Foraging range and habitat use by Cape Vulture Gyps coprotheres from the Msikaba colony, Eastern Cape province, South Africa

Directory of Open Access Journals (Sweden)

Morgan B. Pfeiffer

2015-05-01

Full Text Available Despite the extent of subsistence farmland in Africa, little is known about endangered species that persist within them. The Cape Vulture (Gyps coprotheres is regionally endangered in southern Africa and at least 20% of the population breeds in the subsistence farmland area previously known as the Transkei in the Eastern Cape province of South Africa. To understand their movement ecology, adult Cape Vultures (n = 9 were captured and fitted with global positioning system/global system for mobile transmitters. Minimum convex polygons (MCPs,and 99% and 50% kernel density estimates (KDEs were calculated for the breeding and non breeding seasons of the Cape Vulture. Land use maps were constructed for each 99% KDE and vulture locations were overlaid. During the non-breeding season, ranges were slightly larger(mean [± SE] MCP = 16 887 km2 ± 366 km2 than the breeding season (MCP = 14 707 km2 ± 2155 km2. Breeding and non-breeding season MCPs overlapped by a total of 92%. Kernel density estimates showed seasonal variability. During the breeding season, Cape Vultures used subsistence farmland, natural woodland and protected areas more than expected. In the non-breeding season, vultures used natural woodland and subsistence farmland more than expected, and protected areas less than expected. In both seasons, human-altered landscapes were used less, except for subsistence farmland. Conservation implications: These results highlight the importance of subsistence farm land to the survival of the Cape Vulture. Efforts should be made to minimise potential threats to vultures in the core areas outlined, through outreach programmes and mitigation measures.The conservation buffer of 40 km around Cape Vulture breeding colonies should be increased to 50 km.

Diclofenac toxicity in Gyps vulture is associated with decreased uric acid excretion and not renal portal vasoconstriction.

Science.gov (United States)

Naidoo, V; Swan, G E

2009-04-01

Diclofenac (DF), a non-steroidal anti-inflammatory drug (NSAID), is largely regarded as one of the most devastating environmental toxicant in recent times, after accidental exposure via their food-chain lead to massive mortalities in three vulture species on the Asian subcontinent. Although the use of diclofenac was recently banned on the Indian subcontinent, following the favourable safety profile of meloxicam, its mechanism of toxicity remains unknown. In an attempt to establish this mechanism, we test three hypotheses using models established from either the domestic chicken (Gallus domesticus) or the African White-backed vulture (Gyps africanus). We demonstrate that both DF and meloxicam are toxic to renal tubular epithelial (RTE) cells following 12 h of exposure, due to an increase in production of reactive oxygen species (ROS), which could be temporarily ameliorated by pre-incubation with uric acid (UA). When cultures were incubated with either drug for only 2 h, meloxicam showed no toxicity in contrast to diclofenac. In both cases no increase in ROS production was evident. In addition, diclofenac decreased the transport of uric acid, by interfering with the p-amino-hippuric acid (PAH) channel. We conclude that vulture susceptibility to diclofenac results from a combination of an increased ROS, interference with UA transport and the duration of exposure.

Himalayan Vultures in Khodpe, far-west Nepal: is there any threat?

Directory of Open Access Journals (Sweden)

Manoj Kumar Joshi

2015-11-01

Full Text Available There is evidence that Himalayan Vulture Gyps himalayensis is susceptible to the veterinary drug diclofenac, which is responsible for the decline of other Gyps species across South Asia.  Unlike other Gyps species, there is little quantitative data to assess Himalayan Vultures population.  Based on observation, we analyzed the flock size and breeding success of the Himalayan Vultures on two cliffs of Khodpe in Baitadi District, far-west Nepal.  The mean flock size of Himalayan Vulture was 25.83±6.33.  Overall breeding success was 90.9% based on active nests.  We also conducted a questionnaire survey to assess the perceived threats in the view of local people to vultures and these threats include loss of food, veterinary drug, lack of proper nest sites, and lack of public awareness.  Additionally, 76% of the respondents felt that vultures were decreasing in the area, 94.7% were not aware of the toxicity of diclofenac to vultures, and very few (2% knew about the availability of meloxicam as a safe alternative drug.  The colony we studied is one of the few remaining known breeding populations, which provide baseline information from far-west Nepal, thus we recommend for conservation and continuous monitoring of this species to understand their population change and breeding biology. 

Lappet-faced Vulture (Torgos tracheliotos) breeding in Ithala Game ...

African Journals Online (AJOL)

Predator simulation, re-colonization, KwaZulu-Natal. African White-backed Vulture Gyps africanus, Lappet-faced. Vulture Torgos tracheliotos. Authors' addresses: Ian Rushworth & James Wakelin, Ezemvelo KwaZulu-Natal. Wildlife, P.O. Box 13053, Cascades 3202, KwaZulu-Natal,. South Africa; Gary Bawden, Ithala Game ...

Vulture News - Vol 55 (2006)

African Journals Online (AJOL)

First record of Himalayan Griffon vulture Gyps himalyensis in Chhep, Preah Vihear, northern Cambodia · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Martin Gilbert, Song Chansocheat, Nadia Sureda, 4-5 ...

How do colonial Eurasian Griffon Vultures prevent extra-pair mating?

Directory of Open Access Journals (Sweden)

Joan Bertran

2016-02-01

Full Text Available In colonial breeding species, preventive measures to reduce the risks of extra-pair copulations (EPCs should reflect the actual risk perceived by males (e.g., proximity of neighbors, intrusions into the nest mainly during the fertile period. In colonial vultures, specific studies examining the preventive measures that minimize the risks of EPCs occurring within the competitive context of colonial breeding have not been conducted. Here we tested at Eurasian Griffon Vulture (Gyps fulvus nesting sites the intensity of paternity assurance behavior, shown as frequency and duration of within-pair copulations (WPCs, potential mate vigilance or nest attendance, and levels of aggressivity. This was measured according to the frequency of territorial intrusions and comparison of the fertile vs. the non-fertile period. Our findings suggest that the frequency of WPCs and their duration increased significantly during the presumed fertile period, regarded as the period when Griffon pairs spent significantly more time together at their nests. In addition, low levels of territorial intrusions were observed, an aggressive response of pairs towards intruders, and a relatively high presence of pairs at the nests during the fertile period. Thus, although nesting sites are subject to low exposure to EPC attempts, the increased frequency and duration of copulations during the fertile period suggests that, under pressure from the colonial breeding system, a higher rate of copulations is the most effective preventive mechanism against relative uncertainty of paternity.

Levels of blood lead in Griffon vultures from a Wildlife Rehabilitation Center in Spain.

Science.gov (United States)

González, Fernando; López, Irene; Suarez, Laura; Moraleda, Virginia; Rodríguez, Casilda

2017-09-01

Lead is considered a highly toxic contaminant with important impacts to bird wildlife. Griffon vultures (Gyps fulvus) are a sensitive indicator of the level of environmental contamination due to their position at the top of the food chain and their dependence on human activities. The aim of this study was to assess susceptibility to lead intoxication in Griffon vultures admitted to Wildlife Rehabilitation Centers (WRC), measuring blood lead levels and determining if blood lead concentrations are related to clinical signs, hematological, biochemical or radiographic findings. Also, the influence of age, gender, body condition, season and primary cause of admission were evaluated. This study was realized in all Griffon vultures admitted during a period of one year in the Rehabilitation Center GREFA. Blood lead levels are measured by using anodic stripping voltammetry. In Griffon vultures, we observed that 26% of the analyzed birds presented lead levels above 20µg/dL with 74% below 20µg/dL ([Pb] lead according to sex, season of admission to the center and body condition. A negative correlation was found between levels of metal and hematocrit. No association was found between clinical signs and blood lead levels in Griffon vultures, except for digestive signs as stasis and weight loss. On numerous occasions, the intoxication in this specie is related to ingestion of lead ammunition; however, we have not detected radiographic lead in our vultures. Compared with other studies, we generally found low levels of lead in blood of Griffon vultures but the blood of all birds admitted to WRC presented detectable lead concentrations. This species apparently presents a higher sensibility to the toxic effects of this metal than that described by other authors. It have been observed that there is some evidence that suggests that subclinical levels of lead could be related with a predisposition to injury or diseases, even though these birds might be admitted for other causes. The

The Safety and Pharmacokinetics of Carprofen, Flunixin and Phenylbutazone in the Cape Vulture (Gyps coprotheres following Oral Exposure.

Directory of Open Access Journals (Sweden)

Tamsyn Fourie

Full Text Available The following study evaluates the overt toxic potential of carprofen (CRP, flunixin (FXN and phenylbutazone (PBZ in Old world vultures in relation to historic toxicity data for diclofenac and ketoprofen, with the Cape vulture (Gyps coprotheres being the indicator species. The toxic potential of a single oral dose of CRP (11.5 mg/kg, FXN (1 mg/kg,PBZ (1.7 mg/kg or water was evaluated by means of a four-way parallel study (n = 2, as means of ascertaining if these drugs were as toxic as diclofenac in the vulture. No unscheduled deaths or pathological lesions were noted following exposure. Clinical signs of lethargy and depression were, however, noted in one CRP, two FXN and one PBZ treated birds. Mild reversible inhibition of UA excretion was evident in all three groups, although UA remained within the population reference interval in contrast to the effects previously described for diclofenac and ketoprofen. All treatment groups had a drug concentration responsive increase in alanine transferase activity. CRP, FXN and PBZ were characterised by a maximum plasma concentration (Cmax of 1051.8 ± 620.7 ng/ml, 335.9 ± 36.3 ng/ml and 11150 ± 2474.9 ng/ml at 4 ± 4.3, 0.45 ± 0.02 and 5.3 ± 5.2 hours (Tmax respectively and a half-life of elimination of 13.3 ±5, 1.8±1 and 18.7 ±11.4 hours respectively. While we could not demonstrate a lethal effect of the tested substances, the presence of toxic clinical signs, clinical pathological changes and/or long half-lives of elimination suggests that all three drugs have a potential for toxicity in a larger population or on repeat administration. In conclusion while the studied substances were not as overtly toxic as diclofenac, they are of safety concern.

The Safety and Pharmacokinetics of Carprofen, Flunixin and Phenylbutazone in the Cape Vulture (Gyps coprotheres) following Oral Exposure.

Science.gov (United States)

Fourie, Tamsyn; Cromarty, Duncan; Duncan, Neil; Wolter, Kerri; Naidoo, Vinny

2015-01-01

The following study evaluates the overt toxic potential of carprofen (CRP), flunixin (FXN) and phenylbutazone (PBZ) in Old world vultures in relation to historic toxicity data for diclofenac and ketoprofen, with the Cape vulture (Gyps coprotheres) being the indicator species. The toxic potential of a single oral dose of CRP (11.5 mg/kg), FXN (1 mg/kg),PBZ (1.7 mg/kg) or water was evaluated by means of a four-way parallel study (n = 2), as means of ascertaining if these drugs were as toxic as diclofenac in the vulture. No unscheduled deaths or pathological lesions were noted following exposure. Clinical signs of lethargy and depression were, however, noted in one CRP, two FXN and one PBZ treated birds. Mild reversible inhibition of UA excretion was evident in all three groups, although UA remained within the population reference interval in contrast to the effects previously described for diclofenac and ketoprofen. All treatment groups had a drug concentration responsive increase in alanine transferase activity. CRP, FXN and PBZ were characterised by a maximum plasma concentration (Cmax) of 1051.8 ± 620.7 ng/ml, 335.9 ± 36.3 ng/ml and 11150 ± 2474.9 ng/ml at 4 ± 4.3, 0.45 ± 0.02 and 5.3 ± 5.2 hours (Tmax) respectively and a half-life of elimination of 13.3 ±5, 1.8±1 and 18.7 ±11.4 hours respectively. While we could not demonstrate a lethal effect of the tested substances, the presence of toxic clinical signs, clinical pathological changes and/or long half-lives of elimination suggests that all three drugs have a potential for toxicity in a larger population or on repeat administration. In conclusion while the studied substances were not as overtly toxic as diclofenac, they are of safety concern.

Blood lead levels in White-Backed Vultures (Gyps africanus) from ...

African Journals Online (AJOL)

Campbell Murn

Currently vulture populations in sub-. Saharan Africa are dramatically declining due to direct and indirect poisoning with pesticides (Ogada. 2014, Virani 2011). During a tagging and radio telemetry study from 2012 thru 2015 involving several species of vultures in. Botswana, the Denver Zoological. Foundation in ...

Observation of a population of Egyptian Vultures Neophron ...

African Journals Online (AJOL)

Campbell Murn

Observational study of behavior: sampling methods. Behaviour 49:227- 267. Baral, N., R. Gautam & B. Tamang .2005. Population status and breeding ecology of White-rumped Vulture Gyps bengalensis in Rampur Valley,. Nepal. Forktail 21: 87-91. Brandl, R., Utschick, H & Schmidtke, K. 1985. Raptors and land-use systems.

The effect of wind farms on vultures in northern Spain - fatalities behaviour and correction measures

Energy Technology Data Exchange (ETDEWEB)

Camina, Alvaro

2011-07-01

Full text: Spain is one of the leading countries on wind energy, accounting for 20,155 MW installed by 2010. The study has been made in a large area, 300 km long and 50 km width, extending over eight provinces accounting for 170 wind farms and 4605 turbines. 89 wind farms were sampled between 2001 and 2009 for bird fatalities. Collisions involved 2191 griffon vultures Gyps fulvus, the most affected species with 75% of them being adult birds. Other species colliding were the cinereous vulture Aegypius monachus (2 individuals) and the Egyptian vulture Neophron percnopterus (4 individuals). Around 5-10% of turbines caused up to 60% of fatalities and mortality was temporally clumped and related with the species biology. It was lower in January- February while griffons are incubating, increasing in March when hatching. Then, it was reduced until September with a new increase at November-December. In order to explain causes in detail and reduce mortality a pilot study was carried out in a portion of this area (10 wind farms and 267 turbines) from 2005 to the present. Due to high mortality rates on griffons, 33 turbines were shut down by authorities in June 2008. Relationships between flight altitude at turbines area with both weather conditions and landscape features were analysed by means of statistical parametric GLM models. Results included air temperature; turbine features such as its slope and time of the year as significant variables. On the other side, the European policy against the Bovine Spongiform Encephalopathy (BSE) also contributed to increase both mortality and vulture.s crossings through the turbines. Closure of vulture restaurants and carcass removal in the area caused food lacking for these birds. Then, they were forced to feed from a rubbish dump close to the turbines. Correction measures such as opening vulture restaurants since June 2009 and ceasing droppings at the rubbish dump significantly reduced flying rates of griffons to previous levels. In

Naturally acquired antibodies to Bacillus anthracis protective antigen in vultures of southern Africa

Directory of Open Access Journals (Sweden)

P. C.B. Turnbull

2008-08-01

Full Text Available TURNBULLP, P.C.B. DIEKMANNM,M., KILIAN, J.W., VERSFELDW, W.,DE VOS, V., ARNTZENL, L.,WOLTER, K., BARTELS, P. & KOTZE, A. 2008.N aturally acquired antibodies to Bacillusa nthracisp rotective antigeni n vultureso f southern Africa. Onderstepoort Journal of Veterinary Research, T5:95-102 Sera from 19 wild caught vultures in northern Namibia and 15 (12 wild caught and three captive bred but with minimal histories in North West Province, South Africa, were examined by an enzyme-linked immunosorbenats say( ELISAf or antibodiesto the Bacillus anthracis toxin protective antigen (PA. As assessed from the baseline established with a control group of ten captive reared vultures with well-documented histories, elevated titres were found in 12 of the 19 (63% wild caught Namibian birds as compared with none of the 15 South African ones. There was a highly significant difference between the Namibian group as a hole and the other groups (P 0.05. Numbers in the Namibian group were too small to determine any significances in species-, sex- or age-related differences within the raw data showing elevated titres in four out of six Cape Vultures, Gyps coprotheress, six out of ten Whitebacked Vultures, Gyps africanus, and one out of three Lappet-faced Vultures, Aegypiust racheliotus, or in five of six males versus three of seven females, and ten of 15 adults versus one of four juveniles. The results are in line with the available data on the incidence of anthrax in northern Namibia and South Africa and the likely contact of the vultures tested with anthrax carcasses. lt is not known whether elevated titre indicates infection per se in vultures or absorption of incompletely digested epitopes of the toxin or both. The results are discussed in relation to distances travelled by vultures as determined by new tracking techniques, how serology can reveal anthrax activity in an area and the issue of the role of vultures in transmission of anthrax.

Cape Vulture Gyps coprotheres caught in gin trap

African Journals Online (AJOL)

campbell

its right foot fly into its nest situated on a cliff face and containing a large chick. The chain used to tether the trap to the ground could be clearly seen dangling below the flying bird. We have no way of knowing whether the deployment of this trap was accidental or intentional relative to its having caught a Cape Vulture.

A survey of White-rumped Vultures Gyps bengalensis in Gujarat ...

African Journals Online (AJOL)

2007-09-02

Sep 2, 2007 ... During the field survey, 73.1% of the vultures were found soaring, 13.7% were perching on trees and/or the ground, while 13.2% were observed feeding on ..... A Pictorial Guide to the Birds of the Indian subcontinent. Bombay ...

Dropping dead: causes and consequences of vulture population declines worldwide.

Science.gov (United States)

Ogada, Darcy L; Keesing, Felicia; Virani, Munir Z

2012-02-01

Vultures are nature's most successful scavengers, and they provide an array of ecological, economic, and cultural services. As the only known obligate scavengers, vultures are uniquely adapted to a scavenging lifestyle. Vultures' unique adaptations include soaring flight, keen eyesight, and extremely low pH levels in their stomachs. Presently, 14 of 23 (61%) vulture species worldwide are threatened with extinction, and the most rapid declines have occurred in the vulture-rich regions of Asia and Africa. The reasons for the population declines are varied, but poisoning or human persecution, or both, feature in the list of nearly every declining species. Deliberate poisoning of carnivores is likely the most widespread cause of vulture poisoning. In Asia, Gyps vultures have declined by >95% due to poisoning by the veterinary drug diclofenac, which was banned by regional governments in 2006. Human persecution of vultures has occurred for centuries, and shooting and deliberate poisoning are the most widely practiced activities. Ecological consequences of vulture declines include changes in community composition of scavengers at carcasses and an increased potential for disease transmission between mammalian scavengers at carcasses. There have been cultural and economic costs of vulture declines as well, particularly in Asia. In the wake of catastrophic vulture declines in Asia, regional governments, the international scientific and donor communities, and the media have given the crisis substantial attention. Even though the Asian vulture crisis focused attention on the plight of vultures worldwide, the situation for African vultures has received relatively little attention especially given the similar levels of population decline. While the Asian crisis has been largely linked to poisoning by diclofenac, vulture population declines in Africa have numerous causes, which have made conserving existing populations more difficult. And in Africa there has been little

Antibiotics threaten wildlife: circulating quinolone residues and disease in Avian scavengers.

Directory of Open Access Journals (Sweden)

Jesús A Lemus

Full Text Available Antibiotic residues that may be present in carcasses of medicated livestock could pass to and greatly reduce scavenger wildlife populations. We surveyed residues of the quinolones enrofloxacin and its metabolite ciprofloxacin and other antibiotics (amoxicillin and oxytetracycline in nestling griffon Gyps fulvus, cinereous Aegypius monachus and Egyptian Neophron percnopterus vultures in central Spain. We found high concentrations of antibiotics in the plasma of many nestling cinereous (57% and Egyptian (40% vultures. Enrofloxacin and ciprofloxacin were also found in liver samples of all dead cinereous vultures. This is the first report of antibiotic residues in wildlife. We also provide evidence of a direct association between antibiotic residues, primarily quinolones, and severe disease due to bacterial and fungal pathogens. Our results indicate that, by damaging the liver and kidney and through the acquisition and proliferation of pathogens associated with the depletion of lymphoid organs, continuous exposure to antibiotics could increase mortality rates, at least in cinereous vultures. If antibiotics ingested with livestock carrion are clearly implicated in the decline of the vultures in central Spain then it should be considered a primary concern for conservation of their populations.

Not in wilderness: African vulture strongholds remain in areas with high human density

Science.gov (United States)

Granadeiro, José Pedro; Monteiro, Hamilton; Nuno, Ana; Lecoq, Miguel; Cardoso, Paulo; Regalla, Aissa; Catry, Paulo

2018-01-01

Vultures constitute an important functional group in many ecosystems, providing crucial ecosystem services both in natural and humanized environments. These scavengers are facing massive declines worldwide, but in several African countries virtually nothing is known on populations’ status and threats, hampering the development of adequate conservation strategies. In Guinea-Bissau, globally important populations of Hooded Necrosyrtes monachus and African white-backed vultures Gyps africanus were recently reported. Using the country as a study area, we aim to characterize human-vulture interactions in West Africa applying a multidisciplinary approach. We assessed the status and distribution of vulture populations using data from 1711 km of roadside transects, examined predictors of their distribution, and produced a nationwide population estimate for the Hooded Vulture, using an innovative method based on the relationship between the size of human population in settlements and vulture numbers. We conducted 47 stakeholder interviews to assess perceived roles played by vultures, and to investigate potential anthropogenic threats. Hooded vultures were strongly associated with high human population densities, whereas no relation was found between African white-backed and Rüppell’s vultures and any of the tested predictors, which included cattle density, precipitation and Normalized Difference Vegetation Index, among others. We estimate a national population of 43347 Hooded vultures, the largest population reported in the species range. Respondents were generally aware of the services provided by vultures, especially waste and carcass removal, including in urban areas. Hunting for witchcraft and traditional medicine was the most frequently recognised threat, while poisoning was ranked as having the highest impact. We hypothesise that poisoning-related mortality may be affecting African white-backed and Rüppell’s vultures’ distribution and explain their scarcity

Metabolism of aceclofenac in cattle to vulture-killing diclofenac.

Science.gov (United States)

Galligan, T H; Taggart, M A; Cuthbert, R J; Svobodova, D; Chipangura, J; Alderson, D; Prakash, V M; Naidoo, V

2016-10-01

The nonsteroidal anti-inflammatory drug (NSAID) diclofenac is highly toxic to Gyps vultures, and its recent widespread use in South Asia caused catastrophic declines in at least 3 scavenging raptors. The manufacture of veterinary formulations of diclofenac has since been banned across the region with mixed success. However, at least 12 other NSAIDs are available for veterinary use in South Asia. Aceclofenac is one of these compounds, and it is known to metabolize into diclofenac in some mammal species. The metabolic pathway of aceclofenac in cattle, the primary food of vultures in South Asia, is unknown. We gave 6 cattle the recommended dose of aceclofenac (2 mg/kg), collected blood thereafter at intervals for up to 12 h, and used liquid chromatography with mass spectrometry in a pharmacokinetic analysis of aceclofenac and diclofenac in the plasma. Nearly all the aceclofenac administered to the cattle was very rapidly metabolized into diclofenac. At 2 h, half the aceclofenac had been converted into diclofenac, and at 12 h four-fifths of the aceclofenac had been converted into diclofenac. Therefore, administering aceclofenac to livestock poses the same risk to vultures as administering diclofenac to livestock. This, coupled with the risk that aceclofenac may replace diclofenac in the veterinary market, points to the need for an immediate ban on all aceclofenac formulations that can be used to treat livestock. Without such a ban, the recovery of vultures across South Asia will not be successful. © 2016 Society for Conservation Biology.

High altitude and hemoglobin function in the vultures Gyps rueppelli and Aegypius monachus

DEFF Research Database (Denmark)

Weber, Roy E.; Hiebl, Inge; Braunitzer, Gerhard

1988-01-01

Functional characteristics of the stripped composite hemoglobins (Hbs) of lhevultures Gyps rueppellii and Aegypills monachus that can fly at extremely high altitudes, and of component Hbs of G. rueppellii are reported, in relation to influences of pH, temperalure and inositol hexaphosphate. G...... structures of the constituent polypeptide chains to trace molecular adaptations to high-altitude respiration, and to physiological factors (pulmonary hypoxia and hypocapnia, body temperature shifts, and lung and nasal gas and heat exchange) to discern their possible survival value at altitudes of 11300 m....

A preliminary assessment of the potential risks from electrical ...

African Journals Online (AJOL)

... Grey-crowned Crane Balearica regulorum, Lesser Flamingo Phoeniconaias minor, White-backed Vulture Gyps africanus, Rüppell's Vulture Gyps rueppellii, Martial Eagle Polemaetus bellicosus, White Stork Ciconia ciconia, Secretarybird Sagittarius serpentarius, and various sit-and-wait raptors. These preliminary findings ...

How predictability of feeding patches affects home range and foraging habitat selection in avian social scavengers?

Directory of Open Access Journals (Sweden)

Sophie Monsarrat

Full Text Available Feeding stations are commonly used to sustain conservation programs of scavengers but their impact on behaviour is still debated. They increase the temporal and spatial predictability of food resources while scavengers have supposedly evolved to search for unpredictable resources. In the Grands Causses (France, a reintroduced population of Griffon vultures Gyps fulvus can find carcasses at three types of sites: 1. "light feeding stations", where farmers can drop carcasses at their farm (spatially predictable, 2. "heavy feeding stations", where carcasses from nearby farms are concentrated (spatially and temporally predictable and 3. open grasslands, where resources are randomly distributed (unpredictable. The impact of feeding stations on vulture's foraging behaviour was investigated using 28 GPS-tracked vultures. The average home range size was maximal in spring (1272 ± 752 km(2 and minimal in winter (473 ± 237 km(2 and was highly variable among individuals. Analyses of home range characteristics and feeding habitat selection via compositional analysis showed that feeding stations were always preferred compared to the rest of the habitat where vultures can find unpredictable resources. Feeding stations were particularly used when resources were scarce (summer or when flight conditions were poor (winter, limiting long-ranging movements. However, when flight conditions were optimal, home ranges also encompassed large areas of grassland where vultures could find unpredictable resources, suggesting that vultures did not lose their natural ability to forage on unpredictable resources, even when feeding stations were available. However during seasons when food abundance and flight conditions were not limited, vultures seemed to favour light over heavy feeding stations, probably because of the reduced intraspecific competition and a pattern closer to the natural dispersion of resources in the landscape. Light feeding stations are interesting tools

How predictability of feeding patches affects home range and foraging habitat selection in avian social scavengers?

Science.gov (United States)

Monsarrat, Sophie; Benhamou, Simon; Sarrazin, François; Bessa-Gomes, Carmen; Bouten, Willem; Duriez, Olivier

2013-01-01

Feeding stations are commonly used to sustain conservation programs of scavengers but their impact on behaviour is still debated. They increase the temporal and spatial predictability of food resources while scavengers have supposedly evolved to search for unpredictable resources. In the Grands Causses (France), a reintroduced population of Griffon vultures Gyps fulvus can find carcasses at three types of sites: 1. "light feeding stations", where farmers can drop carcasses at their farm (spatially predictable), 2. "heavy feeding stations", where carcasses from nearby farms are concentrated (spatially and temporally predictable) and 3. open grasslands, where resources are randomly distributed (unpredictable). The impact of feeding stations on vulture's foraging behaviour was investigated using 28 GPS-tracked vultures. The average home range size was maximal in spring (1272 ± 752 km(2)) and minimal in winter (473 ± 237 km(2)) and was highly variable among individuals. Analyses of home range characteristics and feeding habitat selection via compositional analysis showed that feeding stations were always preferred compared to the rest of the habitat where vultures can find unpredictable resources. Feeding stations were particularly used when resources were scarce (summer) or when flight conditions were poor (winter), limiting long-ranging movements. However, when flight conditions were optimal, home ranges also encompassed large areas of grassland where vultures could find unpredictable resources, suggesting that vultures did not lose their natural ability to forage on unpredictable resources, even when feeding stations were available. However during seasons when food abundance and flight conditions were not limited, vultures seemed to favour light over heavy feeding stations, probably because of the reduced intraspecific competition and a pattern closer to the natural dispersion of resources in the landscape. Light feeding stations are interesting tools for managing

Griffon – what's in a name?

African Journals Online (AJOL)

Campbell Murn

genus name of Gyps for Gyps vulgaris [= G.fulvus], which he ... Appendix to this note my translation of Perrault's article; curiously he ... My translation of Mr. Perrault's article. ANATOMICAL DESCRIPTION OF. TWO GRIFONS. The description that previous. Authors made of the Grifon does not fit any known animal: besides the.

Cape Vulture usurps Bearded Vulture nest | Crowson | Vulture News

African Journals Online (AJOL)

Cape Vulture usurps Bearded Vulture nest. John Crowson, Sonja Krüger. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More ...

Vulture updates - October 2016 - Around the World of Vultures ...

African Journals Online (AJOL)

Campbell Murn

2016-10-17

Oct 17, 2016 ... The CMS Africa-Eurasian Vulture. Multi-species Action Plan ... a novel success there. African roundup: The 2nd. Pan-. African Vulture Summit was integrated with Africa's regional contribution to the CMS Vulture. MsAP and was held as part of .... The movements of those birds have generated considerable ...

Lead and cadmium in wild birds in southeastern Spain

Energy Technology Data Exchange (ETDEWEB)

Garcia-Fernandez, A.J.; Sanchez-Garcia, J.A.; Luna, A. [Univ. of Murcia (Spain); Jimenez-Montalban, P. [Regional Environmental Agency, Murcia (Spain). Centro de Recuperacion de Fauna Silvestre El Valle

1995-12-01

The main purpose of this study was to monitor exposure to lead and cadmium in wild birds in Murcia, a southeastern region of Spain on the Mediterranean coast. This region lies on one of the African-European flyways. Samples of liver, kidney, brain, bone, and whole blood from several species of wild birds were obtained during 1993. The authors found a clear relationship between cadmium and lead concentrations in birds and their feedings habits. Vultures (Gyps fulvus) had the highest concentrations of lead (mean 40 {micro}g/dl in blood), and seagulls (Larus argentatus and Larus ridibundus) the highest concentrations of cadmium (mean 4.43 {micro}g/g in kidney). Insectivores had high concentrations of both metals, and diurnal and nocturnal raptors showed the lowest tissue concentrations. The findings that tissue and blood concentrations were generally not elevated suggests environmental (rather than acute) exposure. Birds from more industrialized areas of the region studied here had higher concentrations of both lead and cadmium.

Fatal embryo chondral damage associated with fluoroquinolones in eggs of threatened avian scavengers

International Nuclear Information System (INIS)

Lemus, J.A.; Blanco, G.; Arroyo, B.; Martinez, F.; Grande, J.

2009-01-01

Stabled livestock reared in housed conditions are often subjected to intensive treatments with veterinary drug, which residues may be present in livestock meat ingested by scavengers, but nothing is known about their presence in eggs of wild birds and their potential detrimental effects on breeding success. We searched for residues of veterinary drugs and other toxicants in infertile and embryonated unhatched eggs of griffon vultures (Gyps fulvus) and red kites (Milvus milvus), two threatened avian scavengers. Quinolones (ciprofloxacin and enrofloxacin) were found in most unhatched eggs of both scavenger species clearly associated with severe alterations in the development of embryo cartilage and bones that could preclude embryo movements and subsequently normal development, pre-hatch position and successful hatching. The detrimental effects on developing eggs of veterinary drugs from livestock operations may help to explain reduced breeding success of avian scavengers. - Fluoroquinolones used in livestock farming and found in eggs of avian scavenger caused severe alterations in embryo cartilage and bone development.

Fatal embryo chondral damage associated with fluoroquinolones in eggs of threatened avian scavengers

Energy Technology Data Exchange (ETDEWEB)

Lemus, J.A. [Departamento de Ecologia Evolutiva, Museo Nacional de Ciencias Naturales (CSIC), J. Gutierrez Abascal 2, 28006 Madrid (Spain); Blanco, G., E-mail: gublanco2@yahoo.e [Departamento de Ecologia Evolutiva, Museo Nacional de Ciencias Naturales (CSIC), J. Gutierrez Abascal 2, 28006 Madrid (Spain); Arroyo, B.; Martinez, F.; Grande, J. [Departamento de Ecologia Evolutiva, Museo Nacional de Ciencias Naturales (CSIC), J. Gutierrez Abascal 2, 28006 Madrid (Spain)

2009-08-15

Stabled livestock reared in housed conditions are often subjected to intensive treatments with veterinary drug, which residues may be present in livestock meat ingested by scavengers, but nothing is known about their presence in eggs of wild birds and their potential detrimental effects on breeding success. We searched for residues of veterinary drugs and other toxicants in infertile and embryonated unhatched eggs of griffon vultures (Gyps fulvus) and red kites (Milvus milvus), two threatened avian scavengers. Quinolones (ciprofloxacin and enrofloxacin) were found in most unhatched eggs of both scavenger species clearly associated with severe alterations in the development of embryo cartilage and bones that could preclude embryo movements and subsequently normal development, pre-hatch position and successful hatching. The detrimental effects on developing eggs of veterinary drugs from livestock operations may help to explain reduced breeding success of avian scavengers. - Fluoroquinolones used in livestock farming and found in eggs of avian scavenger caused severe alterations in embryo cartilage and bone development.

