descritivo, com abordagem qualitativa e quantitativa, para a qual se utilizou a aplicação do Autoquestionnaire Qualité de Vie Enfant Imagé (AUQEI. Realizado no Instituto do Rim, em Fortaleza-CE-Brasil, com 13 crianças com diagnóstico de insuficiência renal crônica. Os dados foram analisados por meio da técnica de análise temática e do programa estatístico EXCEL. Emergiram as categorias: Dor no momento da diálise; Hospitalização; Limitações da doença e tratamento; Expectativa do transplante; e Apoio/aproximação familiar. A análise dos dados indicou que 61,53% das crianças possuem qualidade de vida regular, enquanto 38,46% têm essa qualidade prejudicada. As dimensões mais representativas foram: Lazer e Família, sendo Autonomia a dimensão mais comprometida. A qualidade de vida de criança com insuficiência renal crônica é considerada satisfatória, apesar das limitações.El objetivo del estudio fue evaluar la cualidad de vida de niños con insuficiencia renal crónica e identificar los dominios más importantes. Es descriptivo, con abordaje cualitativo y cuantitativo, donde se utilizó la aplicación del Autoquestionnaire Qualité de Vie Enfant Imagé (AUQEI. Realizado en el Instituto del Riñón, en Fortaleza-CE-Brasil, con 13 niños con diagnóstico de insuficiencia renal crónica. Los datos fueron analizados a través de la técnica de análisis temática y del programa EXCEL. Emergieron las categorías: Dolor en el momento de la diálisis; Hospitalización; limitaciones de la enfermedad y tratamiento; expectativa del trasplante; y apoyo/aproximación familiar. El análisis de los datos indicó que 61,53% de los niños poseen una cualidad de vida regular, mientras 38,46% tienen esta cualidad perjudicada. Las dimensiones más representativas fueron: entretenimiento y familia
Institute of Scientific and Technical Information of China (English)
2010-01-01
@@ 号称"Maverick Meerkat(狐獴)"的Ubuntu10.10将于近日发布正式版本,毫无疑问,大部分的Ubuntu用户都在等着下载最新版.以下为那些还没有使用过Ubuntu的用户列举了12个不得不期待Ubuntu10.10的理由. 1.速度 Ubuntu10.10的运行速度异常的快.据报道,Ubuntu使用版甚至可以在短短的7秒内完成开机.对于开机速度这点,Windows显然是无法比的.
Improving the Bevatron vacuum to 10-10 torr
International Nuclear Information System (INIS)
Avery, R.; Elioff, T.; Grunder, H.
1981-03-01
Pressure of approx. 10 -10 torr is needed in the Bevatron to accelerate partially-stripped very-heavy ions (e.g. U 69+ ) in the Bevatron without significant loss due to interactions with the residual gas. This ultra-high vacuum will be achieved by installing (summer and fall 1981) a cryogenic liner, mostly 12 0 K, surrounding the Bevatron circulating beam. The novel construction features are presented along with results from successful tests of prototype sections. This is believed to be the largest application of cryogenic pumping to particle accelerators yet undertaken
10 CFR 602.10 - Additional requirements.
2010-01-01
... Health and Human Services Publication No. [NIH] 86-23, “Guide for the Care and Use of Laboratory Animals...) A recipient performing research on warm-blooded animals shall comply with the Federal Laboratory... activities involving the use of human subjects must comply with DOE regulations in 10 CFR part 745...
Directory of Open Access Journals (Sweden)
SHEN Di
2014-12-01
Full Text Available Objective: To observe the influence of Compound Shougong Powder on JAK2-STAT3 signaling pathway in mice with Lewis lung cancer. Methods: Fifty C57BL/6J mice were inoculated with Lewis lung cancer cell line according to the conventional method, 40 mice bearing cancer successfully were selected 6 d later and randomly divided into 5groups, namely negative control group, cis-platinum group, high-dose Compound Shougong Powder group, middle-dose Compound Shougong Powder group and low-dose Compound Shougong Powder group, 8 mice in each group. Negative control group was drenched with normal saline (NS. Compound Shougong Powder groups were drenched with Compound Shougong Powder, 4 mg/kg for high-dose group, 2 mg/kg for middle-dose group, 1 mg/kg for low-dose group, once per day for 14 d; cis-platinum group was orally administrated 4 mg/kg/w, intraperitoneal injection of 0.1 mL for each, once per week for 2 weeks. Mice’s responses to the treatment, activity levels, mental states and so on during the treatment were observed, tumor inhibition rate was calculated, pathomorphological changes of tumor tissues were observed under light microscope after HE staining, and the expression levels of JAK2 and STAT3 proteins were detected by Western Blot. Results: After drug administration, smooth, glossy body hair and good spirit were observed in cisplatin group and high-dose Compound Shougong Powder group; glossier body hair and less activity level in middle- and low- dose Compound Shougong Powder group, and great toxic and side effects, reduced activity level and weary spirit in negative control group. The tumor inhibition rate of cisplatin group, high-, middle- and low-dose Compound Shougong Powder group and negative control group was 57.69%, 53.53%, 48.40%, 38.46% and 38.46%, respectively. The expression levels of JAK2 and STAT3 proteins in drug groups showed decreases to different degrees, and the decreases of JAK2 were more significant. Conclusion: Compound
Characterisation of 10 kV 10 A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Incau, Bogdan Ioan; Munk-Nielsen, Stig
2015-01-01
The objective of this paper is to characterize and evaluate the static and dynamic performances of 10 kV 10 A 4H-SIC MOSFETs at high temperatures. The results show good electrical performances of the SiC MOSFETs for high temperature operations. The double-pulse test results showed interesting...
Identification of Breast Cancer Using Integrated Information from MRI and Mammography.
Directory of Open Access Journals (Sweden)
Shih-Neng Yang
Full Text Available Integration of information from corresponding regions between the breast MRI and an X-ray mammogram could benefit the detection of breast cancer in clinical diagnosis. We aimed to provide a framework of registration from breast MRI to mammography and to evaluate the diagnosis using the combined information.43 patients with 46 lesions underwent both MRI and mammography scans, and the interval between the two examinations was around one month. The distribution of malignant to benign lesions was 31/46 based on histological results. Maximum intensity projection and thin-plate spline methods were applied for image registration for MRI to mammography. The diagnosis using integrated information was evaluated using results of histology as the reference. The assessment of annotations and statistical analysis were performed by the two radiologists.For the cranio-caudal view, the mean post-registration error between MRI and mammography was 2.2±1.9 mm. For the medio-lateral oblique view, the proposed approach performed even better with a mean error of 3.0±2.4 mm. In the diagnosis using MRI assessment with information of mammography, the sensitivity was 91.9±2.3% (29/31, 28/31, specificity 70.0±4.7% (11/15, 10/15, accuracy 84.8±3.1% (40/46, 38/46, positive predictive value 86.4±2.1% (29/33, 28/33 and negative predictive value 80.8±5.4% (11/13, 10/13.MRI with the aid of mammography shows potential improvements of sensitivity, specificity, accuracy, PPV and NPV in clinical breast cancer diagnosis compared to the use of MRI alone.
CXCL10/IP10 is a novel potential in vitro marker of TB infection
Directory of Open Access Journals (Sweden)
Ilaria Sauzullo
2009-06-01
Full Text Available Introduction IFN-γ is a pivotal cytokine in the immune response to Myc. tuberculosis, infact this is the key cytokine produced in response to antigens specific following tuberculosis exposure causing either active or latent tuberculosis (TB and this observation forms the basis of interferon gamma release assay (IGRA, but there are alternative or additional cytokines and chemokines that could be used to improve detection of Myc. tuberculosis infection.The aim of this study was to evaluate the diagnostic utility of chemokine CXCL10/IP-10 as biomarker of active TB and to compare the results with classical QuantiFERON-Gold assay . Methods CXCL10/IP-10 and IFN-γ responses to stimulation with ESAT-6 and CFP-10 were evaluated in 21 patients with active tuberculosis and in 6 healthy unexposed subjects with no history of TB or TB contact were used as controls healthy controls. QuantiFERON-TB Gold (QFT-G, Cellestis was used for the measurement of IFN-γ levels; CXCL10/IP-10 was detected by ELISA (R&D Systems . Results Of the 21 TB patients included, 11 had a QFT-G positive and 10 had negative QFT-G results.All QFT-G positive patients had increased levels of CXCL10/IP-10 (median, pg/ml in both ESAT-6 and CFP-10 stimulated samples patients compared to healthy controls (1807 and 1111 vs 251 and 188 of controls, respectively (p<0.001 for both. The patients with active TB and QFT-G negative exhibited higher concentrations of CXCL10/IP-10 following antigen stimulation (837 pg/ml for ESAT-6;1674 pg/ml for CFP-10 (p<0.001. Conclusion Our study showed that in all patients with active TB, the CXCL10/IP-10 is expressed in higher amounts than IFN-γ following Myc. tuberculosis antigen-specific stimulation, and CXCL10/IP-10 appeared to be even more sensitive than QuantiFERON TB-Gold in TB patients with negative IFN-γ response. The measurement of chemokine CXCL10/IP-10, although not specific for tuberculosis, may have potential as an alternative or additional marker
Effect of Aromatherapy Massage on Agitation and Depressive Mood in Individuals With Dementia.
Yang, Ya-Ping; Wang, Chi-Jane; Wang, Jing-Jy
2016-09-01
The current study examined the effects of aromatherapy massage on alleviating agitation and depressive mood in individuals with dementia. A randomized controlled trial and repeated measures design was conducted. A total of 59 participants were randomly assigned to intervention or control groups. The intervention group received aromatherapy massage once per week for 8 weeks. Results indicated no significant changes over time in overall agitation for either group, but agitation decreased from Week 1 to Week 5 for the intervention group. In addition, the overall depressive symptoms decreased significantly over time for the intervention group compared to the control group (p aromatherapy massage showed some significant changes in Weeks 5 and 9. Aromatherapy massage can be an effective and safe intervention to alleviate specific agitated behaviors and depressive mood in individuals with dementia. [Journal of Gerontological Nursing, 42(9), 38-46.]. Copyright 2016, SLACK Incorporated.
Directory of Open Access Journals (Sweden)
Smaranda Mâşu
2011-10-01
Full Text Available The study aims to monitor the capacity of certain organic fertilizers (volcanic tuff and municipal sludge, applied as such and mixed with volcanic rocks with a high content in clinoptilolite, to determine the covering with vegetation of fly ash deposits resulted from the combustion of lignite in thermal plants. Both biosolids (20 t/ha and volcanic rock with high clinoptilolite content (5 t/ha determined the installation of a vegetative layer and diminished the soil metal bioavailability to the Lolium prerenne plant biomass. When using the organic-zeolite mixture, a synergistic effect is recorded of the two components of the treatment agent and an increase of the biomass with 448%. Moreover, the resulted biomass shows the highest reductions of metal bioaccumulations, of 38-46% for Zn and Fe, of 62% for Cu and between 82-89% for Cr, Ni and Pb.
Effects of Colored Noise on Periodic Orbits in a One-Dimensional Map
Li, Feng-Guo; Ai, Bao-Quan
2011-06-01
Noise can induce inverse period-doubling transition and chaos. The effects of the colored noise on periodic orbits, of the different periodic sequences in the logistic map, are investigated. It is found that the dynamical behaviors of the orbits, induced by an exponentially correlated colored noise, are different in the mergence of transition, and the effects of the noise intensity on their dynamical behaviors are different from the effects of the correlation time of noise. Remarkably, the noise can induce new periodic orbits, namely, two new orbits emerge in the period-four sequence at the bifurcation parameter value μ = 3.5, four new orbits in the period-eight sequence at μ = 3.55, and three new orbits in the period-six sequence at μ = 3.846, respectively. Moreover, the dynamical behaviors of the new orbits clearly show the resonancelike response to the colored noise.
Effects of Colored Noise on Periodic Orbits in a One-Dimensional Map
International Nuclear Information System (INIS)
Li Fengguo; Ai Baoquan
2011-01-01
Noise can induce inverse period-doubling transition and chaos. The effects of the colored noise on periodic orbits, of the different periodic sequences in the logistic map, are investigated. It is found that the dynamical behaviors of the orbits, induced by an exponentially correlated colored noise, are different in the mergence of transition, and the effects of the noise intensity on their dynamical behaviors are different from the effects of the correlation time of noise. Remarkably, the noise can induce new periodic orbits, namely, two new orbits emerge in the period-four sequence at the bifurcation parameter value μ = 3.5, four new orbits in the period-eight sequence at μ = 3.55, and three new orbits in the period-six sequence at μ = 3.846, respectively. Moreover, the dynamical behaviors of the new orbits clearly show the resonancelike response to the colored noise. (general)
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Fees. 10.219 Section 10.219 Shipping COAST GUARD... Requirements for All Merchant Mariner Credentials § 10.219 Fees. (a) Use table 10.219(a) of this section to calculate the mandatory fees for MMCs and associated endorsements. Table 10.219(a) Fees If you apply for And...
Directory of Open Access Journals (Sweden)
Gilmour M Ian
2000-07-01
Full Text Available Abstract PM10 (the mass of particles present in the air having a 50% cutoff for particles with an aerodynamic diameter of 10 μm is the standard measure of particulate air pollution used worldwide. Epidemiological studies suggest that asthma symptoms can be worsened by increases in the levels of PM10. Epidemiological evidence at present indicates that PM10 increases do not raise the chances of initial sensitisation and induction of disease, although further research is warranted. PM10 is a complex mixture of particle types and has many components and there is no general agreement regarding which component(s could lead to exacerbations of asthma. However pro-inflammatory effects of transition metals, hydrocarbons, ultrafine particles and endotoxin, all present to varying degrees in PM10, could be important. An understanding of the role of the different components of PM10 in exacerbating asthma is essential before proper risk assessment can be undertaken leading to advice on risk management for the many asthmatics who are exposed to air pollution particles.
Electromagnetic physical modeling. 10; Denji yudoho no model jikken. 10
Energy Technology Data Exchange (ETDEWEB)
Noguchi, K; Endo, M; Yoshimori, M [Waseda University, Tokyo (Japan). School of Science and Engineering; Saito, A [Mitsui Mineral Development Engineering Co. Ltd., Tokyo (Japan)
1996-10-01
The model experiment of a borehole electromagnetic (EM) method was carried out using the prepared waterproof sensor and materials with conductivity of 10{sup 0}-10{sup 2}S/m as medium. The 2-layered structure ground model was prepared by filling a water tank with saturated brine of nearly 20S/m up to 30cm. Square wave current was sent from an amplifier to a transmitter coil, and electro motive force induced in a receiver coil was measured. Although numerical simulation is widely used for EM method, analog model experiment is also effective. For the receiver coil installed in brine, preventive measures from short-circuit and water were prepared. Electro motive force was measured at receiver intervals of 1cm and at 0-10cm in depth using a bar carbon model immersed in brine by 5cm in depth under resistivity contrast of 1000 times. In addition, to reduce the resistivity contrast between brine and body, the model experiment was carried out using immersed thin metallic sheet structure with conductivity similar to that of ore under resistivity contrast of 250 times. The effect of medium on both models was thus clarified. 4 refs., 10 figs.
10 CFR 10.28 - Conduct of hearing.
2010-01-01
... regular or routine procedure by the business or agency from which obtained, or other physical evidence... of business, or other physical evidence other than investigative reports, relating to a controverted... NATIONAL SECURITY INFORMATION OR AN EMPLOYMENT CLEARANCE Procedures § 10.28 Conduct of hearing. (a) The...
49 CFR 1103.10 - Introduction.
2010-10-01
... 49 Transportation 8 2010-10-01 2010-10-01 false Introduction. 1103.10 Section 1103.10 Transportation Other Regulations Relating to Transportation (Continued) SURFACE TRANSPORTATION BOARD, DEPARTMENT OF TRANSPORTATION RULES OF PRACTICE PRACTITIONERS Canons of Ethics § 1103.10 Introduction. The...
Various endocrine disorders in children with t(13;14(q10;q10 Robertsonian translocation
Directory of Open Access Journals (Sweden)
Byung Ho Choi
2013-09-01
Full Text Available Purpose45,XY,t(13;14(q10;q10 karyotype can suggest infertility associated with more or less severe oligospermia in male adults. In addition, 45,XX,t(13;14(q10;q10 karyotype carries reproductive risks such as miscarriage or infertility in female adults. However, reports on the phenotype of this karyotype in children are very rare. This study was done to observe various phenotypes of this karyotype in children.MethodsBetween January 2007 and December 2012, children diagnosed with 45,XY,t(13;14(q10;q10 or 45,XX,t(13;14(q10;q10 karyotype by chromosome analysis were analyzed retrospectively.ResultsEight children (5 boys and 3 girls were diagnosed with 45,XY,t(13;14(q10;q10 or 45,XX,t(13;14(q10;q10 karyotype. They ranged in age from 5 years and 6 months to 12 years and 4 months. The phenotypes of the study patients consisted of 1 hypogonadotrophic hypogonadism, 1 precocious puberty, 3 early puberty, 2 growth hormone deficiency (GHD (partial and 1 idiopathic short stature. As shown here t(13;14(q10;q10 Robertsonian translocation shows a wide range of phenotypes.ConclusionIt can be said that t(13;14(q10;q10 Robertsonian translocation shows various phenotypes from GHD to precocious puberty in children. Further large-scale studies are necessary.
Radiolabeled 9- or 10-monoiodostearic acid and 9- or 10-monoiodostearyl carnitine: Pt. 1
International Nuclear Information System (INIS)
Reed, K.W.; Ueda, C.T.; Murray, W.J.; Augustine, S.C.
1989-01-01
The purpose of this investigation was to synthesize and purify radiolabeled 9- or 10-monoiodostearyl carnitine for potential use as a perfusion and metabolic imaging agent for the heart. Oleic acid was iodinated via a free radical addition reaction of Hl across the double bond to give 9- or 10-monoiodostearic acid which in turn was esterified with carnitine. The identity of 9- or 10-monoiodostearic acid and 9-or 10-monoiodostearyl carnitine was determined using nuclear magnetic resonance (NMR), infrared (i.r.), ultraviolet (u.v.), and mass spectroscopy. The purity of the fatty acid and carnitine ester was established by thin layer chromatography. 9- or 10-Monoiodo[ 125 I]stearic acid and 9- or 10-monoiodo[ 125 I]stearyl carnitine were synthesized via the isotopic exchange of 125 I for cold iodine bonded to 9- or 10-monoiodostearic acid and 9- or 10-monoiodostearyl carnitine. (author)
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Closeout. 400.10 Section 400.10 Telecommunication NATIONAL TELECOMMUNICATIONS AND INFORMATION ADMINISTRATION, DEPARTMENT OF COMMERCE, AND NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION E-911 GRANT PROGRAM § 400.10 Closeout...
47 CFR 10.400 - Classification.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Classification. 10.400 Section 10.400 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL MOBILE ALERT SYSTEM Alert Message Requirements § 10.400 Classification. A Participating CMS Provider is required to receive and transmit three...
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2400.10 Section 2400.10 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION FELLOWSHIP PROGRAM REQUIREMENTS Application § 2400.10 Application. Eligible applicants for fellowships must...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Planning. 10.7 Section 10.7... GENERAL ENVIRONMENTAL CONSIDERATIONS Agency Implementing Procedures § 10.7 Planning. (a) Early planning. The Regional Administrator shall integrate the NEPA process with other planning at the earliest...
Cognitive Status Correlates with CXCL10/IP-10 Levels in Parkinson’s Disease
Directory of Open Access Journals (Sweden)
Natália Pessoa Rocha
2014-01-01
Full Text Available Cognitive impairment and depressive symptoms are of great interest in Parkinson’s disease (PD, since they are very common and lead to increased disability with poor quality of life. Inflammatory mechanisms have been implicated in PD and its nonmotor symptoms. In the current pilot study, we aimed to evaluate plasma levels of chemokines in PD patients and to analyze the putative association of chemokines with depressive symptoms and cognitive performance. We hypothesized that higher chemokines levels are associated with worse cognitive performance and increased depressive symptoms in PD. For this purpose, 40 PD patients and 25 age- and gender-matched controls were subjected to a clinical evaluation including cognitive and mood tests. Peripheral blood was drawn and plasma levels of CCL2/MCP-1, CCL11/eotaxin, CCL24/eotaxin-2, and CXCL10/IP-10 were measured by enzyme-linked immunosorbent assay. PD patients and control individuals presented comparable plasma concentrations of all the evaluated chemokines. In PD patients, CXCL10/IP-10 plasma levels correlated positively with Hoehn and Yahr staging scale. In addition, the higher CXCL10/IP-10 levels, the worse performance on cognitive tests. Although there was no significant difference between PD patients and control individuals regarding chemokines levels, our preliminary results showed that CXCL10/IP-10 may be associated with cognitive status in PD.
Analysis of the Numerical Modelling of Turbulence in the Conical Reverse-Flow Cyclone
Directory of Open Access Journals (Sweden)
Inga Jakštonienė
2011-02-01
Full Text Available The paper describes the numerical modelling of the swirling fluid flow in the Stairmand cyclone (conical reverse-flow – CRF with tangential inlet (equipment for separating solid particles from the gaseous fluid flow. A review of experimental and theoretical papers is conducted introducing three-dimensional differential equations for transfer processes. The numerical modelling of the Stairmand cyclone the height of which is 0.75 m, diameter – 0.17 m, the height of a cylindrical part – 0.290 m, a conical part – 0,39 m and an inlet area is 0,085×0,032 m is presented. When governing three-dimensional fluid flow, transfer equations Navje-Stokes and Reynolds are solved using the finite volume method in a body-fitted co-ordinate system using standard k– e and RNG k– e model of turbulence. Modelling is realised for inlet velocity 4.64, 9.0 and 14.8 m/s (flow rate was 0.0112, 0.0245 and 0.0388 m3/s. The results obtained from the numerical tests have demonstrated that the RNG k– e model of turbulence yields a reasonably good prediction for highly swirling flows in cyclones: the presented numerical results (tangential and radial velocity profiles are compared with numerical and experimental data obtained by other authors. The mean relative error of ± 7,5% is found. Keywords: cyclone, solid particles, numerical modelling, turbulence, one-phase flow.DOI: 10.3846/mla.2010.085
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Mediation. 617.10 Section 617.10 Public Welfare... OF AGE IN PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE FROM NSF § 617.10 Mediation. (a) NSF will refer to the Federal Mediation and Conciliation Service all complaints that fall within...
International Nuclear Information System (INIS)
Yoganathan, M.; Suttrop, W.; Devaty, R.P.; Choyke, W.J.
1994-01-01
The development of epitaxic and bulk-grown semiconductor SiC exhibiting uniform polytype phase homogeneity is critically dependent upon the accurate identification of crystallographic orientations corresponding to the desired polytype. In this paper, experimental transmission Laue photographs as well as computer-generated transmission Laue patterns are presented for {2 anti 1 anti 10} and {10 anti 10} faces of the 4H, 6H and 15R polytypes of silicon carbide. The transmission patterns permit easy recognition of polytypes and crystal orientations. (orig.)
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Review. 76.10 Section 76.10 Telecommunication... TELEVISION SERVICE General § 76.10 Review. (a) Interlocutory review. (1) Except as provided below, no party may seek review of interlocutory rulings until a decision on the merits has been issued by the staff...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Reports. 3.10 Section 3.10 Public Lands: Interior Office of the Secretary of the Interior PRESERVATION OF AMERICAN ANTIQUITIES § 3.10 Reports. At the close of each season's field work the permitee shall report in duplicate to the Smithsonian...
10 CFR 719.10 - What information must be included in the legal management plan?
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false What information must be included in the legal management plan? 719.10 Section 719.10 Energy DEPARTMENT OF ENERGY CONTRACTOR LEGAL MANAGEMENT REQUIREMENTS Legal Management Plan § 719.10 What information must be included in the legal management plan? The legal management...
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Fees. 1705.10 Section 1705.10 Public Welfare... PRIVACY REGULATIONS § 1705.10 Fees. (a) The Commission will not charge an individual for the costs of... necessary part of the process of disclosing the record to the individual) the Commission will charge a fee...
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Fees. 1800.10 Section 1800.10 Public Welfare Regulations Relating to Public Welfare (Continued) HARRY S. TRUMAN SCHOLARSHIP FOUNDATION PRIVACY ACT OF 1974 § 1800.10 Fees. If an individual requests copies of his or her record, he or she shall be charged ten...
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Autopsies. 831.10 Section 831.10 Transportation.../INCIDENT INVESTIGATION PROCEDURES § 831.10 Autopsies. The Board is authorized to obtain, with or without reimbursement, a copy of the report of autopsy performed by State or local officials on any person who dies as a...
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Authority. 28.10 Section 28.10 Shipping COAST GUARD... General Provisions § 28.10 Authority. The regulations in this part are prescribed by the Commandant of the Coast Guard, pursuant to a delegation of authority by the Secretary of Homeland Security set forth in...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Patent. 402.10 Section 402.10 Public Lands... LANDS IN FEDERAL RECLAMATION PROJECTS Public Lands § 402.10 Patent. When a purchaser has complied fully... and patent and shall state the statutory authority for such liens. The receipt shall be submitted to...
DEFF Research Database (Denmark)
Reynolds, J V; Preston, S R; O'Neill, B
2017-01-01
comprehensive modern staging, compares both these regimens. METHODS: This open label, multicentre, phase III RCT randomises patients (cT2-3, N0-3, M0) in a 1:1 fashion to receive CROSS protocol (Carboplatin and Paclitaxel with concurrent radiotherapy, 41.4Gy/23Fr, over 5 weeks). The power calculation is a 10......% difference in favour of CROSS, powered at 80%, two-sided alpha level of 0.05, requiring 540 patients to be evaluable, 594 to be recruited if a 10% dropout is included (297 in each group). The primary endpoint is overall survival, with a minimum 3-year follow up. Secondary endpoints include: disease free......). TRIAL REGISTRATION: NCT01726452 . Protocol 10-14. Date of registration 06/11/2012....
Rathbone, Andy
2015-01-01
The fast and easy way to get up and running with Windows 10 Windows 10 For Dummies covers the latest version of Windows and gets you up and running with the changes and new features you'll find in this updated operating system. Packed with time-saving tips to help you get the most out of the software, this helpful Windows 10 guide shows you how to manage Windows tasks like navigating the interface with a mouse or touchscreen, connecting to the web, and troubleshooting problems and making quick fixes. Assuming no prior knowledge of the software, Windows 10 For Dummies addresses the updates to
Radiobiology of BNCT mediated by GB-10 and GB-10+BPA in experimental oral cancer
Energy Technology Data Exchange (ETDEWEB)
Trivillin, Veronica A.; Heber, Elisa M.; Itoiz, Maria E.; Nigg, David; Calzetta, Osvaldo; Blaumann, Herman; Longhino, Juan; Schwint, Amanda E. E-mail: schwint@cnea.gov.ar
2004-11-01
We previously reported biodistribution and pharmacokinetic data for GB-10 (Na{sub 2}{sup 10}B{sub 10}H{sub 10}) and the combined administration of GB-10 and boronophenylalanine (BPA) as boron delivery agents for boron neutron capture therapy (BNCT) in the hamster cheek pouch oral cancer model. The aim of the present study was to assess, for the first time, the response of hamster cheek pouch tumors, precancerous tissue and normal tissue to BNCT mediated by GB-10 and BNCT mediated by GB-10 and BPA administered jointly using the thermalized epithermal beam of the RA-6 Reactor at the Bariloche Atomic Center. GB-10 exerted 75.5% tumor control (partial+complete remission) with no damage to precancerous tissue around tumor or to normal tissue. Thus, GB-10 proved to be a therapeutically efficient boron agent in this model despite the fact that it is not taken up selectively by oral tumor tissue. GB-10 exerted a selective effect on tumor blood vessels leading to significant tumor control with a sparing effect on normal tissue. BNCT mediated by the combined administration of GB-10 and BPA resulted in a reduction in the dose to normal tissue and would thus allow for significant escalation of dose to tumor without exceeding normal tissue tolerance.
Radiobiology of BNCT mediated by GB-10 and GB-10+BPA in experimental oral cancer
International Nuclear Information System (INIS)
Trivillin, Veronica A.; Heber, Elisa M.; Itoiz, Maria E.; Nigg, David; Calzetta, Osvaldo; Blaumann, Herman; Longhino, Juan; Schwint, Amanda E.