Status of birds of prey in Guinea-Bissau: first assessment based on ...

African Journals Online (AJOL)

... cover (based on the normalised difference vegetation index). Apart from Hooded Vultures and White-backed Vultures Gyps africanus, all other raptors in the IUCN Red List were found to be scarce, including other vultures and several medium-to-large eagles. Keywords: birds, Guinea-Bissau, raptors, transects, West Africa ...

Turkey vulture surveys in Cuba

Science.gov (United States)

Wotzkow, C.; Wiley, J.W.

1988-01-01

Turkey Vultures (Cathartes aura), were surveyed monthly in Cuba from March 1982-January 1983. A total of 25371 vultures were tallied in 7186 km (3.5 vultures/transect km) of roadside counting along main highways leading from the city of La Habana (northwestern Cuba) to the city of Las Tunas (southeast). Numbers of vultures counted declined substantially beyond 200 m from the transect road. Density of vultures observed within 200 m of the road along the transect route was 0.06/ha. Highest counts were obtained in March, April and June. Turkey Vulture flying activity was greatest during the periods 0900-1200 H and 1400-1700 H.

ARTICLES

African Journals Online (AJOL)

campbell

Abstract. A study on communal roosts of African White-backed Gyps africanus and. Hooded Vultures Necrosyrtes monachus in Wondo Genet College of Forestry and Natural Resources, southern Ethiopia was conducted from January to. March 2012 to investigate population dynamics of vultures. The population fluctuation ...

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-09-02

Sep 2, 2006 ... Does the King Vulture Sarcoramphus papa use a sense of smell to locate food? Ibis 126: 67-69. Houston, D.C. 1986. Scavenging efficacy of Turkey Vultures in Tropical Forest. Condor 88: 318-323. Stager, K.E. 1964. The role of olfaction in food location by the Turkey Vulture. Contrib. Sci. (Los Ang.) 8: 1.

High occurrence of extra-pair partnerships and homosexuality in a ...

African Journals Online (AJOL)

The Cape Vulture Gyps coprotheres is an Endangered colonial cliff-nesting species that is typically cited as monogamous. Observations of wild Cape Vulture colonies note extra-pair breeding activities but homosexual activity has never been confirmed. Observations of breeding behaviours within a captive colony were ...

The microbiome of New World vultures

DEFF Research Database (Denmark)

Roggenbuck, Michael; Schnell, Ida Baerholm; Blom, Nikolaj

2014-01-01

Vultures are scavengers that fill a key ecosystem niche, in which they have evolved a remarkable tolerance to bacterial toxins in decaying meat. Here we report the first deep metagenomic analysis of the vulture microbiome. Through face and gut comparisons of 50 vultures representing two species, we...... demonstrate a remarkably conserved low diversity of gut microbial flora. The gut samples contained an average of 76 operational taxonomic units (OTUs) per specimen, compared with 528 OTUs on the facial skin. Clostridia and Fusobacteria, widely pathogenic to other vertebrates, dominate the vulture's gut...... microbiota. We reveal a likely faecal-oral-gut route for their origin. DNA of prey species detectable on facial swabs was completely degraded in the gut samples from most vultures, suggesting that the gastrointestinal tracts of vultures are extremely selective. Our findings show a strong adaption of vultures...

Author Details

African Journals Online (AJOL)

Chansocheat, Song. Vol 55 (2006) - Articles Olfaction in Accipitrid vultures. Abstract PDF · Vol 55 (2006) - Articles First record of Himalayan Griffon vulture Gyps himalyensis in Chhep, Preah Vihear, northern Cambodia Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...

In South Asia, it's cattle vs vultures | Ganguli | Vulture News

African Journals Online (AJOL)

In South Asia, it's cattle vs vultures. Ishani Ganguli. Abstract. No Abstract. Vulture News Vol. 55, 2006: 50-51. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors ...

The microbiome of New World vultures.

Science.gov (United States)

Roggenbuck, Michael; Bærholm Schnell, Ida; Blom, Nikolaj; Bælum, Jacob; Bertelsen, Mads Frost; Sicheritz-Pontén, Thomas; Pontén, Thomas Sicheritz; Sørensen, Søren Johannes; Gilbert, M Thomas P; Graves, Gary R; Hansen, Lars H

2014-11-25

Vultures are scavengers that fill a key ecosystem niche, in which they have evolved a remarkable tolerance to bacterial toxins in decaying meat. Here we report the first deep metagenomic analysis of the vulture microbiome. Through face and gut comparisons of 50 vultures representing two species, we demonstrate a remarkably conserved low diversity of gut microbial flora. The gut samples contained an average of 76 operational taxonomic units (OTUs) per specimen, compared with 528 OTUs on the facial skin. Clostridia and Fusobacteria, widely pathogenic to other vertebrates, dominate the vulture's gut microbiota. We reveal a likely faecal-oral-gut route for their origin. DNA of prey species detectable on facial swabs was completely degraded in the gut samples from most vultures, suggesting that the gastrointestinal tracts of vultures are extremely selective. Our findings show a strong adaption of vultures and their bacteria to their food source, exemplifying a specialized host-microbial alliance.

Articles

African Journals Online (AJOL)

2011-09-01

Sep 1, 2011 ... that an exchange of information can occur at a colony, ... events, low adult survival rates and high emigration rates, and these sinks are therefore prone to ..... Eurasian griffons Gyps fulvus in the island of Crete, Greece. Wildlife ...

Fine-scale assessment of home ranges and activity patterns for resident black vultures (Coragyps atratus and turkey vultures (Cathartes aura.

Directory of Open Access Journals (Sweden)

Amanda E Holland

Full Text Available Knowledge of black vulture (Coragyps atratus and turkey vulture (Cathartes aura spatial ecology is surprisingly limited despite their vital ecological roles. Fine-scale assessments of space use patterns and resource selection are particularly lacking, although development of tracking technologies has allowed data collection at finer temporal and spatial resolution. Objectives of this study were to conduct the first assessment of monthly home range and core area sizes of resident black and turkey vultures with consideration to sex, as well as elucidate differences in monthly, seasonal, and annual activity patterns based on fine-scale movement data analyses. We collected 2.8-million locations for 9 black and 9 turkey vultures from June 2013 -August 2015 using solar-powered GSM/GPS transmitters. We quantified home ranges and core areas using the dynamic Brownian bridge movement model and evaluated differences as a function of species, sex, and month. Mean monthly home ranges for turkey vultures were ~50% larger than those of black vultures, although mean core area sizes did not differ between species. Turkey vulture home ranges varied little across months, with exception to a notable reduction in space-use in May, which corresponds with timing of chick-rearing activities. Black vulture home ranges and core areas as well as turkey vulture core areas were larger in breeding season months (January-April. Comparison of space use between male and female vultures was only possible for black vultures, and space use was only slightly larger for females during breeding months (February-May. Analysis of activity patterns revealed turkey vultures spend more time in flight and switch motion states (between flight and stationary more frequently than black vultures across temporal scales. This study reveals substantive variability in space use and activity rates between sympatric black and turkey vultures, providing insights into potential behavioral mechanisms

Epibiotic ciliates Scyphidia sp. and diatoms on Tigriopus fulvus (Copepoda: Harpacticoida exoskeleton

Directory of Open Access Journals (Sweden)

Luigi Pane

2014-12-01

Full Text Available Several microorganisms – epibionts – can adhere to living supports taking advantage for their survival, feeding and movement. Epibiosis occurs particularly in aquatic environments, on both benthic and planktonic organisms, among which copepods and cladocerans represent an important living support. The harpacticoid copepod Tigriopus fulvus, living in the splashpools of rocky coasts, was studied to recognize the occurrence of epibionts on the exoskeleton surface using scanning electon microscopy techniques. The first evidence of ciliate Scyphidia sp. on Tigriopus fulvus has been described and the occurrence of algae Cocconeis sp. has been observed as well. Epibionts were found to adhere to antennae, a site linked to the exploitation of water currents carrying food particles to mouthparts and to swimming legs. The reason of the occurrence on swimming legs is less clear and needs further observations. Pertinent results are described and discussed and the influence of epibionts on life cycle and behavior of Tigriopus fulvus is considered.

VULTURE NEWS 55.indd

African Journals Online (AJOL)

The Hooded Vulture Neophron monachus occurs naturally in most of Zambia's rural areas, especially around large cattle farms and human habitations. Being next to a large game farm, The Meintjes have a number of Hooded Vultures on their farm, Kamfinsa Dairy Farm. About seven years ago they slaughtered a sheep.

The microbiome of New World vultures

OpenAIRE

Roggenbuck, Michael; Schnell, Ida Baerholm; Blom, Nikolaj; Bælum, Jacob; Bertelsen, Mads Frost; Sicheritz-Pontén, Thomas; Sørensen, Søren Johannes; Gilbert, M. Thomas P.; Graves, Gary R.; Hansen, Lars Henrik

2014-01-01

Vultures are scavengers that fill a key ecosystem niche, in which they have evolved a remarkable tolerance to bacterial toxins in decaying meat. Here we report the first deep metagenomic analysis of the vulture microbiome. Through face and gut comparisons of 50 vultures representing two species, we demonstrate a remarkably conserved low diversity of gut microbial flora. The gut samples contained an average of 76 operational taxonomic units (OTUs) per specimen, compared with 528 OTUs on the fa...

Caracterización, diseño y producción recombinante de bacteriocinas y otros péptidos antimicrobianos, secuenciación genómica y efecto en la microbiota de péptidos bioactivos producidos por enterococos

OpenAIRE

Arbulu Ruiz, Sara

2016-01-01

El trabajo desarrollado en esta tesis doctoral ha empleado técnicas de microbiología y bioquímica clásicas, así como técnicas recientes de ingeniería genética, genómica y proteómica y describe en capítulos diferenciados, los siguientes objetivos: En el capítulo III, se describe la identificación y caracterización de bacterias lácticas (BAL) aísladas de heces de buitres leonados (Gyps fulvus subesp. fulvus) por su actividad antimicrobiana, genes que codifican bacteriocinas, factores potenciale...

Ecology and behaviour of Palm-nut Vultures Gypohierax angolensis ...

African Journals Online (AJOL)

Populations of many vulture species have undergone substantial declines. In Africa, 82% are threatened and although research on vultures has increased, the biology and ecology of several species is still poorly known. The Palm-nut Vulture Gypohierax angolensis has peculiar ecological characteristics, feeding on palm ...

The impact of urbanization and agricultural development on vultures ...

African Journals Online (AJOL)

The methodology uses point count surveys of vulture species density along an urban to forest gradient (dense downtown areas, suburbs, rural villages and farms, mixed uninhabited savanna, open and closed forests). The very common Black Vulture and the slightly less common Turkey Vulture were most often recorded in ...

Effects of vulture exclusion on carrion consumption by facultative scavengers.

Science.gov (United States)

Hill, Jacob E; DeVault, Travis L; Beasley, James C; Rhodes, Olin E; Belant, Jerrold L

2018-03-01

Vultures provide an essential ecosystem service through removal of carrion, but globally, many populations are collapsing and several species are threatened with extinction. Widespread declines in vulture populations could increase the availability of carrion to other organisms, but the ways facultative scavengers might respond to this increase have not been thoroughly explored. We aimed to determine whether facultative scavengers increase carrion consumption in the absence of vulture competition and whether they are capable of functionally replacing vultures in the removal of carrion biomass from the landscape. We experimentally excluded 65 rabbit carcasses from vultures during daylight hours and placed an additional 65 carcasses that were accessible to vultures in forested habitat in South Carolina, USA during summer (June-August). We used motion-activated cameras to compare carrion use by facultative scavenging species between the experimental and control carcasses. Scavenging by facultative scavengers did not increase in the absence of competition with vultures. We found no difference in scavenger presence between control carcasses and those from which vultures were excluded. Eighty percent of carcasses from which vultures were excluded were not scavenged by vertebrates, compared to 5% of carcasses that were accessible to vultures. At the end of the 7-day trials, there was a 10.1-fold increase in the number of experimental carcasses that were not fully scavenged compared to controls. Facultative scavengers did not functionally replace vultures during summer in our study. This finding may have been influenced by the time of the year in which the study took place, the duration of the trials, and the spacing of carcass sites. Our results suggest that under the warm and humid conditions of our study, facultative scavengers would not compensate for loss of vultures. Carcasses would persist longer in the environment and consumption of carrion would likely shift from

Dallas Zoo hunts for escaped vulture

African Journals Online (AJOL)

shows eating off the antelopes that lions kill and everything,” Mr Brown said. The African White-backed vultures have been at the zoo since August. They're expected to be part of an exhibit that is undergoing renovations. Mr Brown said vultures are hardy, resourceful animals. When the missing bird becomes hungry,.

Sympatric occurrence of four Cathartid vultures in the dry forests of ...

African Journals Online (AJOL)

dry forests of north-western Peru. Robert S R Williams. Frankfurt Zoological Society and Asociación TuTierra. rob@szfperu.org. This photograph, taken with a cameratrap, shows four species of Cathartid vultures: Andean Condor Vultur gryphus, King. Vulture Sarcoramphus papa, Turkey. Vulture Cathartes aura and Black ...

Vulture worries stalk activists on Uttarayan

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... Vulture worries stalk activists on Uttarayan. Anon. Ahmedabad – When kites take to the skies on Uttarayan, animal activists will be biting their nails in apprehension. Their main concern is the White-rumped. Vulture, a highly endangered species, of which only 137 birds are left in the city, according to figures ...

Age-Related Relationships between Innate Immunity and Plasma Carotenoids in an Obligate Avian Scavenger.

Science.gov (United States)

López-Rull, Isabel; Hornero-Méndez, Dámaso; Frías, Óscar; Blanco, Guillermo

2015-01-01

Variation in immunity is influenced by allocation trade-offs that are expected to change between age-classes as a result of the different environmental and physiological conditions that individuals encounter over their lifetime. One such trade-off occurs with carotenoids, which must be acquired with food and are involved in a variety of physiological functions. Nonetheless, relationships between immunity and carotenoids in species where these micronutrients are scarce due to diet are poorly studied. Among birds, vultures show the lowest concentrations of plasma carotenoids due to a diet based on carrion. Here, we investigated variations in the relationships between innate immunity (hemagglutination by natural antibodies and hemolysis by complement proteins), pathogen infection and plasma carotenoids in nestling and adult griffon vultures (Gyps fulvus) in the wild. Nestlings showed lower hemolysis, higher total carotenoid concentration and higher pathogen infection than adults. Hemolysis was negatively related to carotenoid concentration only in nestlings. A differential carotenoid allocation to immunity due to the incomplete development of the immune system of nestlings compared with adults is suggested linked to, or regardless of, potential differences in parasite infection, which requires experimental testing. We also found that individuals with more severe pathogen infections showed lower hemagglutination than those with a lower intensity infection irrespective of their age and carotenoid level. These results are consistent with the idea that intraspecific relationships between innate immunity and carotenoids may change across ontogeny, even in species lacking carotenoid-based coloration. Thus, even low concentrations of plasma carotenoids due to a scavenger diet can be essential to the development and activation of the immune system in growing birds.

Vulture populations in Pakistan and the Gyps Vulture Restoration ...

African Journals Online (AJOL)

near 50%, suggesting that extinction, at least across most of the range for these. March 2008 ... (approximately 90 km north-west of. Multan), were extinct by the 2003/2004 breeding season. .... Worldwide: Proceedings of the VI World Conference on Birds of Prey and Owls,. Budapest, Hungary, 18-23 May 2003. Chancellor ...

Confirmed organophosphorus and carbamate pesticide poisonings in South African wildlife (2009–2014

Directory of Open Access Journals (Sweden)

Christo J. Botha

2015-12-01

Full Text Available During a six-year period (from January 2009 to December 2014, specimens collected from 344 cases of suspected organophosphorus and carbamate pesticide poisonings in wildlife, including birds, were submitted to the Toxicology Laboratory (ARC-OVI for analysis. A positive diagnosis was made in 135 (39% of these cases. The majority of cases were from birds, which included Cape vultures (Gyps coprotheres and African white-backed vultures (Gyps africanus and bateleur eagles (Terathopius ecaudatus. In one incident 49 vultures were killed when a farmer intentionally laced carcasses with carbofuran in an attempt to control jackal predation. There were 22 incidents of poisoning in helmeted guineafowl (Numida meleagris. On nine different occasions blue cranes (Anthropoides paradiseus were poisoned, in one incident 14 birds were reported to have been killed. Over the period of investigation, there were 20 cases of poisoning involving mammalian species, the majority being vervet monkeys (Chlorocebus pygerythrus. The carbamate pesticides were responsible for 57 incidents of poisoning. Aldicarb, carbofuran and methomyl were detected in 26, 18 and 12 cases respectively. The majority of organophosphorus pesticide poisonings were caused by diazinon (n = 19, monocrotophos (n = 13 and methamidophos (n = 10.

Removal (and attempted removal) of material from a Hooded Vulture ...

African Journals Online (AJOL)

Relatively little is documented about nest material theft in vultures. We used camera traps to monitor Hooded Vulture Necrosyrtes monachus nests for a year. We report camera trap photographs of a starling Lamprotornis sp. removing what appeared to be dung from an inactive Hooded Vulture nest on Cleveland Game ...

Collision vulnerability of vultures at established windfarms

African Journals Online (AJOL)

Campbell Murn

Acquisition (SCADA) systems. (Davenport et al. 2011) as well as the strategic positioning of vulture restaurants to draw vultures away from these areas (Martin et al. 2012). Acknowledgements. An unknown reviewer is thanked for comments on a previous draft of this note. References. Baidya Roy, S., Pacala, S.W. & Walko, ...

Significant population of Egyptian Vulture Neophron percnopterus ...

African Journals Online (AJOL)

The Egyptian Vulture Neophron percnopterus population in Morocco has undergone a marked decline since the 1980s to the point of nearing local extinction in the twenty-first century. A field study of some possible sites for Egyptian Vultures was carried out over six days during June 2014 in the Middle Atlas Mountains, ...

Tree-nesting Rüppells Griffon vultures | Rondeau | Vulture News

African Journals Online (AJOL)

Guy Rondeau, Phlippe Pilard, Bernard Ahon, Moussa Coundé. Abstract. No Abstract. Vulture News Vol. 55, 2006: 14-22. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians ...

Observations on the population and breeding status of the African ...

African Journals Online (AJOL)

The breeding success of the nests of 60 African White-backed Vultures Gyps africanus, nine Black-chested Snake Eagles Circaetus pectoralis and 12 Secretarybirds Sagittarius serpentarius was monitored for three years, during a seven-year population dynamics study on raptors in the Kgalagadi Transfrontier Park (KTP).

The first whole genome and transcriptome of the cinereous vulture reveals adaptation in the gastric and immune defense systems and possible convergent evolution between the Old and New World vultures.

Science.gov (United States)

Chung, Oksung; Jin, Seondeok; Cho, Yun Sung; Lim, Jeongheui; Kim, Hyunho; Jho, Sungwoong; Kim, Hak-Min; Jun, JeHoon; Lee, HyeJin; Chon, Alvin; Ko, Junsu; Edwards, Jeremy; Weber, Jessica A; Han, Kyudong; O'Brien, Stephen J; Manica, Andrea; Bhak, Jong; Paek, Woon Kee

2015-10-21

The cinereous vulture, Aegypius monachus, is the largest bird of prey and plays a key role in the ecosystem by removing carcasses, thus preventing the spread of diseases. Its feeding habits force it to cope with constant exposure to pathogens, making this species an interesting target for discovering functionally selected genetic variants. Furthermore, the presence of two independently evolved vulture groups, Old World and New World vultures, provides a natural experiment in which to investigate convergent evolution due to obligate scavenging. We sequenced the genome of a cinereous vulture, and mapped it to the bald eagle reference genome, a close relative with a divergence time of 18 million years. By comparing the cinereous vulture to other avian genomes, we find positively selected genetic variations in this species associated with respiration, likely linked to their ability of immune defense responses and gastric acid secretion, consistent with their ability to digest carcasses. Comparisons between the Old World and New World vulture groups suggest convergent gene evolution. We assemble the cinereous vulture blood transcriptome from a second individual, and annotate genes. Finally, we infer the demographic history of the cinereous vulture which shows marked fluctuations in effective population size during the late Pleistocene. We present the first genome and transcriptome analyses of the cinereous vulture compared to other avian genomes and transcriptomes, revealing genetic signatures of dietary and environmental adaptations accompanied by possible convergent evolution between the Old World and New World vultures.

Vulture worries stalk activists on Uttarayan | Anon | Vulture News

African Journals Online (AJOL)

Vulture News. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 56 (2007) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your Web ...

Vulture worries stalk activists on Uttarayan | Anon | Vulture News

African Journals Online (AJOL)

No Abstract. Vulture News Vol. 56 () 2007: pp.103-103. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

Mighty vulture back from near extinction | Nickerson | Vulture News

African Journals Online (AJOL)

No Abstract. Vulture News Vol. 56 () 2007: pp.104-105. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

Vulture significance in Ogoni Culture | Saale | AFRREV LALIGENS ...

African Journals Online (AJOL)

This study explained the spiritual and social significance of vulture in Ogoni culture. It also explained how the use of vulture to refer to human beings and its characteristics became sources of social relations and conflicts in Ogoni culture. It adopted both the anthropological and sociological approaches. Findings from the ...

Some statistics from the 2012 Lappet-faced Vulture chick ringing in ...

African Journals Online (AJOL)

Campbell Murn

The long and the short of it: Some statistics from the 2012. Lappet-faced Vulture chick ringing in the Namib. Holger Kolberg1 and Peter Bridgeford2. Vultures Namibia, P.O. Box 3699, Walvis Bay, Namibia. 1 email: holgerk@mweb.com.na, 2 email: pmbridge@iway.na. Vultures Namibia once again ringed. Lappet-faced.

Visitors to nests of Hooded Vultures Necrosyrtes monachus in ...

African Journals Online (AJOL)

We recommend expanding the Hooded Vulture nest monitoring programme to include more pairs. Keywords: Alopochen aegyptiaca, Chacma Baboon, Egyptian Goose, Hooded Vulture, Kruger-to-Canyons Biosphere Region, Martial Eagle, Necrosyrtes monachus, nest visitors, Papio ursinus, Polemaetus bellicosus ...

Comoé National Park – a refuge for critically endangered vulture ...

African Journals Online (AJOL)

Campbell Murn

vulture nests to assess the status of the different species in the south- west of the park;. 2. To capture two White- headed Vultures or White-backed. Vultures to equip them with satellite tags;. 3. To introduce the project to the park-authorities of the Office. Ivorien des Parcs et Reserves. (OIPR), to the Deutsche Gesellschaft.

Selected mineral and heavy metal concentrations in blood and ...

African Journals Online (AJOL)

Concentrations of eight essential elements (Ca, Co, Cr, Cu, Fe, Mn, Ni and Zn) and three toxic metals (Al, Pb and Sr) were measured in various tissue samples from African whitebacked (Pseudogyps africanus), Cape griffon (Gyps coprotheres) and Lappetfaced (Torgos tracheliotos) vultures in different regions of South ...

Tourism in protected areas: Disentangling road and traffic effects on intra-guild scavenging processes.

Science.gov (United States)

Donázar, José Antonio; Ceballos, Olga; Cortés-Avizanda, Ainara

2018-07-15

The expansion of road networks and the increase in traffic have emerged in recent years as key threats to the conservation of biodiversity. This is particularly concerning in many protected areas because the increase of recreational activities requiring the use of vehicles. Effects of roads and traffic within guild scenarios and ecological processes remain however poorly known. Here we examined how road proximity and traffic intensity influence patterns of resource use in an Old-World avian scavenger guild living in a protected natural park in northern Spain. We experimentally placed 130 carcasses at different distances from a scenic road in the centre of the park. Vehicles were recorded by means of traffic counters which revealed that maximum numbers were reached during weekends and holidays and during the middle hours of the day. Avian scavenger attendance at carcasses was recorded by means of camera-traps. Obligated scavengers, Eurasian griffon (Gyps fulvus) and Egyptian vultures (Neophron percnopterus) were frequently observed (59.4% and 37.7% of the consumed carcasses) together with five other facultative scavenger species. We found that the richness (number of species) and the probability of consumption of the resource were reduced the smaller the distance to the road and in days with higher traffic intensity. The same factors affected the probability of presence of all the scavenger species. Moreover, some of them, notably griffon vultures, showed hourly patterns of carcass attendance suggesting avoidance of maximum traffic levels. Our results highlight that roads and traffic would trigger consequences on the structure and functioning of scavenger food webs, which may be particularly concerning in protected areas with remarkable levels of biodiversity. Future regulations at protected areas should couple both traffic and tourist affluence with wildlife conservation. In this way important ecological processes would be preserved while maintaining a good

Raptor mortality in wind farms of southern Spain: mitigation measures on a major migration bottleneck area

Energy Technology Data Exchange (ETDEWEB)

Gallego, Antonio-Roman Munoz; Lucas, Manuela De; Casado, Eva; Ferrer, Miguel

2011-07-01

Full text: To assess and monitor the impact of wind farms on fauna is crucial if we want to achieve ecologically sustainable development of this renewable energy resource. Today there are clear evidences that the probability of raptor collision depends critically on species behaviour and weather conditions, and the topographic factors related to each windmill. In our study area EIA were not able to predict this differential risk and in these circumstances mitigating the causes of bird mortality becomes a task of major importance, especially to those wind farms located in the Strait of Gibraltar, a water crossing of 14 km at its shortest distance acting as a major migration bottleneck for Paleo-African soaring migrants. We collected all available information on raptor collision from 1992, when the first wind farm was installed, and from 2005 until present a total of 262 turbines, grouped into 20 wind farms, were surveyed in a daily basis through a surveillance program with the main goal of register the actual mortality of birds. A total of 1291 raptors of 19 species were found of which 78.5% correspond to two species, the griffon vulture (Gyps fulvus) and the kestrel (Falco tinnunculus). In order to mitigate the impact on raptors, and particularly on the griffon vulture, in 2007 a program based on selective stopping of turbines was imposed, in collaboration with the environmental competent authority, on new approved projects. During 2008 there was a reduction in mortality by 48%, which remained in 2009 with a remarkably lower economic cost. An analysis of the temporal collision patterns will be presented and discussed, with special attention to those species suffering higher mortality rate, and to those who have some degree of threat. (Author)

Decision-making by a soaring bird: time, energy and risk considerations at different spatio-temporal scales

Science.gov (United States)

Fluhr, Julie; Horvitz, Nir; Sarrazin, François; Hatzofe, Ohad

2016-01-01

Natural selection theory suggests that mobile animals trade off time, energy and risk costs with food, safety and other pay-offs obtained by movement. We examined how birds make movement decisions by integrating aspects of flight biomechanics, movement ecology and behaviour in a hierarchical framework investigating flight track variation across several spatio-temporal scales. Using extensive global positioning system and accelerometer data from Eurasian griffon vultures (Gyps fulvus) in Israel and France, we examined soaring–gliding decision-making by comparing inbound versus outbound flights (to or from a central roost, respectively), and these (and other) home-range foraging movements (up to 300 km) versus long-range movements (longer than 300 km). We found that long-range movements and inbound flights have similar features compared with their counterparts: individuals reduced journey time by performing more efficient soaring–gliding flight, reduced energy expenditure by flapping less and were more risk-prone by gliding more steeply between thermals. Age, breeding status, wind conditions and flight altitude (but not sex) affected time and energy prioritization during flights. We therefore suggest that individuals facing time, energy and risk trade-offs during movements make similar decisions across a broad range of ecological contexts and spatial scales, presumably owing to similarity in the uncertainty about movement outcomes. This article is part of the themed issue ‘Moving in a moving medium: new perspectives on flight’. PMID:27528787

Population and breeding success of Red-headed Vulture Sarcogyps ...

African Journals Online (AJOL)

Campbell Murn

the population trends of Red-headed and Egyptian Vultures in Nepal, where this study was undertaken. Large-scale surveys of domestic ungulate carcasses (the principal food source of vultures in South Asia) across India indicate that 10-11% of carcasses are contaminated with diclofenac (Cuthbert et al. 2011b).

Some Important Observations on the Populations of Hooded Vultures Necrosyrtes monachus in Urban Ghana

Directory of Open Access Journals (Sweden)

Francis Gbogbo

2016-01-01

Full Text Available Despite major declines in the population of vultures around the world, noticeable increases were reported in the populations of Hooded Vultures Necrosyrtes monachus over the past decade in Accra—an important vulture habitat in Ghana. In recent times, however, there is a growing concern that the vulture numbers are decreasing even though scientific data to support this is nonexisting. As a vital zoogeographical and conservation tool, it is important to keep an up-to-date knowledge about urban bird populations amidst rapid urbanization and associated changes. Using a combination of field data, literature review, and stakeholder consultations, it was indicative that severe decline might have indeed occurred in the populations of Hooded Vultures in Accra. Evidence suggests the killing of vultures for consumption, traditional medicine, and black magic in an undercover trade with possible transboundary connections as important underlying factor. Additional factors suspected to underlie the declines include changes in management of urban facilities and destruction of roosting and nesting trees. The implications of interspecific competition with Pied Crows Corvus albus on Hooded Vultures however remain unclear. There is an urgent need for conservation campaign and education to save the Hooded Vulture in Ghana.

Author Details

African Journals Online (AJOL)

van Stuyvenberg, Karen. Vol 66 (2014) - Articles Monitoring White-backed Vultures Gyps africanus in the North West Province (Stellaland), South Africa Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

Vultures have flown under radar Population boom inspires scientists ...

African Journals Online (AJOL)

2007-03-02

Mar 2, 2007 ... Page 1 ... age structure is.” USDA researchers are fitting 16 vultures with satellite transmitters this month to document movements and behavioural patterns of vultures near the Marine Corps Air. Station in Beaufort, S.C. The project will ... emergency landing at Merritt Island. Airport. “You're always constantly ...

Vultures and honeybees

African Journals Online (AJOL)

ZeldaH

in the Ganab area of the Namib-Naukluft. Park, Namibia, we came across an unusual occurrence: When we reached the chick in the nest, we found honeybees Apis mellifera, crowded over and covering the eyes of the young vulture. The Namib-Naukluft Park (NNP),. 49,785 km², is the largest conservation area in Namibia ...

Observations of White-backed Vultures eating plant material in ...

African Journals Online (AJOL)

campbell

small quantities of the green leaves and eagerly feed on dried leaves after the first winter frost without obvious negative effects (H. Stehn, pers. obs.). On being informed of the incident, NT was intrigued, as he had never heard of vultures eating plant material and as White-backed. Vultures eat primarily soft body parts and do ...

Record of Rüppell's Griffon Gyps rueppellii in southern KwaZulu ...

African Journals Online (AJOL)

ZeldaH

Modderfontein, 1645, South. Africa. ² P.O. Box 26776, Plains, 4243, South Africa. Rüppell's Griffon Gyps rueppellii is considered to be a rare vagrant to southern Africa (Hockey et al. 2005) and the first record for this species for the region is from Wabai ...

Movement ecology of migration in turkey vultures.

Science.gov (United States)

Mandel, J T; Bildstein, K L; Bohrer, G; Winkler, D W

2008-12-09

We develop individual-based movement ecology models (MEM) to explore turkey vulture (Cathartes aura) migration decisions at both hourly and daily scales. Vulture movements in 10 migration events were recorded with satellite-reporting GPS sensors, and flight behavior was observed visually, aided by on-the-ground VHF radio-tracking. We used the North American Regional Reanalysis dataset to obtain values for wind speed, turbulent kinetic energy (TKE), and cloud height and used a digital elevation model for a measure of terrain ruggedness. A turkey vulture fitted with a heart-rate logger during 124 h of flight during 38 contiguous days showed only a small increase in mean heart rate as distance traveled per day increased, which suggests that, unlike flapping, soaring flight does not lead to greatly increased metabolic costs. Data from 10 migrations for 724 hourly segments and 152 daily segments showed that vultures depended heavily upon high levels of TKE in the atmospheric boundary layer to increase flight distances and maintain preferred bearings at both hourly and daily scales. We suggest how the MEM can be extended to other spatial and temporal scales of avian migration. Our success in relating model-derived atmospheric variables to migration indicates the potential of using regional reanalysis data, as here, and potentially other regional, higher-resolution, atmospheric models in predicting changing movement patterns of soaring birds under various scenarios of climate and land use change.

The impact of traditional use on vultures in South Africa

African Journals Online (AJOL)

Campbell Murn

are betting and gambling, for improved business success, and intelligence in school children. Vulture is ... some 59,000 consumption events of vulture pieces. The total ... spirits (Berglund 1976). For this ... plants and animals to earn a living .... relationship with traders / Traditional. Healers at ..... through enhanced policy and.

Vulture News - Vol 66 (2014)

African Journals Online (AJOL)

The impact of urbanization and agricultural development on vultures in El Salvador · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Michael O'Neal Campbell, 16-28 ...

African vultures don't follow migratory herds: scavenger habitat use is not mediated by prey abundance.

Directory of Open Access Journals (Sweden)

Corinne J Kendall

Full Text Available The ongoing global decline in vulture populations raises major conservation concerns, but little is known about the factors that mediate scavenger habitat use, in particular the importance of abundance of live prey versus prey mortality. We test this using data from the Serengeti-Mara ecosystem in East Africa. The two hypotheses that prey abundance or prey mortality are the main drivers of vulture habitat use provide alternative predictions. If vultures select areas based only on prey abundance, we expect tracked vultures to remain close to herds of migratory wildebeest regardless of season. However, if vultures select areas where mortality rates are greatest then we expect vultures to select the driest regions, where animals are more likely to die of starvation, and to be attracted to migratory wildebeest only during the dry season when wildebeest mortality is greatest. We used data from GSM-GPS transmitters to assess the relationship between three vulture species and migratory wildebeest in the Mara-Serengeti ecosystem. Results indicate that vultures preferentially cluster around migratory herds only during the dry season, when herds experience their highest mortality. Additionally during the wet season, Ruppell's and Lappet-faced vultures select relatively dry areas, based on Normalized Difference Vegetation Index, whereas White-backed vultures preferred wetter areas during the wet season. Differences in habitat use among species may mediate coexistence in this scavenger guild. In general, our results suggest that prey abundance is not the primary driver of avian scavenger habitat use. The apparent reliance of vultures on non-migratory ungulates during the wet season has important conservation implications for vultures in light of on-going declines in non-migratory ungulate species and use of poisons in unprotected areas.

Coprophagy of African Wild Dog faeces by Hooded Vultures in ...

African Journals Online (AJOL)

Campbell Murn

Coprophagy by vertebrates is rare, especially among birds and species that consume the faeces of other species (Soave & Brand 1991,. Hirakawa 2001, Shimada 2012). While New World Vultures practice coprophagy (Del Hoyo et al. 1994,. Buckley 1999, Blanco et al. 2013), the only Old World vulture we could find that ...

Natural mortality factors for African White-backed Vultures in Namibia?

African Journals Online (AJOL)

2007-09-02

Sep 2, 2007 ... September 2007. Vulture News 57. 63. Figure 2. Lightning damage to the bark of the above camel thorn tree (photographer: Ann Scott). Figure 1. Carcass of an African White-backed Vulture below a nest in a camel thorn tree in the Kalahari Desert, Namibia (photographer: Ann Scott).

Natural mortality factors for African White-backed Vultures in Namibia?

African Journals Online (AJOL)

Natural mortality factors for African White-backed Vultures in Namibia? A Scott, M Scott, P Bridgeford, M Bridgeford. Abstract. No Abstract. Vulture News Vol. 57 2007: pp. 62-64. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online.

Vulture News - Vol 56 (2007)

African Journals Online (AJOL)

Radio-satelllite telemetry of a territorial bearded vulture Gypaetus barbatus in the Caucasus · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Gavashelishvili, MJ McGrady, 4-13 ...

Vulture News 71 November 2016 61 The Editor The Hindu Daily ...

African Journals Online (AJOL)

Campbell Murn

2016-11-17

Nov 17, 2016 ... governments, Non-Governmental Organizations and researchers to rescue vulture populations from the brink of extinction. Vultures play a very important role in ecosystems and biodiversity conservation by scavenging on dead animals thereby protecting humans from potentially lethal zoonotic diseases.

Cinereous Vulture Nesting Ecology in Ikh Nartyn Chuluu Nature Reserve, Mongolia

Directory of Open Access Journals (Sweden)

Richard P. Reading

2005-06-01

Full Text Available Cinereous vultures ( Aegypius monachus are the largest raptors in Eurasia. Little is known about the species, especially in Mongolia. We studied the nesting ecology of cinereous vultures in Ikh Nartyn Chuluu Nature Reserve, Dornogobi Aimag. To assess reproductive success, we located active nests and periodically checked to determine if they remained active. We measured nest sizes and, periodically, nestling sizes and weights. We located 42 active cinereous vulture nests (27 on rocks and 15 on trees in 2003 and 19 nests (14 on rocks and 5 on trees in 2004. Mean volume of active nests was 3.92 ± 0.39 m 3 ( n = 36. Most nests failed prior to egg hatching, but after hatching nesting success rates increased dramatically. Following hatching, cinereous vulture chicks grew linearly until leveling off just prior to fledging. We generated growth curves for chicks that allowed us to determine the average size of chicks on specific dates. Improving the prospects for successful cinereous vulture conservation likely requires a better understanding of nesting ecology. As such, we plan to improve the quality of our data by monitoring nests more intensively to determine incubation and fledging lengths, as well as causes of nest failures.

The treatment implementation advisor: a component of the GypsES project

Science.gov (United States)

Michael C. Saunders; Michael A. Foster

1991-01-01

The treatment implementation advisor is one of the knowledge based advisory modules of GypsES, a knowledge system environment for decision support in gypsy moth management. Its function is to provide detailed advice on intervention tactics for gypsy moth: e.g. aerial and ground application of insecticides and microbials, inundative or augmentative releases of...

Vulture rescue and rehabilitation in South Africa: An urban perspective

Directory of Open Access Journals (Sweden)

V. Naidoo

2011-04-01

Full Text Available SouthAfrica is home to 9 vulture species, of which 7 are endangered. While the cause of the population declines remains largely speculative, a vast amount of effort has been dedicated towards the protection of populations by ensuring sustainable and safe food sources for the various colonies. Limited focus was placed in the past on efforts related to the rescue and/or rehabilitation (R&R of injured birds and the release of these birds back into the wild. This paper provides an overview of the causes, the impact and success of 3 organisations involved in R&R efforts of vultures in the Magaliesberg mountain range and surrounding areas over a period of 10 years. Study material included 162 Cape griffon (CGV and 38 African white-backed (AWBV vultures. Datasets include the number, sex and age of birds received, the reason the vultures were brought in for R&R, surgical interventions performed and outcomes of rescue efforts. The CGV dominated the rehabilitation attempts. Results further show that a large number of apparently healthy birds were presented for veterinary treatment. The R&R data clearly indicate that the major cause of injuries was birds colliding with overhead pylons, as a high number of soft tissue and skeletal injuries were observed. The study also shows that successful releases of rescued birds are possible. It is concluded that urbanisation has had a major negative impact on vultures around the Magaliesberg mountain range.

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-09-02

Sep 2, 2006 ... this predatory behaviour had a profound impact on chick mortality rates. Even after the chicks fledged and began flying around the pan, the vultures persisted with predation. In earlyMay many of the juvenile birds had already joined the adult population in the remaining waters in the northern section of Sua ...

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-09-02

Sep 2, 2006 ... trapping expedition* to Chhep district,. Preah Vihear province ... Our trap had been baited the previous evening with a young cow, and within two hours of sunrise had attracted a mixed flock of 54 vultures. The birds strung themselves out in the trees above the bait ... patterns and to locate nest locations. As.

Vulture News - Vol 58 (2008)

African Journals Online (AJOL)

Scavenging and predation by Black Vultures Coragyps atratus at a South American sea lion breeding colony · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. HJ Pavés, RP Schlatter, CI Espinoza, 4-15 ...

Comparison of eye morphology and retinal topography in two species of New World vultures (Aves: Cathartidae).

Science.gov (United States)

Lisney, Thomas J; Stecyk, Karyn; Kolominsky, Jeffrey; Graves, Gary R; Wylie, Douglas R; Iwaniuk, Andrew N

2013-12-01

Vultures are highly reliant on their sensory systems for the rapid detection and localization of carrion before other scavengers can exploit the resource. In this study, we compared eye morphology and retinal topography in two species of New World vultures (Cathartidae), turkey vultures (Cathartes aura), with a highly developed olfactory sense, and black vultures (Coragyps atratus), with a less developed sense of olfaction. We found that eye size relative to body mass was the same in both species, but that black vultures have larger corneas relative to eye size than turkey vultures. However, the overall retinal topography, the total number of cells in the retinal ganglion cell layer, peak and average cell densities, cell soma area frequency distributions, and the theoretical peak anatomical spatial resolving power were the same in both species. This suggests that the visual systems of these two species are similar and that vision plays an equally important role in the biology of both species, despite the apparently greater reliance on olfaction for finding carrion in turkey vultures. Copyright © 2013 Wiley Periodicals, Inc.

Comparison of eye morphology and retinal topography in two species of new world vultures (Aves: Cathartidae)

DEFF Research Database (Denmark)

Lisney, Thomas J.; Stecyk, Karyn; Kolominsky, Jeffrey

2013-01-01

Vultures are highly reliant on their sensory systems for the rapid detection and localization of carrion before other scavengers can exploit the resource. In this study, we compared eye morphology and retinal topography in two species of New World vultures (Cathartidae), turkey vultures (Cathartes...... aura), with a highly developed olfactory sense, and black vultures (Coragyps atratus), with a less developed sense of olfaction. We found that eye size relative to body mass was the same in both species, but that black vultures have larger corneas relative to eye size than turkey vultures. However......, the overall retinal topography, the total number of cells in the retinal ganglion cell layer, peak and average cell densities, cell soma area frequency distributions, and the theoretical peak anatomical spatial resolving power were the same in both species. This suggests that the visual systems of these two...

Using wind tunnels to predict bird mortality in wind farms: the case of griffon vultures.

Science.gov (United States)

de Lucas, Manuela; Ferrer, Miguel; Janss, Guyonne F E

2012-01-01

Wind farms have shown a spectacular growth during the last 15 years. Avian mortality through collision with moving rotor blades is well-known as one of the main adverse impacts of wind farms. In Spain, the griffon vulture incurs the highest mortality rates in wind farms. As far as we know, this study is the first attempt to predict flight trajectories of birds in order to foresee potentially dangerous areas for wind farm development. We analyse topography and wind flows in relation to flight paths of griffon vultures, using a scaled model of the wind farm area in an aerodynamic wind tunnel, and test the difference between the observed flight paths of griffon vultures and the predominant wind flows. Different wind currents for each wind direction in the aerodynamic model were observed. Simulations of wind flows in a wind tunnel were compared with observed flight paths of griffon vultures. No statistical differences were detected between the observed flight trajectories of griffon vultures and the wind passages observed in our wind tunnel model. A significant correlation was found between dead vultures predicted proportion of vultures crossing those cells according to the aerodynamic model. Griffon vulture flight routes matched the predominant wind flows in the area (i.e. they followed the routes where less flight effort was needed). We suggest using these kinds of simulations to predict flight paths over complex terrains can inform the location of wind turbines and thereby reduce soaring bird mortality.

Identification and pest status of Holopothrips fulvus (Thysanoptera: Phlaeothripidae on dwarf-cashew crops in northeastern Brazil

Directory of Open Access Journals (Sweden)

Maria G.A. Lima

Full Text Available Abstract Cashew, Anacardium occidentale L. (Anacardiaceae, is one of the most important sources of agricultural income in northeastern Brazil, but many of the arthropods associated with the crop have yet to be identified. We describe here for the first time the damage caused by Holopothrips fulvus (Morgan (Thysanoptera: Phlaeothripidae to dwarf-cashew trees cultivated in the municipality of Pacajús, Ceará, Brazil. Leaf tissue injuries were caused by the sucking mouthparts of the insect and were characterized by dark necrotic spots on the epidermis that resulted in yellowing, wilting and, ultimately, abscission of the leaves. H. fulvus also fed on developing kernels and pseudofruits producing injuries that manifested in the form of chlorotic specks. Additional information is given on the pest status and important aspects of the morphology of the insect, including sexual dimorphism, redescription of the adults and description of the second instar larvae.

Vulture News - Vol 60 (2011)

African Journals Online (AJOL)

second count of vultures at carcasses in Uganda, and a revised proposal for a standardised method · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. D Pomeroy, A Byaruhangab, G Kaphu, M Opige, M Masiko, B Lutuk, 15-21 ...

SOVEREIGN DEBT RESTRUCTURING AND “VULTURE FUNDS”

Directory of Open Access Journals (Sweden)

Emilia Cornelia STOICA

2016-06-01

Full Text Available Defining sovereign debt - debt issued or guaranteed by a public entity: central and / or regional public authorities, central banks, public institutions or enterprises - must include the risks that its management may generate, mainly the risk of default. If an medium period of time - 3-5 years – the macroeconomic growth of a state, and as the result the increase of the public revenues constantly lies below the growth of sovereign debt, these will cause an insolvability risk to cover it, and that state should proceed to restructure its debt. Financial stability of public authorities and sovereign debt occurred since the beginning of the creation of democratic states, and instruments for debt restructuring have been continuously adapted to economic and social conjuncture. Initially, states faced a necessity of funding were borrowed from foreign governments and / or large consortia bank, and when their debts had to be restructured it has been created the international institutional framework to negotiate between debtor countries and public creditors - Paris Club - and to coordinate negotiations between public authorities and major debtor consortia - London Club. In the last decade 'vulture funds' occurred, which are hedge funds acquiring from the secondary financial market debt the securities, including public debt, to a much lower share nominal value. Subsequently, vulture funds claim states issuing debt repayment at values close or equal to the face value - in this way can make a profit of more than 100% of the financial investment they made it on the secondary market. If these countries do not comply, generally being unable to honor their public debt, vultures funds act the countries in international courts, which usually prevails because vultures funds’ action is legal under current conditions.

Using wind tunnels to predict bird mortality in wind farms: the case of griffon vultures.

Directory of Open Access Journals (Sweden)

Manuela de Lucas

Full Text Available BACKGROUND: Wind farms have shown a spectacular growth during the last 15 years. Avian mortality through collision with moving rotor blades is well-known as one of the main adverse impacts of wind farms. In Spain, the griffon vulture incurs the highest mortality rates in wind farms. METHODOLOGY/PRINCIPAL FINDINGS: As far as we know, this study is the first attempt to predict flight trajectories of birds in order to foresee potentially dangerous areas for wind farm development. We analyse topography and wind flows in relation to flight paths of griffon vultures, using a scaled model of the wind farm area in an aerodynamic wind tunnel, and test the difference between the observed flight paths of griffon vultures and the predominant wind flows. Different wind currents for each wind direction in the aerodynamic model were observed. Simulations of wind flows in a wind tunnel were compared with observed flight paths of griffon vultures. No statistical differences were detected between the observed flight trajectories of griffon vultures and the wind passages observed in our wind tunnel model. A significant correlation was found between dead vultures predicted proportion of vultures crossing those cells according to the aerodynamic model. CONCLUSIONS: Griffon vulture flight routes matched the predominant wind flows in the area (i.e. they followed the routes where less flight effort was needed. We suggest using these kinds of simulations to predict flight paths over complex terrains can inform the location of wind turbines and thereby reduce soaring bird mortality.

Seropositivity and risk factors associated with Toxoplasma gondii infection in wild birds from Spain.

Directory of Open Access Journals (Sweden)

Oscar Cabezón

Full Text Available Toxoplasma gondii is a zoonotic intracellular protozoan parasite of worldwide distribution that infects many species of warm-blooded animals, including birds. To date, there is scant information about the seropositivity of T. gondii and the risk factors associated with T. gondii infection in wild bird populations. In the present study, T. gondii infection was evaluated on sera obtained from 1079 wild birds belonging to 56 species (including Falconiformes (n=610, Strigiformes (n=260, Ciconiiformes (n=156, Gruiformes (n=21, and other orders (n=32, from different areas of Spain. Antibodies to T. gondii (modified agglutination test, MAT titer ≥1:25 were found in 282 (26.1%, IC(95%:23.5-28.7 of the 1079 birds. This study constitute the first extensive survey in wild birds species in Spain and reports for the first time T. gondii antibodies in the griffon vulture (Gyps fulvus, short-toed snake-eagle (Circaetus gallicus, Bonelli's eagle (Aquila fasciata, golden eagle (Aquila chrysaetos, bearded vulture (Gypaetus barbatus, osprey (Pandion haliaetus, Montagu's harrier (Circus pygargus, Western marsh-harrier (Circus aeruginosus, peregrine falcon (Falco peregrinus, long-eared owl (Asio otus, common scops owl (Otus scops, Eurasian spoonbill (Platalea leucorodia, white stork (Ciconia ciconia, grey heron (Ardea cinerea, common moorhen (Gallinula chloropus; in the International Union for Conservation of Nature (IUCN "vulnerable" Spanish imperial eagle (Aquila adalberti, lesser kestrel (Falco naumanni and great bustard (Otis tarda; and in the IUCN "near threatened" red kite (Milvus milvus. The highest seropositivity by species was observed in the Eurasian eagle owl (Bubo bubo (68.1%, 98 of 144. The main risk factors associated with T. gondii seropositivity in wild birds were age and diet, with the highest exposure in older animals and in carnivorous wild birds. The results showed that T. gondii infection is widespread and can be at a high level in many wild

Culture- and molecular-based detection of swine-adapted Salmonella shed by avian scavengers.

Science.gov (United States)

Blanco, Guillermo; Díaz de Tuesta, Juan A

2018-04-13

Salmonella can play an important role as a disease agent in wildlife, which can then act as carriers and reservoirs of sanitary importance at the livestock-human interface. Transmission from livestock to avian scavengers can occur when these species consume contaminated carcasses and meat remains in supplementary feeding stations and rubbish dumps. We compared the performance of PCR-based detection with conventional culture-based methods to detect Salmonella in the faeces of red kites (Milvus milvus) and griffon vultures (Gyps fulvus) in central Spain. The occurrence of culturable Salmonella was intermediate in red kites (1.9%, n=52) and high in griffon vultures (26.3%, n=99). These proportions were clearly higher with PCR-based detection (13.5% and 40.4%, respectively). Confirmation cultures failed to grow Salmonella in all faecal samples positive by the molecular assay but negative by the initial conventional culture in both scavenger species, indicating the occurrence of false (non-culturable) positives by PCR-based detection. This suggests that the molecular assay is highly sensitive to detecting viable Salmonella in cultures, but also partial genomes and dead or unviable bacteria from past infections or contamination. Thus, the actual occurrence of Salmonella in a particular sampling time period can be underestimated when using only culture detection. The serovars found in the scavenger faeces were among the most frequently isolated in pigs from Spain and other EU countries, especially those generally recognized as swine-adapted monophasic variants of S. Typhimurium. Because the studied species obtain much of their food from pig carcasses, this livestock may be the primary source of Salmonella via direct ingestion of infected carcasses and indirectly via contamination due to the unsanitary conditions found in supplementary feeding stations established for scavenger conservation. Combining culture- and molecular-based detection is encouraged to understand the

Consumption of Big Game Remains by Scavengers: A Potential Risk as Regards Disease Transmission in Central Spain

Directory of Open Access Journals (Sweden)

Ricardo Carrasco-Garcia

2018-03-01

Full Text Available Understanding the role that facultative scavenger species may play in spreading infectious pathogens, and even becoming reservoirs for humans, domestic and wild ungulates or, on the contrary, preventing the spread of disease, requires a prior understanding of the pattern of carrion scavenging in specific scenarios. The objectives of this paper are (i to describe the guild of vertebrate scavengers and (ii to study the species-specific, habitat, and management-related factors involved in the usage of gut piles in South Central Spain (SCS, a tuberculosis (TB endemic area. We used camera trapping at 18 hunting piles on seven hunting estates. A total of eight bird and five mammal taxa were detected at the remains of hunting piles. The most frequently detected species in terms of number of gut piles visited (78% and scavenged (61% was the red fox Vulpes vulpes, followed by the griffon vulture Gyps fulvus (56% as regards both presence and scavenging and the raven Corvus corax (61 and 39% as regards presence and scavenging, respectively. We evidenced that griffon vultures accounted for most of the scavenging activity in open habitats, while facultative mammal scavengers, red fox, and wild boar Sus scrofa made the highest contribution to scavenging in vegetation-covered habitats. In the case of wild boar, the gut piles deposited during the evening and night favored higher rates of scavenging, while the opposite pattern was observed for griffons. Overall, our findings suggest that when disposing of hunting remains in areas of risk as regards disease transmission it is particularly important to consider the access that facultative mammals, and especially wild boar, have to material, while the presence of the resource needs to be safeguarded to protect specialist scavengers of conservation value. These results are of particular relevance in the case of wild boar in the current context of re-emerging TB and emerging African swine fever (ASF in Europe.

The impact of traditional use on vultures in South Africa | McKean ...

African Journals Online (AJOL)

The main drivers of demand for these uses are betting and gambling, for improved business success, and intelligence in school children. Vulture is also prescribed by traditional healers for various ailments, including headaches. It is estimated that 160 vultures are sold per annum in eastern South Africa, with some 59,000 ...

Effects of habitat and time of day on flock size of Turkey Vultures in Cuba (Cathartes aura

Directory of Open Access Journals (Sweden)

Piotr Tryjanowski

2018-01-01

Full Text Available In agricultural landscapes, the Turkey Vulture Cathartes aura feeds mainly on carcases of domestic animals. In spring 2017, data on 214 flocks of Turkey vultures were collected in a road survey in Cuba (in total 2384 km. Turkey Vultures were found to be common accross Cuba, but flock size varied between habitats, reaching a maximum of 43 in valleys and 31 in agricultural landscapes with domestic animal farms. Vultures were active throughout the day, but the time of day did not significantly affect flock size. This study corroborates previous studies which suggested that carrion resources located in agricultural habitats and river valleys is crucial for the continued survival of this still abundant species. Changes in Cuba’s socio-political system in the near future will likely impact agricultural practices, and this in turn will likely affect Turkey Vultures. Our study may serve as a baseline against which future population changes and flocking behaviour of Turkey Vultures can be compared.

Vulture numbers are cut to the bone Extinction fears for a scavenger ...

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... gives them the gift to see the future. – are eating vulture meat to acquire the power of clairvoyance. ... Asia over the past five years, the use of the painkiller diclofenac in cattle has wiped out three species ... need for vulture flesh to satisfy markets for traditional medicines, their links with clairvoyance, hunting ...

Nandankanan zoo to house vultures

African Journals Online (AJOL)

of epidemics by eating the carcasses before they rot and are known to feed on rotting flesh without any adverse effect on them. The Indian White-backed. Vulture in 1992 number was more than 100 times than the 2003 number. Although they hang out in smelly places and eat carcasses, research shows that if given a choice ...

Chick success for Asian vultures

African Journals Online (AJOL)

2007-03-02

Mar 2, 2007 ... of international zoo programmes, said the society had been heavily involved in the centre since the late 1990s. “It was established with a UK government ... about the extinction of the vultures,” he warned. “The communities that use this drug can be remote; cattle are literally found in their millions and people ...

Lead toxicosis of captive vultures: case description and responses to chelation therapy

Science.gov (United States)

2013-01-01

Background Lead, a serious threat for raptors, can hamper the success of their conservation. This study reports on experience with accidental lead intoxication and responses to chelation therapy in captive Cinereous (Aegypius monachus) and Egyptian (Neophron percnopterus) Vultures. Results Soil contamination by lead-based paint sanded off the steel aviary resulted in poisoning of eight Cinereous and two Egyptian Vultures. A male Egyptian Vulture developed signs of apathy, polydipsia, polyuria, regurgitation, and stupor, and died on the next day. Liver, kidney and blood lead concentrations were 12.2, 8.16 and 2.66 μg/g, respectively. Laboratory analyses confirmed severe liver and kidney damage and anaemia. Blood Pb levels of Pb-exposed Cinereous Vultures were 1.571 ± 0.510 μg/g shortly after intoxication, decreased to 0.530 ± 0.165 μg/g without any therapy in a month and to 0.254 ± 0.097 μg/g one month after CaNa2EDTA administration. Eight months later, blood lead levels decreased to close to the background of the control group. Blood parameters of healthy Pb-non-exposed Cinereous Vultures were compared with those of the exposed group prior to and after chelation therapy. Iron levels in the lead-exposed pre-treatment birds significantly decreased after chelation. Haematocrit levels in Pb-exposed birds were significantly lower than those of the controls and improved one month after chelation. Creatine kinase was higher in pre-treatment birds than in the controls but normalised after therapy. Alkaline phosphatase increased after chelation. A marked increase in the level of lipid peroxidation measured as thiobarbituric acid reactive species was demonstrated in birds both prior to and after chelation. The ferric reducing antioxidant power was significantly lower in pre-treatment vultures and returned to normal following chelation therapy. Blood metallothionein levels in lead-exposed birds were higher than in controls. Reduced glutathione dropped after

Lead toxicosis of captive vultures: case description and responses to chelation therapy.

Science.gov (United States)

Pikula, Jiri; Hajkova, Pavlina; Bandouchova, Hana; Bednarova, Ivana; Adam, Vojtech; Beklova, Miroslava; Kral, Jiri; Ondracek, Karel; Osickova, Jitka; Pohanka, Miroslav; Sedlackova, Jana; Skochova, Hana; Sobotka, Jakub; Treml, Frantisek; Kizek, Rene

2013-01-16

Lead, a serious threat for raptors, can hamper the success of their conservation. This study reports on experience with accidental lead intoxication and responses to chelation therapy in captive Cinereous (Aegypius monachus) and Egyptian (Neophron percnopterus) Vultures. Soil contamination by lead-based paint sanded off the steel aviary resulted in poisoning of eight Cinereous and two Egyptian Vultures. A male Egyptian Vulture developed signs of apathy, polydipsia, polyuria, regurgitation, and stupor, and died on the next day. Liver, kidney and blood lead concentrations were 12.2, 8.16 and 2.66 μg/g, respectively. Laboratory analyses confirmed severe liver and kidney damage and anaemia. Blood Pb levels of Pb-exposed Cinereous Vultures were 1.571 ± 0.510 μg/g shortly after intoxication, decreased to 0.530 ± 0.165 μg/g without any therapy in a month and to 0.254 ± 0.097 μg/g one month after CaNa(2)EDTA administration. Eight months later, blood lead levels decreased to close to the background of the control group. Blood parameters of healthy Pb-non-exposed Cinereous Vultures were compared with those of the exposed group prior to and after chelation therapy. Iron levels in the lead-exposed pre-treatment birds significantly decreased after chelation. Haematocrit levels in Pb-exposed birds were significantly lower than those of the controls and improved one month after chelation. Creatine kinase was higher in pre-treatment birds than in the controls but normalised after therapy. Alkaline phosphatase increased after chelation. A marked increase in the level of lipid peroxidation measured as thiobarbituric acid reactive species was demonstrated in birds both prior to and after chelation. The ferric reducing antioxidant power was significantly lower in pre-treatment vultures and returned to normal following chelation therapy. Blood metallothionein levels in lead-exposed birds were higher than in controls. Reduced glutathione dropped after CaNa(2)EDTA therapy, while

Effects of Vehicle Speed on Flight Initiation by Turkey Vultures: Implications for Bird-Vehicle Collisions

Science.gov (United States)

DeVault, Travis L.; Blackwell, Bradley F.; Seamans, Thomas W.; Lima, Steven L.; Fernández-Juricic, Esteban

2014-01-01

The avoidance of motorized vehicles is a common challenge for birds in the modern world. Birds appear to rely on antipredator behaviors to avoid vehicles, but modern vehicles (automobiles and aircraft) are faster than natural predators. Thus, birds may be relatively ill-equipped, in terms of sensory capabilities and behaviors, to avoid vehicles. We examined the idea that birds may be unable to accurately assess particularly high speeds of approaching vehicles, which could contribute to miscalculations in avoidance behaviors and ultimately cause collisions. We baited turkey vultures (Cathartes aura) to roads with animal carcasses and measured flight initiation distance and effective time-to-collision in response to a truck driving directly towards vultures from a starting distance of 1.13 km and at one of three speeds: 30, 60, or 90 kph (no vultures were struck). Flight initiation distance of vultures increased by a factor of 1.85 as speed increased from 30 to 90 kph. However, for 90-kph approaches there was no clear trend in flight initiation distance across replicates: birds appeared equally likely to initiate escape behavior at 40 m as at 220 m. Time-to-collision decreased by a factor of 0.62 with approach speeds from 30 to 90 kph. Also, at 90 kph, four vehicle approaches (17%) resulted in near collisions with vultures (time-to-collision ≤1.7 s), compared to none during 60 kph approaches and one during 30 kph approaches (4%). Our findings suggest that antipredator behaviors in turkey vultures, particularly stimulus processing and response, might not be well tuned to vehicles approaching at speeds ≥90 kph. The possible inability of turkey vultures to react appropriately to high-speed vehicles could be common among birds, and might represent an important determinant of bird-vehicle collisions. PMID:24503622

Assessing species habitat using Google Street View: a case study of cliff-nesting vultures.

Science.gov (United States)

Olea, Pedro P; Mateo-Tomás, Patricia

2013-01-01

The assessment of a species' habitat is a crucial issue in ecology and conservation. While the collection of habitat data has been boosted by the availability of remote sensing technologies, certain habitat types have yet to be collected through costly, on-ground surveys, limiting study over large areas. Cliffs are ecosystems that provide habitat for a rich biodiversity, especially raptors. Because of their principally vertical structure, however, cliffs are not easy to study by remote sensing technologies, posing a challenge for many researches and managers working with cliff-related biodiversity. We explore the feasibility of Google Street View, a freely available on-line tool, to remotely identify and assess the nesting habitat of two cliff-nesting vultures (the griffon vulture and the globally endangered Egyptian vulture) in northwestern Spain. Two main usefulness of Google Street View to ecologists and conservation biologists were evaluated: i) remotely identifying a species' potential habitat and ii) extracting fine-scale habitat information. Google Street View imagery covered 49% (1,907 km) of the roads of our study area (7,000 km²). The potential visibility covered by on-ground surveys was significantly greater (mean: 97.4%) than that of Google Street View (48.1%). However, incorporating Google Street View to the vulture's habitat survey would save, on average, 36% in time and 49.5% in funds with respect to the on-ground survey only. The ability of Google Street View to identify cliffs (overall accuracy = 100%) outperformed the classification maps derived from digital elevation models (DEMs) (62-95%). Nonetheless, high-performance DEM maps may be useful to compensate Google Street View coverage limitations. Through Google Street View we could examine 66% of the vultures' nesting-cliffs existing in the study area (n = 148): 64% from griffon vultures and 65% from Egyptian vultures. It also allowed us the extraction of fine-scale features of cliffs

A mass poisoning of White-Backed and Lappet-Faced Vultures in Gonarezhou National Park

NARCIS (Netherlands)

Groom, R.J.; Gandiwa, E.; Gandiwa, P.; Westhuizen, H.F.

2013-01-01

In this article we report a mass poisoning of vultures in the Gonarezhou National Park in Zimbabwe. This was one of the largest mass killings of vultures ever recorded and the largest recorded in Zimbabwe. On many of the carcasses the upper beaks were removed, suggesting the involvement of

Homesick vulture moves into retirement village

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... contact him on (031) 785-2981. Raptor. Rescue is based at the newly opened. African Bird of Prey Centre on the Lion. Park road where other vultures and many species of hawks, owls and eagles are on display. This is also where Hoffman's wife, Shannon, and her team, present daily flying demonstrations.

Congregations of wintering Egyptian Vultures Neophron ...

African Journals Online (AJOL)

Nearly half of the birds were adults and the majority roosted on bird-safe types of electric pylons. Most of the Egyptian Vultures were found below 500 m above sea level, in bare areas, open savannas or grasslands, and their abundance was negatively related to the amount of cover of bush vegetation. The distribution of ...