2004-01-01
We previously reported biodistribution and pharmacokinetic data for GB-10 (Na 2 10 B 10 H 10 ) and the combined administration of GB-10 and boronophenylalanine (BPA) as boron delivery agents for boron neutron capture therapy (BNCT) in the hamster cheek pouch oral cancer model. The aim of the present study was to assess, for the first time, the response of hamster cheek pouch tumors, precancerous tissue and normal tissue to BNCT mediated by GB-10 and BNCT mediated by GB-10 and BPA administered jointly using the thermalized epithermal beam of the RA-6 Reactor at the Bariloche Atomic Center. GB-10 exerted 75.5% tumor control (partial+complete remission) with no damage to precancerous tissue around tumor or to normal tissue. Thus, GB-10 proved to be a therapeutically efficient boron agent in this model despite the fact that it is not taken up selectively by oral tumor tissue. GB-10 exerted a selective effect on tumor blood vessels leading to significant tumor control with a sparing effect on normal tissue. BNCT mediated by the combined administration of GB-10 and BPA resulted in a reduction in the dose to normal tissue and would thus allow for significant escalation of dose to tumor without exceeding normal tissue tolerance
8x8 and 10x10 Hyperspace Representations of SU(3) and 10-fold Point-Symmetry Group of Quasicrystals
Animalu, Alexander
2012-02-01
In order to further elucidate the unexpected 10-fold point-symmetry group structure of quasi-crystals for which the 2011 Nobel Prize in chemistry was awarded to Daniel Shechtman, we explore a correspondence principle between the number of (projective) geometric elements (points[vertices] + lines[edges] + planes[faces]) of primitive cells of periodic or quasi-periodic arrangement of hard or deformable spheres in 3-dimensional space of crystallography and elements of quantum field theory of particle physics [points ( particles, lines ( particles, planes ( currents] and hence construct 8x8 =64 = 28+36 = 26 + 38, and 10x10 =100= 64 + 36 = 74 + 26 hyperspace representations of the SU(3) symmetry of elementary particle physics and quasicrystals of condensed matter (solid state) physics respectively, As a result, we predict the Cabibbo-like angles in leptonic decay of hadrons in elementary-particle physics and the observed 10-fold symmetric diffraction pattern of quasi-crystals.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1209.10 Section 1209.10 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS....10 Marketing. (a) Marketing means the sale or other disposition of mushrooms in any channel of...
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Advertising. 10.32 Section 10... of Professional Responsibility § 10.32 Advertising. (a) Subject to § 10.31, a practitioner may advertise services through public media, including a telephone directory, legal directory, newspaper, or...
20 Questions of Gamblers Anonymous: A Psychometric Study with Population of Spain.
Ursua, María Prieto; Uribelarrea, Luis Llavona
1998-01-01
The authors present a psychometric study of the questionnaire proposed by the Gamblers Anonymous organization for the self-assessment of problem gambling. The study was carried out in Spain with two samples: one of 127 problem gamblers (mean age: 41.67; sex: 78.7% men; mean duration of the problem: 5 years) and the other of 142 social gamblers (mean age: 38.46; sex: 60% men). The questionnaire was self-applied, in the presence of one of the investigators in case any doubts arose. The results indicate that it is a good screening instrument, with high reliability (Cronbach's alpha = 0.94), good covergent validity (the correlation with the SOGS questionnaire is high (r = 0.94; p < 0.001)), good factorial validity (the questionnaire's structure is unidimensional and coherent (just one factor explains more than 50% of the variance)), and its discriminative power is high (diagnostic efficacy = 98.88%). The study offers a comparative analysis of this instrument with other measures of problem gambling, emphasizing its extraordinary performance.
International Nuclear Information System (INIS)
Gonzalez Vasquez, Carlos Mario; Pulgarin, Ricardo Luis German; Melo Arango, Catalina; Delgado de Bedout, Jorge Andres; Llano Serna, Juan Fernando; Restrepo Restrepo, Jose Ignacio
2007-01-01
Purpose: to compare the concordance between defecography and magnetic resonance in patients with constipation. Materials and methods: we did a prospective and descriptive assay to determine the concordance of a diagnostic test with 17 patients. The evaluation of the studies was double blind. Results: the 17 patients were females, age range 31 - 77 year the symptoms were present between 3 to 120 months. Anterior rectocele was the most common diagnosis (11 patients) and magnetic resonance had sensibility 100%, specificity 50%, positive predictive value 78, 57% and negative predictive value 100%. 7 patients had pelvic floor descent and magnetic resonance had sensibility 71.4%, specificity 20% positive predictive value 38.46% and negative predictive value 50%. Defecography found patients with enterocele and magnetic resonance had sensibility 0% and specificity 100 anismus was present in 2 patients and magnetic resonance didn't find them. Conclusion defecography is still the gold standard for patients with eonstipation. Magnetic resonance are a promise for those patients but has to improve
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Discovery. 10.71 Section 10.71 Money... SERVICE Rules Applicable to Disciplinary Proceedings § 10.71 Discovery. (a) In general. Discovery may be... relevance, materiality and reasonableness of the requested discovery and subject to the requirements of § 10...
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Act. 1205.10 Section 1205.10 Agriculture Regulations... for Conduct of Sign-up Period Definitions § 1205.10 Act. The term Act means the Cotton Research and Promotion Act, as amended [7 U.S.C 2101-2118; Public Law 89-502, 80 Stat 279, as amended]. ...
Heat shock protein 10 (Hsp10) in immune-related diseases: one coin, two sides
Jia, Haibo; Halilou, Amadou I.; Hu, Liang; Cai, Wenqian; Liu, Jing; Huang, Bo
2011-01-01
Heat shock protein 10 (Hsp10) in eukaryotes, originally identified as a mitochondrial chaperone, now is also known to be present in cytosol, cell surface, extracellular space and peripheral blood. Functionally besides participating in mitochondrial protein folding in association with Hsp60, Hsp10 appears to be related to pregnancy, cancer and autoimmune inhibition. Hsp10 can be released to peripheral blood at very early time point of pregnancy and given another name called early pregnancy factor (EPF), which seems to play a critical role in developing a pregnant niche. In malignant disorders, Hsp10 is usually abnormally expressed in the cytosol of malignant cells and further released to extracellular space, resulting in tumor-promoting effect from various aspects. Furthermore, distinct from other heat shock protein members, whose soluble form is recognized as danger signal by immune cells and triggers immune responses, Hsp10 after release, however, is designed to be an inhibitory signal by limiting immune response. This review discusses how Hsp10 participates in various physiological and pathological processes from basic protein molecule folding to pregnancy, cancer and autoimmune diseases, and emphasizes how important the location is for the function exertion of a molecule. PMID:21969171
http://dx.doi.org/10.4314/ajtcam.v10i4.8
African Journals Online (AJOL)
AJTCAM
http://dx.doi.org/10.4314/ajtcam.v10i4.8. 47. DIMETHOXYFLAVONE ISOLATED FROM THE STEM BARK OF STEREOSPERMUM KUNTHIANUM POSSESSES. ANTIDIARRHOEAL ACTIVITY IN RODENTS. Ching, F. P.1*, Otokiti, I. O.2 and Egert-omoneukanrin, B.2. 1*Department of Pharmacology, Faculty of Basic Medical ...
http://dx.doi.org/10.4314/ajtcam.v10i4.6
African Journals Online (AJOL)
AJTCAM
http://dx.doi.org/10.4314/ajtcam.v10i4.6. 36. CHEMOTHERAPEUTIC ACTIVITIES OF CARTHAMI FLOS AND ITS REVERSAL EFFECT ON. MULTIDRUG RESISTANCE IN CANCER CELLS. Jimmy Yiu-Cheong Wu*a, Zhi-Ling Yub, Wang-Fun Fongb, Yi-Qian Shia. aZhejiang Chinese Medical University, Hangzhou 310053, ...
Creep strength of 10 CrMo 9 10 welding material
International Nuclear Information System (INIS)
Maile, K.; Theofel, H.
1993-01-01
Samples from different welding materials of the heat-resistant steel 10 Cr Mo 10 were subjected to creep tests. The maximum duration of stressing was 36,000 hours. At a text temperature of 450 C, the creep behaviour is considerably affected by different initial strengths. At 500 and 550 C, the creep fracture points for most of the welding materials in the long term range lie scattered in a relatively narrow band. This range is at or just below the lower scatteer band limit of the basic material (corresponding to DIN 17175, mean value ± 20%. (orig.) [de
Representation of the properties 10 CrMoNiNb 9 10
International Nuclear Information System (INIS)
Dette, M.; Hahn, H.; Nieuwland, H.C.D.; Tichler, J.W.
The high-temperature ferritic steal 10 CrMoNiNb 9 10 is used as structural material in nuclear steam generators. It is exposed to loads within the creep range. In order to resist safety also loads caused by incidents after long temperature stress, the time-independent stability parameters must not fall below specified minimum values. The material is characterised by the stability degree Nb/C+N and the niobium excess δ Nb. (orig.) [de
A polymorphism in miR-1262 regulatory region confers the risk of lung cancer in Chinese population.
Xie, Kaipeng; Chen, Mengxi; Zhu, Meng; Wang, Cheng; Qin, Na; Liang, Cheng; Song, Ci; Dai, Juncheng; Jin, Guangfu; Shen, Hongbing; Lin, Dongxin; Ma, Hongxia; Hu, Zhibin
2017-09-01
It has been proposed that the majority of disease-associated loci identified by genome-wide association studies (GWAS) are enriched in non-coding regions, such as the promoter, enhancer or non-coding RNA genes. Thus, we performed a two-stage case-control study to systematically evaluate the association of genetic variants in miRNA regulatory regions (promoter and enhancer) with lung cancer risk in 7,763 subjects (discovery stage: 2,331 cases and 3,077 controls; validation stage: 1,065 cases and 1,290 controls). As a result, we identified that rs12740674 (C > T) in miR-1262 enhancer was significantly associated with the increased risk of lung cancer (additive model in discovery stage: adjusted OR = 1.31, 95%CI = 1.13-1.53, p = 3.846 × 10 -4 in Nanjing GWAS; adjusted OR = 1.20, 95%CI = 1.00-1.44, p = 0.041 in Beijing GWAS; validation stage: adjusted OR = 1.20, 95%CI = 1.03-1.41, p = 0.024). In meta-analysis, the p value for the association between rs12740674 and lung cancer risk reached 6.204 × 10 -6 (adjusted OR = 1.24, 95%CI = 1.13-1.36). Using 3DSNP database, The Cancer Genome Atlas (TCGA) data and functional assays, we observed that the risk T allele of rs12740674 reduced the expression level of miR-1262 in lung tissue through chromosomal looping, and overexpression of miR-1262 inhibited lung cancer cell proliferation probably through targeting the expression levels of ULK1 and RAB3D. Our findings confirmed the important role that genetic variants of noncoding sequence play in lung cancer susceptibility and indicated that rs12740674 in miR-1262 may be biologically relevant to lung carcinogenesis. © 2017 UICC.
African Journals Online (AJOL)
Should LSP Dictionaries also Include Professional Jargon and Slang?* EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. R Gläser. http://dx.doi.org/10.5788/10-0-888 ...
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false [Reserved] 801.10 Section 801.10 Agriculture Regulations of the Department of Agriculture (Continued) GRAIN INSPECTION, PACKERS AND STOCKYARD... FOR GRAIN INSPECTION EQUIPMENT § 801.10 [Reserved] ...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Location. 193.50-10 Section 193.50-10 Shipping COAST... Details § 193.50-10 Location. (a) Approved hand portable fire extinguishers and semiportable fire extinguishing systems shall be installed in accordance with Table 193.50-10(a). The location of the equipment...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Location. 95.50-10 Section 95.50-10 Shipping COAST GUARD...-10 Location. (a) Approved hand portable fire extinguishers and semiportable fire extinguishing systems shall be installed in accordance with Table 95.50-10(a). The location of the equipment shall be to...
New Model Exhaust System Supports Testing in NASA Lewis' 10- by 10-Foot Supersonic Wind Tunnel
Roeder, James W., Jr.
1998-01-01
In early 1996, the ability to run NASA Lewis Research Center's Abe Silverstein 10- by 10- Foot Supersonic Wind Tunnel (10x10) at subsonic test section speeds was reestablished. Taking advantage of this new speed range, a subsonic research test program was scheduled for the 10x10 in the fall of 1996. However, many subsonic aircraft test models require an exhaust source to simulate main engine flow, engine bleed flows, and other phenomena. This was also true of the proposed test model, but at the time the 10x10 did not have a model exhaust capability. So, through an in-house effort over a period of only 5 months, a new model exhaust system was designed, installed, checked out, and made ready in time to support the scheduled test program.
Lopez, J B Gonzalez; Baron, T; Ferreira, P; Kolobara, B; Pugh, M A; Resco, A; Trzaskoma, J P
2014-01-01
Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into 'version 1.0', recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop de...
Energy Technology Data Exchange (ETDEWEB)
Rosenthal, D.
2007-03-15
In this work, we studied the growth and structure of titanium dioxide films on two morphologically different transition metal surfaces, namely the trench-like rhenium(10-10) and the hexagonal ruthenium(0001). The following methods were used: X-ray photoelectron and Auger-electron spectroscopy (XPS and AES), low energy electron diffraction (LEED), low energy Helium-ion scattering (LEIS), scanning tunneling microscopy (STM) and X-ray diffraction (XRD). Titanium dioxide films on rhenium(10-10) were synthesized by co-adsorption of titanium vapor in an oxygen atmosphere up to a thickness of 500 Aa and investigated by means of LEED, LEIS, XPS and XRD. In order to calibrate the titanium flux, the growth mode of titanium on the Re(10-10) surface was determined by means of LEIS, XPS and LEED. The growth of titanium dioxide on the hexagonal ruthenium(0001) surface was investigated by means of STM, XPS and AES. Due to the alloying affinity of Ti and Ru, a titanium oxide film pre-grown at low temperature was finally/fully oxidized at elevated temperature and pressure. First experiments concerning the growth of gold on these titanium dioxide films are presented. One important result of the ongoing work is the imaging of gold clusters with 2-5 atoms in the troughs of rutile(110) beside the typically observed clusters with 3 nm diameter by STM. (orig.)
DEFF Research Database (Denmark)
Szklarczyk, Damian; Franceschini, Andrea; Wyder, Stefan
2015-01-01
, and the available data exhibit notable differences in terms of quality and completeness. The STRING database (http://string-db.org) aims to provide a critical assessment and integration of protein-protein interactions, including direct (physical) as well as indirect (functional) associations. The new version 10...... into families at various levels of phylogenetic resolution. Further improvements in version 10.0 include a completely redesigned prediction pipeline for inferring protein-protein associations from co-expression data, an API interface for the R computing environment and improved statistical analysis...
An Efficiency Comparison of MBA Programs: Top 10 versus Non-Top 10
Hsu, Maxwell K.; James, Marcia L.; Chao, Gary H.
2009-01-01
The authors compared the cohort group of the top-10 MBA programs in the United States with their lower-ranking counterparts on their value-added efficiency. The findings reveal that the top-10 MBA programs in the United States are associated with statistically higher average "technical and scale efficiency" and "scale efficiency", but not with a…
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Introduction. 1726.10 Section 1726.10 Agriculture... ELECTRIC SYSTEM CONSTRUCTION POLICIES AND PROCEDURES General § 1726.10 Introduction. The policies... specifications, duties and responsibilities of the engineer and architect, and engineering and architectural...
2010-01-01
... means information and programs that are designed to develop new markets, marketing strategies, increase... 7 Agriculture 10 2010-01-01 2010-01-01 false Information. 1206.10 Section 1206.10 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS...
RERTR-10 Irradiation Summary Report
Energy Technology Data Exchange (ETDEWEB)
D. M. Perez
2011-05-01
The Reduced Enrichment for Research and Test Reactor (RERTR) experiment RERTR-10 was designed to further test the effectiveness of modified fuel/clad interfaces in monolithic fuel plates. The experiment was conducted in two campaigns: RERTR-10A and RERTR-10B. The fuel plates tested in RERTR-10A were all fabricated by Hot Isostatic Pressing (HIP) and were designed to evaluate the effect of various Si levels in the interlayer and the thickness of the Zr interlayer (0.001”) using 0.010” and 0.020” nominal foil thicknesses. The fuel plates in RERTR-10B were fabricated by Friction Bonding (FB) with two different thickness Si layers and Nb and Zr diffusion barriers.1 The following report summarizes the life of the RERTR-10A/B experiment through end of irradiation, including as-run neutronic analysis results, thermal analysis results and hydraulic testing results.
RERTR-10 Irradiation Summary Report
International Nuclear Information System (INIS)
Perez, D.M.
2011-01-01
The Reduced Enrichment for Research and Test Reactor (RERTR) experiment RERTR-10 was designed to further test the effectiveness of modified fuel/clad interfaces in monolithic fuel plates. The experiment was conducted in two campaigns: RERTR-10A and RERTR-10B. The fuel plates tested in RERTR-10A were all fabricated by Hot Isostatic Pressing (HIP) and were designed to evaluate the effect of various Si levels in the interlayer and the thickness of the Zr interlayer (0.001-inch) using 0.010-inch and 0.020-inch nominal foil thicknesses. The fuel plates in RERTR-10B were fabricated by Friction Bonding (FB) with two different thickness Si layers and Nb and Zr diffusion barriers.1 The following report summarizes the life of the RERTR-10A/B experiment through end of irradiation, including as-run neutronic analysis results, thermal analysis results and hydraulic testing results.
46 CFR 111.20-10 - Autotransformers.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Autotransformers. 111.20-10 Section 111.20-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING ELECTRIC SYSTEMS-GENERAL REQUIREMENTS Transformer Construction, Installation, and Protection § 111.20-10 Autotransformers. An...
46 CFR 190.07-10 - Construction.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Construction. 190.07-10 Section 190.07-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT Structural Fire Protection § 190.07-10 Construction. (a) The hull, superstructure, structural...
49 CFR 179.10 - Tank mounting.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Tank mounting. 179.10 Section 179.10 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS SAFETY... Design Requirements § 179.10 Tank mounting. (a) The manner in which tanks are attached to the car...
42 CFR 1000.10 - General definitions.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false General definitions. 1000.10 Section 1000.10 Public Health OFFICE OF INSPECTOR GENERAL-HEALTH CARE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL PROVISIONS INTRODUCTION; GENERAL DEFINITIONS Definitions § 1000.10 General definitions. In this chapter...
42 CFR 54.10 - Fiscal accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Fiscal accountability. 54.10 Section 54.10 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS CHARITABLE CHOICE... PROJECTS FOR ASSISTANCE IN TRANSITION FROM HOMELESSNESS GRANTS § 54.10 Fiscal accountability. (a) Religious...
49 CFR 10.13 - Privacy Officer.
2010-10-01
... INDIVIDUALS General § 10.13 Privacy Officer. (a) To assist with implementation, evaluation, and administration issues, the Chief Information Officer appoints a principal coordinating official with the title Privacy... 49 Transportation 1 2010-10-01 2010-10-01 false Privacy Officer. 10.13 Section 10.13...
46 CFR 168.15-10 - Construction.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Construction. 168.15-10 Section 168.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Accommodations § 168.15-10 Construction. (a) The accommodations provided must be securely constructed, properly...
46 CFR 92.07-10 - Construction.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Construction. 92.07-10 Section 92.07-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS CONSTRUCTION AND ARRANGEMENT Structural Fire Protection § 92.07-10 Construction. (a) The hull, superstructure, structural...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Discovery. 354.10 Section 354.10 Customs Duties... ANTIDUMPING OR COUNTERVAILING DUTY ADMINISTRATIVE PROTECTIVE ORDER § 354.10 Discovery. (a) Voluntary discovery. All parties are encouraged to engage in voluntary discovery procedures regarding any matter, not...
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 592.10 Section 592.10 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EGG PRODUCTS INSPECTION VOLUNTARY INSPECTION OF EGG PRODUCTS Administration § 592.10 Authority. The Administrator shall...
32 CFR 631.10 - Administration.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Administration. 631.10 Section 631.10 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL... Disciplinary Control Boards § 631.10 Administration. (a) Commanders are authorized to acquire, report, process...
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false Construction. 10.5 Section 10.5 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE MILITARY COMMISSIONS MILITARY COMMISSION INSTRUCTIONS § 10.5 Construction. Military Commission Instructions shall be construed in a manner consistent...
45 CFR 707.10 - Auxiliary aids.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Auxiliary aids. 707.10 Section 707.10 Public Welfare Regulations Relating to Public Welfare (Continued) COMMISSION ON CIVIL RIGHTS ENFORCEMENT OF... § 707.10 Auxiliary aids. (a) The Agency shall furnish appropriate auxiliary aids where necessary to...
46 CFR 10.214 - Security Check.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Security Check. 10.214 Section 10.214 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner Credentials § 10.214 Security Check. Until April 15, 2009...
46 CFR 194.10-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 194.10-1 Section 194.10-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS HANDLING, USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-1 Application. (a) The provisions...
46 CFR 193.10-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 193.10-1 Section 193.10-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Main System, Details § 193.10-1 Application. (a) The provisions of this subpart, with the...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Location. 193.60-10 Section 193.60-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS FIRE PROTECTION EQUIPMENT Fire Axes § 193.60-10 Location. (a) Fire axes shall be distributed throughout the spaces available...
46 CFR 46.10-65 - Construction.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Construction. 46.10-65 Section 46.10-65 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES SUBDIVISION LOAD LINES FOR PASSENGER VESSELS Administration § 46.10-65 Construction. (a) The watertight subdivision of every passenger vessel...
10. ročník „Berlin 10“ konference v Jihoafrické republice
Czech Academy of Sciences Publication Activity Database
Burešová, Iva
-, č. 4 (2012) E-ISSN 1805-2800. [Berlin10. Stellenbosch, 06.11.2012-08.11.2012] Keywords : conferences * Berlin Open Access Conference * open access http://www.lib.cas.cz/casopis-informace/10-rocnik-%E2%80%9Eberlin-10-konference-v-jihoafricke-republice/
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Facilities. 351.10 Section 351.10... CERTIFICATION CERTIFICATION OF TECHNICAL ANIMAL FATS FOR EXPORT Facilities and Operations § 351.10 Facilities. (a) Facilities for the preparation, identification, and storage of the technical animal fat to be...
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Purpose. 226.10 Section 226.10 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ADMINISTRATION OF ASSISTANCE AWARDS TO U.S. NON-GOVERNMENTAL ORGANIZATIONS Pre-award Requirements § 226.10 Purpose. Sections 226.11 through 226.17 prescribe forms and...
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Options. 6.10 Section 6.10 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS UNITED STATES GOVERNMENT LIFE INSURANCE Optional Settlement § 6.10 Options. Insurance will be payable in one sum only when...
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Application. 1200.10 Section 1200.10 Highways NATIONAL... PROCEDURES FOR STATE HIGHWAY SAFETY PROGRAMS UNIFORM PROCEDURES FOR STATE HIGHWAY SAFETY PROGRAMS Application, Approval, and Funding of the Highway Safety Program § 1200.10 Application. Each fiscal year, a State's...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Reports. 1003.10 Section 1003.10 Foreign Relations INTER-AMERICAN FOUNDATION RULES SAFEGUARDING PERSONAL INFORMATION IN IAF RECORDS § 1003.10 Reports... or systems will be separately listed and reported to the Office of Management and Budget in...
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Administration. 23.10 Section 23.10 Agriculture Office of the Secretary of Agriculture STATE AND REGIONAL ANNUAL PLANS OF WORK Regional Program § 23.10 Administration. (a) The Regional Programs will be administered through four Regional Rural Development Centers...
2010-01-01
... the General Accounting Office; and (b) 'Merit system principles' means the principles for Federal... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Definitions. 10.1 Section 10.1... AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.1 Definitions. For purposes of this rule— (a...
46 CFR 190.10-1 - Application.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 190.10-1 Section 190.10-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS CONSTRUCTION AND ARRANGEMENT Means of Escape § 190.10-1 Application. (a) The provisions of this subpart, with the exception of...
50 CFR 404.10 - Commercial fishing.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Commercial fishing. 404.10 Section 404.10... MARINE NATIONAL MONUMENT § 404.10 Commercial fishing. (a) Lobster fishing. Any commercial lobster fishing... species. (1) Notwithstanding the prohibitions in § 404.7(a) and (h), commercial fishing for bottomfish and...
46 CFR 196.15-10 - Sanitation.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Sanitation. 196.15-10 Section 196.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS OPERATIONS Test, Drills, and Inspections § 196.15-10 Sanitation. (a) It shall be the duty of the master and chief engineer...
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Waiting time. 9.10 Section 9.10 Shipping COAST GUARD... § 9.10 Waiting time. The same construction should be given the act when charging for waiting time as... for duty the waiting time amounts to at least one hour. ...
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Location. 76.50-10 Section 76.50-10 Shipping COAST GUARD... Extinguishers and Semiportable Fire Extinguishing Systems, Arrangements and Details § 76.50-10 Location. (a... fire extinguishing systems Classification (see § 76.50-5) Quantity and location Safety area 1...
FK506-binding protein 10 (FKBP10) regulates lung fibroblast migration via collagen VI synthesis.
Knüppel, Larissa; Heinzelmann, Katharina; Lindner, Michael; Hatz, Rudolf; Behr, Jürgen; Eickelberg, Oliver; Staab-Weijnitz, Claudia A
2018-04-19
In idiopathic pulmonary fibrosis (IPF), fibroblasts gain a more migratory phenotype and excessively secrete extracellular matrix (ECM), ultimately leading to alveolar scarring and progressive dyspnea. Here, we analyzed the effects of deficiency of FK506-binding protein 10 (FKBP10), a potential IPF drug target, on primary human lung fibroblast (phLF) adhesion and migration. Using siRNA, FKBP10 expression was inhibited in phLF in absence or presence of 2ng/ml transforming growth factor-β1 (TGF-β1) and 0.1mM 2-phosphoascorbate. Effects on cell adhesion and migration were monitored by an immunofluorescence (IF)-based attachment assay, a conventional scratch assay, and single cell tracking by time-lapse microscopy. Effects on expression of key players in adhesion dynamics and migration were analyzed by qPCR and Western Blot. Colocalization was evaluated by IF microscopy and by proximity ligation assays. FKBP10 knockdown significantly attenuated adhesion and migration of phLF. Expression of collagen VI was decreased, while expression of key components of the focal adhesion complex was mostly upregulated. The effects on migration were 2-phosphoascorbate-dependent, suggesting collagen synthesis as the underlying mechanism. FKBP10 colocalized with collagen VI and coating culture dishes with collagen VI, and to a lesser extent with collagen I, abolished the effect of FKBP10 deficiency on migration. These findings show, to our knowledge for the first time, that FKBP10 interacts with collagen VI and that deficiency of FKBP10 reduces phLF migration mainly by downregulation of collagen VI synthesis. The results strengthen FKBP10 as an important intracellular regulator of ECM remodeling and support the concept of FKBP10 as drug target in IPF.
Analysis list: fkh-10 [Chip-atlas[Archive
Lifescience Database Archive (English)
Full Text Available fkh-10 Embryo,Larvae + ce10 http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/...fkh-10.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/target/fkh-10.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/target/fkh-10.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/fkh-10.Embryo....tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/fkh-10.Larvae.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/ce10/colo/Embryo.gml,http://dbarchive.biosciencedbc.jp/kyushu-u/ce10/colo/Larvae.gml ...
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.220-10 Section 179.220-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.220-10 Welding. (a) All joints... of this subchapter). Welding procedures, welders, and fabricators shall be approved. (b) Radioscopy...
43 CFR 17.10 - Judicial review.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Judicial review. 17.10 Section 17.10... Origin § 17.10 Judicial review. Action taken pursuant to section 602 of the act is subject to judicial review as provided in section 603 of the act. [29 FR 16293, Dec. 4, 1964] ...
50 CFR 296.10 - Agency review.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Agency review. 296.10 Section 296.10..., DEPARTMENT OF COMMERCE CONTINENTAL SHELF FISHERMEN'S CONTINGENCY FUND § 296.10 Agency review. (a) Within 30..., NMFS, or his designee, for a review of the initial determination. (b) The petitioner may submit written...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Sanitation. 97.15-10 Section 97.15-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS OPERATIONS Tests, Drills, and Inspections § 97.15-10 Sanitation. (a) It shall be the duty of the master and chief engineer...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Location. 95.60-10 Section 95.60-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS FIRE PROTECTION EQUIPMENT Fire Axes § 95.60-10 Location. (a) Fire axes shall be distributed throughout the spaces available to persons...
45 CFR 606.10 - Self-evaluation.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Self-evaluation. 606.10 Section 606.10 Public... § 606.10 Self-evaluation. (a) The Foundation shall, within one year of the effective date of this part... with handicaps, to participate in the self-evaluation process by submitting comments (both oral and...
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Control. 46.10-60 Section 46.10-60 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) LOAD LINES SUBDIVISION LOAD LINES FOR PASSENGER VESSELS Administration § 46.10-60 Control. (a) The District Director of Customs or the Coast Guard District Commander may...
Fabrication and Characterization of novel W80Ni10Nb10 alloy produced by mechanical alloying
Saxena, R.; Patra, A.; Karak, S. K.; Pattanaik, A.; Mishra, S. C.