Assessing species habitat using Google Street View: a case study of cliff-nesting vultures.

Directory of Open Access Journals (Sweden)

Pedro P Olea

Full Text Available The assessment of a species' habitat is a crucial issue in ecology and conservation. While the collection of habitat data has been boosted by the availability of remote sensing technologies, certain habitat types have yet to be collected through costly, on-ground surveys, limiting study over large areas. Cliffs are ecosystems that provide habitat for a rich biodiversity, especially raptors. Because of their principally vertical structure, however, cliffs are not easy to study by remote sensing technologies, posing a challenge for many researches and managers working with cliff-related biodiversity. We explore the feasibility of Google Street View, a freely available on-line tool, to remotely identify and assess the nesting habitat of two cliff-nesting vultures (the griffon vulture and the globally endangered Egyptian vulture in northwestern Spain. Two main usefulness of Google Street View to ecologists and conservation biologists were evaluated: i remotely identifying a species' potential habitat and ii extracting fine-scale habitat information. Google Street View imagery covered 49% (1,907 km of the roads of our study area (7,000 km². The potential visibility covered by on-ground surveys was significantly greater (mean: 97.4% than that of Google Street View (48.1%. However, incorporating Google Street View to the vulture's habitat survey would save, on average, 36% in time and 49.5% in funds with respect to the on-ground survey only. The ability of Google Street View to identify cliffs (overall accuracy = 100% outperformed the classification maps derived from digital elevation models (DEMs (62-95%. Nonetheless, high-performance DEM maps may be useful to compensate Google Street View coverage limitations. Through Google Street View we could examine 66% of the vultures' nesting-cliffs existing in the study area (n = 148: 64% from griffon vultures and 65% from Egyptian vultures. It also allowed us the extraction of fine-scale features of

Avian Pox in Turkey Vulture (Cathartes aura)

African Journals Online (AJOL)

Campbell Murn

Vulture Cathartes aura meridionalis was captured for wing-tagging on San. Francisco, Zulia state, Venezuela. (10°32'15"N, -71°38'10"W). Nodular cutaneous lesions were observed on the head (Figure 1A). Sections of the skin were removed and fixed in 10% buffer formalin and submitted to. Laboratorio de. Diagnostico.

Knowledge-based geographic information systems on the Macintosh computer: a component of the GypsES project

Science.gov (United States)

Gregory Elmes; Thomas Millette; Charles B. Yuill

1991-01-01

GypsES, a decision-support and expert system for the management of Gypsy Moth addresses five related research problems in a modular, computer-based project. The modules are hazard rating, monitoring, prediction, treatment decision and treatment implementation. One common component is a geographic information system designed to function intelligently. We refer to this...

Observation of a population of Egyptian Vultures Neophron ...

African Journals Online (AJOL)

Campbell Murn

Forest between 2013 and 2014 in Karnataka, southern India. ... could affect other animals and humans (Ogada ... Nepal (Cuthbert et al. .... most people are Hindu and therefore .... Bathing behavior and waterhole importance of white-rumped vulture ... strategies in a flock-living bird: movement and social cohesion of hooded.

Mutual tolerance or reproductive competition? Patterns of reproductive skew among male redfronted lemurs (Eulemur fulvus rufus)

OpenAIRE

Kappeler, Peter M.; Port, Markus

2008-01-01

The social organization of gregarious lemurs significantly deviates from predictions of the socioecological model, as they form small groups in which the number of males approximately equals the number of females. This study uses models of reproductive skew theory as a new approach to explain this unusual group composition, in particular the high number of males, in a representative of these lemurs, the redfronted lemur (Eulemur fulvus rufus). We tested two central predictions of “concession”...

Food safety in scavenger conservation: Diet-associated exposure to livestock pharmaceuticals and opportunist mycoses in threatened Cinereous and Egyptian vultures.

Science.gov (United States)

Blanco, Guillermo; Junza, Alexandra; Barrón, Dolores

2017-01-01

Pharmaceuticals from veterinary treatments may enter terrestrial food webs when medicated livestock are available to wildlife in supplementary feeding stations aimed at the conservation of endangered scavengers. Here, we hypothesized that the exposure risk to livestock fluoroquinolones, as indicators of pharmaceutical burden in food, is related to the variable reliance of scavengers on domestic versus wild animal carcasses. Since the misuse of broad-spectrum antibiotics is a major predisposing factor for opportunistic mycoses, we evaluated disease signs potentially associated with diet-dependent drug exposure in nestlings of two threatened vultures. A greater occurrence (100%, n=14) and concentration of fluoroquinolones (mean±SD=73.0±27.5µgL -1 , range=33.2-132.7), mostly enrofloxacin, were found in Cinereous vultures, Aegypius monachus, due to their greater dependence on livestock carcasses than Egyptian vultures, Neophron percnopterus (fluoroquinolones occurrence: 44%, n=16, concentration: 37.9±16.6µgL -1 , range=11.5-55.9), which rely much more on carcasses of wild animals (42% of remains vs. 23% in the cinereous vulture). The chaotic, chronic and pulsed ingestion of these drugs throughout nestling development is proposed as one of the most plausible explanations for the high occurrence and intensity of oral Candida-like lesions in nestling vultures. The high occurrence of fluoroquinolone residues and disease hindered the probing of a cause-effect relationship between both factors in individual vultures. This relationship could be evaluated through a population-based approach by sampling vultures not exposed to these drugs. The high dependence of vultures on domestic animals today compared to past decades and the growing intensification of livestock farming, imply an expected increase in the impact of pharmaceuticals on scavenger populations. This requires further evaluation due to potential consequences in biodiversity conservation and environmental health

The vultures at the crossroads of biodiversity, politics, tourism, the ...

African Journals Online (AJOL)

ZeldaH

... (Orabi 2011), or by consuming carcasses of cattle treated ... in the functioning of communities (Choisy. 2003). ... eaten by vultures at small feeding sites operated by ... water supplies can be polluted. The ..... The integrated biogeographic and.

Maintenance of syntenic groups between Cathartidae and Gallus gallus indicates symplesiomorphic karyotypes in new world vultures

Directory of Open Access Journals (Sweden)

Marcella M. Tagliarini

2011-01-01

Full Text Available Similarities between New World and Old World vultures have been interpreted to reflect a close relationship and to suggest the inclusion of both in Accipitridae (Falconiformes. However, deeper analyses indicated that the placement of the New World vultures (cathartids in this Order is uncertain. Chromosome analysis has shown that cathartids retained a karyotype similar to the putative avian ancestor. In order to verify the occurrence of intrachromosomal rearrangements in cathartids, we hybridized whole chromosome probes of two species (Gallus gallus and Leucopternis albicollis onto metaphases of Cathartes aura. The results showed that not only were the syntenic groups conserved between Gallus and C. aura, but probably also the general gene order, suggesting that New World vultures share chromosomal symplesiomorphies with most bird lineages.

Cape Vulture Gyps coprotheres breeding status in southern Africa ...

African Journals Online (AJOL)

While our data suggests multiple colonies are stable or increasing, the extinction of peripheral colonies and contraction of the species' range is alarming and gives evidence for unsustainable population declines. Monitoring efforts chronicled the extinction of the previously large core colony at Roberts' Farm, which was ...

The impact of urbanization and agricultural development on vultures ...

African Journals Online (AJOL)

Campbell Murn

along an urban to forest gradient (dense downtown areas, suburbs, rural villages and farms ... negatively on many species, including .... landuse, this having more animals ..... behavior of black and turkey vultures: implications for reducing bird– .... Brazil: species richness and abundance and the influence of the survey.

Report on Kwando (Botswana) Vulture poisoning investigation 16 ...

African Journals Online (AJOL)

Campbell Murn

2013-11-16

Nov 16, 2013 ... and only two white-back vulture remains were found. Although no tusks were present, we saw no evidence of chopping of the maxilla on this elephant skull. It is possible that all three carcasses were poisoned, but the majority of the dead birds were found at Carcass 1 and 2. Both carcasses were further ...

HD-GYP domain proteins regulate biofilm formation and virulence in Pseudomonas aeruginosa

DEFF Research Database (Denmark)

Ryan, Robert P.; Lucey, Jean; O'Donovan, Karen

2009-01-01

residues (YN-GYP). Here we have investigated the role of these proteins in biofilm formation, virulence factor synthesis and virulence of P. aeruginosa. Mutation of PA4108 and PA4781 led to an increase in the level of cyclic-di-GMP in P. aeruginosa, consistent with the predicted activity of the encoded......2572 had a negative influence on swarming that was cryptic and was revealed only after removal of an uncharacterized C-terminal domain. Mutation of PA4108, PA4781 and PA2572 had distinct effects on biofilm formation and architecture of P. aeruginosa. All three proteins contributed to virulence of P...

The decline of an urban Hooded Vulture Necrosyrtes monachus ...

African Journals Online (AJOL)

Likely causes are (1) exponential urbanisation resulting in loss of feeding sites and reduced food availability, (2) increased poisoning of feral dogs with strychnine sulphate due to an upsurge of rabies and (3) increased disappearance of suitable trees for nesting and roosting. Keywords: cutting of trees, Hooded Vulture, ...

Non-steroidal Anti-inflammatory Drugs in Raptors

Science.gov (United States)

Oaks, J. Lindsay; Meteyer, Carol U.; Miller, R. Eric; Fowler, Murray E.

2012-01-01

The use of analgesia has become standard, and appropriate, practice in avian medicine. As in mammals, pain control in avian patients is usually accomplished with opioids and nonsteroidal anti-inflammatory drugs (NSAIDs) used singly or in combination for a multimodal approach. Despite their usefulness, widespread use, and relative safety in clinical use, few controlled studies in birds have been conducted on efficacy, safety, and dosing. The guidelines for the use of NSAIDs in raptors and other birds have mainly been empirical. More recently, NSAIDs in free-living raptors have emerged as a major conservation issue with the discovery that diclofenac sodium was responsible for the population crash of three species of Gyps vultures in southern Asia. In this context, residues of veterinary NSAIDs in domestic animals are now considered environmental contaminants that can be significantly toxic to vultures and possibly other avian scavengers. Ironically, the disaster with Asian vultures has led to a considerable body of research on NSAIDs in raptors to the benefit of clinicians who now have scientific information available to help assess dosing, safety, toxicity, and pharmacokinetics of NSAIDs in their raptor patients.

Need and seek for dietary micronutrients: endogenous regulation, external signalling and food sources of carotenoids in new world vultures.

Directory of Open Access Journals (Sweden)

Guillermo Blanco

Full Text Available Among birds, vultures show low concentrations of plasma carotenoids due to the combination of their large size, general dull colouration and a diet based on carrion. We recorded the concentration of each carotenoid type present in plasma of the Andean condor (Vultur gryphus according to age and sex, that determine colour signalling and dominance hierarchies in the carcasses. We compared the carotenoid profile in wild condors with that of captive condors fed with a controlled diet of flesh to test the hypothesis that wild individuals could acquire extra carotenoids from vegetal matter contained in carcass viscera and fresh vegetation. Wild American black vultures (Coragyps atratus were also sampled to evaluate the potential influence of colouration in the integument on absorption and accumulation patterns of plasma carotenoids. A remarkably higher concentration of lutein than β-carotene was found in wild condors, while the contrary pattern was recorded in American black vultures and captive condors. We found a consistent decrease in all plasma carotenoids with age, and a lower concentration of most xanthophylls in male compared to female wild condors. Positive correlations of all carotenoids indicated general common absorption and accumulation strategies or a single dietary source containing all pigments found in plasma. The comparatively low total concentration of carotenoids, and especially of lutein rather than β-carotene, found in captive condors fed with a diet restricted to flesh supports the hypothesis that Andean condors can efficiently acquire carotenoids from vegetal matter in the wild. Andean condors seem to be physiologically more competent in the uptake or accumulation of xanthophylls than American black vultures, which agrees with the use of colour-signalling strategies in sexual and competitive contexts in the Andean condor. This study suggests that vultures may use dietary vegetal supplements that provide pigments and

Need and Seek for Dietary Micronutrients: Endogenous Regulation, External Signalling and Food Sources of Carotenoids in New World Vultures

Science.gov (United States)

Blanco, Guillermo; Hornero-Méndez, Dámaso; Lambertucci, Sergio A.; Bautista, Luis M.; Wiemeyer, Guillermo; Sanchez-Zapata, José A.; Garrido-Fernández, Juan; Hiraldo, Fernando; Donázar, José A.

2013-01-01

Among birds, vultures show low concentrations of plasma carotenoids due to the combination of their large size, general dull colouration and a diet based on carrion. We recorded the concentration of each carotenoid type present in plasma of the Andean condor (Vultur gryphus) according to age and sex, that determine colour signalling and dominance hierarchies in the carcasses. We compared the carotenoid profile in wild condors with that of captive condors fed with a controlled diet of flesh to test the hypothesis that wild individuals could acquire extra carotenoids from vegetal matter contained in carcass viscera and fresh vegetation. Wild American black vultures (Coragyps atratus) were also sampled to evaluate the potential influence of colouration in the integument on absorption and accumulation patterns of plasma carotenoids. A remarkably higher concentration of lutein than β-carotene was found in wild condors, while the contrary pattern was recorded in American black vultures and captive condors. We found a consistent decrease in all plasma carotenoids with age, and a lower concentration of most xanthophylls in male compared to female wild condors. Positive correlations of all carotenoids indicated general common absorption and accumulation strategies or a single dietary source containing all pigments found in plasma. The comparatively low total concentration of carotenoids, and especially of lutein rather than β-carotene, found in captive condors fed with a diet restricted to flesh supports the hypothesis that Andean condors can efficiently acquire carotenoids from vegetal matter in the wild. Andean condors seem to be physiologically more competent in the uptake or accumulation of xanthophylls than American black vultures, which agrees with the use of colour-signalling strategies in sexual and competitive contexts in the Andean condor. This study suggests that vultures may use dietary vegetal supplements that provide pigments and micronutrients that are

The importance of the nutritive value of old bones in the diet of Bearded vultures Gypaetus barbatus.

Science.gov (United States)

Margalida, Antoni; Villalba, Daniel

2017-08-14

Vultures are central-place foragers and need to optimize their foraging behaviour to offset travel costs by increasing their energy gain. This process is more obvious in certain vulture species that do not feed their young by regurgitation and so must carry food items back to the nest. The Bearded Vulture Gypaetus barbatus is the only species with a bone-diet based. We analysed the chemical composition of bones and the age-related changes in their nutritive value to assess the differences in energy content between bones of differing age, body part and species. We found differences between specific anatomical parts, species and the age of the bones. Fresh bones contain 108% as much energy as fresh meat and, interestingly, dry bones retain 90% of the protein found in fresh bones. Dry femurs weighing 140 g retain enough protein to be comparable to 111 g of fresh meat, in energy terms. Compared to meat-eating species, the specialized osteophagous diet of the Bearded Vulture seems to have certain advantages. A better understanding of nutrient levels in food remains could help to improve theoretical foraging models, assist in conservation management, and even improve our understanding of the use of bones by early hominids.

Traditional medicine trade in vulture parts in northern Nigeria | Saidu ...

African Journals Online (AJOL)

We report findings on the vulture trade in northern Nigeria, where it is commonly practised especially to supply the traditional medicine industry. We administered an open-ended questionnaire to 113 traditional, predominantly Hausa medicinal traders in 39 markets within eight states in northern Nigeria. Of the interviewed ...

Environmental drivers of variability in the movement ecology of turkey vultures (Cathartes aura) in North and South America.

Science.gov (United States)

Dodge, Somayeh; Bohrer, Gil; Bildstein, Keith; Davidson, Sarah C; Weinzierl, Rolf; Bechard, Marc J; Barber, David; Kays, Roland; Brandes, David; Han, Jiawei; Wikelski, Martin

2014-01-01

Variation is key to the adaptability of species and their ability to survive changes to the Earth's climate and habitats. Plasticity in movement strategies allows a species to better track spatial dynamics of habitat quality. We describe the mechanisms that shape the movement of a long-distance migrant bird (turkey vulture, Cathartes aura) across two continents using satellite tracking coupled with remote-sensing science. Using nearly 10 years of data from 24 satellite-tracked vultures in four distinct populations, we describe an enormous amount of variation in their movement patterns. We related vulture movement to environmental conditions and found important correlations explaining how far they need to move to find food (indexed by the Normalized Difference Vegetation Index) and how fast they can move based on the prevalence of thermals and temperature. We conclude that the extensive variability in the movement ecology of turkey vultures, facilitated by their energetically efficient thermal soaring, suggests that this species is likely to do well across periods of modest climate change. The large scale and sample sizes needed for such analysis in a widespread migrant emphasizes the need for integrated and collaborative efforts to obtain tracking data and for policies, tools and open datasets to encourage such collaborations and data sharing.

Observations on the breeding of Indian long-billed vultures Gyps ...

African Journals Online (AJOL)

Campbell Murn

observed to be abandoned by the birds after 29 days of incubation during December. We also observed mating attempts (n=5) in adult birds during nestling period. Out of 16 chicks, one died at the hatching stage and one died during the fledgling stage, thus only 14 chicks fledged successfully with a success rate of. 82.35%.

Monitoring White-backed Vultures Gyps africanus in the North West ...

African Journals Online (AJOL)

Campbell Murn

Stellaland), South Africa. Dirk, Karen and Stefan van Stuyvenberg. Stellaland Raptor Project. e-mail: stuyvies@telkomsa.net. Introduction. We became involved with the ringing of birds in 2002 and started to ring raptors actively since 2003.

Devil's Claw – a natural substitute for diclofenac? | Mundy | Vulture ...

African Journals Online (AJOL)

Vulture News. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 67, No 2 (2014) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your ...

Spatial variations in Eulemur fulvus rufus and Lepilemur mustelinus densities in Madagascar.

Science.gov (United States)

Lehman, Shawn M

2007-01-01

I present data on variations in Eulemur fulvus rufus and Lepilemur mustelinus densities as well as tree characteristics (height, diameter and stem frequency) between edge and interior forest habitats in southeastern Madagascar. Line transect surveys were conducted from June 2003 to November 2005 in edge and interior forest habitats in the Vohibola III Classified Forest. Although E. f. rufus densities were significantly lower in edge habitats than in interior habitats, density estimates for L. mustelinus did not differ significantly between habitats. Trees in edge habitats were significantly shorter, had smaller diameters and had lower stem frequencies (for those >25 cm in diameter) than trees in interior habitats. Spatial characteristics of food abundance and quality may explain lemur density patterns in Vohibola III. Low E. f. rufus densities may reduce seed dispersal in edge habitats, which has important consequences for the long-term viability of forest ecosystems in Madagascar. Copyright (c) 2007 S. Karger AG, Basel.

Ochre Bathing of the Bearded Vulture: A Bio-Mimetic Model for Early Humans towards Smell Prevention and Health

Directory of Open Access Journals (Sweden)

Helmut Tributsch

2016-01-01

Full Text Available Since primordial times, vultures have been competing with man for animal carcasses. One of these vultures, the once widespread bearded vulture ( Gypaetus barbatus , has the habit of bathing its polluted feathers and skin in red iron oxide - ochre - tainted water puddles. Why? Primitive man may have tried to find out and may have discovered its advantages. Red ochre, which has accompanied human rituals and everyday life for more than 100,000 years, is not just a simple red paint for decoration or a symbol for blood. As modern experiments demonstrate, it is active in sunlight producing aggressive chemical species. They can kill viruses and bacteria and convert smelly organic substances into volatile neutral carbon dioxide gas. In this way, ochre can in sunlight sterilize and clean the skin to provide health and comfort and make it scentless, a definitive advantage for nomadic meat hunters. This research thus also demonstrates a sanitary reason for the vulture’s habit of bathing in red ochre mud. Prehistoric people have therefore included ochre use into their rituals, especially into those in relation to birth and death. Significant ritual impulses during evolution of man may thus have developed bio-mimetically, inspired from the habits of a vulture. It is discussed how this health strategy could be developed to a modern standard helping to fight antibiotics-resistant bacteria in hospitals.

Bird-strike of a Cinereous Vulture Aegypius monachus in the ...

African Journals Online (AJOL)

Campbell Murn

Bird-strike of a Cinereous Vulture Aegypius monachus in the Balearic Islands, Spain. Alvaro Camiña1* and Joan ... http://dx.doi.org/10.4314/vulnew.v71i1.3. On 15 September 2016 a Lufthansa flight en route from Munich ... nautical miles from runway 24L. Considering the altitude of the area of around 100 meters, the bird ...

An analysis of bones and other materials collected by Cape Vultures ...

African Journals Online (AJOL)

We compared bones and non-faunal items collected by Cape Vultures at the Blouberg and Kransberg colonies. Bones from the base of the nesting cliffs were on average longer than those from the crops and stomachs of birds. Bones from the Blouberg cliff base were on average shorter than those from the Kransberg.

Centre for Cellular and Molecular Biology to breed vultures for Parsis

African Journals Online (AJOL)

Hyderabad – Parsis worried about the growing pile of bodies in their 'Towers of Silence' can take heart. The Centre for Cellular and Molecular Biology. (CCMB) has decided to take up, on an express basis, the job of breeding vultures, which can later be transported to various parts of the country. Though the problem of ...

Anatomy and ultrasonography of the normal kidney in brown lemurs: Eulemur fulvus.

Science.gov (United States)

Raharison, Fidiniaina; Mogicato, Giovanni; Sautet, Jean

2009-08-01

The purpose of this study is to describe the anatomy and obtain echographic measurements of normal kidneys in brown lemurs (Eulemur fulvus). The anatomical findings show that brown lemur kidneys are comparable to those of rats except for an elongated papilla. The kidneys of 16 (7 females and 9 males) lemurs were examined with two-dimensional and power Doppler ultrasonography under general anesthesia. Morphometrically, the left and right kidney surface areas are comparable (3.29 and 3.51 cm(2)). Kidney area has a significant linear correlation with body weight. Echo-Doppler findings show that the mean renal arterial blood flow speeds for the left and right kidneys are comparable (0.70 and 0.73 m/s). However, flow speed is higher in the male (0.79 m/s) than in the female (0.60 m/s). The renal arterial diameters are between 1.0 and 1.8 mm. The fact that anesthesia can have hemodynamic effects on renal vasculature should be taken into consideration when assessing these echographic results.

Effects of short- and long-term exposures to copper on lethal and reproductive endpoints of the harpacticoid copepod Tigriopus fulvus.

Science.gov (United States)

Biandolino, Francesca; Parlapiano, Isabella; Faraponova, Olga; Prato, Ermelinda

2018-01-01

The long-term exposure provides a realistic measurement of the effects of toxicants on aquatic organisms. The harpacticoid copepod Tigriopus fulvus has a wide geographical distribution and is considered as an ideal model organism for ecotoxicological studies for its good sensitivity to different toxicants. In this study, acute, sub-chronic and chronic toxicity tests based on lethal and reproductive responses of Tigriopus fulvus to copper were performed. The number of moults during larval development was chosen as an endpoint for sub-chronic test. Sex ratio, inhibitory effect on larval development, hatching time, fecundity, brood number, nauplii/brood, total newborn production, etc, were calculated in the chronic test (28d). Lethal effect of copper to nauplii showed the LC50-48h of 310 ± 72µgCu/L (mean ± sd). It was observed a significant inhibition of larval development at sublethal copper concentrations, after 4 and 7 d. After 4d, the EC50 value obtained for the endpoint in "moult naupliar reduction" was of 55.8 ± 2.5µgCu/L (mean ± sd). The EC50 for the inhibition of naupliar development into copepodite stage, was of 21.7 ± 4.4µgCu/L (mean ± sd), after 7 days. Among the different traits tested, copper did not affect sex ratio and growth, while fecundity and total nauplii production were the most sensitive endpoints. The reproductive endpoints offer the advantage of being detectable at very low pollutant concentrations. Copyright © 2017 Elsevier Inc. All rights reserved.

Anatomy, histology, and ultrasonography of the normal adrenal gland in brown lemur: Eulemur fulvus.

Science.gov (United States)

Raharison, Fidiniaina; Bourges Abella, Nathalie; Sautet, Jean; Deviers, Alexandra; Mogicato, Giovanni

2017-04-01

The medical care currently to brown lemurs (Eulemur fulvus) is limited by a lack of knowledge of their anatomy. The aim of this study was to describe the anatomy and histology and obtain ultrasonographic measurements of normal adrenal glands in these animals. The adrenal glands of four lemurs cadavers were used for the anatomical and histological studies, and those of 15 anesthetized lemurs were examined by ultrasonography. Anatomically, the adrenal glands of brown lemurs are comparable to those of other species. The histological findings showed that the cortex is organized into three distinct layers, whereas most domestic mammals have an additional zone. The surface area of the adrenal glands increased with body weight, and the area of the right adrenal was slightly larger than the left. We suggest using ultrasonography to aid the etiological diagnosis of behavioral abnormalities that might be due to dysfunctions of the adrenal gland. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

New Data About Breeding of the Cinereous Vulture in the Republic of Altai, Russia

Directory of Open Access Journals (Sweden)

Elena P. Snayder

2016-02-01

Full Text Available A new step in our knowledge on Cinereous Vulture spreading in Altai was done at the end of July of 2015 when a new breeding colony was found in the canyon of river Kyziilshin that belongs to the basin of Chagan-Uzun River. In total, we found four nest – two of them were empty, but the other two possessed the signs of being used by the vultures in the present year. Checking of the one of those nests yielded us a nice views on a full-fledged nestling. The four newly-found nests located in a row along the river. The distance between the neighboring nests were 0.26 km, 0.16 km and 0.43 km respectively. The spacing between the occupied nests was 0.43 km. The distance between the newly found colony in the canyon of Kyziilshin and the old one in the canyon of Chagan-Uzun is 4.62 km average.

Sulfates removal by the GYP-CIX process following lime treatment

International Nuclear Information System (INIS)

Robertson, A.M.; Everett, D.J.; Plessis, N.J. Du

1994-01-01

The treatment of acid mine drainage by limiting results in the discharge of water saturated in gypsum and containing residual metal concentrations. These waters may exceed drinking and irrigation water standards for TDS, sulfates and some metals. The scaling nature of the saturated gypsum solution makes it unsuitable for industrial use and makes further processing difficult and costly. This paper discusses a novel ion exchange process that is suitable to desalinate large volumes of mine and industrial waters with a TDS of up to 6,500 mg/l which is also high in calcium and sulfates, to meet effluent discharge specifications. The GYP-CIX process is a continuous fluidized bed ion-exchange process that effectively removes calcium sulfate from gypsum saturated waters. It uses low cost chemicals such as lime and sulfuric acid for resin regeneration. The only waste product is gypsum and the treated water produced meets standards for reuse or discharge. This process consists of a two stage operation. The first is the removal of cations in a multistage continuous loading train, using cation exchange resin. The second operation is the removal of anions, again in a multistage continuous loading train using anion exchange resin

Head color and caruncles of sympatric Cathartes vultures (Aves Cathartidae) in Guyana and their possible function in intra- and interspecific signaling

DEFF Research Database (Denmark)

Graves, Gary R.

2016-01-01

The naked heads of Cathartes vultures are widely believed to be adaptations for temperature regulation and to reduce plumage fouling during carrion feeding. Bright head color and the elaborate pattern of caruncles on the head and neck skin have a likely function in intra- and interspecific...... signaling. These integumentary characters have been difficult to study because of extensive postmortem color fading and shrinkage in museum specimens. Here I provide the first detailed description of head color and caruncles of the Greater Yellow-headed Vulture (C. melambrotus) from freshly collected...

Comparison of biomedical evaluation for white-fronted brown lemurs (Eulemur fulvus albifrons) from four sites in Madagascar.

Science.gov (United States)

Junge, Randall E; Dutton, Christopher J; Knightly, Felicia; Williams, Cathy V; Rasambainarivo, Fidisoa T; Louis, Edward E

2008-12-01

Health and nutritional assessments of wildlife are important management tools and can provide a means to evaluate ecosystem health. Such examinations were performed on 37 white-fronted brown lemurs (Eulemur fulvus albifrons) from four sites in Madagascar. Comparison of health parameters between sites revealed statistically significant differences in body weight, body temperature, respiratory rate, hematology parameters (white cell count, hematocrit, segmented neutrophil count, and lymphocyte count), serum chemistry parameters (aspartate aminotransferase, alanine aminotransferase, serum alkaline phosphatase, total protein, albumin, phosphorus, calcium, sodium, chloride, and creatinine phosphokinase), and nutrition parameters (copper, zinc, ferritin, retinol, tocopherol, and 25-hydroxycholecalciferol). Two of 10 lemurs tested were positive for toxoplasmosis; none of 10 were positive for Cryptosporidium or Giardia. Enteric bacteria and endo- and ectoparasites were typical. Statistically different values in hematology and chemistry values probably do not reflect clinically significant differences, whereas nutrition parameter differences are likely related to season, soil, and forage availability.

A balanced solution to the cumulative threat of industrialized wind farm development on cinereous vultures (Aegypius monachus) in south-eastern Europe

Science.gov (United States)

Whitfield, D. Philip; Kati, Vassiliki

2017-01-01

Wind farm development can combat climate change but may also threaten bird populations’ persistence through collision with wind turbine blades if such development is improperly planned strategically and cumulatively. Such improper planning may often occur. Numerous wind farms are planned in a region hosting the only cinereous vulture population in south-eastern Europe. We combined range use modelling and a Collision Risk Model (CRM) to predict the cumulative collision mortality for cinereous vulture under all operating and proposed wind farms. Four different vulture avoidance rates were considered in the CRM. Cumulative collision mortality was expected to be eight to ten times greater in the future (proposed and operating wind farms) than currently (operating wind farms), equivalent to 44% of the current population (103 individuals) if all proposals are authorized (2744 MW). Even under the most optimistic scenario whereby authorized proposals will not collectively exceed the national target for wind harnessing in the study area (960 MW), cumulative collision mortality would still be high (17% of current population) and likely lead to population extinction. Under any wind farm proposal scenario, over 92% of expected deaths would occur in the core area of the population, further implying inadequate spatial planning and implementation of relevant European legislation with scant regard for governmental obligations to protect key species. On the basis of a sensitivity map we derive a spatially explicit solution that could meet the national target of wind harnessing with a minimum conservation cost of less than 1% population loss providing that the population mortality (5.2%) caused by the operating wind farms in the core area would be totally mitigated. Under other scenarios, the vulture population would probably be at serious risk of extinction. Our ‘win-win’ approach is appropriate to other potential conflicts where wind farms may cumulatively threaten wildlife

A balanced solution to the cumulative threat of industrialized wind farm development on cinereous vultures (Aegypius monachus in south-eastern Europe.

Directory of Open Access Journals (Sweden)

Dimitris P Vasilakis

Full Text Available Wind farm development can combat climate change but may also threaten bird populations' persistence through collision with wind turbine blades if such development is improperly planned strategically and cumulatively. Such improper planning may often occur. Numerous wind farms are planned in a region hosting the only cinereous vulture population in south-eastern Europe. We combined range use modelling and a Collision Risk Model (CRM to predict the cumulative collision mortality for cinereous vulture under all operating and proposed wind farms. Four different vulture avoidance rates were considered in the CRM. Cumulative collision mortality was expected to be eight to ten times greater in the future (proposed and operating wind farms than currently (operating wind farms, equivalent to 44% of the current population (103 individuals if all proposals are authorized (2744 MW. Even under the most optimistic scenario whereby authorized proposals will not collectively exceed the national target for wind harnessing in the study area (960 MW, cumulative collision mortality would still be high (17% of current population and likely lead to population extinction. Under any wind farm proposal scenario, over 92% of expected deaths would occur in the core area of the population, further implying inadequate spatial planning and implementation of relevant European legislation with scant regard for governmental obligations to protect key species. On the basis of a sensitivity map we derive a spatially explicit solution that could meet the national target of wind harnessing with a minimum conservation cost of less than 1% population loss providing that the population mortality (5.2% caused by the operating wind farms in the core area would be totally mitigated. Under other scenarios, the vulture population would probably be at serious risk of extinction. Our 'win-win' approach is appropriate to other potential conflicts where wind farms may cumulatively threaten

Testing the goodness of supplementary feeding to enhance population viability in an endangered vulture.

Directory of Open Access Journals (Sweden)

Daniel Oro

Full Text Available BACKGROUND: Human-predator conflicts are directly or indirectly threatening many species with extinction. Thus, biologists are urged to find simple solutions to complex situations while avoiding unforeseen conservation outcomes. The provision of supplementary food at artificial feeding sites (AFS is frequently used in the conservation of scavenger bird populations currently suffering from indirect poisoning, although no scientific studies on its effectiveness have been conducted. METHODOLOGY/PRINCIPAL FINDINGS: We used a long-term data set of 95 individually marked birds from the largest European core of the endangered bearded vulture (Gypaetus barbatus to test the long-term effects of specific AFS for bearded vultures on their survival rates (by CMR models and population dynamics (by Monte Carlo simulations in an area where fatalities derived from illegal poisoning and the use of other toxics like veterinary drugs have increased over the last several years. Our data support the positive relationship between the use of AFS and survival. However, contrary to theoretical predictions (e.g. high and more stable adult survival among long-lived species, the use of AFS increased only survival of pre-adults. Moreover, AFS buffered the effects of illegal poisoning on this age-class, while adult survival decreased over years. Our simulations predicted a maximum value of extinction probability over a time horizon of 50 years. Population projections run with survival rates expected in scenarios without poisoning predicted the situation of least conservation concern, while including only AFS can maintain a large floater surplus that may delay population decline but fails to reduce poisoning risk among adults. CONCLUSIONS/SIGNIFICANCE: Although AFS are not effective to save bearded vultures from an expected population decline, they delay population extinction and can be a useful tool for prolonging population viability while combating illegal and indirect

VULTURES: EXEGESIS OF A SYMBOL

Directory of Open Access Journals (Sweden)

Maura Andreoni

2016-12-01

Full Text Available Depending on the different cultures and historical periods, vultures have been considered both impure or sacred. But, since they usually do not prey upon living animals, their symbolic dimension, associated to the idea of purification, is present in many myths, religions, burial praxis of ancient populations and remains in some religions today.In the ancient Mediterranean civilizations, they have been carved in some of the most ancient bas-reliefs of the history by stone age people; were sacred to Egyptians, who even took them as symbol of gods; in the classical times they were supposed to be all feminine and breed by parthenogenesis, and therefore appreciated by some early Christian authors, who came to comparing them even to the Virgin Mary; they have been studied and described by ancient scientists, naturalists, philosophers, playwrights; involved in many of the most enduring Greek and Roman myths and legends; many parts of their body were considered as a medicine or even a talisman for happiness; and they were so proverbial for Romans to become even one of the symbols of the founding of Rome itself.But they were also so fragile that perfumes, myrrh and pomegranates were supposed to be lethal for them ….

Lead and arsenic in bones of birds of prey from Spain

Energy Technology Data Exchange (ETDEWEB)

Mateo, R.; Taggart, M.; Meharg, A.A

2003-11-01

Raptors feeding on species targeted by hunters in upland habitats suffer from lead poisoning. - The bones (humerus and/or femur) of 229 birds of prey from 11 species were analyzed for Pb and As to evaluate their exposure to Pb shot. The species with the highest mean Pb levels were red kite (Milvus milvus) and Eurasian griffon (Gyps fulvus), and the species with the lowest levels were Eurasian buzzard (Buteo buteo) and booted eagle (Hieraaetus pennatus). Red kite also had the highest mean As level, an element present in small amounts in Pb shot. Elevated bone Pb concentrations (>10 {mu}g/g dry weight) were found in 10 birds from six species. Clinical signs compatible with lethal Pb poisoning and/or excessive bone Pb concentrations (>20 {mu}g/g) were observed in one Eurasian eagle-owl (Bubo bubo), one red kite, and one Eurasian griffon. Pb poisoning has been diagnosed in eight upland raptor species in Spain to date.

Lead and arsenic in bones of birds of prey from Spain

International Nuclear Information System (INIS)

Mateo, R.; Taggart, M.; Meharg, A.A.

2003-01-01

Raptors feeding on species targeted by hunters in upland habitats suffer from lead poisoning. - The bones (humerus and/or femur) of 229 birds of prey from 11 species were analyzed for Pb and As to evaluate their exposure to Pb shot. The species with the highest mean Pb levels were red kite (Milvus milvus) and Eurasian griffon (Gyps fulvus), and the species with the lowest levels were Eurasian buzzard (Buteo buteo) and booted eagle (Hieraaetus pennatus). Red kite also had the highest mean As level, an element present in small amounts in Pb shot. Elevated bone Pb concentrations (>10 μg/g dry weight) were found in 10 birds from six species. Clinical signs compatible with lethal Pb poisoning and/or excessive bone Pb concentrations (>20 μg/g) were observed in one Eurasian eagle-owl (Bubo bubo), one red kite, and one Eurasian griffon. Pb poisoning has been diagnosed in eight upland raptor species in Spain to date

Susceptibility to infection and immune response in insular and continental populations of Egyptian vulture: implications for conservation.

Directory of Open Access Journals (Sweden)

Laura Gangoso

Full Text Available BACKGROUND: A generalized decline in populations of Old World avian scavengers is occurring on a global scale. The main cause of the observed crisis in continental populations of these birds should be looked for in the interaction between two factors -- changes in livestock management, including the increased use of pharmaceutical products, and disease. Insular vertebrates seem to be especially susceptible to diseases induced by the arrival of exotic pathogens, a process often favored by human activities, and sedentary and highly dense insular scavengers populations may be thus especially exposed to infection by such pathogens. Here, we compare pathogen prevalence and immune response in insular and continental populations of the globally endangered Egyptian vulture under similar livestock management scenarios, but with different ecological and evolutionary perspectives. METHODS/PRINCIPAL FINDINGS: Adult, immature, and fledgling vultures from the Canary Islands and the Iberian Peninsula were sampled to determine a the prevalence of seven pathogen taxa and b their immunocompetence, as measured by monitoring techniques (white blood cells counts and immunoglobulins. In the Canarian population, pathogen prevalence was higher and, in addition, an association among pathogens was apparent, contrary to the situation detected in continental populations. Despite that, insular fledglings showed lower leukocyte profiles than continental birds and Canarian fledglings infected by Chlamydophila psittaci showed poorer cellular immune response. CONCLUSIONS/SIGNIFICANCE: A combination of environmental and ecological factors may contribute to explain the high susceptibility to infection found in insular vultures. The scenario described here may be similar in other insular systems where populations of carrion-eaters are in strong decline and are seriously threatened. Higher susceptibility to infection may be a further factor contributing decisively to the extinction

What Is It Going to Be? Pattern and Potential Function of Natal Coat Change in Sexually Dichromatic Redfronted Lemurs (Eulemur fulvus rufus)

DEFF Research Database (Denmark)

Barthold, Julia A; Fichtel, Claudia; Kappeler, Peter M

2009-01-01

In some primate species, pelage colorations at birth contrast with adult colorations. The intensity of natal coats and their phylogenetic distribution is highly variable within primates. Natal coat coloration seems to change to adult coloration in most species when infants become independent from...... their mothers, but an accepted functional explanation for natal coats is not available. Here we describe pelage coloration change in sexually dichromatic redfronted lemurs (Eulemur fulvus rufus) in Kirindy Forest, and propose a new functional hypothesis for this phenomenon. In this species, infants are born...... infants and 2) examined behavioral developmental correlates of the coloration change. The color change took place between 7 and 17 weeks of age and coincided with advanced physical independence; a pattern also found in monochromatic primate species with natal coats. No behavioral differences between male...

Using Wind Tunnels to Predict Bird Mortality in Wind Farms: The Case of Griffon Vultures

OpenAIRE

de Lucas, Manuela; Ferrer, Miguel; Janss, Guyonne F. E.

2012-01-01

Background: Wind farms have shown a spectacular growth during the last 15 years. Avian mortality through collision with moving rotor blades is well-known as one of the main adverse impacts of wind farms. In Spain, the griffon vulture incurs the highest mortality rates in wind farms. Methodology/Principal Findings: As far as we know, this study is the first attempt to predict flight trajectories of birds in order to foresee potentially dangerous areas for wind farm development. We analyse topo...

Spatial and temporal movements in Pyrenean bearded vultures (Gypaetus barbatus): Integrating movement ecology into conservation practice.

Science.gov (United States)

Margalida, Antoni; Pérez-García, Juan Manuel; Afonso, Ivan; Moreno-Opo, Rubén

2016-10-25

Understanding the movement of threatened species is important if we are to optimize management and conservation actions. Here, we describe the age and sex specific spatial and temporal ranging patterns of 19 bearded vultures Gypaetus barbatus tracked with GPS technology. Our findings suggest that spatial asymmetries are a consequence of breeding status and age-classes. Territorial individuals exploited home ranges of about 50 km 2 , while non-territorial birds used areas of around 10 000 km 2 (with no seasonal differences). Mean daily movements differed between territorial (23.8 km) and non-territorial birds (46.1 km), and differences were also found between sexes in non-territorial birds. Daily maximum distances travelled per day also differed between territorial (8.2 km) and non-territorial individuals (26.5 km). Territorial females moved greater distances (12 km) than males (6.6 km). Taking into account high-use core areas (K20), Supplementary Feeding Sites (SFS) do not seem to play an important role in the use of space by bearded vultures. For non-territorial and territorial individuals, 54% and 46% of their home ranges (K90), respectively, were outside protected areas. Our findings will help develop guidelines for establishing priority areas based on spatial use, and also optimize management and conservation actions for this threatened species.

Pathologic bone tissues in a Turkey vulture and a nonavian dinosaur: implications for interpreting endosteal bone and radial fibrolamellar bone in fossil dinosaurs.

Science.gov (United States)

Chinsamy, Anusuya; Tumarkin-Deratzian, Allison

2009-09-01

We report on similar pathological bone microstructure in an extant turkey vulture (Cathartes aura) and a nonavian dinosaur from Transylvania. Both these individuals exhibit distinctive periosteal reactive bone deposition accompanied by endosteal bone deposits in the medullary cavity. Our findings have direct implications on the two novel bone tissues recently described among nonavian dinosaurs, radial fibrolamellar bone tissue and medullary bone tissue. On the basis of the observed morphology of the periosteal reactive bone in the turkey vulture and the Transylvanian dinosaur, we propose that the radial fibrolamellar bone tissues observed in mature dinosaurs may have had a pathological origin. Our analysis also shows that on the basis of origin, location, and morphology, pathologically derived endosteal bone tissue can be similar to medullary bone tissues described in nonavian dinosaurs. As such, we caution the interpretation of all endosteally derived bone tissue as homologous to avian medullary bone. (c) 2009 Wiley-Liss, Inc.

Using Africa's protected area network to estimate the global population of a threatened and declining species: a case study of the Critically Endangered White-headed Vulture Trigonoceps occipitalis.

Science.gov (United States)

Murn, Campbell; Mundy, Peter; Virani, Munir Z; Borello, Wendy D; Holloway, Graham J; Thiollay, Jean-Marc

2016-02-01

The White-headed Vulture Trigonoceps occipitalis (WhV) is uncommon and largely restricted to protected areas across its range in sub-Saharan Africa. We used the World Database on Protected Areas to identify protected areas (PAs) likely to contain White-headed Vultures. Vulture occurrence on road transects in Southern, East, and West Africa was adjusted to nests per km(2) using data from areas with known numbers of nests and corresponding road transect data. Nest density was used to calculate the number of WhV nests within identified PAs and from there extrapolated to estimate the global population. Across a fragmented range, 400 PAs are estimated to contain 1893 WhV nests. Eastern Africa is estimated to contain 721 nests, Central Africa 548 nests, Southern Africa 468 nests, and West Africa 156 nests. Including immature and nonbreeding birds, and accounting for data deficient PAs, the estimated global population is 5475 - 5493 birds. The identified distribution highlights are alarming: over 78% (n = 313) of identified PAs contain fewer than five nests. A further 17% (n = 68) of PAs contain 5 - 20 nests and 4% (n = 14) of identified PAs are estimated to contain >20 nests. Just 1% (n = 5) of PAs are estimated to contain >40 nests; none is located in West Africa. Whilst ranging behavior of WhVs is currently unknown, 35% of PAs large enough to hold >20 nests are isolated by more than 100 km from other PAs. Spatially discrete and unpredictable mortality events such as poisoning pose major threats to small localized vulture populations and will accelerate ongoing local extinctions. Apart from reducing the threat of poisoning events, conservation actions promoting linkages between protected areas should be pursued. Identifying potential areas for assisted re-establishment via translocation offers the potential to expand the range of this species and alleviate risk.

First detection of an NSAID, flunixin, in sheep's wool using GC-MS

Energy Technology Data Exchange (ETDEWEB)

Richards, Ngaio, E-mail: ngaio.richards@anglia.ac.uk [Life Sciences, Anglia Ruskin University, East Road, Cambridge, CB1 1PT (United Kingdom); Hall, Sarah [Life Sciences, Anglia Ruskin University, East Road, Cambridge, CB1 1PT (United Kingdom); Scott, Karen [Forensic Medicine and Science, University of Glasgow, Glasgow G12 8QQ (United Kingdom); Harrison, Nancy [Life Sciences, Anglia Ruskin University, East Road, Cambridge, CB1 1PT (United Kingdom)

2011-05-15

Exposure to the nonsteroidal anti-inflammatory drug (NSAID) diclofenac resulted in the near extinction of three species of Gyps vultures on the Indian subcontinent. Other NSAIDs present in the environment, including flunixin, may pose a similar risk. In the course of a study to determine the feasibility of detecting NSAIDs in keratinous matrices (i.e., hair, nails and feathers) using GC-MS, wool opportunistically collected from a sheep treated with flunixin was analysed for residues. Flunixin was detected qualitatively in external wool wash and extract samples. While residues of veterinary agents and pesticides have previously been found in sheep's wool, our preliminary investigation provides the first instance of an NSAID being detected in this matrix. Here we provide the sample preparation methods and GC-MS parameters used to enable further refinement as part of ongoing conservation and consumer quality control measures. - Highlights: > In this study we qualitatively detected the NSAID flunixin in sheep's wool using GC-MS. > Potential applications of this technique to the conservation of avian scavengers are outlined. > The quantitative and confirmatory steps required to fully validate the method are also provided. - This is the first time that an NSAID has been investigated or detected in sheep's wool. As such, it details a novel exposure pathway for scavenging species in the environment and offers a potential tool for future monitoring effort in vulture conservation.

Detecting diclofenac in livestock carcasses in India with an ELISA: A tool to prevent widespread vulture poisoning

International Nuclear Information System (INIS)

Saini, Mohini; Taggart, Mark A.; Knopp, Dietmar; Upreti, Suchitra; Swarup, Devendra; Das, Asit; Gupta, Praveen K.; Niessner, Reinhard; Prakash, Vibhu; Mateo, Rafael; Cuthbert, Richard J.

2012-01-01

Diclofenac, a non-steroidal anti-inflammatory drug (NSAID), has caused catastrophic vulture declines across the Indian sub-continent. Here, an indirect ELISA is used to detect and quantify diclofenac in 1251 liver samples from livestock carcasses collected across India between August 2007 and June 2008, one to two years after a ban on diclofenac manufacture and distribution for veterinary use was implemented. The ELISAs applicability was authenticated with independent data obtained using LC–ESI/MS. Of 1251 samples, 1150 (91.9%) were negative for diclofenac using both methods, and 60 (4.8%) were positive at 10–4348 and 10–4441 μg kg −1 when analysed by ELISA and LC–ESI/MS, respectively. The residue level relationship in the 60 positive samples was highly significant (p 2 = 0.644). Data suggest that this immunological assay could be used not only for cost effective sample screening, but also for residue level semi-quantification. - Highlights: ► An ELISA is validated for use in diclofenac monitoring. ► We compare ELISA and LC–ESI/MS data for 1251 samples. ► Results indicate the ELISA can be reliably used for screening and semi-quantification. ► In 2007–2008, in India, around 1 in 20 ungulate carcasses contained detectable diclofenac. - The prevalence of diclofenac in carcasses available to vultures in India has declined from around 1:10 to 1:20 since restrictions on veterinary use were first put in place in 2006.

Uneven large-scale movement patterns in wild and reintroduced pre-adult bearded vultures: conservation implications.

Directory of Open Access Journals (Sweden)

Antoni Margalida

Full Text Available After the quasi-extinction of much of the European vertebrate megafauna during the last few centuries, many reintroduction projects seek to restore decimated populations. However, the future of numerous species depends on the management scenarios of metapopulations where the flow of individuals can be critical to ensure their viability. This is the case of the bearded vulture Gypaetus barbatus, an Old World, large body-sized and long-lived scavenger living in mountain ranges. Although persecution in Western Europe restrained it to the Pyrenees, the species is nowadays present in other mountains thanks to reintroduction projects. We examined the movement patterns of pre-adult non-breeding individuals born in the wild population of the Pyrenees (n = 9 and in the reintroduced populations of the Alps (n = 24 and Andalusia (n = 13. Most birds were equipped with GPS-GSM radio transmitters, which allowed accurate determination of individual dispersal patterns. Two estimators were considered: i step length (i.e., the distance travelled per day by each individual, calculated considering only successive days; and ii total dispersal distance (i.e., the distance travelled between each mean daily location and the point of release. Both dispersal estimators showed a positive relationship with age but were also highly dependent on the source population, birds in Andalusia and Alps moving farther than in Pyrenees. Future research should confirm if differences in dispersal distances are the rule, in which case the dynamics of future populations would be strongly influenced. In summary, our findings highlight that inter-population differences can affect the flow of individuals among patches (a key aspect to ensure the viability of the European metapopulation of the endangered bearded vulture, and thus should be taken into account when planning reintroduction programs. This result also raises questions about whether similar scenarios may occur in other

Effect of methodological and ecological approaches on heterogeneity of nest-site selection of a long-lived vulture.

Directory of Open Access Journals (Sweden)

Rubén Moreno-Opo

Full Text Available The application of scientific-based conservation measures requires that sampling methodologies in studies modelling similar ecological aspects produce comparable results making easier their interpretation. We aimed to show how the choice of different methodological and ecological approaches can affect conclusions in nest-site selection studies along different Palearctic meta-populations of an indicator species. First, a multivariate analysis of the variables affecting nest-site selection in a breeding colony of cinereous vulture (Aegypius monachus in central Spain was performed. Then, a meta-analysis was applied to establish how methodological and habitat-type factors determine differences and similarities in the results obtained by previous studies that have modelled the forest breeding habitat of the species. Our results revealed patterns in nesting-habitat modelling by the cinereous vulture throughout its whole range: steep and south-facing slopes, great cover of large trees and distance to human activities were generally selected. The ratio and situation of the studied plots (nests/random, the use of plots vs. polygons as sampling units and the number of years of data set determined the variability explained by the model. Moreover, a greater size of the breeding colony implied that ecological and geomorphological variables at landscape level were more influential. Additionally, human activities affected in greater proportion to colonies situated in Mediterranean forests. For the first time, a meta-analysis regarding the factors determining nest-site selection heterogeneity for a single species at broad scale was achieved. It is essential to homogenize and coordinate experimental design in modelling the selection of species' ecological requirements in order to avoid that differences in results among studies would be due to methodological heterogeneity. This would optimize best conservation and management practices for habitats and species in

Étude anatomique d'une espèce de lémurien (Eulemur fulvus) : coupes topographiques et tomodensitométriques du thorax, de l'abdomen et du bassin. Application à la pratique de l'échographie du cœur et des reins

OpenAIRE

Raharison, Fidiniaina

2008-01-01

L'objectif de notre étude est d'élaborer un document de référence mettant en relation l'anatomie, l'imagerie et la clinique du lémurien brun (Eulemur fulvus) et débouchant sur des mesures échographiques normales des reins et du cœur. Les études anatomique et tomodensitométrique ont été effectuées sur deux lémuriens et l'étude échographique sous différents modes sur 16 animaux après anesthésie. Les coupes anatomiques et tomodensitométriques nous ont permis de préciser la position et la conform...

The shikimic acid: an important metabolite for the Aglianico del Vulture wines

Directory of Open Access Journals (Sweden)

Pasquale Tamborra

2014-12-01

Full Text Available Shikimic acid is a precursor for the biosynthesis of aromatic amino acids and flavonoids (anthocyanins, tannins and flavonols. In the pharmaceutical industry, it is obtained by extraction of star anise from China, and at a yield of 3-7% it is used for the production of antiviral drug, e.g. oseltamivir. Unlike flavonoids which are only present in the grape skins, shikimic acid is present in the juice together with hydroxycinnamil tartaric acids (caffeic, ferulic and p-coumaric acid. Therefore, their content in white wines may not be negligible and their presence may explain the epidemiological studies that showed a reduced incidence of cardiovascular diseases also in people with moderate white wine consumption. The content of shikimic acid has been used to characterize wines. In southern Italy it has been used to distinguish Aglianico grape, which holds medium-high content, from Negroamaro, Primitivo and Uva di Troia grapes who have rather lower levels. It could be useful also to distinguish Fiano di Avellino (high value from Fiano Minutolo (low value. However, results of a recent work showed that the shikimic acid content decreases significantly during the ripening of the grapes and therefore its content in wine is strongly influenced by the harvest period. Finally, in a recent paper it was highlighted the increase in shikimic acid content at the end of fermentation in an Aglianico del Vulture wine, produced in the area of Rapolla (PZ, Italy municipality during the 2013 harvest. These last experimental results explain why the values of shikimic acid were lower in grapes and surprisingly higher in wines produced in the 2011 and 2012 harvest.

Differential range use between age classes of southern African Bearded Vultures Gypaetus barbatus.

Directory of Open Access Journals (Sweden)

Sonja Krüger

Full Text Available Bearded Vulture Gypaetus barbatus movements were investigated in southern Africa to determine whether an individual's age, sex or breeding status influenced its ranging behaviour and to provide the information required to guide conservation activities. Data from satellite transmitters fitted to 18 individuals of four age classes were used to determine range size and use. Because of the nature of the movements of marked individuals, these data could be used to determine the overall foraging range of the entire population, which was estimated to be 51 767 km(2. Although juvenile, immature and sub-adult birds used different parts of the overall range, their combined foraging range was 65% (33 636 km(2 of the overall range. Average adult home ranges (286 km(2 were only around 1% the size of the average foraging ranges of non-adults (10 540 -25 985 km(2, with those of breeding adults being even smaller (95 km(2. Home ranges of breeding adults did not vary in size between seasons but adults utilized their home range more intensively whilst breeding, moving greater distances during the incubation and chick hatching period. Range size and use increased as non-adults aged. Immatures and sub-adults had larger range sizes during winter, but range use of non-adults did not vary seasonally. Range size and use did not differ between the sexes in any of the age classes. Information on home range size and use enables specific areas within the species' range to be targeted for management planning, education and conservation action.

First Report of Cucumber mosaic virus Isolated from Sambungai (Gynura procumbens

Directory of Open Access Journals (Sweden)

June Kwon

2017-12-01

Full Text Available In March 2016, an isolate of Cucumber mosaic virus (named Gyp-CMV was isolated from the Sambungai (Gynura procumbens showing the symptoms of mosaic and chlorosis. The isolate Gyp-CMV was characterized by disease reactions in several indicator plants, reverse transcription-polymerase chain reaction (RT-PCR, PCR-restriction fragment length polymorphism, and sequence analysis of movement protein (3a and coat protein (CP genes. Tobacco, tomato, pepper, ground cherry, and lambsquarters (Chenopodium quinoa and C. amaranticolor appeared typical CMV symptoms, but zucchini and cucumber were not infected. Phylogenetic analysis of the 3a and CP gene indicated that Gyp-CMV belongs to the CMV subgroup II. Sequence identities of the Gyp-CMV 3a and CP genes showed 99.3% and 100% to that of Hnt-CMV at amino acid level. To our knowledge, this is the first report of CMV infection in Gynura procumbens.

Andean Condor (Vultur gryphus) in Ecuador: Geographic Distribution, Population Size and Extinction Risk.

Science.gov (United States)

Naveda-Rodríguez, Adrián; Vargas, Félix Hernán; Kohn, Sebastián; Zapata-Ríos, Galo

2016-01-01

The Andean Condor (Vultur gryphus) in Ecuador is classified as Critically Endangered. Before 2015, standardized and systematic estimates of geographic distribution, population size and structure were not available for this species, hampering the assessment of its current status and hindering the design and implementation of effective conservation actions. In this study, we performed the first quantitative assessment of geographic distribution, population size and population viability of Andean Condor in Ecuador. We used a methodological approach that included an ecological niche model to study geographic distribution, a simultaneous survey of 70 roosting sites to estimate population size and a population viability analysis (PVA) for the next 100 years. Geographic distribution in the form of extent of occurrence was 49 725 km2. During a two-day census, 93 Andean Condors were recorded and a population of 94 to 102 individuals was estimated. In this population, adult-to-immature ratio was 1:0.5. In the modeled PVA scenarios, the probability of extinction, mean time to extinction and minimum population size varied from zero to 100%, 63 years and 193 individuals, respectively. Habitat loss is the greatest threat to the conservation of Andean Condor populations in Ecuador. Population size reduction in scenarios that included habitat loss began within the first 15 years of this threat. Population reinforcement had no effects on the recovery of Andean Condor populations given the current status of the species in Ecuador. The population size estimate presented in this study is the lower than those reported previously in other countries where the species occur. The inferences derived from the population viability analysis have implications for Condor management in Ecuador. This study highlights the need to redirect efforts from captive breeding and population reinforcement to habitat conservation.

Vultures of the seas: hyperacidic stomachs in wandering albatrosses as an adaptation to dispersed food resources, including fishery wastes.

Directory of Open Access Journals (Sweden)

David Grémillet

Full Text Available Animals are primarily limited by their capacity to acquire food, yet digestive performance also conditions energy acquisition, and ultimately fitness. Optimal foraging theory predicts that organisms feeding on patchy resources should maximize their food loads within each patch, and should digest these loads quickly to minimize travelling costs between food patches. We tested the prediction of high digestive performance in wandering albatrosses, which can ingest prey of up to 3 kg, and feed on highly dispersed food resources across the southern ocean. GPS-tracking of 40 wandering albatrosses from the Crozet archipelago during the incubation phase confirmed foraging movements of between 475-4705 km, which give birds access to a variety of prey, including fishery wastes. Moreover, using miniaturized, autonomous data recorders placed in the stomach of three birds, we performed the first-ever measurements of gastric pH and temperature in procellariformes. These revealed surprisingly low pH levels (average 1.50±0.13, markedly lower than in other seabirds, and comparable to those of vultures feeding on carrion. Such low stomach pH gives wandering albatrosses a strategic advantage since it allows them a rapid chemical breakdown of ingested food and therefore a rapid digestion. This is useful for feeding on patchy, natural prey, but also on fishery wastes, which might be an important additional food resource for wandering albatrosses.

Genetic analysis on three South Indian sympatric hipposiderid bats (Chiroptera, Hipposideridae

Directory of Open Access Journals (Sweden)

Kanagaraj, C

2010-12-01

Full Text Available In mitochondrial DNA, variations in the sequence of 16S rRNA region were analyzed to infer the genetic relationship and population history of three sympatric hipposiderid bats, Hipposideros speoris, H. fulvus and H. ater. Based on the DNA sequence data, we observed relatively lower haplotype and higher nucleotide diversity in H. speoris than in the other two species. The pairwise comparisons of the genetic divergence inferred a genetic relationship between the three hipposiderid bats. We used haplotype sequences to construct a phylogenetic tree. Maximum parsimony and Bayesian inference analysis generated a tree with similar topology. H. fulvus and H. ater formed one cluster and H. speoris formed another cluster. Analysis of the demographic history of populations using Jajima’s D test revealed past changes in populations. Comparison of the observed distribution of pairwise differences in the nucleotides with expected sudden expansion model accepts for H. fulvus and H. ater but not for H. speoris populations.

Blood lead levels for Eurasian black vultures (Aegypius monachus migrating between Mongolia and the Republic of Korea

Directory of Open Access Journals (Sweden)

David Kenny

2015-09-01

Full Text Available Since 2009, we have been determining blood lead levels (BLLs for Eurasian black vulture (EbVs, Aegypius monachus in Mongolia. Since EbVs migrated from Mongolia to the Republic (R. of Korea in 2012, we started comparing BLLs from Mongolia to Korean birds [Mongolia; mean=2.72±0.09 μg/dL standard error (SE, n=181, R. of Korea; mean=6.68±0.58 μg/dL SE, n=124]. In Korea we also analyzed birds by comparing BLLs for free-ranging birds (mean=7.54±0.50 μg/dL SE, n=44 to rehabilitation center birds (mean=6.21±0.86 μg/dL SE, n=80, and for birds fed rescued water deer (Hydropotes inermis (mean=11.26±1.66 μg/dL SE, n=7 to birds fed livestock (mean=1.97±0.27 μg/dL, n=4. Finally, we analyzed BLLs from Mongolia and the R. of Korea according to the following categories: background=<10.0 μg/dL (Mongolia 100%, n=181; R. of Korea 83.1%, exposure=≥10.0 μg/dL to <45.0 μg/dL (Mongolia 0%; R. of Korea 16.1%, n=20, and diagnostic=≥45.0 μg/dL (Mongolia 0%; R. of Korea 0.8%, n=1. Our research indicates that EbVs are acquiring lead while migrating to the R. of Korea.

NEWS AND COMMENTS

African Journals Online (AJOL)

campbell

On the morning of 13 May 2013, driving on the S28, a gravel road in southern. Kruger National Park, between Crocodile Bridge camp and Lower Sabie camp, a sub-adult Egyptian Vulture was spotted. It was in open knob-thorn - marula woodland and sitting near a white-backed vulture. The Egyptian Vulture was preening, ...

Utilizing NASA Earth Observations to investigate habitat suitability of the Cape Vulture in the Western Cape Province of South Africa

Science.gov (United States)

Gray, D.; Estes, M. G., Jr.; Griffin, R.; Estes, S. M.

2017-12-01

As the global urban population rapidly increases, many wild species lose habitat to human development. The Western Cape of South Africa contains one of Earth's 35 biodiversity hotspots, with remarkably high levels of species richness and endemism. Understanding the relationship between anthropogenic changes and key species in this region is crucial for conservation of its threatened ecosystems. The objective of this research was to investigate the effect that climate change and urbanization each have on habitat suitability of the Cape Vulture. This research utilized NASA satellite data and crowdsourced species sightings to model past, current, and future habitat suitability for this key species in the Western Cape. Data used from NASA Earth Observations included: Landsat 8- derived Land Cover, Modis Land Surface Temperature, Digital Elevation Models from the Shuttle Radar Topography Mission, and precipitation data which integrated in-situ stations with Infrared data. Species observations were sourced from the Global Biodiversity Information Facility online database. A geospatial modelling framework was used to generate maps of present, past and future suitable habitats for analysis and comparison. Changes in precipitation and temperature may be a factor in the extreme loss of habitat since 1995, and predict even more drastic loss in the future. This research provides insights on anthropogenic effects on a species' range which may be used to inform discussions of conservation as an element of environmentally sustainable development.

Erratum to ``Eruption style and petrology of a new carbonatitic suite from the Mt. Vulture (Southern Italy): The Monticchio Lakes Formation'' [Journal of Volcanology and Geothermal Research 78 (1997) 251 265

Science.gov (United States)

Stoppa, Francesco; Principe, Claudia

1998-01-01

The Monticchio Lakes Formation (MLF) is a newly identified carbonatite-melilitite tuff sequence which is exposed in the southwestern sector of the Vulture volcano. It is the youngest example (ca. 0.13 m.y.) of this type of volcanism in Italy, although other carbonatites of smaller volume, but with similar characteristics, have been discovered recently. This volcanic event occurred in isolation after a 0.35 m.y. period of inactivity at Vulture. The eruption produced two maar-type vents and formed tuff aprons mainly composed of dune beds of lapilli. Depositional features suggest that a dry surge mechanism, possibly triggered by CO 2 expansion, was dominant during tuff emplacement. The MLF event involved a mixture of carbonatite and melilitite liquids which were physically separated before the eruption. Abundant mantle xenoliths are direct evidence of the deep-seated origin of the parental magma and its high velocity of propagation towards the surface. Often, these nodules form the core of lapilli composed of concentric shells of melilitite and/or porphyritic carbonatite. Coarse-ash beds alternate with lapilli beds and consist of abundant lumps and spherulae of very fine-grained calcite immersed in a welded, highly compacted carbonatite matrix. Porphyritic carbonatite shells of the lapilli and fine-grained spherulae of calcite in the tuff matrix suggest incipient crystallisation of a carbonatite liquid in subvolcanic conditions and eruption of carbonatite-spray droplets. Dark coloured juvenile fragments mainly consist of melilite, phlogopite, calcite, apatite, perovskite, and häuyne crystals in a carbonatite or melilitite matrix. The rocks have an extremely primitive, ultramafic composition with very high Mg# (> 85) and Cr and Ni content (1500 ppm). The calcite contains high SrO, BaO and REE of up to 1.5 wt.%. Similar compositions are typical of primary, magmatic carbonates which are found in both intrusive and extrusive carbonatites. The high modal Sr

Insights into the CuO nanoparticle ecotoxicity with suitable marine model species.