2016-02-01
Nanostructured tungsten (W) based alloy with nominal composition of W80Ni10Nb10 (in wt. %) was synthesized by mechanical alloying of elemental powders of tungsten (W), nickel (Ni), niobium (Nb) in a high energy planetary ball-mill for 20 h using chrome steel as grinding media and toluene as process control agent followed by compaction at 500 MPa pressure for 5 mins and sintering at 1500°C for 2 h in Ar atmosphere. The phase evolution and the microstructure of the milled powder and consolidated product were investigated by X-ray diffraction (XRD), Scanning electron microscopy (SEM) and Transmission electron microscopy (TEM). The crystallite size of W in W80Ni10Nb10 powder was reduced from 100 μm at 0 h to 45.6 nm at 10 h and 34.1 nm at 20 h of milling whereas lattice strain increases to 35% at 20 h of milling. The dislocation density shows sharp increase up to 5 h of milling and the rate of increase drops beyond 5 to 20 h of milling. The lattice parameter of tungsten in W80Ni10Nb10 expanded upto 0.04% at 10 h of milling and contracted upto 0.02% at 20 h of milling. The SEM micrograph revealed the presence of spherical and elongated particles in W80Ni10Nb10 powders at 20 h of milling. The particle size decreases from 100 μm to 2 μm with an increase in the milling time from 0 to 20 hours. The crystallite size of W in milled W80Ni10Nb10 alloy as evident from bright field TEM image was in well agreement with the measured crystallite size from XRD. Structure of W in 20 h milled W80Ni10Nb10 alloy was identified by indexing of selected area diffraction (SAD) pattern. Formation of NbNi intermetallic was evident from XRD pattern and SEM micrograph of sintered alloy. Maximum sinterability of 90.8% was achieved in 20 h milled sintered alloy. Hardness and wear study was also conducted to investigate the mechanical behaviour of the sintered product. Hardness of W80Ni10Nb10 alloy reduces with increasing load whereas wear rate increases with increasing load. The evaluated
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Costs. 60.10 Section 60.10 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) FISHER HOUSES AND OTHER TEMPORARY LODGING § 60.10 Costs. Costs for temporary lodging under this part shall be borne...
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Swimming. 331.10 Section 331.10 Parks, Forests, and Public Property CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY REGULATIONS..., KENTUCKY AND INDIANA § 331.10 Swimming. Swimming is prohibited unless authorized in writing by the District...
2010-01-01
... ORGANIZATIONS (OMB CIRCULAR A-110) Pre-Award Requirements § 215.10 Purpose. Sections 215.11 through 215.17... 2 Grants and Agreements 1 2010-01-01 2010-01-01 false Purpose. 215.10 Section 215.10 Grants and Agreements OFFICE OF MANAGEMENT AND BUDGET CIRCULARS AND GUIDANCE Reserved UNIFORM ADMINISTRATIVE...
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Reports. 2472.10 Section 2472.10 Administrative Personnel FEDERAL LABOR RELATIONS AUTHORITY, GENERAL COUNSEL OF THE FEDERAL LABOR RELATIONS... of the Panel § 2472.10 Reports. When a report is issued after a hearing conducted pursuant to § 2472...
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Sampling. 151.10 Section 151.10 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY (CONTINUED) EXAMINATION, SAMPLING, AND TESTING OF MERCHANDISE General § 151.10 Sampling. When necessary, the port director...
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Administration. 57.10 Section 57.10 Agriculture... PRODUCTS INSPECTION ACT) Regulations Governing the Inspection of Eggs General § 57.10 Administration. The... require in the enforcement or administration of the provisions of the act and the regulations in this part...
2010-01-01
... Provider is an entity that contracts with a Lender or CDC to perform management, marketing, legal or other... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Definitions. 120.10 Section 120.10 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Definitions § 120.10...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Evidence. 10.73 Section 10.73 Money and Finance: Treasury Office of the Secretary of the Treasury PRACTICE BEFORE THE INTERNAL REVENUE SERVICE Rules Applicable to Disciplinary Proceedings § 10.73 Evidence. (a) In general. The rules of...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Smoking. 105.45-10 Section 105.45-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CARGO AND MISCELLANEOUS VESSELS COMMERCIAL FISHING VESSELS DISPENSING PETROLEUM PRODUCTS Special Operating Requirements § 105.45-10 Smoking. (a) Smoking is prohibited during and in the vicinity of the...
49 CFR 570.10 - Wheel assemblies.
2010-10-01
... bead through one full wheel revolution and note runout in excess of one-eighth of an inch. (c) Mounting... 49 Transportation 6 2010-10-01 2010-10-01 false Wheel assemblies. 570.10 Section 570.10... Pounds or Less § 570.10 Wheel assemblies. (a) Wheel integrity. A tire rim, wheel disc, or spider shall...
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Location. 76.60-10 Section 76.60-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) PASSENGER VESSELS FIRE PROTECTION EQUIPMENT Fire Axes § 76.60-10 Location. (a) Fire axes shall be distributed throughout the spaces available to passengers and crew so as...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Pumps. 105.20-10 Section 105.20-10 Shipping COAST GUARD... DISPENSING PETROLEUM PRODUCTS Specific Requirements-Cargo Tanks § 105.20-10 Pumps. (a) Pumps for cargo... discharge side of pump if the pressure under shutoff conditions exceeds 60 pounds. When a relief valve is...
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Label. 188.10-37 Section 188.10-37 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS GENERAL PROVISIONS Definition of Terms Used in This Subchapter § 188.10-37 Label. This term means the label required by 49 CFR part 172...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Photographs. 91.10 Section 91.10 Money and Finance: Treasury Regulations Relating to Money and Finance REGULATIONS GOVERNING CONDUCT IN OR ON THE BUREAU OF THE MINT BUILDINGS AND GROUNDS § 91.10 Photographs. The taking of photographs on...
2010-04-01
... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Settlements. 10.108 Section 10... to the Commission; Settlements § 10.108 Settlements. (a) When offers may be made. Parties may at any time during the course of the proceeding propose offers of settlement. All offers of settlement shall...
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Settlement. 2430.10 Section 2430.10... FEDERAL LABOR RELATIONS AUTHORITY AWARDS OF ATTORNEY FEES AND OTHER EXPENSES § 2430.10 Settlement. The applicant and the General Counsel may agree on a proposed settlement of the award before final action on the...
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Reports. 34.10 Section 34.10 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION, DEPARTMENT OF... SECURITIES OR THE ASSUMPTION OF LIABILITIES § 34.10 Reports. The applicant must file reports under § 131.43...
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Reports. 273.10 Section 273.10 Postal Service... REMEDIES ACT § 273.10 Reports. (a) Not later than October 31 of each year, the Postmaster General shall prepare and transmit to the appropriate committees and subcommittees of the Congress an annual report...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false General. 10.1 Section 10.1... TREASURY LIQUORS COMMERCIAL BRIBERY Scope of Regulations § 10.1 General. The regulations in this part, issued pursuant to section 105 of the Federal Alcohol Administration Act (27 U.S.C. 205), specify...
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Losses. 21.10 Section 21.10... NATIONAL PARK; BATHHOUSE REGULATIONS § 21.10 Losses. A bathhouse receiving deposits of jewelry, money, or... on the premises. All losses must be reported promptly to the Superintendent by the bathhouse -manager. ...
Directory of Open Access Journals (Sweden)
Alessandra Scofield
2012-09-01
Full Text Available Severe infestation with lice was observed on crossbred cattle (Bos taurus indicus ×Bos taurus taurus in the municipality of São Domingos do Capim, state of Pará, Brazil. Sixty-five animals were inspected and the lice were manually collected, preserved in 70% alcohol and taken to the Animal Parasitology Laboratory, School of Veterinary Medicine, Federal University of Pará, Brazil, for identification. The adult lice were identified as Haematopinus quadripertusus, and all the cattle examined were infested by at least one development stage of this ectoparasite. The specimens collected were located only on the tail in 80% (52/65 of the cattle, while they were around the eyes as well as on the ears and tail in 20% (13/65. Nits, nymphs and adults of the parasite were respectively collected from 98.46% (64/65, 38.46% (25/65 and 23.08% (15/65 of the animals examined. This is the first report of bovine pediculosis caused by H. quadripertusus in the state of Pará, Brazil. Further studies should be conducted to determine the occurrence pattern of this species in Brazil and its importance to livestock production.Alta infestação por piolhos foi observada em vacas mestiças Bos taurus indicus e Bos taurus taurus do município de São Domingos do Capim, Estado do Pará, Brasil. Sessenta e cinco animais foram inspecionados e os piolhos foram coletados manualmente, armazenados em álcool 70% e transportados ao Laboratório de Parasitologia Animal da Faculdade de Medicina Veterinária da Universidade Federal do Pará para a identificação. Os exemplares adultos foram identificados como Haematopinus quadripertusus e todos os animais examinados apresentaram pelo menos um estágio de desenvolvimento do ectoparasito. Em 80% (52/65 dos animais, os exemplares coletados localizavam-se somente na cauda e em 20% (13/65 na região periocular, orelha e cauda. Lêndeas, ninfas e adultos foram coletados, respectivamente, em 98,46% (64/65, em 38,46% (25/65 e em 23
Directory of Open Access Journals (Sweden)
W.H. Sousa
1999-06-01
Full Text Available Registros de sobrevivência do nascimento ao desmame de 3846 crias de ovinos da raça Santa Inês foram analisados por modelos de reprodutor linear e não linear (modelo de limiar, para estimar componentes de variância e herdabilidade. Os modelos usados para sobrevivência, analisada como característica da cria, incluíram os efeitos fixos de sexo, da combinação tipo de nascimento-criação da cria e da idade da ovelha ao parto, efeito da covariável peso da cria ao nascer e efeitos aleatórios de reprodutor, da classe rebanho-ano-estação e do resíduo. Componentes de variância para o modelo linear foram estimados pelo método da máxima verossimilhança restrita (REML e para o modelo não linear por uma aproximação da máxima verossimilhança marginal (MML, pelo programa CMMAT2. O coeficiente de herdabilidade (h² estimado pelo modelo de limiar foi de 0,29, e pelo modelo linear, 0,14. A correlação de ordem de Spearman entre as capacidades de transmissão dos reprodutores, com base nos dois modelos foi de 0,96. As estimativas de h² obtidas indicam a possibilidade de se obter, por seleção, ganho genético para sobrevivência.Records of 3,846 lambs survival from birth to weaning of Santa Inês hair sheep breed, were analyzed by linear and non linear sire models (threshold model to estimate variance components and heritability (h². The models that were used to analyze survival, considered in this study as a lamb trait, included the fixed effects of sex of the lamb, combination of type of birth-rearing of lamb, and age of ewe, birth weight of lamb as covariate, and random effects of sire, herd-year-season and residual. Variance components were obtained using restricted maximum likelihood (REML, in linear model and marginal maximum likelihood in threshold model through CMMAT2 program. Estimate of heritability (h² obtained by threshold model was 0.29 and by linear model was 0.14. Rank correlation of Spearman, between sire solutions
45 CFR 672.10 - Default order.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Default order. 672.10 Section 672.10 Public... HEARING PROCEDURES § 672.10 Default order. (a) Default. The Presiding Officer may find a party in default.... No finding of default on the basis of a failure to appear at a hearing shall be made against the...
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.200-10 Section 179.200-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.200-10 Welding. (a) All joints... W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall be...
2010-10-01
... Terms Used in This Subchapter § 90.10-25 Ocean. Under this designation shall be included all vessels navigating the waters of any ocean or the Gulf of Mexico more than 20 nautical miles offshore. ... 46 Shipping 4 2010-10-01 2010-10-01 false Ocean. 90.10-25 Section 90.10-25 Shipping COAST GUARD...
2010-10-01
... Terms Used in This Subchapter § 188.10-51 Ocean. Under this designation shall be included all vessels navigating the waters of any ocean, or the Gulf of Mexico more than 20 nautical miles offshore. ... 46 Shipping 7 2010-10-01 2010-10-01 false Ocean. 188.10-51 Section 188.10-51 Shipping COAST GUARD...
Energy Technology Data Exchange (ETDEWEB)
Montes, J.L.; Perusquia, R.; Ortiz, J.J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Francois, J.L.; Marquez, C.M. [FI-UNAM, 04510 Mexico D.F. (Mexico)]. e-mail: jlmt@nuclear.inin.mx
2005-07-01
At the moment in the National Institute of Nuclear Research (ININ) are carried out studies with the purpose of to establish a methodology that allows to carry out the neutron design of fuel cells of type 10 x 10. During the initial stage of the process of cells design, starting from the data that have to do with the planned energy demand it requires to be estimated the average value of the enrichment in U{sup 235} w/o of the one assemble. The experience has shown that the accuracy that is achieved in this estimate it depends, among other factors, of the information (e.g. concentrations of U{sup 235} and Gd{sub 2}O{sub 3}) of the cells that its are disposed in that moment. For what we consider convenient to enlarge the available information by means of a series of calculations of cell physics; and to the one same time some aspects can be studied on the parameters that define the characteristics of a fuel cell. In this work the effect of the presence of different distributions of the concentrations of the fissile material is analyzed and of burnup poisons on the reactivity parameters of the cell as well as in the peak factor of local power (LPPF-Local Power Peaking Factor). (Author)
Coenzyme Q10 and Neurological Diseases
Directory of Open Access Journals (Sweden)
Gabriele Siciliano
2009-12-01
Full Text Available Coenzyme Q10 (CoQ10, or ubiquinone is a small electron carrier of the mitochondrial respiratory chain with antioxidant properties. CoQ10 supplementation has been widely used for mitochondrial disorders. The rationale for using CoQ10 is very powerful when this compound is primary decreased because of defective synthesis. Primary CoQ10 deficiency is a treatable condition, so heightened “clinical awareness” about this diagnosis is essential. CoQ10 and its analogue, idebenone, have also been widely used in the treatment of other neurodegenerative disorders. These compounds could potentially play a therapeutic role in Parkinson’s disease, Huntington’s disease, amyotrophic lateral sclerosis, Friedreich’s ataxia, and other conditions which have been linked to mitochondrial dysfunction. This article reviews the physiological roles of CoQ10, as well as the rationale and the role in clinical practice of CoQ10 supplementation in different neurological diseases, from primary CoQ10 deficiency to neurodegenerative disorders.
Electrical characteristics of Li(Ni7/10Fe3/10)VO4 ceramics
International Nuclear Information System (INIS)
Ram, Moti
2011-01-01
Graphical abstract: Display Omitted Research highlights: → The compound [Li(Ni 7/10 Fe 3/10 )VO 4 ] was synthesized by a solution-based chemical method. → Structural, microstructural and electrical properties are studied using X-ray diffraction, field emission scanning electron microscopy and complex impedance spectroscopy techniques, respectively. → Electrical conductivity study indicates that electrical conduction in the material is a thermally activated process. - Abstract: The compound [Li(Ni 7/10 Fe 3/10 )VO 4 ] was produced by a solution-based chemical route whose electrical properties were investigated using complex impedance spectroscopy technique. X-ray diffraction study reveals an orthorhombic unit cell structure of the compound. Complex electrical impedance analysis exhibits: (i) grain interior, grain boundary and electrode-material interface contributions to electrical response and (ii) the presence of temperature dependent electrical relaxation phenomena in the material. Electrical conductivity study indicates that electrical conduction in the material is a thermally activated process.
Investigations on Important Properties of the 10 cm x 10 cm GEM Prototype
Saenboonruang, Kiadtisak; Kulasri, Kittipong; Ritthirong, Anawat
2015-01-01
The Gas Electron Multiplier (GEM) detector is one of promising particle and radiation detectors that has been improved greatly from previous gas detectors. The improvement includes better spatial resolutions, higher detection rate capabilities, and flexibilities in designs. In particular, the 10 cm x 10 cm GEM prototype is designed and provided by the Gas Detectors Development group (GDD) at CERN, Switzerland. With its simplicity in operations and designs, while still maintaining high qualities, the GEM prototype is suitable for both start-up and advanced researches. This article aims to report the investigations on some important properties of the 10 cm x 10 cm GEM detector using current measurement and signal counting. Results have shown that gains of the GEM prototype exponentially increase as voltage supplied to the detector increases, while the detector reaches full efficiency (plateau region) when the voltage is greater than 4100 V. In terms of signal sharing between X and Y strips of the readout, X str...
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Pets. 501.10 Section 501.10 Agriculture Regulations of... CONDUCT ON U.S. MEAT ANIMAL RESEARCH CENTER, CLAY CENTER, NEBRASKA § 501.10 Pets. Animals shall be brought... Director, Research Center, except seeing eye dogs may be brought to the reception area serving the offices...
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Applicability. 10.1 Section 10.1 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.1 Applicability. This part contains rules of conduct for the...
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Costs. 4221.10 Section 4221.10 Labor Regulations Relating... PLANS ARBITRATION OF DISPUTES IN MULTIEMPLOYER PLANS § 4221.10 Costs. The costs of arbitration under... the costs of its own witnesses. (b) Other costs of arbitration. Except as provided in § 4221.6(d) with...
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Alcohol. 328.10 Section 328.10 Food and Drugs FOOD...-THE-COUNTER DRUG PRODUCTS INTENDED FOR ORAL INGESTION THAT CONTAIN ALCOHOL Ingredients § 328.10 Alcohol. (a) Any over-the-counter (OTC) drug product intended for oral ingestion shall not contain alcohol...
Preferential binding to Elk-1 by SLE-associated IL10 risk allele upregulates IL10 expression.
Directory of Open Access Journals (Sweden)
Daisuke Sakurai
Full Text Available Immunoregulatory cytokine interleukin-10 (IL-10 is elevated in sera from patients with systemic lupus erythematosus (SLE correlating with disease activity. The established association of IL10 with SLE and other autoimmune diseases led us to fine map causal variant(s and to explore underlying mechanisms. We assessed 19 tag SNPs, covering the IL10 gene cluster including IL19, IL20 and IL24, for association with SLE in 15,533 case and control subjects from four ancestries. The previously reported IL10 variant, rs3024505 located at 1 kb downstream of IL10, exhibited the strongest association signal and was confirmed for association with SLE in European American (EA (P = 2.7×10⁻⁸, OR = 1.30, but not in non-EA ancestries. SNP imputation conducted in EA dataset identified three additional SLE-associated SNPs tagged by rs3024505 (rs3122605, rs3024493 and rs3024495 located at 9.2 kb upstream, intron 3 and 4 of IL10, respectively, and SLE-risk alleles of these SNPs were dose-dependently associated with elevated levels of IL10 mRNA in PBMCs and circulating IL-10 protein in SLE patients and controls. Using nuclear extracts of peripheral blood cells from SLE patients for electrophoretic mobility shift assays, we identified specific binding of transcription factor Elk-1 to oligodeoxynucleotides containing the risk (G allele of rs3122605, suggesting rs3122605 as the most likely causal variant regulating IL10 expression. Elk-1 is known to be activated by phosphorylation and nuclear localization to induce transcription. Of interest, phosphorylated Elk-1 (p-Elk-1 detected only in nuclear extracts of SLE PBMCs appeared to increase with disease activity. Co-expression levels of p-Elk-1 and IL-10 were elevated in SLE T, B cells and monocytes, associated with increased disease activity in SLE B cells, and were best downregulated by ERK inhibitor. Taken together, our data suggest that preferential binding of activated Elk-1 to the IL10 rs3122605-G allele
Charged pion photoproduction from 10B
International Nuclear Information System (INIS)
Rowley, D.; LeRose, J.; Min, K.; Sapp, B.O.; Stoler, P.; Winhold, E.J.; Yergin, P.F.; Bernstein, A.M.; Blomqvist, K.I.; Caplan, H.S.; Dytman, S.A.; Franklin, G.; Pauli, M.
1982-01-01
Measurements were made of dsigma/dΩ [theta/sub π/ = 90 0 (lab)] for 10 B(γ,π + ) 10 Be(g.s.) at T/sub π/ = 17, 29, and 42 MeV, for 10 B(γ,π + ) 10 Be(E/sub x/ = 3.37 MeV) at T/sub π/ = 29 and 42 MeV, and for 10 B(γ,π - ) 10 C(g.s.) at T/sub π/ = 29 MeV. The results disagree significantly with several recent distorted-wave impulse approximation calculations
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Default. 959.10 Section 959.10 Postal Service... STATUTES § 959.10 Default. (a) If the respondent fails to file an answer within the time specified in the notice of hearing, the respondent shall be deemed in default and to have waived hearing and further...
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Act. 901.10 Section 901.10 Foreign Relations FOREIGN SERVICE GRIEVANCE BOARD GENERAL Meanings of Terms As Used in This Chapter § 901.10 Act. Act means the Foreign Service Act of 1980 (Pub. L. 96-465, October 17, 1980), as amended. [56 FR 55458, Oct. 28...
Measuring Information Security Performance with 10 by 10 Model for Holistic State Evaluation.
Directory of Open Access Journals (Sweden)
Igor Bernik
Full Text Available Organizations should measure their information security performance if they wish to take the right decisions and develop it in line with their security needs. Since the measurement of information security is generally underdeveloped in practice and many organizations find the existing recommendations too complex, the paper presents a solution in the form of a 10 by 10 information security performance measurement model. The model-ISP 10×10M is composed of ten critical success factors, 100 key performance indicators and 6 performance levels. Its content was devised on the basis of findings presented in the current research studies and standards, while its structure results from an empirical research conducted among information security professionals from Slovenia. Results of the study show that a high level of information security performance is mostly dependent on measures aimed at managing information risks, employees and information sources, while formal and environmental factors have a lesser impact. Experts believe that information security should evolve systematically, where it's recommended that beginning steps include technical, logical and physical security controls, while advanced activities should relate predominantly strategic management activities. By applying the proposed model, organizations are able to determine the actual level of information security performance based on the weighted indexing technique. In this manner they identify the measures they ought to develop in order to improve the current situation. The ISP 10×10M is a useful tool for conducting internal system evaluations and decision-making. It may also be applied to a larger sample of organizations in order to determine the general state-of-play for research purposes.
Measuring Information Security Performance with 10 by 10 Model for Holistic State Evaluation.
Bernik, Igor; Prislan, Kaja
Organizations should measure their information security performance if they wish to take the right decisions and develop it in line with their security needs. Since the measurement of information security is generally underdeveloped in practice and many organizations find the existing recommendations too complex, the paper presents a solution in the form of a 10 by 10 information security performance measurement model. The model-ISP 10×10M is composed of ten critical success factors, 100 key performance indicators and 6 performance levels. Its content was devised on the basis of findings presented in the current research studies and standards, while its structure results from an empirical research conducted among information security professionals from Slovenia. Results of the study show that a high level of information security performance is mostly dependent on measures aimed at managing information risks, employees and information sources, while formal and environmental factors have a lesser impact. Experts believe that information security should evolve systematically, where it's recommended that beginning steps include technical, logical and physical security controls, while advanced activities should relate predominantly strategic management activities. By applying the proposed model, organizations are able to determine the actual level of information security performance based on the weighted indexing technique. In this manner they identify the measures they ought to develop in order to improve the current situation. The ISP 10×10M is a useful tool for conducting internal system evaluations and decision-making. It may also be applied to a larger sample of organizations in order to determine the general state-of-play for research purposes.
Automated system for equivalent noise charge measurements from 10 ns to 10 μs
International Nuclear Information System (INIS)
La Taille, C. de.
1992-07-01
Noise measurements versus filter time constant constitute a very powerful method to investigate series, parallel and 1/f noise contributions in front end electronics. Usually performed with a set of filters and a multichannel analyser, they are tedious and often limited to values greater than 100 ns. A very low noise bipolar filter is described whose time constant can be selected via GPIB bus from 10 ns to 10 μs in 10 steps. The data are transferred from a digital scope to a computer which generates a baseline histogram and determines the overall gain. The Equivalent Noise Charge is then calculated for each time constant and a fit to the results determines the various noise parameters. (author) 13 refs., 10 figs., 1 tab
International Nuclear Information System (INIS)
Loehneer, H.
1997-01-01
During the IV TAPS (two arm photon spectrometer) workshop held at Mont Saint Odile near Strasbourg the third of September, the TAPS collaboration celebrated its 10. anniversary. At this occasion a compilation entitled 'The first 10 years with TAPS' was issued. The foreword of the spokesperson of the TAPS collaboration is presented. (K.A.)
Alvarez, Paul
2012-01-01
Ten years ago, in February 2002, the European Network for Light Ion Hadron Therapy (ENLIGHT) had its inaugural meeting at CERN. As a pioneering multidisciplinary network celebrates its 10th anniversary, some of the founders recall how it all started. Picture 1 : Participants at the 10th anniversary meeting of ENLIGHT at CNAO, Pavia, in September 2012.
Performance of B-10 based detectors
Energy Technology Data Exchange (ETDEWEB)
Boucher, Mathieu; Anderson, Tom; Johnson, Nathan; Mckinny, Kevin; Mcpheeters, Matthew [GE Measurement and Control - Reuter-Stokes, Twinsburg, Ohio (United States)
2015-07-01
Helium-3 gas-filled detectors have been used in nuclear safeguards applications, in homeland security neutron detection modules and in research for over 30 years. With the current shortage of {sup 3}He gas, GE's Reuter-Stokes business developed a {sup 10}B lined proportional counter and a {sup 10}B hybrid detector, in which a small amount of {sup 3}He is added to a 10B detector to enhance the neutron sensitivity. In 2010, GE's Reuter-Stokes successfully developed a commercial alternative to 3He gas-filled detectors for homeland security neutron detection modules based on 10B lined proportional counters. We will present the concept behind the {sup 10}B neutron detection modules, as drop-in replacement to existing 3He neutron detection modules deployed, and the timeline and development needed to get a fully commercial application. To ensure the highest quality, each {sup 10}B neutron detection unit is put through a series of tests: temperature cycles from -40 deg. C to +55 deg. C, vibration testing at levels up to 2.5 g from 10 Hz to 50 Hz in every direction, neutron sensitivity reaching up to 4.5 cps/(ng {sup 252}CF at 2 m), and gamma insensitivity with field reaching 1 Sv/hr. In 2013, GE's Reuter-Stokes developed the B10Plus+{sup R} detector, in which a small amount of {sup 3}He is added to a {sup 10}B lined proportional counter. Depending on the amount of {sup 3}He added, the B10Plus+{sup R} can more than double the neutron sensitivity compared to a {sup 10}B lined proportional counter. {sup 10}B lined proportional counters and B10Plus+{sup R} have excellent gamma rejection and excellent performance even at very high neutron flux. The gamma rejection and high neutron flux performance of these detectors are comparable, if not better, than traditional {sup 3}He proportional counters. GE's Reuter-Stokes business modelled, designed, built and tested prototype coincidence counters using the {sup 10}B lined detectors and the {sup 10}B hybrid
DEFF Research Database (Denmark)
2014-01-01
CINARK10 giver et overblik over de mange typer aktiviteter, forskningsprojekter og personer der har tegnet CINARKs virke gennem de sidste ti år – fra centrets etablering i 2004 til i dag. Materialet vi har samlet viser kun et udsnit de arbejder og de forskellige sammenhænge CINARKs medarbejdere har...
International Nuclear Information System (INIS)
Thomas, J.; Parker, P.; Mangini, A.; Cochran, K.; Turekian, K.; Krishnaswami, S.; Sharma, P.
1981-01-01
10 Be (t/sub 1/2) = 1.5 MY) is(formed in the upper atmosphere by cosmic ray spallation on nitrogen and oxygen. It is transported to the earth's surface via precipitation. In the oceans it is eventually associated with solid phases depositing on the ocean floor such as manganese nodules and deep-sea sediments. One of the assumptions that is normally made in analysis of such processes is that 10 Be has been produced at a relatively uniform rate over the pat several million years. If we assume, in addition, that the initial specific concentration of 10 Be as it precipitates with a solid phase is invariant with time, then we would expect that the decrease of the 10 Be concentration as a function of depth in a deep-sea core or in a manganese nodule would provide a record of sediment accumulation rate in the former and of growth rate in the latter. The possibility of using cosmic-ray produced 10 Be for the dating of marine deposits had been proposed 25 years ago by Arnold and Goel et al. The method of analysis used by these investigators, and those subsequently pursuing the problem, was low-level β counting. Though the potential of using 10 Be for dating manganese nodules was explored more than a decade ago, only a few measurements of 10 Be in nodules exist in date. This is largely because of the 10 Be measurements in environmental samples have gained considerable momentum during the past 3 to 4 years, after the development of accelerator mass spectrometry for its determination
Directory of Open Access Journals (Sweden)
Ahmed A. Karim
2017-08-01
Full Text Available Have you ever noticed that in watch advertisements the time is usually set at 10:10? The reasons and psychological effects of this default time setting are elusive. In Experiment 1, we hypothesized that watches showing a time setting resembling a smiling face (10:10 would enhance emotional valence and intention to buy compared to a neutral time setting (11:30, whereas a time setting resembling a sad face (8:20 would have the opposite effect. Moreover, we investigated a possible interaction effect with the gender of the participants. In Experiment 2, we directly tested the hypotheses that watches set at 10:10 resemble a smiling face, whereas watches set at 8:20 resemble a sad face. The data of the first experiment reveal that watches set at 10:10 showed a significant positive effect on the emotion of the observer and the intention to buy. However, watches set at 8:20 did not show any effect on the emotion or the intention to buy. Moreover, watches set at 10:10 induced in women significantly stronger ratings of pleasure than in men. The data of the second experiment show that participants consistently perceive high resemblance between watches set at 10:10 and a smiling face as well as high resemblance between watches set at 8:20 and a sad face. This study provides for the first time empirical evidence for the notion that using watches with a time setting resembling a smiling face (like 10:10 can positively affect the emotional response of the observers and their evaluation of a seen watch, even though they are not aware of the fact that the shown time setting is inducing this effect. Practical implications of the observed findings and alternative explanations are discussed.