Science.gov (United States)

Rotini, A; Gallo, A; Parlapiano, I; Berducci, M T; Boni, R; Tosti, E; Prato, E; Maggi, C; Cicero, A M; Migliore, L; Manfra, L

2018-01-01

Metal oxide nanoparticles, among them copper oxide nanoparticles (CuO NPs), are widely used in different applications (e.g. batteries, gas sensors, superconductors, plastics and metallic coatings), increasing their potential release in the environment. In aquatic matrix, the behavior of CuO NPs may strongly change, depending on their surface charge and some physical-chemical characteristics of the medium (e.g. ionic strength, salinity, pH and natural organic matter content). Ecotoxicity of CuO NPs to aquatic organisms was mainly studied on freshwater species, few tests being performed on marine biota. The aim of this study was to assess the toxicity of CuO NPs on suitable indicator species, belonging to the ecologically relevant level of consumers. The selected bioassays use reference protocols to identify Effect/Lethal Concentrations (E(L)C), by assessing lethal and sub-lethal endpoints. Mortality tests were performed on rotifer (Brachionus plicatilis), shrimp (Artemia franciscana) and copepod (Tigriopus fulvus). While moult release failure and fertilization rate were studied, as sub-lethal endpoints, on T. fulvus and sea urchin (Paracentrotus lividus), respectively. The size distribution and sedimentation rates of CuO NPs, together with the copper dissolution, were also analyzed in the exposure media. The CuO NP ecotoxicity assessment showed a concentration-dependent response for all species, indicating similar mortality for B. plicatilis (48hLC 50 = 16.94 ± 2.68mg/l) and T. fulvus (96hLC 50 = 12.35 ± 0.48mg/l), followed by A. franciscana (48hLC 50 = 64.55 ± 3.54mg/l). Comparable EC 50 values were also obtained for the sub-lethal endpoints in P. lividus (EC 50 = 2.28 ± 0.06mg/l) and T. fulvus (EC 50 = 2.38 ± 0.20mg/l). Copper salts showed higher toxicity than CuO NPs for all species, with common sensitivity trend as follows: P. lividus ≥ T. fulvus (sublethal endpoint) ≥ B. plicatilis >T. fulvus (lethal endpoint) >A. franciscana. CuO NP micrometric

Browse Title Index

African Journals Online (AJOL)

, ... Vol 53 (2005), Poisoning of seventeen Eurasian Griffons by ... may help save critically endangered Asian vultures, Abstract PDF ... Vol 61 (2011), Trade in Andean Condor Vulture gryphus feathers and body parts in the ...

Kennedy Space Center (KSC) Launch Pad Avian Abatement Efforts Including Related KSC Road Kill Reduction Effort

Science.gov (United States)

Schlierf, Roland; Hight, Ron; Payne, Stephen J.; Shaffer, John P.; Missimer, Brad; Willis, Christopher

2007-01-01

While birds might seem harmless, there's a good reason for the concern. During the July 2005 launch of Discovery on mission STS-1 14, a vulture soaring around the launch pad impacted the shuttle's external tank just after liftoff. With a vulture's average weight ranging from 3 to 5 pounds. a strike at a critical point on the Shuttle -- like the nose or wing leading thermal protection panels -- could cause catastrophic damage to the vehicle. The foam chunk that fatefully struck Columbia's wing in 2003 weighed only 1.7 pounds. (Cheryl L. Mansfield "Bye Bye Birdies" 2006) To address this issue, NASA formed an "Avian Abatement Team". The team goal is to have safer Shuttle missions by reducing the vulture population at KSC near the pad area thereby reducing the probability of another vulture strike during a Shuttle launch.

ORF Alignment: cds [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 92 ---YSSRYIGSLVGDVHRTLIYGGVFGYPGDKKNPNGKLRLLYECAPMAYLMEQAGGIAT 348 ... ... YS+RYIGSLVGD HRTL+YGG++GYP D+K+ NGKLRLLYECAPM++++EQAGG ... + Sbjct: 240 GKPYSARYIGSLVGDFHRTLLYGGIYGYPRDQKSKNGKLRLLYECAPMSFIVEQAGGKGS 299 ...

Browse Title Index

African Journals Online (AJOL)

Items 101 - 150 of 154 ... ... Coragyps atratus at a South American sea lion breeding colony ... Notes and reports - New record of African White-backed Vulture ... Vol 61 (2011), Sympatric occurrence of four Cathartid vultures in the dry forests of ...

76 FR 66954 - Endangered Species; Receipt of Applications for Permit

Science.gov (United States)

2011-10-28

...). black lemur (Eulemur macaco). brown lemur (Eulemur fulvus). black and white ruffed lemur (Varecia...). black and white ruffed lemur (Varecia variagata). red ruffed lemur (Varecia rubra). black lemur (Eulemur...

SHORT COMMUNICATIONS, NOTES AND REPORTS

African Journals Online (AJOL)

campbell

Possible sighting of the Indian subspecies of the Egyptian. Vulture Neophron percnopterus ginginianus in Africa. Ivaylo Angelov. 1*. , Bruktawit Abdu. 2. , Nikolay Terziev. 3. , Samson Zelleke. 4. 1 “Balgarka” 29-A-18, Sliven 8800, Bulgaria. 2 Ethiopian Wildlife and Natural History Society. ... Tunisia, which Egyptian Vultures.

Download this PDF file

African Journals Online (AJOL)

Campbell Murn

Portuguese Nature Conservation. Agency) and the Arribes del Duero. Natural Park, revealed that there are. 135 pairs of Egyptian Vultures along the International Douro and its tributaries. Also, the survey of. Egyptian Vulture in France in 2016 was published by Erick Kobierzycki, who is responsible for the Pyrenees.

Development of microsatellite markers and a restriction endonuclease digest assay for non-invasive sampling of endangered white-rumped, slender-billed and red-headed vultues

Science.gov (United States)

Y.A. Kapetanakos; I.J. Lovette; T.E. Katzner

2014-01-01

Southeast Asian vultures have been greatly reduced in range and population numbers, but it is challenging to use traditional tagging and monitoring techniques to track changes in their populations. Genotypes derived from non-invasively collected feather samples provide an alternative and effective means to 'capture' individual vultures for mark-recapture...

Short CommuniCationS, noteS and reportS

African Journals Online (AJOL)

Lappet-faced Vultures with white feathers hein van Grouw. Curator, Bird Group, Dept. of Zoology, The Natural History Museum, Akeman Street,. Tring, Herts, HP23 6AP, UK. e-mail: h.van-grouw@nhm.ac.uk. Two different Lappet-faced Vultures Torgos tracheliotos with remarkable white feathers over their bodies are seen.

Assessing the impact on birds of prey of nine established wind farms in Thrace, NE Greece

Energy Technology Data Exchange (ETDEWEB)

Kret, Elzbieta; Carcamo, Beatriz; Zografou, Christina; Vasilakis, Dimitris

2011-07-01

Full text: In this study, we evaluate the impact on birds of prey of nine already established wind farms in Thrace, where a large scale wind farm development project of at least 930 MW is under development. Moreover, the area is acknowledged as of high ornithological interest, used for nesting, wintering and passage by rare territorial birds of prey, including the Near Threatened black vultures that use it for foraging. Finally, ca 50% of the wind farm development project area is covered by Natura 2000 sites. During the monitoring (2008-2010), carcass surveys were carried out in order to estimate mortality. In addition, avian space use surveys were carried out, in order to calculate indexes and to establish comparisons with a previous monitoring study run in 2004-05. In total, 14 birds of prey were found dead (one black vulture, four griffon vultures, one booted eagle, two short-toed eagles, one western marsh harrier, one Eurasian sparrow hawk, three common buzzards, one hawk species). The estimated mortality rate was 0.152 birds of prey (including vultures/turbine/year). Griffon vultures, black vultures and common buzzards comprised more than 50% of observations in the study area. Crossing densities between wind turbines were positively correlated with east exposition and the inclination of the slope, and the length of the wind turbines. gaps, while it was negatively correlated with north exposition. The use of the area was more intensive four years after the initial monitoring, but numbers of common buzzard observations drastically decreased. We suggest that during the planning phase of wind farms it is important to avoid steep slopes, east expositions and to take into account the distance between consecutive wind turbines. Our findings indicate that running a post-construction monitoring during only one year may not be enough to properly assess the impact of wind farms on birds of prey. (Author)

Author Details

African Journals Online (AJOL)

Tidmus, Scott. Vol 71 (2016) - Articles Vulture updates - October 2016 - Around the World of Vultures & VSG activities. Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use ...

Author Details

African Journals Online (AJOL)

Williams, RSR. Vol 61 (2011) - Articles Trade in Andean Condor Vulture gryphus feathers and body parts in the city of Cusco and the Sacred Valley, Cusco region, Peru Abstract PDF · Vol 61 (2011) - Articles Sympatric occurrence of four Cathartid vultures in the dry forests of north-western Peru Abstract PDF. ISSN: 1606- ...

Untersuchungen zum Vorkommen von Myxobakterien in von Meerwasser beeinflußten Substraten unter besonderer Berücksichtigung der Insel Helgoland

Science.gov (United States)

Rückert, G.

1984-03-01

Representatives of the family Myxococcaceae, Myxococcus fulvus and M. virescens as well as Archangium gephyra could be isolated from marine sediments (depth range 5 58 m), collected near the island of Helgoland (North Sea); dunes and rudiments of salt marshes additionally yielded M. coralloides and the rare species Melittangium licenicola and M. boletus (Cystobacteriaceae). In soil samples from the island, M. fulvus, M. virescens, M. coralloides, A. gephyra, Cystobacter fuscus and Stigmatella erecta were found. These results were confirmed by data, obtained from the coastal zone of the island of Amrum and marine sediments from various regions. On the other hand samples from shallow fresh water (depth range 0.3 1 m) proved to be richer in species. It is assumed that the myxobacteria found in marine sediments occur as resting cells.

New contributions to the knowledge of Chinese flea beetle fauna (I); Gansuapteris new genus and Primulavorus new genus (Coleoptera; Chrysomelidae; Galerucinae)

Science.gov (United States)

Two new genera and species of flea beetles (Gansuapteris gen. nov., Primulavorus gen. nov., Gansuapteris fulvus sp. nov. and Primulavorus maculata sp. nov.) from South-west China are described and illustrated. The morphological differences of new genera and their allies are discussed....

A new species of Polycyathus Duncan, 1876 from New Caledonia and a new record of Polycyathus senegalensis Chevalier, 1966 (Madreporaria)

NARCIS (Netherlands)

Wijsman-Best, Maya

1970-01-01

A new species of Madreporaria, Polycyathus fulvus, is described from New Caledonia. Zooxanthellae have been found symbiotic in its polyps, although the genus is ahermatypic. Another Polycyathus, P. senegalensis Chevalier, 1966, is recorded from the Caribbean area; it was previously known from the

Fungal Systematics and Evolution: FUSE 2

NARCIS (Netherlands)

Hernández-Restrepo, Margarita; Schumacher, René K.; Wingfield, Michael J.; Ahmad, Ishtiaq; Cai, Lei; Duong, Tuan A.; Edwards, Jacqueline; Gené, Josepa; Groenewald, Johannes Z.; Jabeen, Sana; Nasir Khalid, Abdul; Lombard, Lorenzo; Madrid, Hugo; Marin-Felix, Yasmina; Marincowitz, Seonju; Miller, Andrew N.; Rajeshkumar, Kunhiraman C.; Rashid, Abdul; Sarwar, Samina; Stchigel, Alberto M.; Taylor, Paul W.J.; Zhou, Nan; Crous, Pedro W.

2016-01-01

The present study introduces two new genera, 14 new species, five new combinations and 12 interesting host and/or geographical records. A majority of the fungi are Ascomycetes, but the study also includes a Basidiomycete, Xerocomellus fulvus described from Pakistan. Under single name nomenclature

Vulture News

African Journals Online (AJOL)

... underutilized samples for detecting organophosphorus and carbamate pesticide poisoning in raptors · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ngaio Richards, Irene Zorrilla, Joseph Lalah, Peter Otieno, Isabel Fernandez, Monica Calvino, Joaquin Garcia ...

[Index screening and comprehensive evaluation of phenotypic traits of low nitrogen tolerance using BILs population derived from Dongxiang wild rice (Oryza rufipogon Griff)].

Science.gov (United States)

Hu, Biao-lin; Li, Xia; Wan, Yong; Qiu, Zai-hui; Nie, Yuan-yuan; Xie, Jian-kun

2015-08-01

To identify the low nitrogen tolerance of Dongxiang wild rice (DXWR) and its progenies, ten phenotypic traits including plant height (PH), heading day (HD), panicle length (PL), number of effective tillers per plant (NETP), number of filled grains per panicle (NFGP), number of grains per panicle (NGP), grain density (GD), spikelet fertility (SF), 1000-grain mass (TGM) and grain yield per plant (GYP) were studied under normal and low nitrogen treatments, using backcross inbred lines (BILs) of Xieqingzao B//DXWR/Xieqingzao B in BC1 F12. Comprehensive evaluation on the low nitrogen tolerance of the BILs population was conducted using principal component analysis and the subordinate function. The evaluation results indicated that the low nitrogen tolerance of the line 116, 143 and 157 was the strongest, which could be served as the intermediate materials for genetic studies on the low nitrogen tolerance of DXWR and breeding for the low nitrogen tolerance in rice. The optimal regression equation of the low nitrogen tolerance in rice was established using stepwise regression analysis. The relative values of five traits including PH, NGP, SF, TGM and GYP were screened out and could be used as comprehensive evaluation indices for the low nitrogen tolerance in the whole growth stage. Therefore, more attention should be paid to the relative values of these five traits, especially for NGP and GYP, in the genetic improvement of the low nitrogen tolerance in rice.

Egyptian Vultures and the principle of subspecies in vultures

African Journals Online (AJOL)

Campbell Murn

“abnormal pigmentation” (Porter &. Suleiman 2012). (ii) an adult was photographed in northern Ethiopia (410E) in December. 2010, and was noted as “considerably ... Cramp & Simmons 1980) has provided some real data on percnopterus skins from museums, to compare against the average of ginginianus from literature.

Mighty vulture back from near extinction | Nickerson | Vulture News

African Journals Online (AJOL)

Journal Home > Vol 56 (2007) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register · Download this PDF file. The PDF file you selected should load here if your Web browser has a PDF reader plug-in installed (for example, a recent version of Adobe Acrobat Reader).

The effect of chlorsulfurone and MCPB-Na on the enzymatic activity of microorganisms

Directory of Open Access Journals (Sweden)

Filimon Marioara Nicoleta

2014-01-01

Full Text Available herbicides, have a broad spectrum effect on weeds, in relatively low doses and with a much reduced toxicity on livestock. In this study were used two herbicides: dacsulfuron with the active substance chlorsulfuron (0.005 - 0.035 μg/g soil and butoxone with the active substance MCPB-Na (0.005 - 0.035 mg/L/g soil. The samples were collected from a depth of 0-20 cm from chernozem soil. The effect of herbicide was estimated by measuring the activity of catalase, actual and potential dehydrogenase, urease and cellulase activities. All samples being incubated for 10 days at 27°C using Sapp medium for isolation and study of cellulosolytic bacteria. The inhibitory effect of the tested herbicides was the most intense for the urease and dehydrogenase enzymatic activities. The most resistant cellulosolytic bacteria to the effects of dacsulfuron were Cellfalcicula fusca, Cellfalcicula viridis, Cellvibrio fulvus and Fuseaux veris and for butoxone Cellfalcicula mucosa, C. viridis and C. fulvus.

Assessment of Mercury in Soils, Crops, Earthworms, and Water when Soil is Treated with Gypsum

Science.gov (United States)

Flue gas desulfurization (FGD) gypsum from fossil fuel combustion has many potential uses in agriculture, but there is concern about the potential environmental effects of its elevated mercury (Hg) concentration. The wet limestone scrubbing process that removes sulfur from flue gas (and produces gyp...

Phenology prediction component of GypsES

Science.gov (United States)

Jesse A. Logan; Lukas P. Schaub; F. William Ravlin

1991-01-01

Prediction of phenology is an important component of most pest management programs, and considerable research effort has been expended toward development of predictive tools for gypsy moth phenology. Although phenological prediction is potentially valuable for timing of spray applications (e.g. Bt, or Gypcheck) and other management activities (e.g. placement and...

Lemur species-specific metapopulation responses to habitat loss and fragmentation.

Directory of Open Access Journals (Sweden)

Travis S Steffens

Full Text Available Determining what factors affect species occurrence is vital to the study of primate biogeography. We investigated the metapopulation dynamics of a lemur community consisting of eight species (Avahi occidentalis, Propithecus coquereli, Microcebus murinus, Microcebus ravelobensis, Lepilemur edwardsi, Cheirogaleus medius, Eulemur mongoz, and Eulemur fulvus within fragmented tropical dry deciduous forest habitat in Ankarafantsika National Park, Madagascar. We measured fragment size and isolation of 42 fragments of forest ranging in size from 0.23 to 117.7 ha adjacent to continuous forest. Between June and November 2011, we conducted 1218 surveys and observed six of eight lemur species (M. murinus, M. ravelobensis, C. medius, E. fulvus, P. coquereli, and L. edwardsi in the 42 fragments. We applied among patch incidence function models (IFMs with various measures of dispersal and a mainland-island IFM to lemur species occurrence, with the aim of answering the following questions: 1 Do lemur species in dry deciduous forest fragments form metapopulations? 2 What are the separate effects of area (extinction risk and connectivity/isolation (colonization potential within a lemur metapopulation? 3 Within simulated metapopulations over time, how do area and connectivity/isolation affect occurrence? and 4 What are the conservation implications of our findings? We found that M. murinus formed either a mainland-island or an among patch metapopulation, M. ravelobensis formed a mainland-island metapopulation, C. medius and E. fulvus formed among patch metapopulations, and neither P. coquereli or L. edwardsi formed a metapopulation. Metapopulation dynamics and simulations suggest that area was a more consistent positive factor determining lemur species occurrence than fragment isolation and is crucial to the maintenance of lemur populations within this fragmented landscape. Using a metapopulation approach to lemur biogeography is critical for understanding how

Conservation genetics of Iberian raptors

Directory of Open Access Journals (Sweden)

Martinez–Cruz, B.

2011-12-01

Full Text Available In this paper I provide an overview of conservation genetics and describe the management actions in the wild that can benefit from conservation genetic studies. I describe the genetic factors of risk for the survival of wild species, the consequences of loss of genetic diversity, inbreeding and outbreeding depression, and the use of genetic tools to delimitate units of conservation. Then I introduce the most common applications of conservation genetics in the management of wild populations. In a second part of the paper I review the conservation genetic studies carried on the Iberian raptors. I introduce several studies on the Spanish imperial eagle, the bearded vulture, the black vulture and the red kite that were carried out using autosomal microsatellite markers and mitochondrial DNA (mtDNA sequencing. I describe studies on the lesser kestrel and Egyptian vulture that additionally applied major histocompatibility complex (MHC markers, with the purpose of incorporating the study of non–neutral variation. For every species I explain how these studies can be and/or are applied in the strategy of conservation in the wild.

Vulture News: Submissions

African Journals Online (AJOL)

On first mention in all articles, the generally accepted English common name of a species should be followed by the scientific binomial. Thereafter the English name should be used. Scientific names and all non-English words, with the exception of those adopted into the English language, should be in italics. Journal names ...

Calibration of a PHREEQC Based Geochemical Model to Predict Surface Water Discharge Compositions from an Operating Uranium Mill in the Athabasca Basin

International Nuclear Information System (INIS)

Mahoney, John J.; Frey, Ryan A.

2014-01-01

Objectives: • Develop predictive model to estimate concentrations in the Sink Vulture Treated Effluent Management System (SVTEMS) for AREVA Resources Canada McClean Lake Mill: • Sink Reservoir, Vulture and McClean Lakes; • PHREEQC based calculations for geochemistry; • Employ PHREEPLOT for data fittings. • Model designed to predict concentrations in response to changing conditions, including: • Different ores; • Different processes; • Different waters sources; • Changing treatment conditions; • This is a batch mixing model: • Think well mixed beakers; • Each model represents one year; • No year-to-year carry over in models

The Humansdorp Cape Griffon Site

African Journals Online (AJOL)

ZeldaH

Figure 1. The cliff north-west of the town of Humansdorp, Eastern Cape, South Africa, where a small group of Cape Griffons Gyps coprotheres roosted, and reportedly bred, until the end of the. 19 th century. The trees seen in the picture are all alien, invasive, black wattles Acacia mearnsii. (Photo: A Boshoff).

VULTURE NEWS 55.indd

African Journals Online (AJOL)

introduced veterinary pharmaceuticals. Diclofenac is a non steroidal anti- inflammatory (NSAID) drug administered to livestock on the Indian subcontinent. Diclofenac is administered for many of the same reasons that a human might take aspirin or ibuprofen, it masks nominal pain and discomfort and gets us back on our feet ...

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-01-30

Jan 30, 2006 ... extensive visceral gout (a buildup of uric acid crystals in the internal organs associated with renal failure). The birds often appeared sick and lethargic, some showed prolonged severe neck drooping, before collapsing—sometimes from their perches. Intensive testing failed to implicate infectious disease ...

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-09-02

Sep 2, 2006 ... area in eastern Mali (Rondeau et al. in prep), along with the Gandamia colony of Gourma, Mali – once the largest in West Africa (Elósegui 1975) that is now virtually abandoned (Rondeau &. Thiollay 2004, Thiollay 2006), there is no overpopulation, nor lack of suitable cliffs, to explain the tree-nesting ...

Tagged vulture causes concerns

African Journals Online (AJOL)

2008-09-15

Sep 15, 2008 ... Italy, Croatia, Bulgaria, Greece, Serbia,. Macedonia, Turkey, Jordan, Sinai and even from Saudi Arabia. Together with. Orr Spiegel we fit 40 GPS-loggers (these are not transmitters) as part of a feeding and demography study, in addition to a smaller number of GPS/PTT transmitters received from Argos.

Vulture News: Advanced Search

African Journals Online (AJOL)

Search tips: Search terms are case-insensitive; Common words are ignored; By default only articles containing all terms in the query are returned (i.e., AND is implied); Combine multiple words with OR to find articles containing either term; e.g., education OR research; Use parentheses to create more complex queries; e.g., ...

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-06-18

Jun 18, 2006 ... near San Lucas, but the marksmen didn't use non-lead ammunition. Condors eat only carrion – dead carcasses – and are highly susceptible to lead poisoning if they ingest lead bullet ... came in and started eating everything,”. Petersen said. News of the ... And yet the state refuses to act.” Earlier this.

VULTURE NEWS 55.indd

African Journals Online (AJOL)

2006-09-02

Sep 2, 2006 ... to scan the hills with binoculars. To my shock, just 20 feet away, I found myself looking into the ruby eyes of a condor. It was perched on the brink of a cliff, just beyond a guard rail, overlooking. Sea Lion Cove and the Pacific Ocean. The condor stared straight at me as if wondering when I might be ready for.

Demonstration of Antimicrobial Corrosion-Resisting Interior Coating Systems for Military Facilities in Warm, Humid Locations

Science.gov (United States)

2017-06-01

solutions in civil and military engineering, geospatial sciences, water resources, and environmental sciences for the Army, the Department of Defense...was unexpectedly upgraded soon after the demonstration coatings were applied, apparently due to a scheduling change or miscommunication re- lated...oils and grease, so no cleaning solution was needed. Sherwin Williams ProMar 200 acrylic primer was used to prime all gyp- sum surfaces that were

VIGILANCE POISON: Illegal poisoning and lead intoxication are the main factors affecting avian scavenger survival in the Pyrenees (France).

Science.gov (United States)

Berny, Philippe; Vilagines, Lydia; Cugnasse, Jean-Marc; Mastain, Olivier; Chollet, Jean-Yves; Joncour, Guy; Razin, Martine

2015-08-01

A specific surveillance program has been set up to monitor avian scavenger populations in the French Pyrenean Mountains, hosting a high proportion of the French populations. The two main purposes of the study were to identify all causes of death and to investigate poisoning cases. All 170 birds found dead during the 7-year program were submitted to full necropsy, X-Ray, parasitological investigations and consistent analytical toxicology screenings (Cholinesterase inhibitors, anticoagulant rodenticides, organochlorine insecticides, Pb, Cd). Over the study period, 8 Bearded Vultures, 120 Griffon Vultures, 8 Egyptian Vultures and 34 Red kites were eventually collected. Mortality events were often multifactorial, but poisoning was by far the most common cause of death (24.1%), followed by trauma/fall (12%), bacterial diseases and starvation (8%) and electrocution (6%). Illicit use of banned pesticides was identified as a common cause of poisoning (53% of all poisoning cases) and lead poisoning was also identified as a significant toxicant issue (17% of all poisoning cases). Lead isotopic signature could be associated primarily with ammunition. Last, a positive association between trauma and lead contamination was detected, indicating that lead could be a significant contributor to different causes of death. These results urge for severe restrictions on the use of lead ammunition to prevent scavengers from detrimental exposure. Copyright © 2015 Elsevier Inc. All rights reserved.

Ostrich: Journal of African Ornithology - Vol 77, No 1 (2006)

African Journals Online (AJOL)

Adaptive benefits of differential post-fledging development patterns in the Lesser Flamingo ... Breeding records and nest site preference of Hooded Vultures in the greater Kruger ... The Bird-watcher's Companion to North American Birdlife

Download this PDF file

African Journals Online (AJOL)

Many animal species benefit from resources provided by other species. ... 98), we observed behavioral interactions at the Punta Lobería Southern Sea-lion ... by Black Vulture Coragyps atratus, Kelp Gull Larus dominicanus and Domestic Dogs.

African Journals Online (AJOL)

African Journals Online (AJOL)

2013). International Journal of Engineering, Science and Technology. Vol 5, No 3 (2013). International Journal of Engineering, Science and Technology. Vol 30, No 1 (2018). South African Journal of Sports Medicine. Vol 66 (2014). Vulture News.

Download this PDF file

African Journals Online (AJOL)

User

Ilorin Journal of Religious Studies, (IJOURELS). Vol.7 No.2, 2017, ..... Bee, iah meaning Vulture , Zimri meaning a mountain Sheep ,. Jonah meaning Dove , ..... American Journal of Semitic Languages and Literatures Vol. 24, No. 1. (1907) ...

African Zoology - Vol 25, No 3 (1990)

African Journals Online (AJOL)

Food choice and diet of the bearded vulture Gypaetus barbatus in southern Africa · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. C.J. Brown, I Plug, 169-177 ...

Download this PDF file

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... most colonies of Cape Vultures have gone extinct; a southern colony is the only one showing ... have disappeared first around Lesotho causing both species' range to retract into ... plants and animals have shifted their.

[Culicidae insect fauna from rural zone in Amazonas State with incidence of sylvatic yellow fever].

Science.gov (United States)

Fé, Nelson Ferreira; Barbosa Md, Maria das Graças Vale; Fé, Flávio Augusto Andrade; Guerra, Marcus Vinitius de Farias; Alecrim, Wilson Duarte

2003-01-01

After the occurrence of 14 sylvatic yellow fever cases in 10 cities in the State of Amazonas during 1996, an investigation into the presence of sylvatic yellow fever vectors was carried out. The material of larvae and adult insects was collected around residences and canopy trees within forests, using a light trap (CDC) and human bait. A total of 424 insects was collected. Thirty seven species were identified, some of which were sylvatic yellow fever vectors: Haemagogus janthinomys, Ha. leucocelaenus, Aedes fulvus.

Selected mineral and heavy metal concentrations in blood and ...

African Journals Online (AJOL)

Unknown

Pb in the dead vultures were generally above values characteristic of heavy metal poisoning. ... of the food chain), may accumulate and concentrate heavy metals in their ..... µg/g wet weight) (Honda et al., 1990), which validates the order of ...

78 FR 23286 - Endangered Species; Marine Mammals; Receipt of Applications for Permit

Science.gov (United States)

2013-04-18

...-horned oryx (Oryx dammah), from the captive herd maintained at their facility, for the purpose of...) African wild dog (Lycaon pictus) Rothschild's starling (Leucopsar rothschildi) Radiated tortoise...) Koala (Phascolarctos cinereus) African wild dog (Lycaon pictus) Andean condor (Vultur gryphus) Harpy...

Vulture News - Vol 53 (2005)

African Journals Online (AJOL)

Poisoning of seventeen Eurasian Griffons by carbofuran on the Island of Rab, Croatia, in December 2004 · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Gordana Pavokovic, Goran Susic, 24-25. http://dx.doi.org/10.4314/vulnew.v53i1.37632 ...

Book Reviews | Mundy | Vulture News

African Journals Online (AJOL)

(2015) Ministry of Environment and Tourism, and Namibia Nature Foundation, Windhoek. 320pp. ISBN 978-9-9945-0082-6. Book Review 3. Book Title: The 2015 Eskom Red Data Book of birds of South Africa, Lesotho and Swaziland. Book Authors: M.R. Taylor, F Peacock & R.M. Wanless (Eds.) (2015) BirdLife South Africa, ...

Vulture News - Vol 72 (2017)

African Journals Online (AJOL)

... but underutilized samples for detecting organophosphorus and carbamate pesticide poisoning in raptors · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Ngaio Richards, Irene Zorrilla, Joseph Lalah, Peter Otieno, Isabel Fernandez, Monica Calvino, Joaquin Garcia ...

Journal of Biosciences | Indian Academy of Sciences

Indian Academy of Sciences (India)

... Faculty of Veterinary, University of Zaragoza, Zaragoza, Spain; Foundation for the Conservation of the Bearded Vulture (FCQ), Zaragoza, Spain; Biodiversity Service, Agriculture and Environmental Department, Aragón Government, Aragón, Spain; Wildlife Conservation Centre La Alfranca, Zaragoza, Spain; Surgery Unit, ...

Wind effects on the migration routes of trans-Saharan soaring raptors: geographical, seasonal, and interspecific variation

Science.gov (United States)

Vidal-Mateo, Javier; Mellone, Ugo; López-López, Pascual; La Puente, Javier De; García-Ripollés, Clara; Bermejo, Ana; Urios, Vicente

2016-01-01

Abstract Wind is among the most important environmental factors shaping birds’ migration patterns. Birds must deal with the displacement caused by crosswinds and their behavior can vary according to different factors such as flight mode, migratory season, experience, and distance to goal areas. Here we analyze the relationship between wind and migratory movements of three raptor species which migrate by soaring–gliding flight: Egyptian vulture Neophron percnopterus, booted eagle Aquila pennata, and short-toed snake eagle Circaetus gallicus. We analyzed daily migratory segments (i.e., the path joining consecutive roosting locations) using data recorded by GPS satellite telemetry. Daily movements of Egyptian vultures and booted eagles were significantly affected by tailwinds during both autumn and spring migrations. In contrast, daily movements of short-toed eagles were only significantly affected by tailwinds during autumn migration. The effect of crosswinds was significant in all cases. Interestingly, Egyptian vultures and booted eagles showed latitudinal differences in their behavior: both species compensated more frequently at the onset of autumn migration and, at the end of the season when reaching their wintering areas, the proportion of drift segments was higher. In contrast, there was a higher drift at the onset of spring migration and a higher compensation at the end. Our results highlight the effect of wind patterns on the migratory routes of soaring raptors, with different outcomes in relation to species, season, and latitude, ultimately shaping the loop migration patterns that current tracking techniques are showing to be widespread in many long distance migrants. PMID:29491895

ARTICLES

African Journals Online (AJOL)

Campbell Murn

Traders identified the following traits ascribed to vulture remains: treatment of epilepsy, insanity, stroke, ease of delivery in women, spiritual protection against witches and witchcraft, evil spirits, good luck (during gambling, money doubling, competition, contest), to stimulate walking in infants, and to gain supernatural powers.

Conservation of the Red Kite Milvus milvus (Aves: Accipitriformes) is not affected by the establishment of a broad hybrid zone with the Black Kite Milvus migrans migrans in central Europe

Czech Academy of Sciences Publication Activity Database

Heneberg, P.; Dolinay, Matej; Matušík, H.; Pfeiffer, T.; Nachtigall, W.; Bizos, J.; Šimčíková, D.; Literák, I.

2016-01-01

Roč. 11, č. 7 (2016), č. článku 159202. E-ISSN 1932-6203 Institutional support: RVO:68081766 Keywords : Old-World vultures * mitochondrial DNA * harriers circus * bird * gene * sterility * Eagles * hybridization * phylogeny Subject RIV: EG - Zoology Impact factor: 2.806, year: 2016

SHORT COMMUNICATIONS, NOTES AND REPORTS Record of ...

African Journals Online (AJOL)

Campbell Murn

50. SHORT COMMUNICATIONS, NOTES AND. REPORTS. Record of Cinereous Vulture Aegypius monachus from Mukundara Hills Tiger Reserve, Rajasthan,. India. Sailaja Nayak1*, Sunny Shah2 and Jimmy Borah2 .... Prey status and abundance in Mukundara Hills Tiger. Reserve. Technical Report, WWF-India. Rao, J.P. ...

Articles

African Journals Online (AJOL)

ZeldaH

better method than a bird carrying us up to the heavens. ... on the Gulf of Khambhat at 250 km north of Mumbai .... connected to the war-god Ares, and thus affiliated to .... The role of vultures in the disposal of human corpses in India and. Tibet.

ARTICLES

African Journals Online (AJOL)

Migrants tended to fly higher in more stable air than local birds, which often fly low over the forest canopy .... Flapping rate of Turkey Vultures as a function of cloud cover in Costa Rica, autumn 2003. Data are ... layer in order to search for food.

Serologic evidence of exposure of raptors to influenza A virus.

Science.gov (United States)

Redig, Patrick T; Goyal, Sagar M

2012-06-01

Serum or plasma samples from raptors that prey or scavenge upon aquatic birds were tested by a commercially available blocking enzyme-linked immunosorbent assay for the evidence of antibodies to influenza A virus. Samples were taken from birds (n = 616) admitted to two rehabilitation centers in the United States. In addition, samples from 472 migrating peregrine falcons (Falco peregrinus) trapped on autumnal and vernal migrations for banding purposes were also tested. Only bald eagles were notably seropositive (22/406). One each of peregrine falcon, great horned owl (Bubo virginianus), and Cooper's hawk (Accipiter cooperi) from a total of 472, 81, and 100, respectively, were also positive. None of the turkey vultures (n = 21) or black vultures (n = 8) was positive. No clinical signs referable to avian influenza were seen in any bird at the time of capture. These data indicate that, among raptors, bald eagles do have exposure to influenza A viruses.

Items of interest from recent ornithological literature

African Journals Online (AJOL)

Molecular Phylogenetics and Evolution 37: 327-346. ii) Helbig, A.J., Kocum, A., Seibold, I. & Braun, M.J. 2005. A multi-gene phylogeny of aquiline eagles ... Genera: Gypohierax, Neophron and Gypaetus (Palm-nut and. Egyptian Vultures and Lammergeier) iv. Perninae: Kites that specialise on insects, bees or wasp larvae.

Validation of the EU Environmental Risk Assessment for Veterinary Medicines

NARCIS (Netherlands)

Montforts, M.H.M.M.

2005-01-01

An alarming decline of vulture populations (up to 95%) in Pakistan in the late 1990’s has recently been attributed to the use of the anti-inflammatory drug diclofenac in cattle. Several species are now threatened with extinction, a tragedy that demonstrates that an environmental risk assessment of

Download this PDF file

African Journals Online (AJOL)

Wildlife and Environmental Society of Malawi, Blantyre. Lipiya, A. 2011. Status of Birds of Prey, with Special Emphasis on Vultures, in Kasungu. National Park. Unpublished report. Department of National Parks and Wildlife,. Lilongwe. 5pp. MacDonald, L. 2011. Recent Sightings. Vocifer. A Bulletin of Ornithological News in.

Browse Title Index

African Journals Online (AJOL)

Items 1 - 50 of 154 ... Vol 68, No 1 (2015), A preliminary assessment of the palate and tongue for detecting organophosphorus and carbamate pesticide exposure in the degraded carcasses of vultures and other animals, Abstract PDF PDF. Ngaio L Richards, Irene Zorilla, Isabel Fernandez, Monica Calvino, Joaquin Garcia, ...

The 20TH Annual Intelligent Ground Vehicle Competition: Building a Generation of Robotists

Science.gov (United States)

2012-11-26

advisors as an excellent multidisciplinary design experience for student teams, and a number of engineering schools give credit in senior design courses...Indian Institute of Technology, Bombay IIT Bombay 1044.00 7 U.S. Naval Academy Robo -Goat 1041.67 8 Lawrence Technological University vuLTUre 2 1033.67

California condors spotted nesting in Big Spur | San Hose Mercury ...

African Journals Online (AJOL)

California condors spotted nesting in Big Spur. Associated Press San Hose Mercury News. Abstract. No Abstract. Vulture News Vol. 55, 2006: 59. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT · AJOL African Journals Online. HOW TO USE AJOL.

Impact of Kite String Injuries and Temporal Variation in Type of ...

African Journals Online (AJOL)

campbell

patterns. Results and Discussion. Injuries caused by Kite Strings. (KSI), dehydration and visceral gout have been the major causes of rescues/mortalities in Ahmadabad and the White-rumped Vulture. (WRV) colonies in the surrounding areas (Muralidharan et al. 2010;. Roy 2011). A total of 108 live/dead WRVs have been.

Author Details

African Journals Online (AJOL)

Thomson, Ian. Vol 70 (2016) - Articles King Vulture (Sarcoramphus papa) scavenging at green turtle (Chelonia mydas) carcasses in Tortuguero National Park, Costa Rica Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about ...

Author Details

African Journals Online (AJOL)

Cutler, Kat. Vol 70 (2016) - Articles King Vulture (Sarcoramphus papa) scavenging at green turtle (Chelonia mydas) carcasses in Tortuguero National Park, Costa Rica Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL ...

Gli uccelli del Parco Nazionale della Val Grande e delle aree limitrofe (Verbano Cusio Ossola, Piemonte, Italia

Directory of Open Access Journals (Sweden)

Fabio Casale

2014-12-01

conservazionistico legate ad habitat montani, quali Bonasa bonasia (20-50 coppie, Tetrao tetrix (40-100 maschi adulti, Alectoris graeca saxatilis (20-50 coppie, Circaetus gallicus (4-5 coppie, Aquila chrysaetos (6-7 coppie, Falco peregrinus (4-5 coppie, Bubo bubo (4 coppie, Aegolius funereus, Dryocopus martius (30 coppie, Monticola saxatilis (5-10 coppie, Tichodroma muraria (5-10 coppie, Pyrrhocorax graculus (50-70 coppie, Prunella collaris (10-20 coppie, Emberiza cia (200-300 coppie, per la migrazione primaverile dei rapaci diurni (15 specie rilevate, delle quali 10 di interesse comunitario, soprattutto Pernis apivorus (21,3% degli individui censiti, Falco tinnunculus (16,7% e Buteo buteo (14,5% e per la migrazione autunnale dei Passeriformi (30 specie rilevate, soprattutto fringillidi (46,9% degli individui censiti, irundinidi (32,8% e motacillidi (15,6%. Gypaetus barbatus e Gyps fulvus vi vengono occasionalmente rilevati.

自然発症高血圧ラットにおける釣藤散の抗高血圧作用 : 釣藤鈎及び石膏の役割について

OpenAIRE

趙, ??; 渡辺, 裕司; 村上, 孝寿; 東田, 道久; 松本, 欣三; Zhao, QI; Hiroshi, WATANABE; Yukihisa, MURAKAMI; Michihisa, TOHDA; Kinzo, MATSUMOTO; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門; 富山医科薬科大学 和漢薬研究所 生物試験部門

2002-01-01

To clarify a role of Chotoko (Uncaria sp.) and gypsum in the anti-hypertensive effect of a Kampo prescription Choto-san (Diao-Teng-San), we investigated effects of Choto-san except Chotoko or gypsum, Chotoko alone and gyp-sum alone on the blood pressure and the heart rate in spontaneously hypertensive rats (SHR). Choto-san (0.5, 1.0 and 2.0 g/kg, p.o.) produced a dose-dependent hypotensive effect, but did not affect the heart rate in SHR. It affected neither blood pressure nor heart rate in n...

Updated vegetation information in high resolution WRF simulations

DEFF Research Database (Denmark)

Nielsen, Joakim Refslund; Dellwik, Ebba; Hahmann, Andrea N.

2013-01-01

modify the energy distribution at the land surface. In weather and climate models it is important to represent the vegetation variability accurately to obtain reliable results. The weather research and forecasting (WRF) model uses green vegetation fraction (GVF) time series to represent vegetation...... seasonality. The GVF of each grid cell is additionally used to scale other parameters such as LAI, roughness, emissivity and albedo within predefined intervals. However, the default GYP used by WRF does not reflect recent climatic changes or change in management practices since it was derived more than 20...

Author Details

African Journals Online (AJOL)

Reid, Tim. Vol 64 (2013) - Articles New project examining Bearded Vulture movements in southern Africa to inform wind turbine placement. Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms ...

Raptor population decline in West Africa | Thiollay | Ostrich: Journal ...

African Journals Online (AJOL)

The roadside counts conducted in 1969–1973 through Burkina Faso, Mali, Niger and northern Cameroon (9 712km) were repeated in 2000–2004 by the same observer, using the same methods, during the same season. Overall, 28 837 Falconiforms from 51 species were recorded. The four large vultures decreased ...

Forest culicinae mosquitoes in the environs of samuel hydroeletric plant, state of Rondônia, Brazil

Directory of Open Access Journals (Sweden)

SLB Luz

1996-08-01

Full Text Available Data on frequency and seasonal distribution of culicinae were recorded in the forest near a recently constructed hydroelectric plant - Samuel, in the State of Rondônia, Brazilian Amazon. Collections were performed almost daily from August 1990 to July 1991, between 6 and 9 p.m., using human bait. A total of 3,769 mosquitoes was collected, representing 21 species, including seven new records for the State of Rondônia. The most frequently collected species were Aedes fulvus (25% and Ae. pennai (12.3%. The highest density for the majority of mosquito species coincided with the rainy season.

VULTURE SNIPPETS FROM AROUND THE WORLD

African Journals Online (AJOL)

2007-09-02

Sep 2, 2007 ... roof of this structure the bottom of their nest. As the palm sheds its .... It is fairly flat area, 900-1100 m ... Drinie van Rensburg; e-mail address: driniev@wrc.org.za. Buzzards foil .... be about three feet tall, weigh up to 30 pounds ...

VULTURE SNIPPETS FROM AROUND THE WORLD

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... We spent a week in the Kruger National ... minutes, they started taking off without ... Kundian near Mianwali in three months, ... Some more links to articles about lead poisoning and California .... which also kill the condors.

VULTURE SNIPPETS FROM AROUND THE WORLD

African Journals Online (AJOL)

2007-03-01

Mar 1, 2007 ... bird-watchers, we made a list of all the bird species seen .... on the vehicle contains a very good image of a Cape Griffon, ..... gets into an engine, it will destroy it, the motor will stop ... benches and a shelf for binoculars, books.

Author Details

African Journals Online (AJOL)

Campbell, Michael O'Neal. Vol 66 (2014) - Articles The impact of urbanization and agricultural development on vultures in El Salvador Abstract PDF. ISSN: 1606-7479. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and ...

Zone-tailed Hawk (Buteo albonotatus)

Science.gov (United States)

Scott H. Stoleson; Giancarlo Sadoti

2010-01-01

The Zone-tailed Hawk (Buteo albonotatus) might well be dubbed "the Great Pretender" because it so closely resembles the ubiquitous Turkey Vulture (Cathartes aura) in appearance and behavior as to be frequently mistaken for it. In the border regions where it lives, it may be confused as well with another "Mexican" raptor, the Common Black-Hawk (...

Rare birds of prey observations in Kresna Gorge in Bulgaria

African Journals Online (AJOL)

Campbell Murn

the feeding site and roost in the area in 2013. Passage of birds from Serbia,. Croatia, FYR of Macedonia and. Greece were recorded, as well as a bird tagged in Israel, but most were probably of Balkan origin. There are two peaks of increased presence of exogenous Griffon Vultures in. Kresna Gorge and these are in May-.

Malaria Epidemics in Dembia, Northwest Ethiopia 1952 – 1953

African Journals Online (AJOL)

unhcc

result, dead bodies were reportedly devoured by dogs and wild animals. That was particularly the case when domestic servants died. They were left in the open field to be eaten by vultures, dogs, and hyenas. Some of the lucky ones were .... had fever and enormous swelling of the spleen and nearly all of them had serious ...

Download this PDF file

African Journals Online (AJOL)

2006-03-02

Mar 2, 2006 ... perch sites utilized by the adult Turkey. Vultures before landing on the entrance ledge at the BMW Nest could not be seen by the nestlings. Therefore, at the BMW nest the only contact between the adult on perch sites and young in the pit was auditory. On day 25 post hatch the nestlings appeared to respond.

SHORT COMMUNICATIONS, NOTES AND REPORTS

African Journals Online (AJOL)

Campbell Murn

1976). Among raptors there are those species where only the female incubates, those where the male may also incubate for short to longer periods, and those in which females and males equally share the incubation (Newton 1979). It is well known that both sexes incubate the clutch in vultures, both in the wild (Mundy et al.

Book Review – Wildlife Forensic Investigation

African Journals Online (AJOL)

Campbell Murn

Wildlife crime is an increasingly serious issue for populations of both threatened and common species in many parts of the world. In particular, the use of poisons and other toxic chemicals are one of the greatest threats to vultures in many parts of the world, especially in. Africa. Often, one of the key difficulties in prosecuting ...

Organ procurement: let's presume consent

OpenAIRE

Moustarah, F

1998-01-01

IN WINNING FIRST PRIZE in the Logie Medical Ethics Essay Contest in 1997, Dr. Fady Moustarah made a strong and compelling argument in favour of presumed consent in the procurement of donor organs. He stressed that a major education campaign will be needed when such a policy is adopted lest some people begin to regard physicians as "organ vultures."

Environmental Assessment of Demolition Activities at Dover Air Force Base, Delaware

Science.gov (United States)

2003-11-01

Setophaga ruticilla), broad- winged hawk (Buteo platypterus), cliff swallow (Petrochelidon pyrrhonota), bank swallow ( Riparia riparia ), black vulture...Explosive safety-quantity distance (QD) zones are designated areas designed to safeguard the base population and civilian community from potential...explosions. These clear zones include the area within a safety arc surrounding an explosive storage facility. The QD zones at Dover AFB encompass

ARTICLES

African Journals Online (AJOL)

2007-09-02

Sep 2, 2007 ... Summary. I collected data over six field seasons (34 ½ wks) between 1994-2000 at Hato Las. Nieves in northwestern Bolívar state, Venezuela. A mean of 6.4 King Vultures. (Sarcoramphus papa) ± 4.9 SD (range = 2-15) searched in flight for jaguar (Panthera onca) or remains of kills and were present at or ...

Prevalence of encysted apicomplexans in muscles of raptors.

Science.gov (United States)

Lindsay, D S; Blagburn, B L

1999-01-28

An acid-pepsin digestion technique was used to examine portions of breast muscle and heart from raptors for encysted protozoans. Apicomplexan zoites were present in 52 (45.6%) of the 114 samples examined: 11 of 12 (91.7%) red-shouldered hawks (Buteo lineatus), 20 of 34 (58.8%) red-tailed hawks (Buteo jamaicensis), two of seven (28.6%) Cooper's hawks (Accipiter cooperi), three of four (75%) sharp-shinned hawks (Accipiter striatus), one (100%) Mississippi kites (Ictinia misisippiensis), one of two (50%) American kestrels (Falco sparverius), one bald eagle (Haliaeetus leucocephalus), one of two (50%) golden eagles (Aquila chrysaetos), one of three (33%) turkey vultures (Cathartes aura), two of three (66.7%) black vultures (Coragyps atratus), three of six (50%) great-horned owls (Bubo virginianus), five of 15 (33.3%) barred owls (Strix varia), and one of 12 (8.3%) screech owls (Asio otus). Encysted protozoans were not observed in digests of tissues from three broad-winged hawks (Buteo platypterus), four ospreys (Pandion haliaetus), and five barn owls (Tyto alba). Apicomplexan cysts resembling Sarcocystis species were observed in tissue sections of muscles from 28 (37.8%) of 74 raptors.

Comparison of nest-site selection patterns of different sympatric raptor species as a tool for their conservation

Directory of Open Access Journals (Sweden)

Poirazidis, K.

2007-12-01

Full Text Available In this study the nest-site selection patterns of four tree-nesting sympatric raptor species in Dadia National Park (Greece were compared in order to provide a sound conservation tool for their long-term management in the area. The species studied were the Black vulture (Aegypius monachus, the Lesser-spotted eagle (Aquila pomarina, the Booted eagle (Hieraaetus pennatus and the Goshawk (Accipiter gentilis. Twenty-six variables illustrating the landscape context and vegetation structure of nesting sites were analysed. Multivariate-ANOVA and Discriminant Function Analysis were used to test for significant differentiations in nest-site characteristics among the species. The species studied were initially differentiated by geomorphology and distance to foraging areas. Once these were determined their nesting areas were established according to forest structure. Our results indicate that forest management should integrate the preservation of mature forest stands with sparse canopy and forest heterogeneity in order to conserve suitable nesting habitats for the raptors. Specific conservation measures such as restriction of road construction should be implemented in order to protect the active nests and provisions should be made for adequate nesting sites for the Black vulture, which is sensitive to human disturbance.

Improving conservation outcomes with insights from local experts and bureaucracies.

Science.gov (United States)

Haenn, Nora; Schmook, Birgit; Reyes, Yol; Calmé, Sophie

2014-08-01

We describe conservation built on local expertise such that it constitutes a hybrid form of traditional and bureaucratic knowledge. Researchers regularly ask how local knowledge might be applied to programs linked to protected areas. By examining the production of conservation knowledge in southern Mexico, we assert local expertise is already central to conservation. However, bureaucratic norms and social identity differences between lay experts and conservation practitioners prevent the public valuing of traditional knowledge. We make this point by contrasting 2 examples. The first is a master's thesis survey of local experts regarding the biology of the King Vulture (Sarcoramphus papa) in which data collection took place in communities adjacent to the Calakmul Biosphere Reserve. The second is a workshop sponsored by the same reserve that instructed farmers on how to monitor endangered species, including the King Vulture. In both examples, conservation knowledge would not have existed without traditional knowledge. In both examples, this traditional knowledge is absent from scientific reporting. On the basis of these findings, we suggest conservation outcomes may be improved by recognizing the knowledge contributions local experts already make to conservation programming. © 2014 Society for Conservation Biology.

Screening of new British thraustochytrids isolates for docosahexaenoic acid (DHA) production.

Science.gov (United States)

Marchan, Loris Fossier; Lee Chang, Kim J; Nichols, Peter D; Polglase, Jane L; Mitchell, Wilfrid J; Gutierrez, Tony

2017-01-01

Thraustochytrids isolated from hot tropical and sub-tropical waters have been well studied for DHA and biodiesel production in the last decades. However, little research has been performed on the oils of cold water thraustochytrids, in particular from the North Sea region. In this study, thraustochytrid strains from British waters showed high relative levels of omega-3 long-chain (≥C 20 ) polyunsaturated fatty acids (LC-PUFA), including docosahexaenoic acid (DHA, 22:6ω3). The relative levels of DHA (as % of total fatty acids, TFA) in the different British strains are hitherto amongst the highest recorded from any thraustochytrid screening study, with strain TL18 reaching up to 67% DHA in modified Glucose-Yeast Extract-Peptone (GYP) medium. At this screening stage, low final biomass and fatty acid yield were observed in modified GYP and MarChiquita-Brain Heart Broth (MCBHB), while PUFA profiles (as % of PUFA) remained unaltered regardless of the culture medium used. Hence, optimizing the medium and culture conditions to improve growth and lipid content, without impacting the relative percentage of DHA, has the potential to increase the final DHA concentration. With this in mind, three strains were identified as promising organisms for the production of DHA. In the context of possible future industrial exploitation involving a winterization step, we investigated the recycling of the residual oil for biodiesel use. To do this, a mathematical model was used to assess the intrinsic properties of the by-product oil. The results showed the feasibility of producing primary DHA-rich oil, assuming optimized conditions, while using the by-product oil for biodiesel use.

Assessing allowable take of migratory birds

Science.gov (United States)

Runge, M.C.; Sauer, J.R.; Avery, M.L.; Blackwell, B.F.; Koneff, M.D.

2009-01-01

Legal removal of migratory birds from the wild occurs for several reasons, including subsistence, sport harvest, damage control, and the pet trade. We argue that harvest theory provides the basis for assessing the impact of authorized take, advance a simplified rendering of harvest theory known as potential biological removal as a useful starting point for assessing take, and demonstrate this approach with a case study of depredation control of black vultures (Coragyps atratus) in Virginia, USA. Based on data from the North American Breeding Bird Survey and other sources, we estimated that the black vulture population in Virginia was 91,190 (95% credible interval = 44,520?212,100) in 2006. Using a simple population model and available estimates of life-history parameters, we estimated the intrinsic rate of growth (rmax) to be in the range 7?14%, with 10.6% a plausible point estimate. For a take program to seek an equilibrium population size on the conservative side of the yield curve, the rate of take needs to be less than that which achieves a maximum sustained yield (0.5 x rmax). Based on the point estimate for rmax and using the lower 60% credible interval for population size to account for uncertainty, these conditions would be met if the take of black vultures in Virginia in 2006 was < 3,533 birds. Based on regular monitoring data, allowable harvest should be adjusted annually to reflect changes in population size. To initiate discussion about how this assessment framework could be related to the laws and regulations that govern authorization of such take, we suggest that the Migratory Bird Treaty Act requires only that take of native migratory birds be sustainable in the long-term, that is, sustained harvest rate should be < rmax. Further, the ratio of desired harvest rate to 0.5 x rmax may be a useful metric for ascertaining the applicability of specific requirements of the National Environmental Protection Act.

Mohos y levaduras en agua envasada y bebidas sin alcohol Moulds and yeasts in bottled water and soft drinks

Directory of Open Access Journals (Sweden)

E. G. Ancasi

2006-04-01

Full Text Available La aparición esporádica de alteraciones en algunos envases dentro de lotes de aguas carbonatadas y de bebidas con zumos frutales (carbonatadas y no carbonatadas motivó la presente investigación, en la que se determinaron los microorganismos causantes del deterioro observado. También se estudiaron los contaminantes del azúcar utilizado en la elaboración de una de las bebidas analizadas. Se emplearon los métodos de Déak y Beuchat y de Pitt y Hocking para la identificación de levaduras y de mohos, respectivamente. Las levaduras causantes del deterioro de las bebidas fueron Debaryomyces hansenii, Debaryomyces polymorphus, Galactomyces geotrichum, Metschnikowia pulcherrima, Mucor circinelloides, Pichia anomala, Pichia jadinii, Pichia subpelliculosa, Rhodotorula glutinis y Zygosaccharomyces bailii. Los mohos y las levaduras encontrados en el azúcar fueron Aspergillus niger, Aspergillus penicilloides, Aspergillus versicolor, Cladosporium sphaerospermum, Mucor racemosus, Pichia anomala y Rhizopus stolonifer. En el agua carbonatada se encontraron los mohos Paecilomyces fulvus y Penicillium glabrum.Some damaged cartons of soft drinks and carbonated water were analyzed to detect the microorganisms that caused the damage. The contaminants of sugar used in the production of one of the drinks were also studied. The methods of Déak & Beuchat and Pitt & Hocking were used for the identification of yeasts and moulds, respectively. The agents of the spoilage of soft drinks were Debaryomyces hansenii, Debaryomyces polymorphus, Galactomyces geotrichum, Metschnikowia pulcherrima, Mucor circinelloides, Pichia anomala, Pichia jadinii, Pichia subpelliculosa, Rhodotorula glutinis and Zygosaccharomyces bailii. The microorganisms found in sugar were Aspergillus niger, Aspergillus penicilloides, Aspergillus versicolor, Cladosporium sphaerospermum, Mucor racemosus, P. anomala and Rhizopus stolonifer. Paecilomyces fulvus and Penicillium glabrum were observed in

Fauna de Culicidae em municípios da zona rural do estado do Amazonas, com incidência de febre amarela

Directory of Open Access Journals (Sweden)

Fé Nelson Ferreira

2003-01-01

Full Text Available Em 1996, foi realizado um levantamento da fauna de Culicidae (coleta de adultos e imaturos em cinco dos dez municípios onde foram registrados 14 casos de febre amarela silvestre (Rio Preto da Eva, Iranduba, Manacapuru, Manaquiri e Careiro. Os mosquitos foram coletados utilizando-se armadilhas de luz CDC, inspeções domiciliares e captura com tubos coletores para isca humana. Foram identificadas entre adultos e imaturos 36 espécies de Culicidae, entre estas, nove foram encontradas apenas na fase imatura. Dentre os adultos, coletou-se espécies de Haemagogus janthinomys, Ha. leucocelaenus e Aedes fulvus, incluídas entre os vetores de febre amarela silvestre.

Polyphyly of the hawk genera Leucopternis and Buteogallus (Aves, Accipitridae): multiple habitat shifts during the Neotropical buteonine diversification

OpenAIRE

do Amaral, Fabio S Raposo; Miller, Matthew J; Silveira, Luís Fábio; Bermingham, Eldredge; Wajntal, Anita

2006-01-01

Abstract Background The family Accipitridae (hawks, eagles and Old World vultures) represents a large radiation of predatory birds with an almost global distribution, although most species of this family occur in the Neotropics. Despite great morphological and ecological diversity, the evolutionary relationships in the family have been poorly explored at all taxonomic levels. Using sequences from four mitochondrial genes (12S, ATP8, ATP6, and ND6), we reconstructed the phylogeny of the Neotro...

Distribution of Studied Insectivorous Bat Species of Myanmar

International Nuclear Information System (INIS)

Nyo Nyo

2005-10-01

Fourty-five species of insectivourous bats; Craseonycteris thonglongyai, Emballonura monticola, Taphozous melenopongon, T. theobaldi, T. longimanus, Megaderma lyra, M. spasma, Rhinolophus affinis, R. rouxii, R. pusillus, R. lepidus, R. macrotis, R. trifoliatus, R. pearsoni, R. malayanus, R. stheno, R. thomasi, R. shameli, R. acuminatus, R. marshalli, Rhinolophus sp., Hipposideros pomona, H. larvatus, H. armiger, H. lylei, H. ater, H. fulvus, Aselliscus stoliczkanus, Tadarida plicata, Myotis siligorensis, M. muricola, M. horsfieldii, M. hasseltii, M. chinensis, Scotophilus heathii, S. kuhlii, Ia io, Pipistrellus javanicus, P. coromandra, P. pulveratus, P. paterculus, P. affinis, P. ceylonicus, Miniopterus pusillus and M. magnater were distributed in 7 Divisions; Yangon, Bago, Ayeyawady, Taninthayi, Magway, Mandalay and Sagaing Division, and 7 States; Mon, Kayin, Shan, Chin, Kayah, Kachin and Rakhine States of Myanmar.

Assessing the impact of removal scenarios on population viability of a threatened, long-lived avian scavenger

OpenAIRE

Margalida, Antoni; Colomer, M? ?ngels; Oro, Daniel; Arlettaz, Rapha?l; Don?zar, Jos? A.

2015-01-01

The removal of eggs or chicks from wild populations to create captive populations, reinforce free-ranging populations or reintroduce species into the wild is a restoration tool that requires an assessment of potential detrimental effects upon the donor population. This is an absolute prerequisite when wild donor populations are scarce and small. Here, we forecast the population trend of the largest European population of the bearded vulture (Gypaetus barbatus) over the next 30 years under dif...

U. S. Pacific Fleet. Central Pacific Force. Operation Plan Number Cen 1-43

Science.gov (United States)

1943-10-25

Wareagle Snowflake Stork Beagle v Jocko Bagdad Frolic Locust Tycoon Vulture Dodger Husky Trojan Harpoon Designation or Commander A-II-2 COMM. A...Tiptop Killnrney Saskatoon Dodger Boar lake Titvdllow Beagle Huniboldt Moonglow Raiiisgate COIJ2!. A-II GOMI. A-II OPERATIONfPI^M No. Cen 1-43 ANNEX A...Daytona Decatur Delaware Denmark Del Rio Democrat DeSoto Dingbct Dodger Dogwood Dolores Ship or Unit TG 54.1 CTG 54.6 CTF 51 LST 78 Hq

Seasonal and circadian biases in bird tracking with solar GPS-tags

OpenAIRE

Silva, Rafa; Afán, Isabel; Gil, Juan A.; Bustamante, Javier

2017-01-01

Global Positioning System (GPS) tags are nowadays widely used in wildlife tracking. This geolocation technique can suffer from fix loss biases due to poor satellite GPS geometry, that result in tracking data gaps leading to wrong research conclusions. In addition, new solar-powered GPS tags deployed on birds can suffer from a new "battery drain bias" currently ignored in movement ecology analyses. We use a GPS tracking dataset of bearded vultures (Gypaetus barbatus), tracked for several years...

Wind farms threaten southern Africa's cliff-nesting vultures ...

African Journals Online (AJOL)

active selection for ridge tops and upper slopes), and that both species generally fly at heights within the rotor-sweep of a typical, modern wind turbine. We constructed a population viability model using actual population data from the area presently ...

New project examining Bearded Vulture movements in southern ...

African Journals Online (AJOL)

campbell

southern Africa to inform wind turbine placement. Tim Reid. 1. , Sonja Krüger. 1,2 and Arjun Amar. 1. 1. Percy FitzPatrick Institute of African Ornithology, DST/NRF Centre of. Excellence, Dept. of Biological Sciences, University of Cape Town,. Rondebosch 7701, South Africa. 2. Ezemvelo KwaZulu-Natal Wildlife, P.O. Box ...

Unearthing poison use and consequent anecdotal vulture mortalities ...

African Journals Online (AJOL)

Aldicarb or carbofuran were the most commonly used poisons, but strychnine is still used by about one farmer out of 10. Poison is typically used by means of distributing poisoned baits in the landscape. Furthermore, willingness to use poison in the future was highest for farmers who own large properties with high livestock ...

Prevalence of encysted Toxoplasma gondii in raptors from Alabama.

Science.gov (United States)

Lindsay, D S; Smith, P C; Hoerr, F J; Blagburn, B L

1993-12-01

Little is known about the prevalence of encysted Toxoplasma gondii in wild birds. We examined the hearts and breast muscles from 101 raptors for encysted T. gondii. All of the raptors had been submitted for necropsy to the State Veterinary Diagnostic Laboratory, Auburn, Alabama. Tissues were digested in acid-pepsin solution and inoculated into groups of 3-5 laboratory mice. Toxoplasma gondii was isolated from 27 of 101 (26.7%) raptors: 8 of 12 (66.7%) red-shouldered hawks (Buteo lineatus), 13 of 27 (41.1%) red-tailed hawks (Buteo jamaicensis), 1 of 4 (25%) Cooper's hawks (Accipiter cooperi), 1 of 5 (20%) great horned owls (Bubo virginianus), 4 of 15 (26.7%) barred owls (Strix varia), and 1 of 3 (33.3%) kestrels (Falco sparverius). Toxoplasma gondii was not isolated from 3 broad-winged hawks (Buteo platypterus), 3 sharp-shinned hawks (Accipiter striatus), 6 barn owls (Tyto alba), 9 screech owls (Asio otus), a Mississippi kite (Ictinia misisippiensis), 2 golden eagles (Aquila chrysaetos), a bald eagle (Haliaeetus leucocephalus), 4 ospreys (Pandion haliaetus), 4 turkey vultures (Cathartes aura), or 2 black vultures (Coragyps atratus). No significant difference (P > 0.05) in prevalence was detected based on sex using chi-square analysis. Chi-square analysis of the data demonstrated that adult raptors had encysted stages of T. gondii significantly (P < 0.05) more often than did immature raptors.

Seroepidemiologic Survey of Potential Pathogens in Obligate and Facultative Scavenging Avian Species in California

Science.gov (United States)

Straub, Mary H.; Kelly, Terra R.; Rideout, Bruce A.; Eng, Curtis; Wynne, Janna; Braun, Josephine; Johnson, Christine K.