Karim, Ahmed A; Lützenkirchen, Britta; Khedr, Eman; Khalil, Radwa
2017-01-01
Have you ever noticed that in watch advertisements the time is usually set at 10:10? The reasons and psychological effects of this default time setting are elusive. In Experiment 1, we hypothesized that watches showing a time setting resembling a smiling face (10:10) would enhance emotional valence and intention to buy compared to a neutral time setting (11:30), whereas a time setting resembling a sad face (8:20) would have the opposite effect. Moreover, we investigated a possible interaction effect with the gender of the participants. In Experiment 2, we directly tested the hypotheses that watches set at 10:10 resemble a smiling face, whereas watches set at 8:20 resemble a sad face. The data of the first experiment reveal that watches set at 10:10 showed a significant positive effect on the emotion of the observer and the intention to buy. However, watches set at 8:20 did not show any effect on the emotion or the intention to buy. Moreover, watches set at 10:10 induced in women significantly stronger ratings of pleasure than in men. The data of the second experiment show that participants consistently perceive high resemblance between watches set at 10:10 and a smiling face as well as high resemblance between watches set at 8:20 and a sad face. This study provides for the first time empirical evidence for the notion that using watches with a time setting resembling a smiling face (like 10:10) can positively affect the emotional response of the observers and their evaluation of a seen watch, even though they are not aware of the fact that the shown time setting is inducing this effect. Practical implications of the observed findings and alternative explanations are discussed.
Development of LD pumped 10 J x 10 Hz Nd: Glass slab laser system
International Nuclear Information System (INIS)
Yamanaka, Masanobu; Kanabe, Tadashi; Matsui, Hideki
2000-01-01
As a first step of a driver development for the inertial fusion energy, we are developing a diode-pumped zig-zag Nd: glass slab laser amplifier system which can generate an output of 10 J per pulse at 1053 nm in 10 Hz operation. The water-cooled zig-zag Nd: glass slab is pumped from both sides by 803-nm AlGaAs laser-diode (LD) module; each LD module has an emitting area of 420 mm x 10 mm and two LD modules generated in total 200 kW peak power with 2.5 kW/cm 2 peak intensity at 10 Hz repetition rate. We have obtained in a preliminary experiment a 8.5 J output energy at 0.5 Hz with beam quality of 2 times diffraction limited far-field pattern. (author)
HTR-10 severe accident management
International Nuclear Information System (INIS)
Xu Yuanhui; Sun Yuliang
1997-01-01
The High Temperature Gas-cooled Reactor (HTR-10) is under construction at the Institute of Nuclear Energy Technology site northwest of Beijing. This 10 MW thermal plant utilizes a pebble bed high temperature gas cooled reactor for a large range of applications such as electricity generation, steam and district heat generation, gas turbine and steam turbine combined cycle and process heat for methane reforming. The HTR-10 is the first high temperature gas cooled reactor to be licensed in China. This paper describes the safety characteristics and design criteria for the HTR-10 as well as the accident management and analysis required for the licensing process. (author)
Stopping power of charged particles from 10 eV/amu to 10 GeV/amu
International Nuclear Information System (INIS)
Nakane, Yoshihiro; Tanaka, Shun-ichi; Furihata, Shiori; Iwai, Satoshi.
1993-08-01
Electric collision, nuclear collision and total stopping powers in 10 kinds of elements: H 2 , He, Be, C, Al, Fe, Cu, W, Pb and U, and 4 kinds of materials: water, phantom, LiF-TLD and SSNTD (solid state neutron track detector) have been calculated for 10 kinds of charged particles from 10 eV/amu to 10 GeV/amu with STOPPING, SPAR, and RSTAN/RSHEV codes, in which the charged particles are important projectiles for evaluating the dose and detector responses of radiations, and for accelerator shielding calculations. Calculated data are presented in Table and Figure. (author)
2003-01-01
Force10 Networks, Inc., today announced that the performance of the Force10 E-Series switch/routers deployed in a transcontinental network has been verified as line-rate 10 GE throughput by Ixia, a leading provider of high-speed, network performance and conformance analysis systems. The network, the world's first transcontinental 10 GE wide area network, consists of a SURFnet OC-192 lambda between Geneva and the StarLight facility in Chicago via Amsterdam and another OC-192 lambda between this same facility in Chicago and Carleton University in Ottawa, Canada provided by CANARIE and ORANO (1/2 page).
Determining the nuclear data uncertainty on MONK10 and WIMS10 criticality calculations
Ware, Tim; Dobson, Geoff; Hanlon, David; Hiles, Richard; Mason, Robert; Perry, Ray
2017-09-01
The ANSWERS Software Service is developing a number of techniques to better understand and quantify uncertainty on calculations of the neutron multiplication factor, k-effective, in nuclear fuel and other systems containing fissile material. The uncertainty on the calculated k-effective arises from a number of sources, including nuclear data uncertainties, manufacturing tolerances, modelling approximations and, for Monte Carlo simulation, stochastic uncertainty. For determining the uncertainties due to nuclear data, a set of application libraries have been generated for use with the MONK10 Monte Carlo and the WIMS10 deterministic criticality and reactor physics codes. This paper overviews the generation of these nuclear data libraries by Latin hypercube sampling of JEFF-3.1.2 evaluated data based upon a library of covariance data taken from JEFF, ENDF/B, JENDL and TENDL evaluations. Criticality calculations have been performed with MONK10 and WIMS10 using these sampled libraries for a number of benchmark models of fissile systems. Results are presented which show the uncertainty on k-effective for these systems arising from the uncertainty on the input nuclear data.
DEFF Research Database (Denmark)
Wenander, Fredrik; Riisager, Karsten
2012-01-01
REX-ISOLDE, one of CERN’s most compact accelerators, has just celebrated its 10th anniversary. The machine’s versatility provides radioactive ion beams across the range of nuclear isotopes.......REX-ISOLDE, one of CERN’s most compact accelerators, has just celebrated its 10th anniversary. The machine’s versatility provides radioactive ion beams across the range of nuclear isotopes....
10 anos com Mafalda / 10 years with Mafalda
Santos, José Douglas Alves dos
2013-01-01
10 anos com Mafalda (2010), publicado pela Editora WMF Martins Fontes e traduzido por Monica Stahel, é um livro que reproduz as tiras de Mafalda e sua turma desenhadas por Quino, Joaquín Salvador Lavado, organizadas em 13 temas – a família, a rua, a escola, assim vai o mundo, Mafalda e a sopa, Férias, TV, Guile, Susanita, Felipe, Manolito, Miguelito e Liberdade.
46 CFR 194.10-25 - Ventilation.
2010-10-01
... magazines. (1) All integral magazines shall be provided with natural or mechanical ventilation. Design... vans shall be provided with natural ventilation sufficient to maintain the inside air temperature below... 46 Shipping 7 2010-10-01 2010-10-01 false Ventilation. 194.10-25 Section 194.10-25 Shipping COAST...
Directory of Open Access Journals (Sweden)
Konstantina Fragaki
Full Text Available BACKGROUND: Coenzyme Q10 (CoQ10 or ubiquinone deficiency can be due either to mutations in genes involved in CoQ10 biosynthesis pathway, or to mutations in genes unrelated to CoQ10 biosynthesis. CoQ10 defect is the only oxidative phosphorylation disorder that can be clinically improved after oral CoQ10 supplementation. Thus, early diagnosis, first evoked by mitochondrial respiratory chain (MRC spectrophotometric analysis, then confirmed by direct measurement of CoQ10 levels, is of critical importance to prevent irreversible damage in organs such as the kidney and the central nervous system. It is widely reported that CoQ10 deficient patients present decreased quinone-dependent activities (segments I + III or G3P + III and II + III while MRC activities of complexes I, II, III, IV and V are normal. We previously suggested that CoQ10 defect may be associated with a deficiency of CoQ10-independent MRC complexes. The aim of this study was to verify this hypothesis in order to improve the diagnosis of this disease. RESULTS: To determine whether CoQ10 defect could be associated with MRC deficiency, we quantified CoQ10 by LC-MSMS in a cohort of 18 patients presenting CoQ10-dependent deficiency associated with MRC defect. We found decreased levels of CoQ10 in eight patients out of 18 (45 %, thus confirming CoQ10 disease. CONCLUSIONS: Our study shows that CoQ10 defect can be associated with MRC deficiency. This could be of major importance in clinical practice for the diagnosis of a disease that can be improved by CoQ10 supplementation.
Volume 10 No. 10 October 2010 4235 DETERMINANTS OF ...
African Journals Online (AJOL)
user
2010-10-10
Oct 10, 2010 ... women had between 5 and 8 children, 42.7% of the respondents were ... poverty among subsistence farmers' households, promote ... livelihood of the people with about 70% rural population. .... were between the ages of 30 and 39. .... which reported that the percentage of children in Nigeria who are.
Latitude SSTmax = 0 SSTmax = 10 SSTmax = 20
Indian Academy of Sciences (India)
. −10. −5. 0. 5. 10. V (m/s). −30. −20. −10. 0. 10. 20. 30. −10. −5. 0. 5. 10. Latitude. V (m/s). V Non−linear model. Non−linear advection term. Pressure gradient term. SSTmax = 0. SSTmax = 10. SSTmax = 20.
UPSILON'(10.01) resonance parameters
International Nuclear Information System (INIS)
Niczyporuk, B.; Zeludziewicz, T.; Chen, K.W.; Hartung, R.
1980-09-01
The resonance parameters of the UPSILON'(10.01) were measured using the LENA detector at the DORIS e + e - storage ring. We obtained a mass of M(UPSILON') = (10 013.6 +- 1.2 +- 10.0) MeV and an electronic width of GAMMAsub(ee)(UPSILON') = (0.53 +- 0.07sup(+0.09)sub(-0.05) keV. The upper limit set to the μ-pair branching ratio is 3.8% which implies a lower limit on the total UPSILON' widUPSILON parameters we obtain a mass difference M(UPSILON') - M(UPSILON) = (552.0 +- 1.3 +- 10.0) MeV and GAMMAsub(ee)UPSILON')/ = 0.43 +- 0.07sup(+0.05)sub(-0.00). (orig.)
38 CFR 39.10 - Application requirements.
2010-07-01
...-10) Grant Requirements and Procedures § 39.10 Application requirements. (a) For a project to be..., etc., (10) Economic activities, (11) Cultural resources, (12) Aesthetics, (13) Residential population...
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Fire pumps. 95.10-5 Section 95.10-5 Shipping COAST GUARD... Main System, Details § 95.10-5 Fire pumps. (a) Vessels shall be equipped with independently driven fire pumps in accordance with Table 95.10-5(a). Table 95.10-5(a) Gross tons Over Not over Minimum number of...
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Fire pumps. 76.10-5 Section 76.10-5 Shipping COAST GUARD..., Details § 76.10-5 Fire pumps. (a) Vessels shall be equipped with independently driven fire pumps in accordance with table 76.10-5(a). Table 76.10-5(a) Gross tons Over Not over Minimum number of pumps...
Determining the nuclear data uncertainty on MONK10 and WIMS10 criticality calculations
Directory of Open Access Journals (Sweden)
Ware Tim
2017-01-01
Full Text Available The ANSWERS Software Service is developing a number of techniques to better understand and quantify uncertainty on calculations of the neutron multiplication factor, k-effective, in nuclear fuel and other systems containing fissile material. The uncertainty on the calculated k-effective arises from a number of sources, including nuclear data uncertainties, manufacturing tolerances, modelling approximations and, for Monte Carlo simulation, stochastic uncertainty. For determining the uncertainties due to nuclear data, a set of application libraries have been generated for use with the MONK10 Monte Carlo and the WIMS10 deterministic criticality and reactor physics codes. This paper overviews the generation of these nuclear data libraries by Latin hypercube sampling of JEFF-3.1.2 evaluated data based upon a library of covariance data taken from JEFF, ENDF/B, JENDL and TENDL evaluations. Criticality calculations have been performed with MONK10 and WIMS10 using these sampled libraries for a number of benchmark models of fissile systems. Results are presented which show the uncertainty on k-effective for these systems arising from the uncertainty on the input nuclear data.
TIPSS: 10 years of experience; TIPSS: 10 Jahre klinische Erfahrung
Energy Technology Data Exchange (ETDEWEB)
Richter, G.M.; Brado, M.; Simon, C.; Radeleff, B.; Kauffmann, G.W. [Heidelberg Univ. (Germany). Abt. Radiodiagnostik; Noeldge, G.; Scharf, J.; Hansmann, J.
1998-04-01
Purpose: To demonstrate and document 10 years of clinical experience gathered by us with TIPSS and to discuss achievements, problems and outlook. Results: Variceal filling was widely reduced by TIPSS, and significantly reduced portal liver perfusion as assessed morphologically and rheologically. However, there was an immediate onset of compensated liver perfusion by increased arterial inflow. Total liver perfusion did not change significantly. In TIPSS portal decompression was readily achieved, the portosystemic gradient dropping from an average of 24 mm Hg to 10.5 mm Hg. In our series we could not demonstrate an increased incidence of hepatic encephalopathy during the 30-day post-TIPSS period. Early mortality was 4% and early rebleeding rate 3%. The 12-month re-intervention rate based on an invasive portography follow-up protocol was 76%, and the 24-month re-intervention rate was 90%. The definite occlusion rate was below 5%. Beyond a follow-up time span of 24-months the necessity for re-intervention dropped significantly: Less than one-third of our patients required some sort of re-intervention. (orig./AJ) [Deutsch] Ziel: Darstellung der nach 10jaehriger klinischer Anwendung von TIPSS gewonnenen Erfahrungen unter Beruecksichtigung der technischen Grundlagen, der Veraenderungen in der Haemodynamik der Leber und der Langzeitergebnisse. Ergebnisse: TIPSS reduziert die Varizenfuellung und verringert morphologisch und haemodynamisch die portale Perfusion. Die Gesamtleberperfusion aendert sich nicht signifikant. Unter TIPSS kommt es zu einer unmittelbaren Zunahme der arteriellen Leberperfusion. Die portale Drucksenkung erfolgt von einem portosystemischen Mitteldruck von 24 mmHg auf 10,5 mmHg im Durchschnitt. Die spontane hepatische Enzephalopathierate von etwa 20% aendert sich durch TIPSS nicht wesentlich. Die Fruehletalitaet betraegt 4% und die Nachblutungsrate 3%. Insbesondere die Standardisierung von Indikationen und Kontraindikationen, des Punktionsbesteckes, der
47 CFR 10.540 - Attestation requirement. [Reserved
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Attestation requirement. [Reserved] 10.540 Section 10.540 Telecommunication FEDERAL COMMUNICATIONS COMMISSION GENERAL COMMERCIAL MOBILE ALERT SYSTEM Equipment Requirements § 10.540 Attestation requirement. [Reserved] ...
7 CFR 1290.10 - Audit requirements.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Audit requirements. 1290.10 Section 1290.10 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... audit, a copy of the audit results. ...
Knott, Anja; Achterberg, Volker; Smuda, Christoph; Mielke, Heiko; Sperling, Gabi; Dunckelmann, Katja; Vogelsang, Alexandra; Krüger, Andrea; Schwengler, Helge; Behtash, Mojgan; Kristof, Sonja; Diekmann, Heike; Eisenberg, Tanya; Berroth, Andreas; Hildebrand, Janosch; Siegner, Ralf; Winnefeld, Marc; Teuber, Frank; Fey, Sven; Möbius, Janne; Retzer, Dana; Burkhardt, Thorsten; Lüttke, Juliane; Blatt, Thomas
2015-01-01
Ubiquinone (coenzyme Q10, Q10) represents an endogenously synthesized lipid-soluble antioxidant which is crucial for cellular energy production but is diminished with age and under the influence of external stress factors in human skin. Here, it is shown that topical Q10 treatment is beneficial with regard to effective Q10 replenishment, augmentation of cellular energy metabolism, and antioxidant effects. Application of Q10-containing formulas significantly increased the levels of this quinone on the skin surface. In the deeper layers of the epidermis the ubiquinone level was significantly augmented indicating effective supplementation. Concurrent elevation of ubiquinol levels suggested metabolic transformation of ubiquinone resulting from increased energy metabolism. Incubation of cultured human keratinocytes with Q10 concentrations equivalent to treated skin showed a significant augmentation of energy metabolism. Moreover, the results demonstrated that stressed skin benefits from the topical Q10 treatment by reduction of free radicals and an increase in antioxidant capacity. © 2015 International Union of Biochemistry and Molecular Biology.
2010-04-01
... that date, except as otherwise provided in §§ 10.241 through 10.248; (2) Rum and tafia classified in subheading 2208.40, Harmonized Tariff Schedule of the United States; (3) Sugars, syrups, and sugar-containing...
Spinocerebellar ataxia-10 with paranoid schizophrenia
Directory of Open Access Journals (Sweden)
Bhavesh Trikamji
2015-01-01
Full Text Available Spino-cerebellar ataxia type 10 (SCA10 is an autosomal dominant disorder that is characterized by cerebellar ataxia, seizures and nystagmus with a fragmented pursuit. Schizophrenia has been reported with SCAs 1 and 2 yet in SCA 10, psychiatric manifestations are uncommon. We report a Hispanic family involving a father and his four children with SCA10 genetic mutation. Two of his children, a 20-year-old female and a 23-year-old male, presented with gradually progressive spino-cerebellar ataxia and paranoid schizophrenia. Neurological examination revealed ocular dysmetria, dysdiadokinesia, impaired finger-to-nose exam, gait ataxia and hyperreflexia in both the cases. Additionally, they had a history of psychosis with destructive behavior, depression and paranoid delusions with auditory hallucinations. Serology and CSF studies were unremarkable and MRI brain revealed cerebellar volume loss. Ultimately, a test for ATAXIN-10 mutation was positive thus confirming the diagnosis of SCA10 in father and his four children. We now endeavor to investigate the association between schizophrenia and SCA10.
Combining MOD10A1 and MYD10A1 Images For Snow Cover Area Monitoring
Tekeli, A. E.
2008-12-01
MOD10A1 and MYD10A1 daily snow cover maps at 500 m resolution are available from MODIS sensors on Terra and Aqua satellites. Aqua obtains the image of same region approximately three hours after Terra over Turkey region. MODIS is an optic sensor and cloud cover degrades the usability of derived snow cover maps. Moreover, spectral similarity between clouds and snow complicates their separability in visible imagery. Fortunately, dynamic behavior of clouds enables their discrimination from snow stationary on the surface. Combined use of MOD10A1 and MYD10A1 images mostly reduces the cloud cover present in one image alone and provides better representation of surface snow cover. Comparison of merged images with in situ data indicated higher hit ratios. The individual comparison of MOD10A1 and MYD10A1 images with ground data each yielded 31% hit ratio whereas, the merged images provided 38%. One-day shifts in comparisons increased hit ratios to 52 % and 46% whereas and two-day shifts gave 77 % and 79 % for MOD10A1 and MYD10A1 respectively. Merged maps yielded 54% and 83% for one and two day shifts. The improvement provided by the merging technique is found to be 7% for the present day, 7 % for one- day and 5% for two-day shifts for the whole season. Monthly decomposition resulted 25% improvement as the maximum. The snow cover product obtained by merging Terra and Aqua satellites provided higher hit ratios, as expected.
Beryllium-10 in continental sediments
International Nuclear Information System (INIS)
Brown, L.; Sacks, I.S.; Tera, F.; Klein, J.; Middleton, R.
1981-01-01
The concentration of 10 Be has been measured in 10 samples taken from a transect of surface sediments beginning in the Atchafalaya River and extending across the Bay 136 km into the Gulf of Mexico. If corrected for a lower retentivity of sand for Be, they have a concentration that is constant within 13%. This concentration is about an order of magnitude smaller than that of deep ocean sediments. For comparison, measurements of 10 Be in rainwater, in a sample of soil and in a deep ocean core were made. (orig.)
1969-01-01
Air Force Major Peter Hoag stands in front of the HL-10 Lifting Body. Maj. Hoag joined the HL-10 program in 1969 and made his first glide flight on June 6, 1969. He made a total of 8 flights in the HL-10. They included the fastest lifting-body flight, which reached Mach 1.861 on Feb. 18, 1970. The HL-10 was one of five heavyweight lifting-body designs flown at NASA's Flight Research Center (FRC--later Dryden Flight Research Center), Edwards, California, from July 1966 to November 1975 to study and validate the concept of safely maneuvering and landing a low lift-over-drag vehicle designed for reentry from space. Northrop Corporation built the HL-10 and M2-F2, the first two of the fleet of 'heavy' lifting bodies flown by the NASA Flight Research Center. The contract for construction of the HL-10 and the M2-F2 was $1.8 million. 'HL' stands for horizontal landing, and '10' refers to the tenth design studied by engineers at NASA's Langley Research Center, Hampton, Va. After delivery to NASA in January 1966, the HL-10 made its first flight on Dec. 22, 1966, with research pilot Bruce Peterson in the cockpit. Although an XLR-11 rocket engine was installed in the vehicle, the first 11 drop flights from the B-52 launch aircraft were powerless glide flights to assess handling qualities, stability, and control. In the end, the HL-10 was judged to be the best handling of the three original heavy-weight lifting bodies (M2-F2/F3, HL-10, X-24A). The HL-10 was flown 37 times during the lifting body research program and logged the highest altitude and fastest speed in the Lifting Body program. On Feb. 18, 1970, Air Force test pilot Peter Hoag piloted the HL-10 to Mach 1.86 (1,228 mph). Nine days later, NASA pilot Bill Dana flew the vehicle to 90,030 feet, which became the highest altitude reached in the program. Some new and different lessons were learned through the successful flight testing of the HL-10. These lessons, when combined with information from it's sister ship, the M2
Short-Circuit Degradation of 10-kV 10-A SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Beczkowski, Szymon; Munk-Nielsen, Stig
2017-01-01
The short-circuit behavior of power devices is highly relevant for converter design and fault protection. In this work, the degradation during short-circuit of a 10 kV 10 A 4H-SiC MOSFET is investigated at 6 kV DC-link voltage. The study aims to present the behavior of the device during short-circuit...... transients as it sustains increasing short-circuit pulses during its life-time. As the short-circuit pulse length increases, degradation of the device can be observed in periodically performed characterizations. The initial degradation seems to be associated with the channel region, and continuous stressing...
The 10B (7Li, 7Be)10Be charge-exchange reaction
International Nuclear Information System (INIS)
Etchegoyen, A.
1987-01-01
It is analysed the mechanisms: direct charge-exchange through the two-body residual force (Q opt ∼ 0.2 MeV, which is close to the reaction Q-value of - 1,42 MeV); and single-Nucleon Knock-on exchange (SNKE) due to the intereacting nucleons being undistinguishable. These mechanisms are analysed in detail for producing 10 B ( 7 Li, 7 Be) 10 Be reaction. The experience was carried out at the Tandar Laboratory using conventional electronics. The elastic scattering was simultaneously measured in order to obtain an optical model parameter set. (M.C.K.) [pt
African Journals Online (AJOL)
user
Peer-reviewed paper: 10th World Conference on Animal Production ... values might be biased and reduce effectiveness of selection (Calus et al., 2002). ... in the South African National Dairy Animal Performance Testing Scheme during ...
RRh2Al10 (R = Ce, Yb): New intermetallic compounds in the 1 : 2 : 10 stoichiometry series
Strydom, A. M.; Djoumessi, R. F.; Blinova, M.; Tursina, A.; Nesterenko, S.; Avzuragova, V.
2018-05-01
The orthorhombic, space group Cmcm YbFe2Al10 structure type series of compounds are known to form with practically the entire series of rare-earth elements R, but only with the three d - electron elements Fe, Ru, and Os. The Ce-derivatives in particular have been of much interest since the first reports of their highly unusual physical properties. Classified as Kondo insulators, CeRu2Al10 and CeOs2Al10 controversially order magnetically and with uncharacteristically high Néel temperatures of ≃ 28 K. CeFe2Al10 on the other hand shows pronounced semiconducting and Kondo features but remains paramagnetic. As part of our ongoing studies into the rich physics of this class of materials we have succeeded in synthesizing new members of the 1:2:10 stoichiometry involving the chemical element Rh for the first time. CeRh2Al10 is found to crystallize in the tetragonal system with space group I41 / amd . Yb Rh2Al10 on the other hand forms in the serial Cmcm orthorhombic structure type. We discuss important similarities between the two types. At 5.310 Å the shortest Ce-Ce distance is, likewise to the situation in CeRu2Al10 and CeOs2Al10 , also well above the Hill limit of 3.40 Å. Despite the cage-like structure and large rare-earth separation distances, this study reveals the onset of long-range magnetic ordering in CeRh2Al10 at 3.9 K. The magnetic ordering develops out of an incoherent Kondo state that dominates the electrical resistivity below about 40 K.
CD44v10, osteopontin and lymphoma growth retardation by a CD44v10-specific antibody.
Megaptche, Amelie Pajip; Erb, Ulrike; Büchler, Markus Wolfgang; Zöller, Margot
2014-09-01
Blockade of CD44 is considered a therapeutic option for the elimination of leukemia-initiating cells. However, the application of anti-panCD44 can be burdened by severe side effects. We determined whether these side effects could be avoided by replacing anti-panCD44 with CD44 variant isoform (CD44v)-specific antibodies in CD44v-positive hematological malignancies using the EL4 thymoma and CD44v10-transfected EL4 (EL4-v10) as models. Subcutaneous growth of EL4 and EL4-v10 was equally well inhibited by the anti-panCD44 and anti-CD44v10 antibodies, respectively. Ex vivo analysis indicated that natural killer cytotoxicity and antibody-dependent cellular cytotoxicity were the main effector mechanisms. Under local inflammation, the efficacy of anti-CD44v10 prolonged the survival time twofold compared with untreated, EL4-v10 tumor-bearing mice, and this was due to inflammation-induced expression of osteopontin (OPN). A high level of OPN in EL4-v10 tumors supported leukocyte recruitment and tumor-infiltrating T-cell activation. Taken together, in hematological malignancies expressing CD44v, anti-panCD44 can be replaced by CD44v-specific antibodies without a loss in efficacy. Furthermore, CD44v10-specific antibodies appear particularly advantageous in cutaneous leukemia therapy, as CD44v10 binding of OPN drives leukocyte recruitment and activation.
46 CFR 188.10-11 - Chemistry laboratory.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Chemistry laboratory. 188.10-11 Section 188.10-11 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) OCEANOGRAPHIC RESEARCH VESSELS GENERAL PROVISIONS Definition of Terms Used in This Subchapter § 188.10-11 Chemistry laboratory. This term includes...
50 CFR 10.22 - Law enforcement offices.
2010-10-01
... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Law enforcement offices. 10.22 Section 10... GENERAL PROVISIONS Addresses § 10.22 Law enforcement offices. Service law enforcement offices and their areas of responsibility follow. Mail should be addressed: “Assistant Regional Director, Division of Law...
46 CFR 56.04-10 - Other systems.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Other systems. 56.04-10 Section 56.04-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PIPING SYSTEMS AND APPURTENANCES Piping Classification § 56.04-10 Other systems. Piping systems and appurtenances not requiring plan...
42 CFR 54a.10 - Fiscal accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Fiscal accountability. 54a.10 Section 54a.10 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS CHARITABLE CHOICE... PREVENTION AND TREATMENT SERVICES § 54a.10 Fiscal accountability. (a) Religious organizations that receive...
46 CFR 249.10 - Non-discrimination policy.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Non-discrimination policy. 249.10 Section 249.10... OPERATORS APPROVAL OF UNDERWRITERS FOR MARINE HULL INSURANCE § 249.10 Non-discrimination policy. To administer effectively the policy regarding non-discrimination against U.S. insurers in other countries, as...
25 CFR 571.10 - Geographical location.
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false Geographical location. 571.10 Section 571.10 Indians NATIONAL INDIAN GAMING COMMISSION, DEPARTMENT OF THE INTERIOR COMPLIANCE AND ENFORCEMENT PROVISIONS MONITORING AND INVESTIGATIONS Subpoenas and Depositions § 571.10 Geographical location. The attendance of...
32 CFR 239.10 - Management Controls.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Management Controls. 239.10 Section 239.10...) MISCELLANEOUS HOMEOWNERS ASSISTANCE PROGRAM-APPLICATION PROCESSING § 239.10 Management Controls. (a). Management Systems. Headquarters, USACE has an existing information management system that manages all information...
46 CFR 194.10-30 - Magazine sprinklers.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Magazine sprinklers. 194.10-30 Section 194.10-30..., USE, AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-30 Magazine sprinklers... shall be installed in each magazine or magazine group. The control valve shall generally be in...
49 CFR 10.23 - Accounting of disclosures.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Accounting of disclosures. 10.23 Section 10.23... INDIVIDUALS Maintenance of Records § 10.23 Accounting of disclosures. Each operating administration, the... accurate accounting of: (1) The date, nature, and purpose of each disclosure of a record to any person or...
46 CFR 151.10-20 - Hull construction.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Hull construction. 151.10-20 Section 151.10-20 Shipping... BULK LIQUID HAZARDOUS MATERIAL CARGOES Barge Hull Construction Requirements § 151.10-20 Hull construction. (a) Construction features. (1) Each barge hull shall be constructed with a suitable bow form...
46 CFR 62.35-10 - Flooding safety.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Flooding safety. 62.35-10 Section 62.35-10 Shipping... Requirements for Specific Types of Automated Vital Systems § 62.35-10 Flooding safety. (a) Automatic bilge.... (b) Remote controls for flooding safety equipment must remain functional under flooding conditions to...
49 CFR 179.500-10 - Protective housing.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Protective housing. 179.500-10 Section 179.500-10...-10 Protective housing. (a) Safety devices, and loading and unloading valves on tanks shall be protected from accidental damage by approved metal housing, arranged so it may be readily opened to permit...
42 CFR 491.10 - Patient health records.
2010-10-01
... 42 Public Health 5 2010-10-01 2010-10-01 false Patient health records. 491.10 Section 491.10...: Conditions for Certification; and FQHCs Conditions for Coverage § 491.10 Patient health records. (a) Records... systematically organized. (3) For each patient receiving health care services, the clinic or center maintains a...
46 CFR 26.03-10 - Signaling light.
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Signaling light. 26.03-10 Section 26.03-10 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY UNINSPECTED VESSELS OPERATIONS Special Operating Requirements § 26.03-10 Signaling light. All vessels of over 150 gross tons, when engaged on an international...
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Appearances. 22.10 Section 22.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL CONSOLIDATED RULES OF PRACTICE GOVERNING... and ethics required of practitioners before the courts of the United States. ...
Hydrogen absorption kinetics and structural properties of Mg85Ni10Ca5 and Mg90Ni10
International Nuclear Information System (INIS)
Aoki, Masakazu; Saito, Katsushi; Towata, Shin-ichi
2005-01-01
Mg 85 Ni 10 Ca 5 and Mg 90 Ni 10 were prepared by melting mixtures of the elements in mild steel crucibles and pouring them into copper molds. Hydrogen absorption kinetics and structural properties of the alloys were characterized by the volumetric method using a Sievert's apparatus, X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The crystallite size of Mg in Mg 85 Ni 10 Ca 5 , which is evaluated by XRD peak broadening, is about 50% smaller than that in Mg 90 Ni 10 . In addition, the nanometer-scale structure composed of Mg, Mg 2 Ni, Mg 2 Ca was observed in Mg 85 Ni 10 Ca 5 . Mg 85 Ni 10 Ca 5 shows better hydrogen absorption kinetics than Mg 90 Ni 10 in the temperature range of room temperature to 573 K. The better absorption kinetics of Mg 85 Ni 10 Ca 5 is mainly attributed to the nanometer-scale structure
Permanent magnets prepared from Sm10.5Fe88.5Zr1.0Ny without homogenization
International Nuclear Information System (INIS)
Gebel, B.; Kubis, M.; Mueller, K.-H.
1997-01-01
In as-cast Sm 2 Fe 17 the high amount of α-Fe caused by a peritectic reaction can be considerably reduced by a small addition of about 1 at% Zr. X-ray diffraction showed that as-cast Sm 10.5 Fe 88.5 Zr 1.0 mainly consists of a phase with the Th 2 Zn 17 -type structure and SmFe 3 . Non-homogenized Sm 10.5 Fe 88.5 Zr 1.0 was milled and (i) annealed in vacuum or (ii) treated with a hydrogenation-disproportionation-desorp tion-recombination (HDDR) process. The annealed and subsequently nitrogenated powder is magnetically anisotropic and has a coercivity μ 0J H C up to 2.0 T and an energy product (BH) max up to 136 kJ/m 3 . HDDR-treated and nitrogenated powder is isotropic and exhibits values of μ 0J H C = 3.1 T and (BH) max 103 kJ/m 3 . Consequently, Sm 10.5 Fe 88.5 Zr 1.0 N y (y ∼ 16) permanent magnets with very good properties can be prepared without the time-consuming homogenization procedure. (orig.)
2010-04-01
... 26 Internal Revenue 1 2010-04-01 2010-04-01 true [Reserved] 1.46-10 Section 1.46-10 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY INCOME TAX INCOME TAXES Rules for Computing Credit for Investment in Certain Depreciable Property § 1.46-10 [Reserved] ...
40 CFR 258.10 - Airport safety.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Airport safety. 258.10 Section 258.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES CRITERIA FOR MUNICIPAL SOLID WASTE LANDFILLS Location Restrictions § 258.10 Airport safety. (a) Owners or operators of new...
5 CFR 10.2 - Accountability systems.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Accountability systems. 10.2 Section 10.2 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE RULES AGENCY ACCOUNTABILITY SYSTEMS; OPM AUTHORITY TO REVIEW PERSONNEL MANAGEMENT PROGRAMS (RULE X) § 10.2 Accountability systems. The Director of...
1 CFR 10.1 - Publication required.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Publication required. 10.1 Section 10.1 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER SPECIAL EDITIONS OF THE FEDERAL REGISTER PRESIDENTIAL PAPERS Regular Publication § 10.1 Publication required. The Director publishes a special edition...
38 CFR 4.10 - Functional impairment.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 1 2010-07-01 2010-07-01 false Functional impairment. 4.10 Section 4.10 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS SCHEDULE FOR RATING DISABILITIES General Policy in Rating § 4.10 Functional impairment. The basis of disability...
21 CFR 1020.10 - Television receivers.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Television receivers. 1020.10 Section 1020.10 Food...) RADIOLOGICAL HEALTH PERFORMANCE STANDARDS FOR IONIZING RADIATION EMITTING PRODUCTS § 1020.10 Television receivers. (a) Applicability. The provisions of this section are applicable to television receivers...
49 CFR 10.29 - Social Security numbers.
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false Social Security numbers. 10.29 Section 10.29... INDIVIDUALS Maintenance of Records § 10.29 Social Security numbers. (a) No individual is denied any right... which is required by Federal statute; or (2) The disclosure of a Social Security number when such...
46 CFR 59.10-30 - Seal welding.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Seal welding. 59.10-30 Section 59.10-30 Shipping COAST... VESSELS AND APPURTENANCES Welding Repairs to Boilers and Pressure Vessels in -Service § 59.10-30 Seal welding. Where leaks occur in riveted joints or connections, they shall be carefully investigated to...
45 CFR 1622.10 - Report to Congress.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Report to Congress. 1622.10 Section 1622.10 Public... MEETINGS UNDER THE GOVERNMENT IN THE SUNSHINE ACT § 1622.10 Report to Congress. The Corporation shall report to the Congress annually regarding its compliance with the requirements of the Government in the...
50 CFR 85.10 - Purpose and scope.
2010-10-01
...) FINANCIAL ASSISTANCE-WILDLIFE SPORT FISH RESTORATION PROGRAM CLEAN VESSEL ACT GRANT PROGRAM General § 85.10 Purpose and scope. The purpose of this part is to establish requirements for state participation in the... 50 Wildlife and Fisheries 6 2010-10-01 2010-10-01 false Purpose and scope. 85.10 Section 85.10...
African Journals Online (AJOL)
chifaou.amzat
2011-08-10
Aug 10, 2011 ... and using the security of being anonymous, if one desired, provided by this ..... The Arabic Cyber-Counselor Section was the first media outlet in ... the states, followed by institutions and the biggest international companies.
Energy Technology Data Exchange (ETDEWEB)
Mehnke, Frank; Stellmach, Joachim; Frentrup, Martin; Kusch, Gunnar; Wernicke, Tim; Pristovsek, Markus; Kneissl, Michael [Technische Universitaet Berlin, Institut fuer Festkoerperphysik, Hardenbergstr. 36, 10623 Berlin (Germany)
2011-07-01
The energy gap of AlGaN varies between 3.4 eV and 6.2 eV and allows light emitting diodes (LED) in the ultraviolet spectral region. The authors studied semipolar (11 anti 22) AlGaN layers that were deposited on (10 anti 10) m-plane sapphire using MOVPE (metalorganic vapor phase epitaxy) without nucleation layer with a substrate temperature below 1100 C in H2 atmosphere. The layers are preferably (11 anti 22) oriented. The sample show a surface roughness between 15 and 2 nm. The Al content of the smoothest samples is about 60% determined by transmission experiments. Below 60% Al content a triangular morphology was observed, the opening angle increased with decreasing Al content. The absorption edge was 0.05 eV (GaN) to 0.35 eV (AlN) below the band edge of (0001) oriented AlGaN layers. Further investigations of semipolar AlGaN layers to study the applicability for UV LEDs are under preparation.
46 CFR 52.01-10 - Automatic controls.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Automatic controls. 52.01-10 Section 52.01-10 Shipping... Requirements § 52.01-10 Automatic controls. (a) Each main boiler must meet the special requirements for automatic safety controls in § 62.35-20(a)(1) of this chapter. (b) Each automatically controlled auxiliary...
46 CFR 76.10-3 - Water availability.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Water availability. 76.10-3 Section 76.10-3 Shipping... Fire Main System, Details § 76.10-3 Water availability. (a) On all vessels on an international voyage, regardless of the date of construction, water pressure from the firemain protecting enclosed spaces shall be...
46 CFR 61.30-10 - Hydrostatic test.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Hydrostatic test. 61.30-10 Section 61.30-10 Shipping... INSPECTIONS Tests and Inspections of Fired Thermal Fluid Heaters § 61.30-10 Hydrostatic test. All new installations of thermal fluid heaters must be given a hydrostatic test of 11/2 times the maximum allowable...
46 CFR 188.10-3 - Approved container.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Approved container. 188.10-3 Section 188.10-3 Shipping... PROVISIONS Definition of Terms Used in This Subchapter § 188.10-3 Approved container. This term means a container which is properly labeled, marked and approved by DOT for the commodity which it contains. [CGFR...
46 CFR 90.10-16 - Industrial vessel.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Industrial vessel. 90.10-16 Section 90.10-16 Shipping... PROVISIONS Definition of Terms Used in This Subchapter § 90.10-16 Industrial vessel. This term means every vessel which by reason of its special outfit, purpose, design, or function engages in certain industrial...
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false General. 1738.10 Section 1738.10 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF AGRICULTURE... provide funds, on a technology neutral basis, for the costs of construction, improvement, and acquisition...
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Application. 686.10 Section 686.10 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION TEACHER EDUCATION ASSISTANCE FOR COLLEGE AND HIGHER EDUCATION (TEACH) GRANT PROGRAM...
8 CFR 1003.10 - Immigration judges.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Immigration judges. 1003.10 Section 1003.10 Aliens and Nationality EXECUTIVE OFFICE FOR IMMIGRATION REVIEW, DEPARTMENT OF JUSTICE GENERAL PROVISIONS EXECUTIVE OFFICE FOR IMMIGRATION REVIEW Office of the Chief Immigration Judge § 1003.10 Immigration judges...
32 CFR 806.10 - Records management.
2010-07-01
... 32 National Defense 6 2010-07-01 2010-07-01 false Records management. 806.10 Section 806.10 National Defense Department of Defense (Continued) DEPARTMENT OF THE AIR FORCE ADMINISTRATION AIR FORCE FREEDOM OF INFORMATION ACT PROGRAM § 806.10 Records management. Keep records that were fully released for...
18 CFR 33.10 - Additional information.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Additional information. 33.10 Section 33.10 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION... § 33.10 Additional information. The Director of the Office of Energy Market Regulation, or his designee...
27 CFR 10.21 - Commercial bribery.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Commercial bribery. 10.21 Section 10.21 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS COMMERCIAL BRIBERY Commercial Bribery § 10.21 Commercial bribery. It is...
34 CFR 105.10 - Self-evaluation.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Self-evaluation. 105.10 Section 105.10 Education... DEPARTMENT OF EDUCATION § 105.10 Self-evaluation. (a) The Department shall, within one year of the effective... organizations representing individuals with handicaps to participate in the self-evaluation process by...
27 CFR 10.22 - Employee associations.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Employee associations. 10.22 Section 10.22 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS COMMERCIAL BRIBERY Commercial Bribery § 10.22 Employee associations. Gifts...
10 YEARS AFTER NATO MEMBERSHIP
DEFF Research Database (Denmark)
”10 years after NATO Membership. An Anniversary in the Shadow of a Crisis”, indeholder artikler fra politiske aktører, diplomater og forskere, der alle bidrog til til konferencen af samme navn, hvor den 10-året for baltisk medlemskab af NATO var omdrejningspunktet. Udover den danske...... forsvarsminister, er den estiske og litauiske forsvarsminister og NATO’s vicegeneralsekretær blandt bidragyderne. Konferencens formål var at fejre, inddrage og diskutere 10 års forsvarspolitisk NATO-samarbejde i Østersøområdet. Den internationale udvikling i Europa betød at konferencens dagsorden i stedet for kom...
Teach yourself visually Windows 10
McFedries, Paul
2015-01-01
Learn Windows 10 visually with step-by-step instructions Teach Yourself VISUALLY Windows 10 is the visual learner's guide to the latest Windows upgrade. Completely updated to cover all the latest features, this book walks you step-by-step through over 150 essential Windows tasks. Using full color screen shots and clear instruction, you'll learn your way around the interface, set up user accounts, play media files, download photos from your camera, go online, set up email, and much more. You'll even learn how to customize Windows 10 to suit the way you work best, troubleshoot and repair common
HTR-10 management information system
International Nuclear Information System (INIS)
Liu Ruoxiao; Wu Zhongwang; Xi Shuren
2000-01-01
The HTR-10 Management information system (REMIS) strengthens the managerial level and usage of the information of HTR-10, thereby enhances the ability and efficiency of the design and management work. REMIS is designed based on the Client/Server framework. Database management system is SQL Server 6.5 for NT, While the client side is developed by Borland C ++ Builder, and it is based on Windows 95/98. The network protocol is TCP/IP. REMIS collects date of the HTR-10 at four parameters: Reactor properties, Design parameters, Equipment properties Reactor system flow charts. Final discussing extended prospect of REMIS
Single phase semipolar (11 anti 22) GaN on (10 anti 10) sapphire
Energy Technology Data Exchange (ETDEWEB)
Ploch, S.; Stellmach, J.; Schwaner, T.; Frentrup, M.; Wernicke, T.; Pristovsek, M.; Kneissl, M. [Institute of Solid States Physics, (Germany); Park, J.B.; Niermann, T.; Lehmann, M. [Institute of Optics and Atomic Physics, TU Berlin, Hardenbergstr. 36, 10623 Berlin (Germany)
2011-07-01
InGaN quantum well based light emitters grown on (0001) GaN suffer from poor quantum efficiencies with increasing indium mole fraction due to strong polarization fields along the polar crystal orientation. This effect can be greatly reduced by growing on semi- and non-polar GaN orientations. Semipolar (11 anti 22) GaN layers were deposited by metalorganic vapour phase epitaxy on (10 anti 10) sapphire. After sapphire substrate nitridation at 1000 C, a GaN nucleation layer was deposited at high temperature, followed by the deposition of 1.5 nm thick GaN buffer layers. The samples show predominantly (11 anti 22) orientation with a small fraction of (10 anti 13) oriented domains. With increasing nitridation layer thickness the (10 anti 13) phase is suppressed leading to a very smooth surface morphology (rms roughness < 4nm). PL measurements show dominant basel plane stacking fault (BSF) I{sub 1} luminescence without any other defects. Transmission electron microscopy measurements reveal a high BSF density. The FWHM of the X-ray diffraction rocking curve measurements of the (1122) reflection decreases to 1193 arcsec and 739 arcsec along [1 anti 100] and [11 anti 23] respectively with increasing nucleation temperature. Using high temperature nucleation smooth and homogeneous (11 anti 22) phase GaN layers have been obtained.
46 CFR 113.10-9 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...
46 CFR 92.10-35 - Public spaces.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Public spaces. 92.10-35 Section 92.10-35 Shipping COAST... ARRANGEMENT Means of Escape § 92.10-35 Public spaces. (a) In all cases, public spaces having a deck area of... different corridors, rooms, or spaces to minimize the possibility of one incident blocking both exits. ...
46 CFR 190.10-35 - Public spaces.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Public spaces. 190.10-35 Section 190.10-35 Shipping... ARRANGEMENT Means of Escape § 190.10-35 Public spaces. (a) In all cases, public spaces having a deck area of... different corridors, rooms, or spaces to minimize the possibility of one incident blocking both exits. ...
46 CFR 72.10-35 - Public spaces.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Public spaces. 72.10-35 Section 72.10-35 Shipping COAST... of Escape § 72.10-35 Public spaces. (a) In all cases, public spaces having a deck area of over 300... corridors, rooms, or spaces to minimize the possibility of one incident blocking both exits. (b) [Reserved] ...
46 CFR 190.25-10 - Storm rails.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Storm rails. 190.25-10 Section 190.25-10 Shipping COAST... ARRANGEMENT Rails and Guards § 190.25-10 Storm rails. (a) On vessels in ocean and coastwise service, suitable storm rails shall be installed in all passageways and at the deckhouse sides where persons on board...
46 CFR 72.40-10 - Storm rails.
2010-10-01
... 46 Shipping 3 2010-10-01 2010-10-01 false Storm rails. 72.40-10 Section 72.40-10 Shipping COAST... and Guards § 72.40-10 Storm rails. (a) Suitable storm rails shall be installed in all passageways and at the deckhouse sides where passengers or crew might have normal access. Storm rails shall be...
46 CFR 92.25-10 - Storm rails.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Storm rails. 92.25-10 Section 92.25-10 Shipping COAST... ARRANGEMENT Rails and Guards § 92.25-10 Storm rails. (a) On vessels in ocean and coastwise service, suitable storm rails shall be installed in all passageways and at the deckhouse sides where persons on board...
Xuan, Jinsong; Yao, Hongwei; Feng, Yingang; Wang, Jinfeng
2017-10-01
The Sac10b family proteins, also named as Alba, are small, basic, nucleic acid-binding proteins widely distributed in archaea. They possess divergent physiological functions such as binding to both DNA and RNA with a high affinity and involving in genomic DNA compaction, RNA transactions and transcriptional regulations. The structures of many Sac10b family proteins from hyperthermophilic archaea have been reported, while those from thermophilic and mesophilic archaea are largely unknown. As was pointed out, the homologous members from thermophilic and mesophilic archaea may have functions different from the hyperthermophilic members. Therefore, comparison of these homologous members can provide biophysical and structural insight into the functional diversity and thermal adaptation mechanism. The present work mainly focused on the NMR study of two Sac10b family members, Mvo10b and Mth10b, from the mesophilic and thermophilic archaea, respectively. To overcome the difficulties caused by the oligomerization and conformation heterogeneity of Mth10b, a M13T/L17Q/I20Q/P56A mutant Mth10b (Mth10bTQQA) was constructed and used together with Mvo10b for multi-dimensional NMR experiments. The resonance assignments of Mvo10b and Mth10bTQQA are reported for further structural determination which is a basis for understanding the functional diversity and their thermal adaption mechanisms.
DOI: 10.18697/ajfand.76.15720 11310 DOI: 10.18697/ajfand ...
African Journals Online (AJOL)
Alice
WILD FOOD PLANTS USED BY PEOPLE LIVING WITH HIV/AIDS IN. NAKISUNGA ... P.O. Box 7062, Kampala, Uganda ... HIV/AIDS (PLWHA) because of their presumed nutrition and health benefits. Despite exploitation ...... 1983; 10: 205-210.
30 CFR 746.10 - Information collection.
2010-07-01
... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Information collection. 746.10 Section 746.10... LANDS PROGRAM REVIEW AND APPROVAL OF MINING PLANS § 746.10 Information collection. The information... U.S.C. 3507 and assigned clearance number 1029-0026. The information is being collected to determine...
41 CFR 51-10.102 - Application.
2010-07-01
... 41 Public Contracts and Property Management 1 2010-07-01 2010-07-01 true Application. 51-10.102 Section 51-10.102 Public Contracts and Property Management Other Provisions Relating to Public Contracts... WHO ARE BLIND OR SEVERELY DISABLED § 51-10.102 Application. This part applies to all programs or...
7 CFR 277.10 - Program income.
2010-01-01
... 7 Agriculture 4 2010-01-01 2010-01-01 false Program income. 277.10 Section 277.10 Agriculture... § 277.10 Program income. (a) Program income is gross income resulting from activities financed with program funds. Such earnings exclude interest income but include income from service fees, usage or rental...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Loan amounts. 201.10 Section 201.10... MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER AUTHORITIES TITLE I PROPERTY IMPROVEMENT AND MANUFACTURED HOME LOANS Loan and Note Provisions § 201.10 Loan amounts. (a) Property...
34 CFR 32.10 - Deductions process.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Deductions process. 32.10 Section 32.10 Education Office of the Secretary, Department of Education SALARY OFFSET TO RECOVER OVERPAYMENTS OF PAY OR ALLOWANCES FROM DEPARTMENT OF EDUCATION EMPLOYEES § 32.10 Deductions process. (a) Debts must be collected in...
19 CFR 10.101 - Immediate delivery.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Immediate delivery. 10.101 Section 10.101 Customs... Importations § 10.101 Immediate delivery. (a) Shipments entitled to immediate delivery. Shipments consigned to... as shipments the immediate delivery of which is necessary within the purview of section 448(b...
9 CFR 441.10 - Retained water.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Retained water. 441.10 Section 441.10... STANDARDS: RAW PRODUCTS § 441.10 Retained water. (a) Raw livestock and poultry carcasses and parts will not be permitted to retain water resulting from post-evisceration processing unless the establishment...
Hu, Qing-Ping; Cao, Xin-Ming; Hao, Dong-Lin; Zhang, Liang-Liang
2017-01-01
Cyperus rotundus L. (Cyperaceae) is a medicinal herb traditionally used to treat various clinical conditions at home. In this study, chemical composition of Cyperus rotundus rhizomes essential oil, and in vitro antioxidant, DNA damage protective and cytotoxic activities as well as antibacterial activity against foodborne pathogens were investigated. Results showed that α-cyperone (38.46%), cyperene (12.84%) and α-selinene (11.66%) were the major components of the essential oil. The essential oil had an excellent antioxidant activity, the protective effect against DNA damage, and cytotoxic effects on the human neuroblastoma SH-SY5Y cell, as well as antibacterial activity against several foodborne pathogens. These biological activities were dose-dependent, increasing with higher dosage in a certain concentration range. The antibacterial effects of essential oil were greater against Gram-positive bacteria as compared to Gram-negative bacteria, and the antibacterial effects were significantly influenced by incubation time and concentration. These results may provide biological evidence for the practical application of the C. rotundus rhizomes essential oil in food and pharmaceutical industries. PMID:28338066
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Purpose. 524.10 Section 524.10 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE INMATE ADMISSION, CLASSIFICATION, AND TRANSFER... subpart is to explain the Bureau of Prisons (Bureau) process for classifying newly committed inmates and...
Biochemical Assessment of Coenzyme Q10 Deficiency
Directory of Open Access Journals (Sweden)
Juan Carlos Rodríguez-Aguilera
2017-03-01
Full Text Available Coenzyme Q10 (CoQ10 deficiency syndrome includes clinically heterogeneous mitochondrial diseases that show a variety of severe and debilitating symptoms. A multiprotein complex encoded by nuclear genes carries out CoQ10 biosynthesis. Mutations in any of these genes are responsible for the primary CoQ10 deficiency, but there are also different conditions that induce secondary CoQ10 deficiency including mitochondrial DNA (mtDNA depletion and mutations in genes involved in the fatty acid β-oxidation pathway. The diagnosis of CoQ10 deficiencies is determined by the decrease of its content in skeletal muscle and/or dermal skin fibroblasts. Dietary CoQ10 supplementation is the only available treatment for these deficiencies that require a rapid and distinct diagnosis. Here we review methods for determining CoQ10 content by HPLC separation and identification using alternative approaches including electrochemical detection and mass spectrometry. Also, we review procedures to determine the CoQ10 biosynthesis rate using labeled precursors.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Fuel oil. 58.01-10 Section 58.01-10 Shipping COAST GUARD... SYSTEMS General Requirements § 58.01-10 Fuel oil. (a) The following limits apply to the use of oil as fuel: (1) Except as otherwise permitted by this section, no fuel oil with a flashpoint of less than 60 °C...
31 CFR 10.64 - Answer; default.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Answer; default. 10.64 Section 10.64... SERVICE Rules Applicable to Disciplinary Proceedings § 10.64 Answer; default. (a) Filing. The respondent's... need be adduced at a hearing. (d) Default. Failure to file an answer within the time prescribed (or...
36 CFR 10.1 - Animals available.
2010-07-01
... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Animals available. 10.1 Section 10.1 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR DISPOSAL OF CERTAIN WILD ANIMALS § 10.1 Animals available. From time to time there are surplus live elk...
19 CFR 10.33 - Theatrical effects.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Theatrical effects. 10.33 Section 10.33 Customs... Under Bond § 10.33 Theatrical effects. For purposes of the entry of theatrical scenery, properties and... films. For provisions relating to the return without formal entry of theatrical effects taken from the...
22 CFR 120.10 - Technical data.
2010-04-01
... information in the public domain as defined in § 120.11. It also does not include basic marketing information... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Technical data. 120.10 Section 120.10 Foreign Relations DEPARTMENT OF STATE INTERNATIONAL TRAFFIC IN ARMS REGULATIONS PURPOSE AND DEFINITIONS § 120.10...
12 CFR 541.10 - Dwelling unit.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Dwelling unit. 541.10 Section 541.10 Banks and... FEDERAL SAVINGS ASSOCIATIONS § 541.10 Dwelling unit. The term dwelling unit means the unified combination of rooms designed for residential use by one family, other than a single-family dwelling. ...
Strength behaviour of 10CrMo9.10 steel in nonsteady-state applications
International Nuclear Information System (INIS)
Seidel, C.
2 testing runs with cyclic temperature increase were conducted on steel 10CrMo9.10 samples, i.e., at 500 degC and cyclic increase by 10, 25 and 50 degC, and at 550 degC and cyclic increase by 50 degC. Long-term strength was studied under a strain of 6.1 to 25.6 kp/mm 2 for 22,000 hours and the effect of periodical unloading was investigated on long-term strength at 550 degC. Sample loading and unloading proceeded within the range of 8.8 to 24.7 kp/mm 2 at an unloading rate of 8 to 100 %/min. Steel lifetime was not affected by the number of cycles. The effect of the changing load and of constant temperature without load on the long-term strength of the steel at 550 degC is shown graphically. The results showed a clear dependence of steel life on dwell time at the given temperature without load. (J.P.)
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority. 590.10 Section 590.10 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EGG PRODUCTS... Authority. The Administrator shall perform, for and under the supervision of the Secretary, such duties as...
Study of homogeneous fuel cells type 10 x 10
International Nuclear Information System (INIS)
Montes, J.L.; Perusquia, R.; Ortiz, J.J.; Francois, J.L.; Marquez, C.M.
2005-01-01
At the moment in the National Institute of Nuclear Research (ININ) are carried out studies with the purpose of to establish a methodology that allows to carry out the neutron design of fuel cells of type 10 x 10. During the initial stage of the process of cells design, starting from the data that have to do with the planned energy demand it requires to be estimated the average value of the enrichment in U 235 w/o of the one assemble. The experience has shown that the accuracy that is achieved in this estimate it depends, among other factors, of the information (e.g. concentrations of U 235 and Gd 2 O 3 ) of the cells that its are disposed in that moment. For what we consider convenient to enlarge the available information by means of a series of calculations of cell physics; and to the one same time some aspects can be studied on the parameters that define the characteristics of a fuel cell. In this work the effect of the presence of different distributions of the concentrations of the fissile material is analyzed and of burnup poisons on the reactivity parameters of the cell as well as in the peak factor of local power (LPPF-Local Power Peaking Factor). (Author)
25 CFR 213.10 - Lessor's signature.
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Lessor's signature. 213.10 Section 213.10 Indians BUREAU... MEMBERS OF FIVE CIVILIZED TRIBES, OKLAHOMA, FOR MINING How to Acquire Leases § 213.10 Lessor's signature... thumbprint which shall be designated as “right” or “left” thumbmark. Such signatures must be witnessed by two...
39 CFR 10.2 - Advisory service.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Advisory service. 10.2 Section 10.2 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.2 Advisory service. (a) The General Counsel is the Ethical...
31 CFR 10.8 - Customhouse brokers.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Customhouse brokers. 10.8 Section 10... REVENUE SERVICE Rules Governing Authority to Practice § 10.8 Customhouse brokers. Nothing contained in the regulations in this part will affect or limit the right of a customhouse broker, licensed as such by the...
International Nuclear Information System (INIS)
Rajoy, R R S; Dias, J W C; Rego, E C P; Netto, A D Pereira
2015-01-01
This paper presents the results of the determination of the concentrations of atmospheric particulate matter ≤ 10 μm (PM10), collected simultaneously by six PM10 high volume samplers from two different manufacturers installed in the same location. Fifteen samples of 24 h were obtained with each equipment at a selected urban area of Rio de Janeiro city. The concentration of PM10 ranged between 10.73 and 54.04 μg m −3 . The samplers were considered comparable to each other, as the adopted methodology presented good repeatability
The ETA10 supercomputer system
International Nuclear Information System (INIS)
Swanson, C.D.
1987-01-01
The ETA Systems, Inc. ETA 10 is a next-generation supercomputer featuring multiprocessing, a large hierarchical memory system, high performance input/output, and network support for both batch and interactive processing. Advanced technology used in the ETA 10 includes liquid nitrogen cooled CMOS logic with 20,000 gates per chip, a single printed circuit board for each CPU, and high density static and dynamics MOS memory chips. Software for the ETA 10 includes an underlying kernel that supports multiple user environments, a new ETA FORTRAN compiler with an advanced automatic vectorizer, a multitasking library and debugging tools. Possible developments for future supercomputers from ETA Systems are discussed. (orig.)
2010-01-01
... 15 Commerce and Foreign Trade 2 2010-01-01 2010-01-01 false Discovery. 719.10 Section 719.10... Discovery. (a) General. The parties are encouraged to engage in voluntary discovery regarding any matter... the Federal Rules of Civil Procedure relating to discovery apply to the extent consistent with this...
32 CFR 705.10 - Still photography.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Still photography. 705.10 Section 705.10 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY UNITED STATES NAVY REGULATIONS AND OFFICIAL RECORDS PUBLIC AFFAIRS REGULATIONS § 705.10 Still photography. (a) Policy and procedures on taking photos by the general public, given in ...
Europeans build 10-GigE network
2003-01-01
" CERN, SURFnet and the University of Amsterdam announced that they have succeeded in building and testing a Trans European 10 Gbps Ethernet (10 GE) network. Crossing four countries and spanning 1700 km, the network uses the new 10 GE WAN PHY transmission technology capable of transmitting the equivalent of 1.5 complete data CDs every second" (1 page).
Beryllium-10: Half-life and AMS-standards
International Nuclear Information System (INIS)
Hofmann, H.J.; Beer, J.; Bonani, G.; von Gunten, H.R.; Raman, S.; Suter, M.; Walker, R.L.; Woelfli, W.; Zimmermann, D.
1987-01-01
Absolute AMS measurements of 10 Be require reliable standards for calibration. Among the existing standards, rather large differences have been observed. These differences were found partially to be due to the different half-life values which were assumed. Also for comparison of AMS data with activity measurements, it is necessary to know the 10 Be half-life as precisely as possible. Starting with 5 ml of the standardized ORNL-MASTER solution, a working solution with a well-defined 10 Be content was prepared. Its specific activity was determined by liquid scintillation counting. This measurement yielded a new value of (1.52 +- 0.05) My for the 10 Be half-life, which is in agreement with the previously reported values but is about three times more accurate. Two independent dilution series produced new AMS standards with 10 Be/ 9 Be ratios of the order of 10 -10 and 10 -11 . These standards were measured at the ETH/SIN AMS facility with high accuracy and are compared with other available 10 Be standards. 15 refs, 2 figs., 3 tabs
Bernardi, Giacomo
2012-09-01
The Genome 10K project aims to sequence the genomes of 10,000 vertebrates, representing approximately one genome for each vertebrate genus. Since fishes (cartilaginous fishes, ray-finned fishes and lobe-finned fishes) represent more than 50% of extant vertebrates, it is planned to target 4,000 fish genomes. At present, nearly 60 fish genomes are being sequenced at various public funded labs, and under a Genome 10K and BGI pilot project. An additional 100 fishes have been identified for sequencing in the next phase of Genome 10K project. © 2012 Elsevier B.V.
Bernardi, Giacomo; Wiley, Edward O.; Mansour, Hicham; Miller, Michael R.; Ortí , Guillermo; Haussler, David H.; O'Brien, Stephen J O; Ryder, Oliver A.; Venkatesh, Byrappa
2012-01-01
The Genome 10K project aims to sequence the genomes of 10,000 vertebrates, representing approximately one genome for each vertebrate genus. Since fishes (cartilaginous fishes, ray-finned fishes and lobe-finned fishes) represent more than 50% of extant vertebrates, it is planned to target 4,000 fish genomes. At present, nearly 60 fish genomes are being sequenced at various public funded labs, and under a Genome 10K and BGI pilot project. An additional 100 fishes have been identified for sequencing in the next phase of Genome 10K project. © 2012 Elsevier B.V.
International Nuclear Information System (INIS)
Lopez, J B Gonzalez; Avilés, A; Baron, T; Ferreira, P; Kolobara, B; Pugh, M A; Resco, A; Trzaskoma, J P
2014-01-01
Indico has evolved into the main event organization software, room booking tool and collaboration hub for CERN. The growth in its usage has only accelerated during the past 9 years, and today Indico holds more that 215,000 events and 1,100,000 files. The growth was also substantial in terms of functionalities and improvements. In the last year alone, Indico has matured considerably in 3 key areas: enhanced usability, optimized performance and additional features, especially those related to meeting collaboration. Along the course of 2012, much activity has centred around consolidating all this effort and investment into 'version 1.0', recently released in 2013.Version 1.0 brings along new features, such as the Microsoft Exchange calendar synchronization for participants, many new and clean interfaces (badges and poster generation, list of contributions, abstracts, etc) and so forth. But most importantly, it brings a message: Indico is now stable, consolidated and mature after more than 10 years of non-stop development. This message is addressed not only to CERN users but also to the many organisations, in or outside HEP, which have already installed the software, and to others who might soon join this community. In this document, we describe the current state of the art of Indico, and how it was built. This does not mean that the Indico software is complete, far from it! We have plenty of new ideas and projects that we are working on and which we have shared during CHEP 2013.
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Fires. 327.10 Section 327.10... Fires. (a) Gasoline and other fuels, except that which is contained in storage tanks of vehicles... onto or stored on the project without written permission of the District Commander. (b) Fires shall be...
Directory of Open Access Journals (Sweden)
Sumit Bhattacharyya
2013-01-01
Full Text Available The common food additive carrageenan is a known activator of inflammation in mammalian tissues and stimulates both the canonical and noncanonical pathways of NF-κB activation. Exposure to low concentrations of carrageenan (10 μg/mL in the water supply has produced glucose intolerance, insulin resistance, and impaired insulin signaling in C57BL/6 mice. B-cell leukemia/lymphoma 10 (Bcl10 is a mediator of inflammatory signals from Toll-like receptor (TLR 4 in myeloid and epithelial cells. Since the TLR4 signaling pathway is activated in diabetes and by carrageenan, we addressed systemic and intestinal inflammatory responses following carrageenan exposure in Bcl10 wild type, heterozygous, and null mice. Fecal calprotectin and circulating keratinocyte chemokine (KC, nuclear RelA and RelB, phospho(Thr559-NF-κB-inducing kinase (NIK, and phospho(Ser36-IκBα in the colonic epithelial cells were significantly less (P<0.001 in the carrageenan-treated Bcl10 null mice than in controls. IL-10-deficient mice exposed to carrageenan in a germ-free environment showed an increase in activation of the canonical pathway of NF-κB (RelA activation, but without increase in RelB or phospho-Bcl10, and exogenous IL-10 inhibited only the canonical pathway of NF-κB activation in cultured colonic cells. These findings demonstrate a Bcl10 requirement for maximum development of carrageenan-induced inflammation and lack of complete suppression by IL-10 of carrageenan-induced inflammation.
Volume 10 No. 10 October 2010 4219 YIELD ANALYSIS AT A ...
African Journals Online (AJOL)
user
2010-10-10
Oct 10, 2010 ... with bird batches from four different growers, namely farms A, B, C and D in order to make broader ... old broiler chicks sales were published by the Central Statistical Office (CSO), .... sustainable plan on utilization of feathers.
Shrestha, Sadeep; Wiener, Howard W; Aissani, Brahim; Song, Wei; Shendre, Aditi; Wilson, Craig M; Kaslow, Richard A; Tang, Jianming
2010-10-14
Immunological and clinical outcomes can vary considerably at the individual and population levels during both treated and untreated HIV-1 infection. Cytokines encoded by the interleukin-10 gene (IL10) family have broad immunomodulatory function in viral persistence, and several SNPs in the IL10 promoter sequence have been reported to influence pathogenesis or acquisition of HIV-1 infection. We examined 104 informative SNPs in IL10, IL19, IL20, IL24, IL10RA and IL10RB among 250 HIV-1 seropositive and 106 high-risk seronegative African American adolescents in the REACH cohort. In subsequent evaluation of five different immunological and virological outcomes related to HIV-1 infection, 25 SNPs were associated with a single outcome and three were associated with two different outcomes. One SNP, rs2243191 in the IL19 open reading frame (Ser to Phe substitution) was associated with CD4(+) T-cell increase during treatment. Another SNP rs2244305 in IL10RB (in strong linkage disequilibrium with rs443498) was associated with an initial decrease in CD4(+) T-cell by 23 ± 9% and 29 ± 9% every 3 months (for AA and AG genotypes, respectively, compared with GG) during ART-free period. These associations were reversed during treatment, as CD4(+) T-cell increased by 31 ± 0.9% and 17 ± 8% every 3 months for AA and AG genotype, respectively. In African Americans, variants in IL10 and related genes might influence multiple outcomes of HIV-1 infection, especially immunological response to HAART. Fine mapping coupled with analysis of gene expression and function should help reveal the immunological importance of the IL10 gene family to HIV-1/AIDS.
Blanco, Vanessa; Guisande, María Adelina; Sánchez, María Teresa; Otero, Patricia; Vázquez, Fernando L
2017-11-08
Despite the importance of resilience in populations under stress, and the fact that the 10-item version Connor-Davidson Resilience Scale (CD-RISC 10) is the shortest instrument for reliable and valid evaluation of resilience, there are no data on their psychometric properties in non-professional caregivers. The aim of this study was to analyze the psychometric properties and factorial structure of the spanish version of the CD-RISC 10 in non-professional caregivers. Independently trained assessors evaluated resilience, self-esteem, social support, emotional distress and depression in a sample of 294 caregivers (89.8% women, mean age 55.3 years). The internal consistency of CD-RISC 10 was α = .86. A single factor was found that accounted for 44.7% of the total variance. Confirmatory factor analysis corroborated this unifactorial model. The CD-RISC 10 was significantly correlated with the self-esteem (r = .416, p caregivers with depression (sensitivity = 70.0%, specificity = 68.2%). The CD-RISC 10 is a reliable and valid instrument to evaluate resilience in the caregiver population.
45 CFR 1226.10 - Hatch Act restrictions.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Hatch Act restrictions. 1226.10 Section 1226.10 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY... candidates on canvassing or speaking tours. (12) Participation in or organizing a political parade. (13...
10 CFR 503.31 - Lack of alternate fuel supply for the first 10 years of useful life.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Lack of alternate fuel supply for the first 10 years of useful life. 503.31 Section 503.31 Energy DEPARTMENT OF ENERGY (CONTINUED) ALTERNATE FUELS NEW FACILITIES Permanent Exemptions for New Facilities § 503.31 Lack of alternate fuel supply for the first 10 years of...
Montfort, Nick
2001-01-01
Argues that not every disappearing technology deserves that fate and presents 10 technologies that have an elegance and simplicity the winners lack such as the electric trolley, pneumatic post, Amiga, ribbon microphone, WordStar, Edison's wax cylinder, slide rule, reel mover, automatic watch, and airship. (Author/ASK)
50 CFR 228.10 - Ex parte communications.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Ex parte communications. 228.10 Section... ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS NOTICE AND HEARING ON SECTION 103(d) REGULATIONS § 228.10 Ex parte communications. (a) After notice of a hearing is published in the Federal Register, all...
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Taxation. 352.10 Section 352.10 Money... Taxation. The interest paid on Series HH bonds is subject to all taxes imposed under the Internal Revenue..., whether Federal or State, but are exempt from all taxation now or hereafter imposed on the principal or...
2010-04-01
... a claim that a good is entitled to the duty rate applicable under the US-JFTA; (b) Customs authority. “Customs authority” means the competent authority that is responsible under the law of a country for the... 19 Customs Duties 1 2010-04-01 2010-04-01 false Definitions. 10.702 Section 10.702 Customs Duties...
Supersymmetric SO(10) models inspired by deconstruction
International Nuclear Information System (INIS)
Huang Chaoshang; Jiang Jing; Li Tianjun
2004-01-01
We consider 4-dimensional N=1 supersymmetric SO(10) models inspired by deconstruction of 5-dimensional N=1 supersymmetric orbifold SO(10) models and high-dimensional non-supersymmetric SO(10) models with Wilson line gauge symmetry breaking. We discuss the SO(10)xSO(10) models with bi-fundamental link fields where the gauge symmetry can be broken down to the Pati-Salam, SU(5)xU(1), flipped SU(5)xU(1)' or the Standard Model like gauge symmetry. We also propose an SO(10)xSO(6)xSO(4) model with bi-fundamental link fields where the gauge symmetry is broken down to the Pati-Salam gauge symmetry, and an SO(10)xSO(10) model with bi-spinor link fields where the gauge symmetry is broken down to the flipped SU(5)xU(1)' gauge symmetry. In these two models, the Pati-Salam and flipped SU(5)xU(1)' gauge symmetry can be further broken down to the Standard Model gauge symmetry, the doublet-triplet splittings can be obtained by the missing partner mechanism, and the proton decay problem can be solved. We also study the gauge coupling unification. We briefly comment on the interesting variation models with gauge groups SO(10)xSO(6) and SO(10)xflippedSU(5)xU(1)' in which the proton decay problem can be solved
Directory of Open Access Journals (Sweden)
Elpawati Elpawati
2016-03-01
Full Text Available This research is aimed to determine the effect of growing media composition, the addition different concentration of EM10 fertilizer, and interaction between the composition of the growing media with different concentration of EM10 fertilizer on Zea mays growth and productivity. This research was conducted in Home Composting of UIN Syarif Hidayatullah Jakarta from June until October 2013. This study used Random Grouped for Factorial Design 2 x 5 wth 3 repetitions. First factor was plant media dose (M, consist of two extents, M1 (compost:soil = 1:1 and M2 (compost:soil = 1:2. The second factor was fertilizer concentration (D, consist of five extents, DO (no fertilizer,D1 (Urea: 0,9 g, SP-36: 0,9 g, KCl: 0,45 g, D2 (10 ml EM10, D3 (15 ml EM10, and D4 (20 ml EM10. The obtained data was analyzed using Analysis of Varians(ANOVA and Duncan test when there is a significant difference..The result showed plant media (M2 with ratio composition of compost and soil was 1:2 could increase the stem diameter at harvest time. 20 ml concentration of EM10 could increase the stem diameter’s growth (2.29 mm at harvest time, similarly 15 ml EM10 could increase the cob’s productivity (1.66 cobs. The interaction of composition plant media and fertilizer concentration of EM10 did not influence corn’s growth and productivity.
Deng, Youping; Bhattacharya, Sujoy; Swamy, O Rama; Tandon, Ruchi; Wang, Yong; Janda, Robert; Riedel, Heimo
2003-10-10
The regulation of the metabolic insulin response by mouse growth factor receptor-binding protein 10 (Grb10) has been addressed in this report. We find mouse Grb10 to be a critical component of the insulin receptor (IR) signaling complex that provides a functional link between IR and p85 phosphatidylinositol (PI) 3-kinase and regulates PI 3-kinase activity. This regulatory mechanism parallels the established link between IR and p85 via insulin receptor substrate (IRS) proteins. A direct association was demonstrated between Grb10 and p85 but was not observed between Grb10 and IRS proteins. In addition, no effect of mouse Grb10 was observed on the association between IRS-1 and p85, on IRS-1-associated PI 3-kinase activity, or on insulin-mediated activation of IR or IRS proteins. A critical role of mouse Grb10 was observed in the regulation of PI 3-kinase activity and the resulting metabolic insulin response. Dominant-negative Grb10 domains, in particular the SH2 domain, eliminated the metabolic response to insulin in differentiated 3T3-L1 adipocytes. This was consistently observed for glycogen synthesis, glucose and amino acid transport, and lipogenesis. In parallel, the same metabolic responses were substantially elevated by increased levels of Grb10. A similar role of Grb10 was confirmed in mouse L6 cells. In addition to the SH2 domain, the Pro-rich amino-terminal region of Grb10 was implicated in the regulation of PI 3-kinase catalytic activity. These regulatory roles of Grb10 were extended to specific insulin mediators downstream of PI 3-kinase including PKB/Akt, glycogen synthase kinase, and glycogen synthase. In contrast, a regulatory role of Grb10 in parallel insulin response pathways including p70 S6 kinase, ubiquitin ligase Cbl, or mitogen-activated protein kinase p38 was not observed. The dissection of the interaction of mouse Grb10 with p85 and the resulting regulation of PI 3-kinase activity should help elucidate the complexity of the IR signaling
Massive type IIA supergravity and E10
International Nuclear Information System (INIS)
Henneaux, M.; Kleinschmidt, A.; Persson, D.; Jamsin, E.
2009-01-01
In this talk we investigate the symmetry under E 10 of Romans' massive type IIA supergravity. We show that the dynamics of a spinning particle in a non-linear sigma model on the coset space E 10 /K(E 10 ) reproduces the bosonic and fermionic dynamics of massive IIA supergravity, in the standard truncation. In particular, we identify Romans' mass with a generator of E 10 that is beyond the realm of the generators of E 10 considered in the eleven-dimensional analysis, but using the same, underformed sigma model. As a consequence, this work provides a dynamical unification of the massless and massive versions of type IIA supergravity inside E 10 . (Abstract Copyright [2009], Wiley Periodicals, Inc.)
19 CFR 10.153 - Conditions for exemption.
2010-04-01
... over $200 and Bona Fide Gifts § 10.153 Conditions for exemption. Customs officers shall be further... § 10.151 or § 10.152: (a) A “bona fide gift” for purposes of § 10.152 is an article formerly owned by a... promise of compensation. It does not include articles acquired by purchase, barter, promissory exchange...
Chromosome 10q tetrasomy: First reported case
Energy Technology Data Exchange (ETDEWEB)
Blackston, R.D.; May, K.M.; Jones, F.D. [Emory Univ., Atlanta, GA (United States)] [and others
1994-09-01
While there are several reports of trisomy 10q (at least 35), we are not aware of previous cases of 10q tetrasomy. We present what we believe to be the initial report of such a case. R.J. is a 6 1/2 year old white male who presented with multiple dysmorphic features, marked articulation problems, hyperactivity, and developmental delays. He is the product of a term uncomplicated pregnancy. There was a normal spontaneous vaginal delivery with a birth weight of 6 lbs. 4oz. and length was 19 1/2 inch. Dysmorphic features include small size, an asymmetrically small head, low set ears with overfolded helixes, bilateral ptosis, downslanting eyes, right eye esotropia, prominent nose, asymmetric facies, high palate, mild pectus excavatum deformity of chest, and hyperextensible elbow joints. The patient is in special needs classes for mildly mentally handicapped students. Chromosome analysis at a resolution of 800 bands revealed a complex rearrangement of chromosomes 10 and 11. The segment 10q25.3 to q16.3 appears to be inverted and duplicated within the long arm of chromosome 10 at band q25.3 and the same segment of chromosome 10 is present on the terminal end of the short arm of chromosome 11. There is no visible loss of material from chromosome 11. Fluorescence in situ hybridization was performed with a chromosome 10 specific {open_quotes}paint{close_quotes} to confirm that all of the material on the abnormal 10 and the material on the terminal short arm of 11 was from chromosome 10. Thus, it appears that the segment 10q25.3 to q26.3 is present in four copies. Parental chromosome studies are normal. We compared findings which differ in that the case of 10q tetrasomy did not have prenatal growth deficiency, microphthalmia, cleft palate, digital anomalies, heart, or renal defects. Whereas most cases of 10q trisomy are said to have severe mental deficiency, our case of 10q tetrasomy was only mildly delayed. We report this first apparent cited case of 10q tetrasomy.
LX-10 Explosive Damage Studies
2015-03-03
opposite end of the vessel. The inside of the bomb is fitted with a stainless steel liner to protect the inner surface and to change the bomb...19 18. Size Fractions for Spherical LX-10 Samples Impact Damaged Between 312 and 416 ft/s...19 19. Spherical LX-10 Sample Impact Damaged at 416 ft/s ....................................... 20 20
Trang, N. Ha; Tripathi, N. K.
2014-11-01
Every year, during dry season, Chiang Mai and other northern provinces of Thailand face the problem of haze which is mainly generated by the burning of agricultural waste and forest fire, contained high percentage of particulate matter. Particulate matter 10 (PM10), being very small in size, can be inhaled easily to the deepest parts of the human lung and throat respiratory functions. Due to this, it increases the risk of respiratory diseases mainly in the case of continuous exposure to this seasonal smog. MODIS aerosol images (MOD04) have been used for four weeks in March 2007 for generating the hazard map by linking to in-situ values of PM10. Simple linear regression model between PM10 and AOD got fair correlation with R2 = 0.7 and was applied to transform PM10 pattern. The hazard maps showed the dominance of PM10 in northern part of Chiang Mai, especially in second week of March when PM10 level was three to four times higher than standard. The respiratory disease records and public health station of each village were collected from Provincial Public Health Department in Chiang Mai province. There are about 300 public health stations out of 2070 villages; hence thiessen polygon was created to determine the representative area of each public health station. Within each thiessen polygon, respiratory disease incident rate (RDIR) was calculated based on the number of patients and population. Global Moran's I was computed for RDIR to explore spatial pattern of diseases through four weeks of March. Moran's I index depicted a cluster pattern of respiratory diseases in 2nd week than other weeks. That made sense for a relationship between PM10 and respiratory diseases infections. In order to examine how PM10 affect the human respiratory system, geographically weighted regression model was used to observe local correlation coefficient between RDIR and PM10 across study area. The result captured a high correlation between respiratory diseases and high level of PM10 in
Leveraging the NLM map from SNOMED CT to ICD-10-CM to facilitate adoption of ICD-10-CM.
Cartagena, F Phil; Schaeffer, Molly; Rifai, Dorothy; Doroshenko, Victoria; Goldberg, Howard S
2015-05-01
Develop and test web services to retrieve and identify the most precise ICD-10-CM code(s) for a given clinical encounter. Facilitate creation of user interfaces that 1) provide an initial shortlist of candidate codes, ideally visible on a single screen; and 2) enable code refinement. To satisfy our high-level use cases, the analysis and design process involved reviewing available maps and crosswalks, designing the rule adjudication framework, determining necessary metadata, retrieving related codes, and iteratively improving the code refinement algorithm. The Partners ICD-10-CM Search and Mapping Services (PI-10 Services) are SOAP web services written using Microsoft's.NET 4.0 Framework, Windows Communications Framework, and SQL Server 2012. The services cover 96% of the Partners problem list subset of SNOMED CT codes that map to ICD-10-CM codes and can return up to 76% of the 69,823 billable ICD-10-CM codes prior to creation of custom mapping rules. We consider ways to increase 1) the coverage ratio of the Partners problem list subset of SNOMED CT codes and 2) the upper bound of returnable ICD-10-CM codes by creating custom mapping rules. Future work will investigate the utility of the transitive closure of SNOMED CT codes and other methods to assist in custom rule creation and, ultimately, to provide more complete coverage of ICD-10-CM codes. ICD-10-CM will be easier for clinicians to manage if applications display short lists of candidate codes from which clinicians can subsequently select a code for further refinement. The PI-10 Services support ICD-10 migration by implementing this paradigm and enabling users to consistently and accurately find the best ICD-10-CM code(s) without translation from ICD-9-CM. © The Author 2015. Published by Oxford University Press on behalf of the American Medical Informatics Association. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Yin, Hao; Xu, Linyu; Cai, Yanpeng
2015-08-21
Severe health risks caused by PM10 (particulate matter with an aerodynamic diameter ≤10 μm) pollution have induced inevitable economic losses and have rendered pressure on the sustainable development of society as a whole. In China, with the "Polluters Pay Principle", polluters should pay for the pollution they have caused, but how much they should pay remains an intractable problem for policy makers. This paper integrated an epidemiological exposure-response model with economics methods, including the Amended Human Capital (AHC) approach and the Cost of Illness (COI) method, to value the economic loss of PM10-related health risks in 16 districts and also 4 functional zones in Beijing from 2008 to 2012. The results show that from 2008 to 2012 the estimated annual deaths caused by PM10 in Beijing are around 56,000, 58,000, 63,000, 61,000 and 59,000, respectively, while the economic losses related to health damage increased from around 23 to 31 billion dollars that PM10 polluters should pay for pollution victims between 2008 and 2012. It is illustrated that not only PM10 concentration but also many other social economic factors influence PM10-related health economic losses, which makes health economic losses show a time lag discrepancy compared with the decline of PM10 concentration. In conclusion, health economic loss evaluation is imperative in the pollution indemnity system establishment and should be considered for the urban planning and policy making to control the burgeoning PM10 health economic loss.
Energy Technology Data Exchange (ETDEWEB)
Maekawa, Nobuhiro; Yamashita, Toshifumi
2003-08-14
This Letter demonstrates that, as in flipped SU(5) models, doublet-triplet splitting is accomplished by a missing partner mechanism in flipped SO(10) models. The gauge group SO(10){sub F}xU(1){sub V'{sub F}} includes SU(2){sub E} gauge symmetry, which plays an important role in solving the supersymmetric (SUSY) flavor problem by introducing non-abelian horizontal gauge symmetry and anomalous U(1){sub A} gauge symmetry. The gauge group can be broken into the standard model gauge group by VEVs of only spinor fields; such models may be easier to derive than E{sub 6} models from superstring theory.
DEFF Research Database (Denmark)
This report summarises the discussions and conclusions from the workshop 'Integrating Energy Efficiency into the 10 Year Framework of Programmes on Sustainable Consumption and Production Patterns (10YFP)' jointly organised by the 10YFP Secretariat and the Copenhagen Centre on Energy Efficiency (C2E...
Defining and comparing vibration attributes of AlSi10 foam and CFRP coated AlSi10 foam materials
Çolak, O.; Yünlü, L.
2017-06-01
Now, Aluminum materials have begun being manufactured as porous structures and being used with additive composite materials through emerging manufacturing technologies. These materials those porous structures have also begun being used in many areas such as automotive and aerospace due to light-weighted structures. In addition to examining mechanical behavior of porous metallic structures, examining vibration behavior is important for defining characteristic specifications. In this study, vibration attributes belong to %80 porous AlSi10 foam and CFRP coated %80 porous AlSi10 foam are determined with modal analysis. Modal parameters such as natural frequencies and damping coefficient from frequency response functions at the end of hammer impact tests. It is found that natural frequency of CFRP coated AlSi10 foam’s is 1,14 times bigger than AlSi10 foam and damping coefficient of CFRP coated AlSi10 foam is 5 times bigger than AlSi10 foam’s with tests. Dynamic response of materials in various conditions is simulated by evaluating modal parameters with FEM. According to results of the study, CFRP coating on AlSi10 foam effect vibration damping and resonance avoidance ability positively.
2010-01-01
... § 71.15. Graphite means, for the purposes of §§ 71.15 and 71.22, graphite with a boron equivalent... exceed 2 × 10−3 A2/g. Low toxicity alpha emitters means natural uranium, depleted uranium, natural... microcurie/cm2) for beta and gamma and low toxicity alpha emitters, or 0.4 Bq/cm2 (10−5 microcurie/cm2) for...
Yoshimatsu, Gumpei; Kunnathodi, Faisal; Saravanan, Prathab Balaji; Shahbazov, Rauf; Chang, Charles; Darden, Carly M; Zurawski, Sandra; Boyuk, Gulbahar; Kanak, Mazhar A; Levy, Marlon F; Naziruddin, Bashoo; Lawrence, Michael C
2017-11-01
Pancreatic islets produce and secrete cytokines and chemokines in response to inflammatory and metabolic stress. The physiological role of these "isletokines" in health and disease is largely unknown. We observed that islets release multiple inflammatory mediators in patients undergoing islet transplants within hours of infusion. The proinflammatory cytokine interferon-γ-induced protein 10 (IP-10/CXCL10) was among the highest released, and high levels correlated with poor islet transplant outcomes. Transgenic mouse studies confirmed that donor islet-specific expression of IP-10 contributed to islet inflammation and loss of β-cell function in islet grafts. The effects of islet-derived IP-10 could be blocked by treatment of donor islets and recipient mice with anti-IP-10 neutralizing monoclonal antibody. In vitro studies showed induction of the IP-10 gene was mediated by calcineurin-dependent NFAT signaling in pancreatic β-cells in response to oxidative or inflammatory stress. Sustained association of NFAT and p300 histone acetyltransferase with the IP-10 gene required p38 and c-Jun N-terminal kinase mitogen-activated protein kinase (MAPK) activity, which differentially regulated IP-10 expression and subsequent protein release. Overall, these findings elucidate an NFAT-MAPK signaling paradigm for induction of isletokine expression in β-cells and reveal IP-10 as a primary therapeutic target to prevent β-cell-induced inflammatory loss of graft function after islet cell transplantation. © 2017 by the American Diabetes Association.
19 CFR 10.152 - Bona-fide gifts.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Bona-fide gifts. 10.152 Section 10.152 Customs... and Bona Fide Gifts § 10.152 Bona-fide gifts. Subject to the conditions in § 10.153 of this part, the port director shall pass free of duty and tax any article sent as a bona-fide gift from a person in a...
Henry, Todd; Dieterich, Sergio; Finch, C.; Ianna, P. A.; Jao, W.-C.; Riedel, Adric; Subasavage, John; Winters, J.; RECONS Team
2018-01-01
The sample of stars, brown dwarfs, and exoplanets known within 10 parsecs of our Solar System as of January 1, 2017 is presented. The current census is comprised of 416 objects made up of 371 stars (including the Sun and white dwarfs) and 45 brown dwarfs. The stars are known to be orbited by 43 planets (eight in our Solar System and 35 exoplanets). There are 309 systems within 10 pc, including 275 with stellar primaries and 34 systems containing only brown dwarfs.Via a long-term astrometric effort at CTIO, the RECONS (REsearch Consortium On Nearby Stars, www.recons.org) team has added 44 stellar systems to the sample, accounting for one of every seven systems known within 10 pc. Overall, the 278 red dwarfs clearly dominate the sample, accounting for 75% of all stars known within 10 pc. The completeness of the sample is assessed, indicating that a few red, brown, and white dwarfs within 10 pc may be discovered, both as primaries and secondaries, although we estimate that 90% of the stellar systems have been identified. The evolution of the 10 pc sample over the past century is outlined to illustrate our growing knowledge of the solar neighborhood.The luminosity and mass functions for stars within 10 pc are described. In contrast to many studies, once all known close multiples are resolved into individual components, the true mass function rises to the end of the stellar main sequence, followed by a precipitous drop in the number of brown dwarfs, which are outnumbered 8.2 to 1 by stars. Of the 275 stellar primaries in the sample, 182 (66%) are single, 75 (27%) have at least one stellar companion, only 8 (3%) have a brown dwarf companion, and 19 (7%) systems are known to harbor planets. Searches for brown dwarf companions to stars in this sample have been quite rigorous, so the brown dwarf companion rate is unlikely to rise significantly. In contrast, searches for exoplanets, particularly terrestrial planets, have been limited. Thus, overall the solar neighborhood is
Expression of p16(INK4A) gene in human pituitary tumours.
Machiavelli, Gloria; Cotignola, Javier; Danilowicz, Karina; Carbonara, Carolina; Paes de Lima, Andrea; Basso, Armando; Bruno, Oscar Domingo; Szijan, Irene
2008-01-01
Pituitary adenomas comprise 10-15% of primary intracranial tumours but the mechanisms leading to tumour development are yet to be clearly established. The retinoblastoma pathway, which regulates the progression through the cell cycle, is often deregulated in different types of tumours. We studied the cyclin-dependent kinase inhibitor p16(INK4A) gene expression at mRNA level in human pituitary adenomas. Forty-six tumour specimens of different subtypes, 21 clinically non-functioning, 12 growth hormone-secreting, 6 prolactin-secreting, 6 adrenocorticotropin-secreting, and 1 thyrotropin-secreting tumours were studied. All clinically non-functioning and most of the hormone-secreting tumours were macroadenomas (38/46). The RT-PCR assay and electrophoresis of the PCR-products showed that p16(INK4A) mRNA was undetectable in: 62% of non-functioning, 8% of growth hormone-secreting, 17% of prolactin-secreting and 17% of adrenocorticotropin-secreting adenomas. Forty percent of all macroadenomas and 25% of microadenomas had negative p16(INK4A) mRNA, the latter results suggest that the absence of p16(INK4A) product might be an early event in tumours with no expression of this suppressor gene. Within the non-functioning adenomas 63% were "null cell" and 37% were positive for some hormone, both subgroups showed similar percentage of cases with absence of p16(INK4A) mRNA. Our results show that clinically non-functioning macroadenomas have impaired p16(INK4A) expression in a clearly higher proportion than any other pituitary tumour subtype investigated. Other regulatory pathways may be implicated in the development of tumours with positive p16(INK4A) expression.
46 CFR 50.10-25 - Coast Guard Symbol.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Coast Guard Symbol. 50.10-25 Section 50.10-25 Shipping... Definition of Terms Used in This Subchapter § 50.10-25 Coast Guard Symbol. (a) The term Coast Guard Symbol... impression of the Coast Guard Symbol for stamping nameplates and specimens is shown in Figure 50.10-25(b...
Directory of Open Access Journals (Sweden)
Ana Cecília Ribeiro de Castro
2007-09-01
Full Text Available O objetivo deste trabalho foi avaliar características pós-colheita da primeira haste floral de plantas de Heliconia psittacorum x H. spathocircinata Aristeguieta, cultivar Golden Torch, sob deficiência de macronutrientes. O experimento foi conduzido em casa de vegetação, mediante técnica do elemento faltante. As inflorescências produzidas do tratamento sob omissão de N apresentaram coloração laranja-pálido e deformação nas hastes florais. O comprimento e o diâmetro da haste floral e o comprimento da inflorescência foram reduzidos nos tratamentos com omissão de N, P ou K em até 31,23%, em relação ao tratamento completo. A massa de matéria seca e a durabilidade pós-colheita das hastes florais foram reduzidas em 67 e 38,46%, respectivamente, em ambos os tratamentos com omissão de N ou K. As deficiências desses macronutrientes reduziram, ainda, a produção de hastes florais, a partir do segundo perfilho emitido. Hastes florais com maior massa de matéria seca e diâmetro apresentaram maior durabilidade pós-colheita. O teor de carboidrato na parte subterrânea mostrou correlação positiva (0,90 com a massa de matéria seca das hastes florais. Hastes florais com maior teor de carboidratos solúveis nas folhas retardaram a emissão da inflorescência.The objective of this work was to evaluate Heliconia psittacorum x H. spathocircinata Aristeguieta 'Golden Torch' first flower stem morphological and physiological characteristics as well as postharvest longevity, under macronutrients omissions. A greenhouse experiment was conducted under the technique of the lacking element. Inflorescences produced under N omission treatment showed a pale orange color and floral stem deformation. Stem length and diameter as well as inflorescence length were reduced under omission of N, P or K, down to 31.23% when compared to the complete solution treatment. Floral stem dry matter and postharvest longevity were reduced on 67% and 38.46
International Nuclear Information System (INIS)
Larkin, K.A.
1994-01-01
This test plan describes the activities associated with the High Gradient Magnetic Filtration (HGMF) of plutonium-bearing solutions (10-L). The 10-L solutions were received from Argonne National Laboratories in 1972, are highly acidic, and are considered unstable. The purpose of the testing is to show that HGMF is an applicable method of removing plutonium precipitates from solution. The plutonium then can be stored safely in a solid form
Denollet, Johan; Smolderen, Kim G E; van den Broek, Krista C; Pedersen, Susanne S
2007-06-01
Dysfunctional parenting styles are associated with poor mental and physical health. The 10-item Remembered Relationship with Parents (RRP(10)) scale retrospectively assesses Alienation (dysfunctional communication and intimacy) and Control (overprotection by parents), with an emphasis on deficiencies in empathic parenting. We examined the 2-factor structure of the RRP(10) and its relationship with adult depression. 664 respondents from the general population (48% men, mean age 54.6+/-14.2 years) completed the RRP(10), Parental Bonding Instrument (PBI), and Beck Depression Inventory. The Alienation and Control dimensions of the RRP(10) displayed a sound factor structure, good internal consistency (Cronbach's alpha=0.83-0.86), and convergent validity against the PBI scales. No significant gender differences were found on the RRP(10) scales. Stratifying by RRP(10) dimensions showed that respondents high in Alienation and Control, for both father (33.3% vs. 14.5%, pparental Alienation and Control. High Alienation and Control were independently related to increased risk of depressive symptoms. Given the brevity of the RRP(10), it can easily be used in epidemiological/clinical research on the link between the remembered relationship with parents and mental/physical health.
International Nuclear Information System (INIS)
Mole, R.H.
1984-01-01
The option of restricting medical irradiation of women of reproductive age to the first 10 days of the menstrual cycle is discussed. The current ICRP proposal to abandon the 10-day option in diagnostic radiography is outlined and some reasons for this action by the ICRP are proposed, including the fact that the most sensitive period for radiation damage to the developing foetus brain is at 10-18 weeks after the first day of the last menstrual period. (U.K.)
Yukawa sector of minimal SO(10) unification
Energy Technology Data Exchange (ETDEWEB)
Babu, K.S. [Department of Physics, Oklahoma State University,Stillwater, OK, 74078 (United States); Bajc, Borut [Jožef Stefan Institute,Ljubljana, 1000 (Slovenia); Saad, Shaikh [Department of Physics, Oklahoma State University,Stillwater, OK, 74078 (United States)
2017-02-28
We show that in SO(10) models, a Yukawa sector consisting of a real 10{sub H}, a real 120{sub H} and a complex 126{sub H} of Higgs fields can provide a realistic fit to all fermion masses and mixings, including the neutrino sector. Although the group theory of SO(10) demands that the 10{sub H} and 120{sub H} be real, most constructions complexify these fields and impose symmetries exterior to SO(10) to achieve predictivity. The proposed new framework with real10{sub H} and real120{sub H} relies only on SO(10) gauge symmetry, and yet has a limited number of Yukawa parameters. Our analysis shows that while there are restrictions on the observables, a good fit to the entire fermion spectrum can be realized. Unification of gauge couplings is achieved with an intermediate scale Pati-Salam gauge symmetry. Proton decay branching ratios are calculable, with the leading decay modes being p→ν̄π{sup +} and p→e{sup +}π{sup 0}.
Energy Technology Data Exchange (ETDEWEB)
Tamvakis, K.
1988-01-28
We construct an N=1 supersymmetric SO(10) GUT broken down to SU(3)c x SU(2)/sub L/ x U(1)/sub ..gamma../ with an intermediate flipped SU(5) x U(1)/sub chi/ gauge symmetry. A solution to the triplet-doublet mass-splitting problem is proposed in terms of a non-minimal missing-partner mechanism.
48 CFR 9904.405-10 - [Reserved
2010-10-01
... Section 9904.405-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.405-10 [Reserved] ...
48 CFR 9904.402-10 - [Reserved
2010-10-01
... Section 9904.402-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.402-10 [Reserved] ...
48 CFR 9904.409-10 - [Reserved
2010-10-01
... Section 9904.409-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.409-10 [Reserved] ...
48 CFR 9904.408-10 - [Reserved
2010-10-01
... Section 9904.408-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.408-10 [Reserved] ...
48 CFR 9904.401-10 - [Reserved
2010-10-01
... Section 9904.401-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.401-10 [Reserved] ...
48 CFR 9904.403-10 - [Reserved
2010-10-01
... Section 9904.403-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.403-10 [Reserved] ...
48 CFR 9904.406-10 - [Reserved
2010-10-01
... Section 9904.406-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.406-10 [Reserved] ...
48 CFR 9904.404-10 - [Reserved
2010-10-01
... Section 9904.404-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.404-10 [Reserved] ...
48 CFR 9904.410-10 - [Reserved
2010-10-01
... Section 9904.410-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.410-10 [Reserved] ...
48 CFR 9904.407-10 - [Reserved
2010-10-01
... Section 9904.407-10 Federal Acquisition Regulations System COST ACCOUNTING STANDARDS BOARD, OFFICE OF FEDERAL PROCUREMENT POLICY, OFFICE OF MANAGEMENT AND BUDGET PROCUREMENT PRACTICES AND COST ACCOUNTING STANDARDS COST ACCOUNTING STANDARDS 9904.407-10 [Reserved] ...
Hot cracking of welded joints of the 7CrMoVTiB 10-10 (T/P24) steel
Energy Technology Data Exchange (ETDEWEB)
Adamiec, J, E-mail: janusz.adamiec@polsl.pl [Department of Materials Science, Silesian University of Technology, Krasinskiego 8, 40-019 Katowice (Poland)
2011-05-15
Bainitic steel 7CrMoVTiB10-10 is one the newest steels for waterwalls of modern industrial boilers. In Europe, attempts have been made to make butt welded joints of pipes made of this steel of the diameter up to 51 mm and thickness up to 8 mm. Many cracks have been observed in the welded joint, both during welding and transport and storage. The reasons of cracking and the prevention methods have not been investigated. No comprehensive research is carried out in Europe in order to automate the welding process of the industrial boiler elements made of modern bainitic steel, such as 7CrMoVTiB10-10. There is no information about its overall, operative and local weldability, influence of heat treatment, as well as about resistance of the joints to cracking during welding and use. The paper presents experience of Energoinstal SA from development of technology and production of waterwalls of boilers made of the 7CrMoVTiB 10-10 steel on a multi-head automatic welder for submerged arc welding.
14 CFR 406.10-406.100 - [Reserved
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false [Reserved] 406.10-406.100 Section 406.10-406.100 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION... and Enforcement §§ 406.10-406.100 [Reserved] ...
African Journals Online (AJOL)
USER
2017-01-16
Jan 16, 2017 ... Ethiopian Journal of Environmental Studies & Management 10(1): 1 – 10, 2017. ... 1 million, some identified modern sources had also made little impact ..... bottlenecks and logistics. .... Table 1: Trends in Nigerian Stock Market.
miR-10 in development and cancer
DEFF Research Database (Denmark)
Lund, Anders Henrik
2010-01-01
The microRNA (miRNA) miR-10 family has attracted attention because of its conservation and the position of the miR-10 genes within the Hox clusters of developmental regulators. In several species, miR-10 is coexpressed with a set of Hox genes and has been found to regulate the translation of Hox ...... function to the miRNA repertoire.Cell Death and Differentiation advance online publication, 22 May 2009; doi:10.1038/cdd.2009.58....
46 CFR 61.05-10 - Boilers in service.
2010-10-01
... 46 Shipping 2 2010-10-01 2010-10-01 false Boilers in service. 61.05-10 Section 61.05-10 Shipping... INSPECTIONS Tests and Inspections of Boilers § 61.05-10 Boilers in service. (a) Each boiler, including superheater, reheater, economizer, auxiliary boiler, low-pressure heating boiler, and unfired steam boiler...
47 CFR 10.520 - Common audio attention signal.
2010-10-01
... 47 Telecommunication 1 2010-10-01 2010-10-01 false Common audio attention signal. 10.520 Section... Equipment Requirements § 10.520 Common audio attention signal. A Participating CMS Provider and equipment manufacturers may only market devices for public use under part 10 that include an audio attention signal that...
46 CFR 168.10-5 - Civilian nautical school.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Civilian nautical school. 168.10-5 Section 168.10-5 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS CIVILIAN NAUTICAL SCHOOL VESSELS Definitions of Terms Used in This Part § 168.10-5 Civilian nautical school. The term civilian...
Heat capacity of Sr10(PO4)6Cl2 and Ca10(PO4)6Cl2 by DSC
International Nuclear Information System (INIS)
Venkata Krishnan, R.; Jena, Hrudananda; Govindan Kutty, K.V.; Nagarajan, K.
2008-01-01
Strontium and calcium chloroapatites were synthesized by wet chemical method, characterized by X-ray diffraction and are found to be phase pure materials. The measured room temperature lattice parameter of Ca 10 (PO 4 ) 6 Cl 2 is a = 9.523 A, c = 6.855 A and for Sr 10 (PO 4 ) 6 Cl 2 is a = 9.876 A, c = 7.188 A. Heat capacity measurements were carried out on Ca 10 (PO 4 ) 6 Cl 2 and Sr 10 (PO 4 ) 6 Cl 2 by DSC in the temperature range 298-800 K. The heat capacity values of Sr 10 (PO 4 ) 6 Cl 2 is higher at all temperatures than Ca 10 (PO 4 ) 6 Cl 2 . Enthalpy and entropy increments were computed. Heat capacity values of Ca 10 (PO 4 ) 6 Cl 2 and Sr 10 (PO 4 ) 6 Cl 2 at 298 K are 758 and 868 J K -1 mol -1 , respectively
49 CFR 106.10 - Process for issuing rules.
2010-10-01
... filing written comments or making oral presentations). (4) Whom to call if you have questions about the... 49 Transportation 2 2010-10-01 2010-10-01 false Process for issuing rules. 106.10 Section 106.10... PHMSA Rulemaking Documents § 106.10 Process for issuing rules. (a) PHMSA (“we”) uses informal rulemaking...
46 CFR 151.10-1 - Barge hull classifications.
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Barge hull classifications. 151.10-1 Section 151.10-1... CARRYING BULK LIQUID HAZARDOUS MATERIAL CARGOES Barge Hull Construction Requirements § 151.10-1 Barge hull classifications. (a) Each barge constructed or converted in conformance with this subpart shall be assigned a hull...
45 CFR 33.10 - Procedures for salary offset.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Procedures for salary offset. 33.10 Section 33.10 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION SALARY OFFSET § 33.10 Procedures for salary offset. (a) Method and source of deductions. Unless the employee and the Secretary have...
48 CFR 1631.205-10 - Cost of money.
2010-10-01
... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Cost of money. 1631.205-10... AND PROCEDURES Contracts With Commercial Organizations 1631.205-10 Cost of money. For the purposes of FAR 31.205-10(b)(3), the estimated facilities capital cost of money is specifically identified if it...
Huang, Bei; Jia, Qin Qin; Liang, Ying; Huang, Wen Shu; Nie, P
2015-10-01
IRF10 gene was cloned in orange spotted grouper, Epinephelus coioides, and its expression was examined following poly(I:C) stimulation and bacterial infection. The cDNA sequence of grouper IRF10 contains an open reading frame of 1197 bp, flanked by 99 bp 5'-untranslated region and 480 bp 3'- untranslated region. Multiple alignments showed that the grouper IRF10 has a highly conserved DNA binding domain in the N terminus with characteristic motif containing five tryptophan residues. Quantitative real-time PCR analysis revealed that the expression of IRF10 was responsive to both poly(I:C) stimulation and Vibrio parahemolyticus infection, with a higher increase to poly(I:C), indicating an important role of IRF10 in host immune response during infection. A phyletic distribution of IRF members was also examined in vertebrates, and IRF10 was found in most lineages of vertebrates, not in modern primates and rodents. It is suggested that the first divergence of IRF members might have occurred before the evolutionary split of vertebrate and cephalochordates, producing ancestors of IRF (1/2/11) and IRF (4/8/9/10)[(3/7) (5/6)], and that the second and/or third divergence of IRF members occurred following the split, thus leading to the subsets of the IRF family in vertebrates. Copyright © 2015 Elsevier Ltd. All rights reserved.
12 CFR 1291.10 - Conflicts of interest.
2010-01-01
... 12 Banks and Banking 7 2010-01-01 2010-01-01 false Conflicts of interest. 1291.10 Section 1291.10...' AFFORDABLE HOUSING PROGRAM § 1291.10 Conflicts of interest. (a) Bank directors and employees. (1) Each Bank's... conflict of interest policies required by this section. ...
38 CFR 10.33 - Determination of dependency.
2010-07-01
... dependency. 10.33 Section 10.33 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS ADJUSTED COMPENSATION Adjusted Compensation; General § 10.33 Determination of dependency. A determination of the existence of the alleged dependency will be made upon consideration of all facts relating to...
40 CFR 76.10 - Alternative emission limitations.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Alternative emission limitations. 76.10 Section 76.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) ACID RAIN NITROGEN OXIDES EMISSION REDUCTION PROGRAM § 76.10 Alternative emission limitations. (a...
5 CFR 1303.10 - Access to information.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Access to information. 1303.10 Section 1303.10 Administrative Personnel OFFICE OF MANAGEMENT AND BUDGET ADMINISTRATIVE PROCEDURES PUBLIC INFORMATION PROVISIONS OF THE ADMINISTRATIVE PROCEDURES ACT Procedures § 1303.10 Access to information. (a...
Coenzyme Q10 effects in neurodegenerative disease
Directory of Open Access Journals (Sweden)
Meredith Spindler
2009-11-01
Full Text Available Meredith Spindler1, M Flint Beal1,2, Claire Henchcliffe1,21Department of Neurology, 2Department of Neuroscience, Weill Medical College of Cornell University, New York, NY, USAAbstract: Coenzyme Q10 (CoQ10 is an essential cofactor in the mitochondrial respiratory chain, and as a dietary supplement it has recently gained attention for its potential role in the treatment of neurodegenerative disease. Evidence for mitochondrial dysfunction in neurodegenerative disorders derives from animal models, studies of mitochondria from patients, identification of genetic defects in patients with neurodegenerative disease, and measurements of markers of oxidative stress. Studies of in vitro models of neuronal toxicity and animal models of neurodegenerative disorders have demonstrated potential neuroprotective effects of CoQ10. With this data in mind, several clinical trials of CoQ10 have been performed in Parkinson’s disease and atypical Parkinson’s syndromes, Huntington’s disease, Alzheimer disease, Friedreich’s ataxia, and amyotrophic lateral sclerosis, with equivocal findings. CoQ10 is widely available in multiple formulations and is very well tolerated with minimal adverse effects, making it an attractive potential therapy. Phase III trials of high-dose CoQ10 in large sample sizes are needed to further ascertain the effects of CoQ10 in neurodegenerative diseases.Keywords: coenzyme Q10, neurodegenerative disease, Parkinson’s disease, Huntington’s disease, mitochondrial dysfunction
Welcome to the TEI’10 Proceedings
DEFF Research Database (Denmark)
Pederson, Thomas; Shaer, Orit; Wakkary, Ron
2010-01-01
We welcome you to the proceedings of the 4th ACM International Conference on Tangible, Embedded, and Embodied Interaction -- TEI'10, held in Cambridge, Massachusetts, on the 25th -27th of January 2010. TEI'10 continues the pursuit of key areas of innovation in respect to tangible, embedded...... as Explorations aimed at attracting thought provoking, evocative, visually and sensually rich work by a diverse group of creators. 46 submissions were received from which an expert jury accepted 10 contributions. These contributions are interwoven into the papers and demonstration tracks at the conference...
New Mexico HUC-10 Boundaries - 2013
Earth Data Analysis Center, University of New Mexico — This data set is a complete digital hydrologic unit boundary layer to the watershed (10-digit) 10th level for the State of New Mexico. This data set consists of...
17 CFR 8.10 - Predetermined penalties.
2010-04-01
... Section 8.10 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION EXCHANGE PROCEDURES FOR DISCIPLINARY, SUMMARY, AND MEMBERSHIP DENIAL ACTIONS Disciplinary Procedure § 8.10 Predetermined... the rules of an exchange establish predetermined penalties, the disciplinary committee shall have...
International Nuclear Information System (INIS)
Coutinho, C.M.M.; Rodrigues Filho, J.S.R.; Umeda, K.; Echternacht, M.V.
1990-01-01
A isotopic separation pilot plant with five ion exchange columns interconnected in series were designed and built in the IEN. The columns are charged with a strong anionic resin in its alkaline form. The boric acid solution is introduced in the separation columns until it reaches a absorbing zone length which is sufficient to obtain the desired boron-10 isotopic concentration. The boric acid absorbing zone movement is provided by the injection of a diluted hydrochloric acid solution, which replace the boric acid throughout the columns. The absorbing zone equilibrium length is proportional to its total length. The enriched boron-10 and the depleted boron are located in the final boundary and in the initial position of the absorbing zones, respectively. (author)
46 CFR 78.40-10 - No smoking permitted.
2010-10-01
... § 78.40-10 No smoking permitted. (a) The master shall have appropriate “No Smoking” signs posted and shall take all necessary precautions to prevent smoking or carrying of lighted or smoldering cigars... 46 Shipping 3 2010-10-01 2010-10-01 false No smoking permitted. 78.40-10 Section 78.40-10 Shipping...
46 CFR 111.10-5 - Multiple energy sources.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Multiple energy sources. 111.10-5 Section 111.10-5...-GENERAL REQUIREMENTS Power Supply § 111.10-5 Multiple energy sources. Failure of any single generating set energy source such as a boiler, diesel, gas turbine, or steam turbine must not cause all generating sets...
46 CFR 194.10-5 - Type and location.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Type and location. 194.10-5 Section 194.10-5 Shipping..., AND CONTROL OF EXPLOSIVES AND OTHER HAZARDOUS MATERIALS Magazines § 194.10-5 Type and location. (a.... (b) Magazine vans. (1) Magazine vans may be installed on deck in a location protected from boarding...
Ferumoxtran-10 advanced magnetics.
Leenders, W.P.J.
2003-01-01
Ferumoxtran-10 (Combidex) is an ultra-small superparamagnetic iron oxide molecular resonance imaging contrast agent under development by Advanced Magnetics Ltd and Guerbet for the principal indication of lymph node imaging.
22 CFR 216.10 - Records and reports.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Records and reports. 216.10 Section 216.10 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT ENVIRONMENTAL PROCEDURES § 216.10 Records and... statements, Determinations and Declarations which will be available to the public under the Freedom of...
29 CFR 2201.10 - Maintenance of statistics.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Maintenance of statistics. 2201.10 Section 2201.10 Labor Regulations Relating to Labor (Continued) OCCUPATIONAL SAFETY AND HEALTH REVIEW COMMISSION REGULATIONS IMPLEMENTING THE FREEDOM OF INFORMATION ACT § 2201.10 Maintenance of statistics. (a) The FOIA Disclosure...
31 CFR 10.22 - Diligence as to accuracy.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Diligence as to accuracy. 10.22... § 10.22 Diligence as to accuracy. (a) In general. A practitioner must exercise due diligence— (1) In... provided in §§ 10.34, 10.35, and 10.37, a practitioner will be presumed to have exercised due diligence for...
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Ocean-TB/O. 30.10-45 Section 30.10-45 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY TANK VESSELS GENERAL PROVISIONS Definitions § 30.10-45 Ocean—TB/O. Under this designation shall be included all tank vessels normally navigating the waters of any ocean or...
International Nuclear Information System (INIS)
Vagner, J.
1965-01-01
Measurement of weak direct currents by Townsend's method using a vibrating condenser electrometer. Development of a current generator giving a pico-ampere independently of the resistance of the circuit used. Development of generators giving currents which may be adjusted continuously and exactly (0.1 to 1 pico-ampere, 1 to 10 pico-amperes, 10 to 100 pico-amperes). Measurement of very high resistances (10 12 Ω) by three different methods. Graphs are made by plotting the value of the resistance against the potential difference applied across it (from 50 milli-volts to 50 volts). Two methods use adjustable current generators and the third is applicable to the measurement of resistances of between 10 7 and 10 13 Ω using a series of condensers ranging from 50 pico-farads to 10 micro-farads. The accuracy of the measurements is between 0. 5 and 1 per cent. (author) [fr
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-BS10 (Link to dictyBase) - - - Contig-U16283-1 FC-BS10Z (Li...nk to Original site) - - FC-BS10Z 720 - - - - Show FC-BS10 Library FC (Link to library) Clone ID FC-BS10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-BS/FC-BS10Q.Seq.d/ Representative seq. ID FC-BS...10Z (Link to Original site) Representative DNA sequence >FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq....E Sequences producing significant alignments: (bits) Value FC-BS10 (FC-BS10Q) /CSM/FC/FC-BS/FC-BS10Q.Seq.d/
16 CFR 803.10 - Running of time.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Running of time. 803.10 Section 803.10 Commercial Practices FEDERAL TRADE COMMISSION RULES, REGULATIONS, STATEMENTS AND INTERPRETATIONS UNDER THE HART-SCOTT-RODINO ANTITRUST IMPROVEMENTS ACT OF 1976 TRANSMITTAL RULES § 803.10 Running of time. (a...
29 CFR 525.10 - Prevailing wage rates.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Prevailing wage rates. 525.10 Section 525.10 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS EMPLOYMENT OF WORKERS WITH DISABILITIES UNDER SPECIAL CERTIFICATES § 525.10 Prevailing wage rates. (a) A...
27 CFR 10.24 - Sales promotion contests.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Sales promotion contests. 10.24 Section 10.24 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS COMMERCIAL BRIBERY Commercial Bribery § 10.24 Sales promotion contests...
31 CFR 50.10 - General disclosure requirements.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false General disclosure requirements. 50.10 Section 50.10 Money and Finance: Treasury Office of the Secretary of the Treasury TERRORISM RISK INSURANCE PROGRAM Disclosures as Conditions for Federal Payment § 50.10 General disclosure requirements. (a...
19 CFR 212.10 - Contents of application.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Contents of application. 212.10 Section 212.10 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION INVESTIGATIONS OF UNFAIR PRACTICES IN IMPORT TRADE IMPLEMENTATION OF THE EQUAL ACCESS TO JUSTICE ACT Information Required From Applicants § 212.10...
32 CFR 228.10 - Prohibition on alcohol.
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Prohibition on alcohol. 228.10 Section 228.10 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS SECURITY PROTECTIVE FORCE § 228.10 Prohibition on alcohol. Entering or being on protected property...
6 CFR 5.10 - Preservation of records.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Preservation of records. 5.10 Section 5.10 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY DISCLOSURE OF RECORDS AND INFORMATION Freedom of Information Act § 5.10 Preservation of records. Each component shall preserve all...
21 CFR 1005.10 - Notice of sampling.
2010-04-01
... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Notice of sampling. 1005.10 Section 1005.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) RADIOLOGICAL HEALTH IMPORTATION OF ELECTRONIC PRODUCTS Inspection and Testing § 1005.10 Notice of sampling...
28 CFR 513.10 - Purpose and scope.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Purpose and scope. 513.10 Section 513.10 Judicial Administration BUREAU OF PRISONS, DEPARTMENT OF JUSTICE GENERAL MANAGEMENT AND ADMINISTRATION ACCESS TO RECORDS Production or Disclosure of FBI/NCIC Information § 513.10 Purpose and scope. This...
32 CFR 776.10 - Informal ethics advice.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Informal ethics advice. 776.10 Section 776.10... § 776.10 Informal ethics advice. (a) Advisors. Covered attorneys may seek informal ethics advice either... of Director, JA Division, HQMC; and (5) Head, Standards of Conduct/Government Ethics Branch...
19 CFR 191.10 - Certificate of delivery.
2010-04-01
... 19 Customs Duties 2 2010-04-01 2010-04-01 false Certificate of delivery. 191.10 Section 191.10... TREASURY (CONTINUED) DRAWBACK General Provisions § 191.10 Certificate of delivery. (a) Purpose; when... other party a certificate of delivery, certified by the importer or other party through whose possession...
26 CFR 1.936-10 - Qualified investments.
2010-04-01
... 26 Internal Revenue 10 2010-04-01 2010-04-01 false Qualified investments. 1.936-10 Section 1.936... (CONTINUED) INCOME TAXES Possessions of the United States § 1.936-10 Qualified investments. (a) In general. [Reserved] (b) Qualified investments in Puerto Rico. [Reserved] (c) Qualified investment in certain...
International Nuclear Information System (INIS)
Xu Dejun; Zheng Zhiming; Wang Peng; Wang Li; Yuan Hang; Yu Zengliang
2008-01-01
In order to increase the production efficiency of coenzyme Q 10 , the original strain Agrobacterium tumefaciens ATCC 4452 was mutated by means of Nitrogen ions implantation. A mutant strain, ATX 12, with high contents of coenzyme Q 10 was selected. Subsequently, the conditions such as carbohydrate concentration, nitrogen source concentration, inoculum's size, seed age, aeration and temperature which might affect the production of CoQ 10 were investigated in detail. Under optimal conditions, the maximum concentration of the intracellular CoQ 10 reached 200.3 mg/L after 80 h fed-batch fermentation, about 245% increasing in CoQ 10 production after ion implantation, compared to the original strain. (ion beam bioengineering)
Studi tentang standar sepatu kanvas untuk ekspor
Directory of Open Access Journals (Sweden)
Sri Bandi
1992-04-01
Full Text Available In this study, 10 pairs of canvas shoes with rubber soles of various trade marks were tested. The samples were iaken either from manufacturers or markets in DKI Jakarta or DIY, the test methd used was as stated in sII 1406-g5. The objective of this study is to compile a concept of standard for export quality canvas shoes. The test results of canvas with rubber soles can be provided as follows the portion - bursting strengrh (15,839 - 22,4737 kg/cm'; breaking load of shoe taces 463,31 - &3,846 N; the bottom portion - the thickness of soles without treat (1,31 - z,7g mm; tensile strength (6,25 - 11,94 N/mm2; elongation at break (202,45 - 522,93Vo; permanent set 50 qo e,46 - 5,22; specific gravity (1,L5 - 1,29; Grasselli abrasion resistance (0,49 - 3,25 mmTkgm; tear strength (2,4g -6,46 N/ mm2; flexing resistance no cracks permitted ; hardness (54,17 - 72,g6 shore A. The 10 pairs ofcanvas shoes were also visually inspected according to sII 1406 - 85 and they fulfilled the requirements. Besides testing some standards concepts from other countries such as JIS (Japanese Industrial Standard, IS (Indian standard, CNS (china National Standard, KS (Korean standard were also studied and based on them, a conclusion can be drawn as follows according to JIS. S 5002 - g6, it was necessary to inspect them visually, to test their bursting strength, tensile strength and hardness; according to IS 375 - 1966itwas necessary to inspect them visually to test their thickness, specific gravity, hardness, abrasion resisiance and flexing resistance according to cNS UDC 6g5 - 31 it was necessary to inspect them visually, to test their thickness, tensile strength, and elongation at break, according to KS M 6522 - 74 it was necessary to inspect them visually, to test their bursting strength, elongation at break and tensile sEength.
Zhao, Wei; Shen, Chaoxiong; Cai, Ranze; Wu, Jianfeng; Zhuang, Yuandong; Cai, Zhaowen; Wang, Rui; Chen, Chunmei
2017-01-01
Thoracic ossification of the ligamentum flavum (TOLF) is a common cause of progressive thoracic myelopathy. Surgical decompression is commonly used to treat TOLF. To evaluate the clinical outcomes of microsurgical decompression of TOLF via a paraspinal approach, using a percutaneous tubular retractor system. First, three-dimensional (3D) image reconstruction and printed models were made from thin computed tomography scans for each patient. Then, 3D computer-assisted virtual surgery was performed using the 3D reconstruction to calculate the precise location and sizes of the bone window and the angle of insertion of the percutaneous tubular retractor system. In total, 13 patients underwent the surgery through the percutaneous micro channel unilateral vertebral approach under electrophysiological monitoring. Five days after the surgery, increased creatine phosphokinase levels returned to preoperative levels. The Japanese Orthopedic Association (JOA) score was improved and computed tomography reconstruction and magnetic resonance imaging of the thoracic spine showed that decompression was achieved without injuries to the spinal cord or nerve root. The stability of the spine was not affected, nor were any deformities of the spine detected. Finally, nerve functional recovery was achieved with minimal injury to the paraspinal muscle, articulum, spinous process and ligament. The mean operative time was 98.23 ±19.10 min, and mean blood loss was 19.77 ±5.97 ml. At a mean follow-up of 13.3 months (median: 12 months), the mean JOA score was 7.54 ±1.13 at the final follow-up, yielding a mean RR of 49.10 ±15.71%. Using The recovery rate, 7 (53.85%) patients had good outcomes, 5 (38.46%) patients had a fair outcome, and 1 (7.69%) patient had poor outcomes, indicating significant improvement by the final follow-up examination (p < 0.05). The 3D printed patient model-based microsurgical resection of TOLF via the paraspinal approach can achieve decompression of the spinal canal
Batra, Jyotica; Robinson, Jessica; Soares, Alexei S; Fields, Alan P; Radisky, Derek C; Radisky, Evette S
2012-05-04
Matrix metalloproteinase 10 (MMP-10, stromelysin-2) is a secreted metalloproteinase with functions in skeletal development, wound healing, and vascular remodeling; its overexpression is also implicated in lung tumorigenesis and tumor progression. To understand the regulation of MMP-10 by tissue inhibitors of metalloproteinases (TIMPs), we have assessed equilibrium inhibition constants (K(i)) of putative physiological inhibitors TIMP-1 and TIMP-2 for the active catalytic domain of human MMP-10 (MMP-10cd) using multiple kinetic approaches. We find that TIMP-1 inhibits the MMP-10cd with a K(i) of 1.1 × 10(-9) M; this interaction is 10-fold weaker than the inhibition of the similar MMP-3 (stromelysin-1) catalytic domain (MMP-3cd) by TIMP-1. TIMP-2 inhibits the MMP-10cd with a K(i) of 5.8 × 10(-9) M, which is again 10-fold weaker than the inhibition of MMP-3cd by this inhibitor (K(i) = 5.5 × 10(-10) M). We solved the x-ray crystal structure of TIMP-1 bound to the MMP-10cd at 1.9 Å resolution; the structure was solved by molecular replacement and refined with an R-factor of 0.215 (R(free) = 0.266). Comparing our structure of MMP-10cd·TIMP-1 with the previously solved structure of MMP-3cd·TIMP-1 (Protein Data Bank entry 1UEA), we see substantial differences at the binding interface that provide insight into the differential binding of stromelysin family members to TIMP-1. This structural information may ultimately assist in the design of more selective TIMP-based inhibitors tailored for specificity toward individual members of the stromelysin family, with potential therapeutic applications.
19 CFR 10.542 - Third country transportation.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Third country transportation. 10.542 Section 10.542 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF... Trade Agreement Rules of Origin § 10.542 Third country transportation. (a) General. A good will not be...
22 CFR 9.10 - Mandatory declassification review.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Mandatory declassification review. 9.10 Section 9.10 Foreign Relations DEPARTMENT OF STATE GENERAL SECURITY INFORMATION REGULATIONS § 9.10 Mandatory declassification review. All requests to the Department by a member of the public, a government employee, or an...
29 CFR 1903.10 - Consultation with employees.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Consultation with employees. 1903.10 Section 1903.10 Labor... INSPECTIONS, CITATIONS AND PROPOSED PENALTIES § 1903.10 Consultation with employees. Compliance Safety and... extent they deem necessary for the conduct of an effective and thorough inspection. During the course of...
21 CFR 14.10 - Applicability to Congress.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Applicability to Congress. 14.10 Section 14.10... HEARING BEFORE A PUBLIC ADVISORY COMMITTEE General Provisions § 14.10 Applicability to Congress. This part applies to Congress, individual Members of Congress, and other employees or representatives of Congress in...
26 CFR 1.165-10 - Wagering losses.
2010-04-01
... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Wagering losses. 1.165-10 Section 1.165-10...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.165-10 Wagering losses. Losses sustained during the taxable year on wagering transactions shall be allowed as a deduction but...
1 CFR 5.10 - Forms of publication.
2010-01-01
... 1 General Provisions 1 2010-01-01 2010-01-01 false Forms of publication. 5.10 Section 5.10 General Provisions ADMINISTRATIVE COMMITTEE OF THE FEDERAL REGISTER THE FEDERAL REGISTER GENERAL § 5.10 Forms of publication. Pursuant to section 1506 of title 44, United States Code, the Administrative Committee publishes...
7 CFR 3560.10 - Conflict of interest.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Conflict of interest. 3560.10 Section 3560.10... AGRICULTURE DIRECT MULTI-FAMILY HOUSING LOANS AND GRANTS General Provisions and Definitions § 3560.10 Conflict of interest. To reduce the potential for employee conflict of interest, all RHS activities will be...
19 CFR 10.532 - Integrated Sourcing Initiative.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Integrated Sourcing Initiative. 10.532 Section 10... Trade Agreement Rules of Origin § 10.532 Integrated Sourcing Initiative. (a) For purposes of General... Sourcing Initiative if: (1) The good, in its condition as imported, is both classified in a tariff...
19 CFR 10.454 - Regional value content.
2010-04-01
... TREASURY ARTICLES CONDITIONALLY FREE, SUBJECT TO A REDUCED RATE, ETC. United States-Chile Free Trade Agreement Rules of Origin § 10.454 Regional value content. Where General Note 26, subdivision (n), HTSUS... 19 Customs Duties 1 2010-04-01 2010-04-01 false Regional value content. 10.454 Section 10.454...
39 CFR 10.4 - Financial disclosure reports.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Financial disclosure reports. 10.4 Section 10.4... CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.4 Financial disclosure reports. (a) Requirement of submission of reports. At the time of their nomination, Governors complete a financial disclosure report...
10th International Cryocooler Conference
2002-01-01
Cryocoolers 10 is the premier archival publication of the latest advances and performance of small cryogenic refrigerators designed to provide localized cooling for military, space, semi-conductor, medical, computing, and high-temperature superconductor cryogenic applications in the 2-200 K temperature range. Composed of papers written by leading engineers and scientists in the field, Cryocoolers 10 reports the most recent advances in cryocooler development, contains extensive performance test results and comparisons, and relates the latest experience in integrating cryocoolers into advanced applications.
Short-Circuit Characterization of 10 kV 10A 4H-SiC MOSFET
DEFF Research Database (Denmark)
Eni, Emanuel-Petre; Beczkowski, Szymon; Munk-Nielsen, Stig
2016-01-01
The short-circuit capability of a power device is highly relevant for converter design and fault protection. In this paper a 10kV 10A 4H-SiC MOSFET is characterized and its short circuit withstand capability is studied and analyzed at 6 kV DC-link voltage. The test setup for this study is also...... introduced as its design, especially the inductance in the switching loop, can affect the experimental results. The study aims to present insights specific to the device which are different from that of silicon (Si) based devices. During the short-circuit operation, MOSFET saturation current, ID...
16 CFR 307.10 - Cooperative advertising.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Cooperative advertising. 307.10 Section 307... REGULATIONS UNDER THE COMPREHENSIVE SMOKELESS TOBACCO HEALTH EDUCATION ACT OF 1986 Advertising Disclosures § 307.10 Cooperative advertising. The Act prohibits any manufacturer, packager, or importer of smokeless...
User manual for NASA Lewis 10 by 10 foot supersonic wind tunnel. Revised
Soeder, Ronald H.
1995-01-01
This manual describes the 10- by 10-Foot Supersonic Wind Tunnel at the NASA Lewis Research Center and provides information for users who wish to conduct experiments in this facility. Tunnel performance operating envelopes of altitude, dynamic pressure, Reynolds number, total pressure, and total temperature as a function of test section Mach number are presented. Operating envelopes are shown for both the aerodynamic (closed) cycle and the propulsion (open) cycle. The tunnel test section Mach number range is 2.0 to 3.5. General support systems, such as air systems, hydraulic system, hydrogen system, fuel system, and Schlieren system, are described. Instrumentation and data processing and acquisition systems are also described. Pretest meeting formats and schedules are outlined. Tunnel user responsibility and personnel safety are also discussed.
Radial velocity observations of VB10
Deshpande, R.; Martin, E.; Zapatero Osorio, M. R.; Del Burgo, C.; Rodler, F.; Montgomery, M. M.
2011-07-01
VB 10 is the smallest star known to harbor a planet according to the recent astrometric study of Pravdo & Shaklan [1]. Here we present near-infrared (J-band) radial velocity of VB 10 performed from high resolution (R~20,000) spectroscopy (NIRSPEC/KECK II). Our results [2] suggest radial velocity variability with amplitude of ~1 km/s, a result that is consistent with the presence of a massive planet companion around VB10 as found via long-term astrometric monitoring of the star by Pravdo & Shaklan. Employing an entirely different technique we verify the results of Pravdo & Shaklan.
Energy Technology Data Exchange (ETDEWEB)
Plisson, Christophe, E-mail: Christophe.2.plisson@gsk.com [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Salinas, Cristian [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Weinzimmer, David; Labaree, David; Lin, Shu-Fei; Ding, Yu-Shin [Yale University PET Center, Yale University School of Medicine, PO Box 208048 New Haven, CT (United States); Jakobsen, Steen [Aarhus PET Centre, Aarhus Sygehus, Norrebrogade 44, DK-8000 Aarhus C (Denmark); Smith, Paul W. [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom); Eiji, Kawanishi [Medicinal Chemistry Research Laboratories II, Research Division, Mitsubishi Tanabe Pharma Corporation, Saitama 335-8505 (Japan); Carson, Richard E. [Yale University PET Center, Yale University School of Medicine, PO Box 208048 New Haven, CT (United States); Gunn, Roger N.; Rabiner, Eugenii A. [GlaxoSmithKline, Clinical Imaging Centre Hammersmith Hospital, London, W12 0NN (United Kingdom)
2011-08-15
Introduction: The aim of this study was to evaluate a newly reported positron emission tomography (PET) radioligand [{sup 11}C]MP-10, a potent and selective inhibitor of the central phosphodiesterase 10A enzyme (PDE10A) in vivo, using PET. Methods: A procedure was developed for labeling MP-10 with carbon-11. [{sup 11}C]MP-10 was evaluated in vivo both in the pig and baboon brain. Results: Alkylation of the corresponding desmethyl compound with [{sup 11}C]methyl iodide produced [{sup 11}C]MP-10 with good radiochemical yield and specific activity. PET studies in the pig showed that [{sup 11}C]MP-10 rapidly entered the brain reaching peak tissue concentration at 1-2 min postadministration, followed by washout from the tissue. Administration of a selective PDE10A inhibitor reduced the binding in all brain regions to the levels of the cerebellum, demonstrating the saturability and selectivity of [{sup 11}C]MP-10 binding. In the nonhuman primate, the brain tissue kinetics of [{sup 11}C]MP-10 were slower, reaching peak tissue concentrations at 30-60 min postadministration. In both species, the observed rank order of regional brain signal was striatum>diencephalon>cortical regions=cerebellum, consistent with the known distribution and concentration of PDE10A. [{sup 11}C]MP-10 brain kinetics were well described by a two-tissue compartment model, and estimates of total volume of distribution (V{sub T}) were obtained. Blocking studies with unlabeled MP-10 revealed the suitability of the cerebellum as a reference tissue and enabled the estimation of regional binding potential (BP{sub ND}) as the outcome measure of specific binding. Quantification of [{sup 11}C]MP-10 binding using the simplified reference tissue model with cerebellar input function produced BP{sub ND} estimates consistent with those obtained by the two-tissue compartment model. Conclusion: We demonstrated that [{sup 11}C]MP-10 possesses good characteristics for the in vivo quantification of the PDE10A in the
Fabrication and tensile properties of rapidly solidified Cu-10wt. %Ni alloy. [Cu-10Ni
Energy Technology Data Exchange (ETDEWEB)
Baril, D; Angers, R; Baril, J [Dept. of Mining and Metallurgy, Laval Univ., Ste-Foy, Quebec (Canada)
1992-10-15
Cu-10wt.%Ni ribbons were produced by melt spinning and cut into small particles with a blade cutter mill. The powders were then hot consolidated to full density by hot pressing followed by hot extrusion. Tensile properties of the resulting pieces were measured. Cu-10wt.%Ni cast ingots were also hot extruded and mechanically tested to compare with the rapidly solidified alloy and to evaluate the possible benefits brought by the rapid solidification process.
39 CFR 10.3 - Post-employment activities.
2010-07-01
... 39 Postal Service 1 2010-07-01 2010-07-01 false Post-employment activities. 10.3 Section 10.3 Postal Service UNITED STATES POSTAL SERVICE THE BOARD OF GOVERNORS OF THE U.S. POSTAL SERVICE RULES OF CONDUCT FOR POSTAL SERVICE GOVERNORS (ARTICLE X) § 10.3 Post-employment activities. Governors are subject...
12 CFR 509.10 - Filing of papers.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Filing of papers. 509.10 Section 509.10 Banks... IN ADJUDICATORY PROCEEDINGS Uniform Rules of Practice and Procedure § 509.10 Filing of papers. (a) Filing. Any papers required to be filed, excluding documents produced in response to a discovery request...
48 CFR 719.273-10 - Internal controls.
2010-10-01
... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Internal controls. 719.273...égé Program 719.273-10 Internal controls. (a) OSDBU will oversee the Program and will work in... objectives. OSDBU will establish internal controls as checks and balances applicable to the Program. These...
32 CFR 635.10 - Release of information.
2010-07-01
... 32 National Defense 4 2010-07-01 2010-07-01 true Release of information. 635.10 Section 635.10 National Defense Department of Defense (Continued) DEPARTMENT OF THE ARMY (CONTINUED) LAW ENFORCEMENT AND CRIMINAL INVESTIGATIONS LAW ENFORCEMENT REPORTING Release of Information § 635.10 Release of information. (a) Release of information from Army...
16 CFR 1507.10 - Rockets with sticks.
2010-01-01
... 16 Commercial Practices 2 2010-01-01 2010-01-01 false Rockets with sticks. 1507.10 Section 1507.10... FIREWORKS DEVICES § 1507.10 Rockets with sticks. Rockets with sticks (including skyrockets and bottle rockets) shall utilize a straight and rigid stick to provide a direct and stable flight. Such sticks shall...
28 CFR 550.10 - Purpose and scope.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Purpose and scope. 550.10 Section 550.10... Alcohol Testing § 550.10 Purpose and scope. The Bureau of Prisons maintains a surveillance program in..., or who are considered high risks based on behavior observed or on information received by staff. (a...
21 CFR 340.10 - Stimulant active ingredient.
2010-04-01
... 21 Food and Drugs 5 2010-04-01 2010-04-01 false Stimulant active ingredient. 340.10 Section 340.10 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS FOR HUMAN USE STIMULANT DRUG PRODUCTS FOR OVER-THE-COUNTER HUMAN USE Active Ingredient § 340.10...
Coenzyme Q 10: multiple benefits in one ingredient
Directory of Open Access Journals (Sweden)
Littarru Gian Paolo
2011-03-01
Full Text Available Coenzyme Q is a lipid molecule widely diffused in nature; in humans and other mammals it is present as coenzyme Q10. (CoQ10. The first recognized role of CoQ10 was in mitochondrial bioenergetics, where it plays a central role in the production of ATP. It is also present in other subcellular organelles, both in its oxidized and in its reduced state (ubiquinol-10. The reduced form of CoQ10 is endowed with powerful antioxidant activity: it acts as a chain-breaking antioxidant and is also capable of egenerating alpha-tocopherol, the active form of vitamin E. By these mechanisms CoQ10, together with vitamin E, protects lipoproteins from oxidation a process which bears considerable interest in preventing atherosclerosis. CoQ10 has also been found to support cardiovascular function and the latest findings indicate an active role in counteracting endothelial dysfunction, which is closely implicated in cardiovascular disease. CoQ10 also improves sperm motility, an effect which might be related both to its antioxidant and to its bioenergetic properties. Oxidative stress might be involved in neurodegenerative disease, and in migraine, two fields where the positive effects of CoQ10 have been documented. CoQ10 is synthesized by our body but is also present in food and can be taken as a nutritional supplement. The main source of industrially produced CoQ10 is yeast fermentation. The process results in CoQ10 which is identical to the naturally occurring molecule. Ubiquinol, the reduced form of CoQ10, has recently become available.
Acute and subacute toxicity of 10B-paraboronophenylalanine
International Nuclear Information System (INIS)
Taniyama, K.; Fujiwara, H.; Kuno, T.; Saito, N.; Shuntoh, H.; Sakaue, M.; Tanaka, C.
1989-01-01
The acute and subacute toxicities of 10B-paraboronophenylalanine (10B-BPA) were investigated in the rat, according to the Good Laboratory Practice Standard for safety studies on drugs in Japan. In the acute toxicity test of 10B-BPA, LD50 values of acidic 10B-BPA for intraperitoneal and subcutaneous injections were 640 mg/kg for male and 710 mg/kg for female rats, and more than 1,000 mg/kg for male and female rats, respectively. The LD50 values of neutral 10B-BPA for intraperitoneal and subcutaneous injections were more than 3,000 mg/kg for male and female rats. The difference in LD50 values between acidic and neutral 10B-BPA may be attributed to the acidity of material. From the subacute toxicity test, in which the rats were injected daily subcutaneously for 28 days, the following toxic effects of 10B-BPA were observed. Increase in ketone level in the urine was induced in all rats treated with 10B-BPA. High dose of 10B-BPA (1,500 mg/kg) induced increase in spleen weight and reticulocyte count, and decrease in hemoglobin count, thereby suggesting that 10B-BPA causes hemolysis. Increases in the leukocyte count and the ratio of neutrophils and lymphocytes were also observed in rats treated with a high dose of 10B-BPA. This may be attributed to local reactions at the injection site. There were no significant differences in the findings between control rats and rats treated with a low dose of 10B-BPA (300 mg/kg). Thus, low doses of neutral 10B-BPA may be available for use as a drug
International Nuclear Information System (INIS)
Wu Zongxin; Jing Xingqing
2001-01-01
The 10 MW high temperature cooled reactor (HTR-10) built in Tsinghua University is a pebble bed type of HTGR. The continuous recharge and multiple-pass of spherical fuel elements are used for fuel management. The initiative stage of core is composed of the mix of spherical fuel elements and graphite elements. The equilibrium stage of core is composed of identical spherical fuel elements. The fuel management during the transition from the initiative stage to the equilibrium stage is a key issue for HTR-10 physical design. A fuel management strategy is proposed based on self-adjustment of core reactivity. The neutron physical code is used to simulate the process of fuel management. The results show that the graphite elements, the recharging fuel elements below the burn-up allowance, and the discharging fuel elements over the burn-up allowance could be identified by burn-up measurement. The maximum of burn-up fuel elements could be controlled below the burn-up limit
APOLLO 10 ASTRONAUT ENTERS LUNAR MODULE SIMULATOR
1969-01-01
Apollo 10 lunar module pilot Eugene A. Cernan prepares to enter the lunar module simulator at the Flight Crew Training Building at the NASA Spaceport. Cernan, Apollo 10 commander Thomas P. Stafford and John W. Young, command module pilot, are to be launched May 18 on the Apollo 10 mission, a dress rehearsal for a lunar landing later this summer. Cernan and Stafford are to detach the lunar module and drop to within 10 miles of the moon's surface before rejoining Young in the command/service module. Looking on as Cernan puts on his soft helmet is Snoopy, the lovable cartoon mutt whose name will be the lunar module code name during the Apollo 10 flight. The command/service module is to bear the code name Charlie Brown.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI10 (Link to dictyBase) - - - Contig-U16270-1 FC-AI10F (Li...nk to Original site) FC-AI10F 405 - - - - - - Show FC-AI10 Library FC (Link to library) Clone ID FC-AI10 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI10Q.Seq.d/ Representative seq. ID FC-AI...10F (Link to Original site) Representative DNA sequence >FC-AI10 (FC-AI10Q) /CSM/FC/FC-AI/FC-AI10Q.Seq.... sequence RKKRKSDYTSFSTYIHKLLKQITPPTNAKSNEKGDRKFTISSKAMSVMNSFVHDIFDRIA TEASGLAKKKKRQTLHSRDIQVAVRIILTGELAXHAI
International Nuclear Information System (INIS)
Yang Shijun; Cui Jianhe; Xue Mei
2005-01-01
Objective: To explore the roles played by IL-8 and IP-10 in the development and pathogenesis of psoriasis. Methods: Serum IL-8 (with RIA) and IP-10 (with ELISA) contents were measured in 47 patients with psoriasis and 42 controls. Results: The serum contents of IL-8 and IP-10 were significantly higher in the patients with psoriasis than those in the controls (P<0.01). Conclusion: IL-8 and IP-10 participated in the pathogenesis of psoriasis. Possible mechanisms were discussed. (authors)
30 CFR 700.10 - Information collection.
2010-07-01
... longer a surface coal mining and reclamation operation and thereby when regulatory jurisdiction may end... 30 Mineral Resources 3 2010-07-01 2010-07-01 false Information collection. 700.10 Section 700.10 Mineral Resources OFFICE OF SURFACE MINING RECLAMATION AND ENFORCEMENT, DEPARTMENT OF THE INTERIOR GENERAL...
24 CFR 330.10 - Eligible collateral.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Eligible collateral. 330.10 Section... SECURITIES § 330.10 Eligible collateral. The Association, in its discretion, shall determine what collateral is eligible for inclusion in the Multiclass Securities program. Eligible collateral may include GNMA...
40 CFR 86.884-10 - Information.
2010-07-01
... and torque. (10) Maximum air flow. (11) Maximum and test air inlet restriction. (12) Exhaust pipe diameter(s). (13) Maximum exhaust system backpressure. (b) Test data; general. This information may be... New Diesel Heavy-Duty Engines; Smoke Exhaust Test Procedure § 86.884-10 Information. The following...
31 CFR 210.10 - RDFI liability.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false RDFI liability. 210.10 Section 210.10 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE FEDERAL GOVERNMENT PARTICIPATION IN THE AUTOMATED...
U.S. Environmental Protection Agency — This data layer identifies areas in the U.S. where air pollution levels have not met the National Ambient Air Quality Standards (NAAQS) for PM 10 and have been...
26 CFR 1.857-10 - Information returns.
2010-04-01
... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Information returns. 1.857-10 Section 1.857-10 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Real Estate Investment Trusts § 1.857-10 Information returns. Nothing in §§ 1.857-8 and 1...
12 CFR 263.10 - Filing of papers.
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false Filing of papers. 263.10 Section 263.10 Banks... OF PRACTICE FOR HEARINGS Uniform Rules of Practice and Procedure § 263.10 Filing of papers. (a) Filing. Any papers required to be filed, excluding documents produced in response to a discovery request...
12 CFR 308.10 - Filing of papers.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Filing of papers. 308.10 Section 308.10 Banks... AND PROCEDURE Uniform Rules of Practice and Procedure § 308.10 Filing of papers. (a) Filing. Any papers required to be filed, excluding documents produced in response to a discovery request pursuant to...