2015-01-01

Throughout the world, populations of scavenger birds are declining rapidly with some populations already on the brink of extinction. Much of the current research into the factors contributing to these declines has focused on exposure to drug residues, lead, and other toxins. Despite increased monitoring of these declining populations, little is known about infectious diseases affecting scavenger bird species. To assess potential infectious disease risks to both obligate and facultative scavenger bird species, we performed a serosurvey for eleven potential pathogens in three species of scavenging birds in California: the California condor (Gymnogyps californianus), turkey vulture (Cathartes aura) and golden eagle (Aquila chrysaetos). California condors were seropositive for avian adenovirus, infectious bronchitis virus, Mycoplasma gallisepticum, avian paramyxovirus-2, West Nile virus (WNV) and Toxoplasma gondii. Golden eagles were seropositive for avian adenovirus, Chlamydophila psittaci and Toxoplasma gondii, and turkey vultures were seropositive for avian adenovirus, Chlamydophila psittaci, avian paramyxovirus-1, Toxoplasma gondii and WNV. Risk factor analyses indicated that rearing site and original release location were significantly associated with a positive serologic titer to WNV among free-flying condors. This study provides preliminary baseline data on infectious disease exposure in these populations for aiding in early disease detection and provides potentially critical information for conservation of the endangered California condor as it continues to expand its range and encounter new infectious disease threats. PMID:26606755

Riqueza específica y especies de interés para la conservación de la avifauna del área protegida Serranía del Aguaragüe (sur de Bolivia)

OpenAIRE

Martínez, Omar; Maillard Z., Oswaldo; Vedia-Kennedy, Javier; Herrera, Mauricio; Mesili, Thibeault; Rojas, Abraham

2011-01-01

Se relevó la avifauna de 11 localidades en el Parque Nacional y Área Natural de Manejo Integrado Serranía del Aguaragüe, provincia Gran Chaco, departamento de Tarija, Bolivia. Fueron registradas en total 272 especies de aves, 5 de ellas amenazadas (Buteogallus coronatus, Ara militaris, Amazona tucumana, Vultur gryphus y Buteogallus solitarius). Se incluye el registro de 11 especies nuevas para el departamento de Tarija y de 14 que eran conocidas por pocos registros. Se registraron 29 especies...

Arboretum and Puerto Almendras viruses: two novel rhabdoviruses isolated from mosquitoes in Peru.

Science.gov (United States)

Vasilakis, Nikos; Castro-Llanos, Fanny; Widen, Steven G; Aguilar, Patricia V; Guzman, Hilda; Guevara, Carolina; Fernandez, Roberto; Auguste, Albert J; Wood, Thomas G; Popov, Vsevolod; Mundal, Kirk; Ghedin, Elodie; Kochel, Tadeusz J; Holmes, Edward C; Walker, Peter J; Tesh, Robert B

2014-04-01

Arboretum virus (ABTV) and Puerto Almendras virus (PTAMV) are two mosquito-associated rhabdoviruses isolated from pools of Psorophora albigenu and Ochlerotattus fulvus mosquitoes, respectively, collected in the Department of Loreto, Peru, in 2009. Initial tests suggested that both viruses were novel rhabdoviruses and this was confirmed by complete genome sequencing. Analysis of their 11 482 nt (ABTV) and 11 876 (PTAMV) genomes indicates that they encode the five canonical rhabdovirus structural proteins (N, P, M, G and L) with an additional gene (U1) encoding a small hydrophobic protein. Evolutionary analysis of the L protein indicates that ABTV and PTAMV are novel and phylogenetically distinct rhabdoviruses that cannot be classified as members of any of the eight currently recognized genera within the family Rhabdoviridae, highlighting the vast diversity of this virus family.

Enumeration of Objects and Substances in Non-Human Primates: Experiments with Brown Lemurs ("Eulemur Fulvus")

Science.gov (United States)

Mahajan, Neha; Barnes, Jennifer L.; Blanco, Marissa; Santos, Laurie R.

2009-01-01

Both human infants and adult non-human primates share the capacity to track small numbers of objects across time and occlusion. The question now facing developmental and comparative psychologists is whether similar mechanisms give rise to this capacity across the two populations. Here, we explore whether non-human primates' object tracking…

SU-F-T-447: The Impact of Treatment Planning Methods On RapidPlan Modeling for Rectum Cancer

Energy Technology Data Exchange (ETDEWEB)

Lu, S; Peng, J; Li, K; Wang, J; Hu, W [Fudan University Shanghai Cancer Center, Shanghai, Shanghai (China)

2016-06-15

Purpose: To investigate the dose volume histogram (DVH) prediction varieties based on intensity modulate radiotherapy (IMRT) plan or volume arc modulate radiotherapy (VMAT) plan models on the RapidPlan. Methods: Two DVH prediction models were generated in this study, including an IMRT model trained from 83 IMRT rectum plans and a VMAT model trained from 60 VMAT rectum plans. In the internal validation, 20 plans from each training database were selected to verify the clinical feasibility of the model. Then, 10 IMRT plans (PIMRT-by-IMRT-model) generated from IMRT model and 10 IMRT plans generated from VMAT model (PIMRT-by-VMAT-model) were compared on the dose to organs at risk (OAR), which included bladder, left and right femoral heads. The similar comparison was also performed on the VMAT plans generated from IMRT model (PVMAT-by-IMRT-model) and VMAT plans generated from VMAT (PVMAT-by-VMAT-model) model. Results: For the internal validation, all plans from IMRT or VMAT model shows significantly improvement on OAR sparing compared with the corresponded clinical ones. Compared to the PIMRT-by-VMAT-model, the PIMRT-by-IMRT-model has a reduction of 6.90±3.87%(p<0.001) on V40 6.63±3.62%(p<0.001) on V45 and 4.74±2.26%(p<0.001) on V50 in bladder; and a mean dose reduction of 2.12±1.75Gy(p=0.004) and 2.84±1.53Gy(p<0.001) in right and left femoral head, respectively. There was no significant difference on OAR sparing between PVMAT-by-IMRT-model and PVMAT-by-VMAT-model. Conclusion: The IMRT model for the rectal cancer in the RapidPlan can be applied to for VMAT planning. However, the VMAT model is not suggested to use in the IMRT planning. Cautions should be taken that the planning model based on some technique may not feasible to other planning techniques.

Lactic acid production by irradiated Bacillus NF17 and poly-L-lactate biopolymer formation

International Nuclear Information System (INIS)

Tongpim, Saowanit; Poonsawat, Choosak; Khansawai, Paveena; Piadaeng, Nattaya

2006-09-01

This study was conducted to manipulate the thermo tolerant, lactic acid-producing bacteria, Bacillus coagulans strain NF 1 7, in the production of L-lactic acid and a bio polymer: poly-L-lactate. The bacterial isolate NF 1 7 kept in the culture collection of Khon Kaen University and could tolerate high temperature and produce lactic acid, was employed in this research work. Cell suspension of isolate NF 1 7 was exposed to gamma irradiation at various doses (1-5 KGy). The irradiated survivors were screened on the basis of forming larger colonies and clear zones than the parent strain NF 1 7 when grown on Glucose-Yeast extract-Peptone (GYP) containing CaCO 3 . We obtained 55 effective isolates which the isolate L5I2-14(5), designated as K 1 4, was chosen together with the parent strain NF 1 7 for fermentation experiments. Each bacterial strain was inoculated into GYP broth and incubated statically at 50 o C with daily pH neutralization. After 5 days of incubation, the isolate K 1 4 and NF 1 7 produced 9.71 g/l and 7.42 g/l of L-lactic acid, respectively with a small amount of D-lactic acid. Lactic acid production from sugar cane molasses by batch fermentation of Bacillus Sp. K 1 4 was carried out in a 7 l jar fermentor containing 5 l of fermentation medium. It was found that 20% molasses with the agitation speed of 100 rpm gave the highest yield of lactic acid. Poly-L-lactic acid was chemically polymerized by bulk polymerization process at 140 o C under 40 mmHg conditions. We could obtain the off-white polymer in a small amount of powder form. Improvement the yield of poly-L-lactic acid would be achieved by using polyisoprene-g-polyvinyl monomer to separate lactic acid from the fermenting liquid prior to polymerization processes

The power of poison: pesticide poisoning of Africa's wildlife.

Science.gov (United States)

Ogada, Darcy L

2014-08-01

Poisons have long been used to kill wildlife throughout the world. An evolution has occurred from the use of plant- and animal-based toxins to synthetic pesticides to kill wildlife, a method that is silent, cheap, easy, and effective. The use of pesticides to poison wildlife began in southern Africa, and predator populations were widely targeted and eliminated. A steep increase has recently been observed in the intensity of wildlife poisonings, with corresponding population declines. However, the majority of poisonings go unreported. Under national laws, it is illegal to hunt wildlife using poisons in 83% of African countries. Pesticide regulations are inadequate, and enforcement of existing legislation is poor. Few countries have forensic field protocols, and most lack storage and testing facilities. Methods used to poison wildlife include baiting carcasses, soaking grains in pesticide solution, mixing pesticides to form salt licks, and tainting waterholes. Carbofuran is the most widely abused pesticide in Africa. Common reasons for poisoning are control of damage-causing animals, harvesting fish and bushmeat, harvesting animals for traditional medicine, poaching for wildlife products, and killing wildlife sentinels (e.g., vultures because their aerial circling alerts authorities to poachers' activities). Populations of scavengers, particularly vultures, have been decimated by poisoning. Recommendations include banning pesticides, improving pesticide regulations and controlling distribution, better enforcement and stiffer penalties for offenders, increasing international support and awareness, and developing regional pesticide centers. © 2014 New York Academy of Sciences.

Arboretum and Puerto Almendras viruses: two novel rhabdoviruses isolated from mosquitoes in Peru

Science.gov (United States)

Castro-Llanos, Fanny; Widen, Steven G.; Aguilar, Patricia V.; Guzman, Hilda; Guevara, Carolina; Fernandez, Roberto; Auguste, Albert J.; Wood, Thomas G.; Popov, Vsevolod; Mundal, Kirk; Ghedin, Elodie; Kochel, Tadeusz J.; Holmes, Edward C.; Walker, Peter J.; Tesh, Robert B.

2014-01-01

Arboretum virus (ABTV) and Puerto Almendras virus (PTAMV) are two mosquito-associated rhabdoviruses isolated from pools of Psorophora albigenu and Ochlerotattus fulvus mosquitoes, respectively, collected in the Department of Loreto, Peru, in 2009. Initial tests suggested that both viruses were novel rhabdoviruses and this was confirmed by complete genome sequencing. Analysis of their 11 482 nt (ABTV) and 11 876 (PTAMV) genomes indicates that they encode the five canonical rhabdovirus structural proteins (N, P, M, G and L) with an additional gene (U1) encoding a small hydrophobic protein. Evolutionary analysis of the L protein indicates that ABTV and PTAMV are novel and phylogenetically distinct rhabdoviruses that cannot be classified as members of any of the eight currently recognized genera within the family Rhabdoviridae, highlighting the vast diversity of this virus family. PMID:24421116

A lightweight portable, walk-in trap for catching vultures

African Journals Online (AJOL)

Two holes are drilled through the tubing and the piece of wood is attached to the tubing using 8.7 cm screws (Figure. 3). The location of the latch on the ... lightweight, walk-in trap, with door (shaded area) open, small black square shows location of gate latch. Figure 3. Close-up of gate latch. (photograph: David R. Barber).

Mighty vulture back from near extinction Austrian project breeds ...

African Journals Online (AJOL)

2007-03-02

Mar 2, 2007 ... Alpine roosts. Today, however, the bone crusher is soaring toward a comeback as the continent's most ambitious – and priciest – wildlife reintroduction project achieves small but biologically significant success. The species was hunted nearly to extinction in the Alps by the start of the 20th century, mainly by ...

Poison blamed for decline of Spain's majestic Black Vultures

African Journals Online (AJOL)

2007-03-01

catastrophic” decline in numbers because of illegal poisoning by hunters. The use of poisoned bait to kill foxes, badgers, wild dogs, feral cats and smaller birds of prey has reduced the population by almost a half in the past decade,.

Dominant culturable bacterial microbiota in the digestive tract of the American black vulture (Coragyps atratus Bechstein 1793 and search for antagonistic substances Microbiota bacteriana dominante cultivável no trato digestivo do urubu (Coragyps atratus Bechstein 1793

Directory of Open Access Journals (Sweden)

Lydston Rodrigues de Carvalho

2003-07-01

Full Text Available Strict and facultative culturable anaerobic bacteria from the digestive tract of six American black vultures (Coragyps atratus Bechstein 1793 were isolated and identified. After capture, the birds received a non-contaminated diet for one week to eliminate possible allochthonous microorganisms. Then, specimens collected from tongue, stomach and intestines were weighed, submitted to decimal dilution in an anaerobic chamber, inoculated into culture media and incubated aerobically and anaerobically at 37ºC for enumeration, isolation and identification. Isolated bacteria were submitted to tests to detect possible antagonisms between them. The total bacterial population along the digestive tract ranged from 3.46 ± 0.39 log CFU/g in the stomach to 10.75 ± 0.37 log CFU/g in the distal intestine. Some bacteria were isolated for the first time from the digestive tract of C. atratus: Actinomyces bovis, Lactobacillus cellobiosus, Micrococcus luteus, Neisseria sicca, Clostridium bifermentans, Enterobacter agglomerans, Peptostreptococcus sp., Sarcina sp., Serratia odorifera, and Shigella flexneri. Associations between microorganisms were observed during isolation on two occasions, one involving A. bovis and N. sicca, and the other involving A. bovis and a Gram-negative rod. Hetero-, iso- and autoantagonisms were observed, suggesting the ecological role of these indigenous microorganisms in terms of population auto-control and environmental barrier in the digestive tract of carrion-feeding birds.As bactérias anaeróbias estritas e facultativas cultiváveis do trato digestivo de seis urubus (Coragyps atratus Bechstein 1793 foram isoladas e identificadas. Após a captura, as aves receberam uma alimentação de baixa contaminação durante uma semana para eliminar possíveis microorganismos alóctonos. A seguir, amostras colhidas na língua, estomago e intestinos foram pesadas, submetidas a diluições decimais numa câmara anaeróbia, inoculadas em meios de

The saga behind a slight change of name – now it is Gyps rueppelli

African Journals Online (AJOL)

Campbell Murn

Hawks and owls of the world: a distributional and taxonomic list. Proceedings Western Foundation Vertebrate Zoology. 3: 295-357. Brehm, A. 1852. Beiträge zur Ornithologie Nord-Ost-Afrika's. Naumannia 2. (3): 38-51. Brehm, A.E. 1882. Historia Natural. Tomo III. Montaner y Simon,. Barcelona. Brown, L. & Amadon, D. 1968.

La précarité : une catégorie d’analyse pertinente des enjeux de la norme d’emploi et des situations sociales « d’entre-deux »

Directory of Open Access Journals (Sweden)

Maryse Bresson

2011-04-01

Full Text Available Le présent article propose de prolonger le débat sur « La précarité » commencé dans la livraison de SociologieS mise en ligne le 27 septembre 2010. Il met en perspective les analyses d’Henri Eckert et Mircea Vultur, et propose une grille d’analyse de la précarité ou plus exactement, ici, des emplois dits « atypiques ». L’auteure invite à distinguer d’une part, les représentations sociales et les ressentis « subjectifs » des individus ; d’autre part, les processus économiques et sociaux associés aux transformations du marché du travail, afin de mieux articuler ensuite ces deux dimensions, en insistant sur l’enjeu de la norme d’emploi, et sur l’idée « d’entre-deux » proposée comme clé de lecture de la précarité.Precariousness: a pertinent analysis of the standard of employment issues and of "in-between" social situationsThis paper proposes to extend the debate on "Precariousness" started in SociologieS online on September 27, 2010. It puts into perspective analyses of Henry Eckert and Mircea Vultur, and offers an analysis of precariousness, or more precisely, here, jobs as "atypical". The author invites to distinguish, on the one hand, social representations and how individualsfeel subjectively the precariousness; on the other hand, economic and social processes associated to changes in the labour market, in order to better articulate these two dimensions, with particular emphasis on the issue of the standard of employment, and on the idea of "in-between" proposed as a key to reading the precariousness.¿Es la precariedad un concepto pertinente en lo que concierne la problemática del empleo y des situaciones sociales ambiguas?Este artículo es la continuación del debate sobe la precariedad publicado en la red en Sociologies el 27 septiembre de 2010. Pone en perspectiva los análisis de Henri Eckert y de Mircea Vultur y presenta un panel de análisis de la precariedad en particular de los

Blood-borne parasites in the Black Vulture Coragyps atratus in ...

African Journals Online (AJOL)

campbell

varying greatly by species (Kloss et al. 2003, Nogami et al. 2000). Because sampling occurred at an .... of 12 with multiple protozoan genera present. Finding only hemoprotozoans of the genus. Plasmodium is thus concordant with previously established patterns. Also in agreement with previous research is the lack of.

Scavenging and predation by Black Vultures Coragyps atratus at a ...

African Journals Online (AJOL)

Entre un 12% y 17% de los cachorros sufrieron ataques por jotes durante ambas temporadas. Los perros vagos compiten en forma ventajosa con jotes por carroña. Se postula que la redirección de una conducta carroñera mutualista a depredadora, en el jote de cabeza negra, estaría influenciada por estrés alimentario, ...

TAFONOMÍA DE RESTOS ÓSEOS PROVENIENTES DE EGAGRÓPILAS DE CORAGYPS ATRATUS (JOTE DE CABEZA NEGRA EN EL NOROESTE DE LA PATAGONIA ARGENTINA/Taphonomy of bones remains from pellets of Coragyps Atratus (black vulture in the northwest of the argentinian Patag

Directory of Open Access Journals (Sweden)

Fernando Ballejo

2012-11-01

Full Text Available Existen diversos estudios actualísticos en tafonomía sobre restos de presas de diferentes especies de aves raptoras. Sin embargo, este tipo de trabajos en aves carroñeras ha sido escasamente considerado hasta el momento en Argentina, a pesar que ellas cumplen un papel fundamental en la alteración y transporte de cadáveres. Coragyps atratus (jote de cabeza negra tiene la particularidad de formar posaderos comunales cercanos a áreas de actividades humanas y de alimentarse de animales de todos los tamaños, por lo que pueden interferir en la formación de sitios arqueológicos. El objetivo de este trabajo es realizar un análisis tafonómico sobre los restos óseos recuperados de egagrópilas de C. atratus en el Noroeste patagónico, con el fin de generar herramientas que permitan identificar a estas aves como posibles agentes acumuladores. Se recolectaron 469 egagrópilas distribuidas en tres posaderos del Noroeste patagónico. Se identificaron los elementos recuperados y se evaluaron los grados de alteraciones por ácidos gástricos. Lepus europaeus y Ovis aries dominaron las muestras. Los elementos más representativos pertenecen al autopodio, principalmente falanges. Todos ellos muestran signos de digestión, que van desde porosidades superficiales, perforaciones y fracturas, con la desaparición de la médula en el caso de varias falanges; denotando diferencias en relación al tamaño de la presa consumida. Abstract There are several actualistic taphonomic studies regarding different species of birds of prey. However, the studies focus on scavenger birds have been scarcely considered in Argentina, despite the fact that they play a fundamental role in the alteration and transportation of carcasses. A peculiar characteristic of Coragyps atratus (black vulture is that it builds communal roosts near places where human activities are developed and it feeds on animals of varying size, which may interfere with the formation of archaeological

Un nuevo Trechus (Coleoptera, Carabidae, Trechini hipogeo de la Sierra de Parapanda (Andalucía, España: taxonomía, sistemática y biología

Directory of Open Access Journals (Sweden)

Ortuño, V. M.

2015-08-01

Full Text Available A new hypogean Trechus (Coleoptera, Carabidae, Trechini from Sierra de Parapanda (Andalucía, España: taxonomy, systematics and biology Sampling of arthropod fauna by pitfall traps in the cavern ‘Sima de San Rafael’ in Íllora (Granada, Spain has revealed a new carabid beetle species, Trechus parapandus n. sp., with remarkable troglobiomorphic characteristics: eyes visible only as scars, depigmentation, and elongation of antennae and legs. In consonance with these characteristics, this new species, Trechus parapandus n. sp. is absent in the upper region of the cave. The species belongs to the Trechus fulvus species group (that has five species in Andalusia according to the characteristics of both male and female genitalia. Study of the fauna in the cave suggests that Collembola might be the prey of this new species since they are the most abundant group and have a coincidental phenology. A key for the 11 Trechus species present in Andalusia is provided.

Identification of Blood Meals from Potential Arbovirus Mosquito Vectors in the Peruvian Amazon Basin.

Science.gov (United States)

Palermo, Pedro M; Aguilar, Patricia V; Sanchez, Juan F; Zorrilla, Víctor; Flores-Mendoza, Carmen; Huayanay, Anibal; Guevara, Carolina; Lescano, Andrés G; Halsey, Eric S

2016-11-02

The transmission dynamics of many arboviruses in the Amazon Basin region have not been fully elucidated, including the vectors and natural reservoir hosts. Identification of blood meal sources in field-caught mosquitoes could yield information for identifying potential arbovirus vertebrate hosts. We identified blood meal sources in 131 mosquitoes collected from areas endemic for arboviruses in the Peruvian Department of Loreto by sequencing polymerase chain reaction amplicons of the cytochrome b gene. Psorophora (Janthinosoma) albigenu, Psorophora (Grabhamia) cingulata, Mansonia humeralis, Anopheles oswaldoi s.l., and Anopheles benarrochi s.l. had mainly anthropophilic feeding preferences; Aedes (Ochlerotatus) serratus, and Aedes (Ochlerotatus) fulvus had feeding preferences for peridomestic animals; and Culex (Melanoconion) spp. fed on a variety of vertebrates, mainly rodents (spiny rats), birds, and amphibians. On the basis of these feeding preferences, many mosquitoes could be considered as potential enzootic and bridge arbovirus vectors in the Amazon Basin of Peru. © The American Society of Tropical Medicine and Hygiene.

Amylase production by endophytic fungi Cylindrocephalum sp. isolated from medicinal plant Alpinia calcarata (Haw. Roscoe

Directory of Open Access Journals (Sweden)

V. H. Sunitha.

2012-09-01

Full Text Available Amylases are among the most important enzymes used in modern biotechnology particularly in the process involving starch hydrolysis. Fungal amylase has large applications in food and pharmaceutical industries. Considering these facts, endophytic fungi isolated from the plant Alpinia calcarata (Haw. Roscoe were screened for amylolytic activity on glucose yeast extract peptone agar (GYP medium. Among thirty isolates of endophytic fungi, isolate number seven identified as Cylindrocephalum sp. (Ac-7 showed highest amylolytic activity and was taken for further study. Influence of various physical and chemical factors such as pH, temperature, carbon and nitrogen sources on amylase production in liquid media were studied. The maximal amylase production was found to be at 30ºC and at pH 7.0 of the growth medium. Among the various carbon and nitrogen sources tested, maltose at 1.5% and Sodium nitrate at 0.3% respectively gave optimum amylase production.

Exploring bird aerodynamics using radio-controlled models

International Nuclear Information System (INIS)

Hoey, Robert G

2010-01-01

A series of radio-controlled glider models was constructed by duplicating the aerodynamic shape of soaring birds (raven, turkey vulture, seagull and pelican). Controlled tests were conducted to determine the level of longitudinal and lateral-directional static stability, and to identify the characteristics that allowed flight without a vertical tail. The use of tail-tilt for controlling small bank-angle changes, as observed in soaring birds, was verified. Subsequent tests, using wing-tip ailerons, inferred that birds use a three-dimensional flow pattern around the wing tip (wing tip vortices) to control adverse yaw and to create a small amount of forward thrust in gliding flight.

Sibling Rivalry in Myxococcus xanthus Is Mediated by Kin Recognition and a Polyploid Prophage.

Science.gov (United States)

Dey, Arup; Vassallo, Christopher N; Conklin, Austin C; Pathak, Darshankumar T; Troselj, Vera; Wall, Daniel

2016-01-19

Myxobacteria form complex social communities that elicit multicellular behaviors. One such behavior is kin recognition, in which cells identify siblings via their polymorphic TraA cell surface receptor, to transiently fuse outer membranes and exchange their contents. In addition, outer membrane exchange (OME) regulates behaviors, such as inhibition of wild-type Myxococcus xanthus (DK1622) from swarming. Here we monitored the fate of motile cells and surprisingly found they were killed by nonmotile siblings. The kill phenotype required OME (i.e., was TraA dependent). The genetic basis of killing was traced to ancestral strains used to construct DK1622. Specifically, the kill phenotype mapped to a large "polyploid prophage," Mx alpha. Sensitive strains contained a 200-kb deletion that removed two of three Mx alpha units. To explain these results, we suggest that Mx alpha expresses a toxin-antitoxin cassette that uses the OME machinery of M. xanthus to transfer a toxin that makes the population "addicted" to Mx alpha. Thus, siblings that lost Mx alpha units (no immunity) are killed by cells that harbor the element. To test this, an Mx alpha-harboring laboratory strain was engineered (by traA allele swap) to recognize a closely related species, Myxococcus fulvus. As a result, M. fulvus, which lacks Mx alpha, was killed. These TraA-mediated antagonisms provide an explanation for how kin recognition specificity might have evolved in myxobacteria. That is, recognition specificity is determined by polymorphisms in traA, which we hypothesize were selected for because OME with non-kin leads to lethal outcomes. The transition from single cell to multicellular life is considered a major evolutionary event. Myxobacteria have successfully made this transition. For example, in response to starvation, individual cells aggregate into multicellular fruiting bodies wherein cells differentiate into spores. To build fruits, cells need to recognize their siblings, and in part, this is

Carrapatos do gênero amblyomma (acari: ixodidae e suas relações com os hospedeiros em área endêmica para febre maculosa no Estado de São Paulo Ticks of genus Amblyomma (Acari: Ixodidae and their relationship with hosts in endemic area for spotted fever in the state of São Paulo

Directory of Open Access Journals (Sweden)

Carlos Alberto Perez

2008-12-01

Full Text Available Foram avaliadas 7 espécies da mastofauna e 36 da avifauna quanto à prevalência e intensidade de infestação por carrapatos na ESALQ/USP, no Município de Piracicaba, SP. Analisaram-se 52 indivíduos da mastofauna e 158 da avifauna, parasitados por 12418 carrapatos. Os exemplares adultos (N= 7343 foram encontrados em parasitismo nas capivaras enquanto que os imaturos foram, na maioria, coletados de pequenos mamíferos e aves. Os principais hospedeiros para as formas imaturas, em ordem decrescente, foram gambás (69,1%, capivaras (24,4% e urubus (3,7%. Entre a avifauna, o urubu apresentou o maior número de carrapatos com 69,9%, seguido por indivíduos das famílias Thamnophilidae e Turdidae. Os carrapatos adultos encontrados em capivaras foram A. cajennense (80,8% e A. dubitatum (19,2%. Ambas as espécies foram também coletadas em gambás, correspondendo a 72,4% e 27,6%, respectivamente. Pela facilidade de captura e atratividade de Amblyomma spp. o gambá pode ser usado como bioindicador de infestação em locais endêmicos para febre maculosa. Considerando os índices de parasitismo e prevalência bem como de abundância de carrapatos, susceptibilidade dos hospedeiros, proliferação e susceptibilidade para infecção por R. rickettsi, capivaras e gambás são potenciais hospedeiros amplificadores desse microrganismo no Campus da ESALQ, enquanto eqüídeos, urubus e gatos atuam como hospedeiros secundários.Seven species of mammals and 36 of birds were investigated to determine the tick prevalence and intensity of infestation. The study was conducted at the Esalq/USP in Piracicaba municipality, State of São Paulo. It was collected 52 mammals and 158 birds parasitized by 12,418 ticks. Adult ticks (N= 7,343 were found on capybaras, while the immature were mainly collected on small mammals and birds. The main hosts for immatures in descending order were opossums (69.1%, capybara (24.4% and black vultures (3.7%. Among the avifauna, the black

Screening and mutagenesis of lactobacillus brevis for biosynthesis of γ-aminobutyric acid

International Nuclear Information System (INIS)

Xia Jiang; Mei Lehe; Huang Jun

2006-01-01

γ-aminobutyric acid (GABA) is a major inhibitory neurotransmitter in the central nervous system. In this study, a GABA-producing strain, hjxj-01, was isolated from the milk samples and identified as Lactobacillus brevis. In this GYP medium containing sodium glutamate, the highest GABA concentration accumulated by Lactobacillus brevis hjxj-01 is 7 g/L. The strain was treated with UV and 60 Co γ-rays. Based on high positive mutation rate, the final mutagenesis conditions were UV light 30 W, irradiation distance 45 cm, irradiation time 50 s, and 60 Co γ-rays irradiation of 500 Gy. The mutant strain, hjxj-08119, was bred by GABA resistance selection. Cultured for 12 generations continually, the GABA-producing capacity of hjxj-08119 maintained stably. The fermentation results indicate that compared with the origin strain hjxj-01, the average yield of GABA by hjij-08119 is 17 g/L, which is 142.9% of the origin strain. (authors)

Using areas of known occupancy to identify sources of variation in detection probability of raptors: taking time lowers replication effort for surveys.

Science.gov (United States)

Murn, Campbell; Holloway, Graham J

2016-10-01

Species occurring at low density can be difficult to detect and if not properly accounted for, imperfect detection will lead to inaccurate estimates of occupancy. Understanding sources of variation in detection probability and how they can be managed is a key part of monitoring. We used sightings data of a low-density and elusive raptor (white-headed vulture Trigonoceps occipitalis ) in areas of known occupancy (breeding territories) in a likelihood-based modelling approach to calculate detection probability and the factors affecting it. Because occupancy was known a priori to be 100%, we fixed the model occupancy parameter to 1.0 and focused on identifying sources of variation in detection probability. Using detection histories from 359 territory visits, we assessed nine covariates in 29 candidate models. The model with the highest support indicated that observer speed during a survey, combined with temporal covariates such as time of year and length of time within a territory, had the highest influence on the detection probability. Averaged detection probability was 0.207 (s.e. 0.033) and based on this the mean number of visits required to determine within 95% confidence that white-headed vultures are absent from a breeding area is 13 (95% CI: 9-20). Topographical and habitat covariates contributed little to the best models and had little effect on detection probability. We highlight that low detection probabilities of some species means that emphasizing habitat covariates could lead to spurious results in occupancy models that do not also incorporate temporal components. While variation in detection probability is complex and influenced by effects at both temporal and spatial scales, temporal covariates can and should be controlled as part of robust survey methods. Our results emphasize the importance of accounting for detection probability in occupancy studies, particularly during presence/absence studies for species such as raptors that are widespread and

Trade in Andean Condor Vulture gryphus feathers and body parts in ...

African Journals Online (AJOL)

body parts in the city of Cusco and the Sacred Valley,. Cusco region, Peru. Robert S. R. ... The sale of Andean Condor feathers and body parts is undertaken openly in the tourist markets of Cusco and the Sacred .... and shops. Prices in local currency – Nuevo Sol and US Dollar equivalent given in parentheses). Feather.

Trade in Andean Condor Vulture gryphus feathers and body parts in ...

African Journals Online (AJOL)

commitments under international conventions and act immediately to stop this illegal trade, which is further threatening a species that is already in a precarious situation. Resumen. La venta de ... level (IUCN 2011) and Endangered in Peru.

Food choice and diet of the bearded vulture Gypaetus barbatus in ...

African Journals Online (AJOL)

1990-04-17

Apr 17, 1990 ... samples, forming at least 67% of the bones collected at ossuaries (Table 8) and .... for breaking, and these were mostly larger animals (e.g. horses and cattle). ..... NEWMAN, K.B. 1969. Some notes on the feeding habits of.

The creation of the SAVE consortium – Saving Asia's Vultures from ...

African Journals Online (AJOL)

This article describes the background to this problem, caused mainly by the veterinary drug diclofenac, and the establishment and structure of the SAVE consortium created to help coordinate the necessary conservation response. The lessons learnt in Asia and the working model of such a consortium are presented, which ...

The normal electrocardiogram of four species of conscious raptors.

Science.gov (United States)

Talavera, J; Guzmán, M J; del Palacio, M J Fernández; Albert, A P; Bayón, A

2008-02-01

The aim of this study was to describe normal ECG patterns and values in four species of conscious raptors (Eurasian kestrel, Griffon vulture, Little owl, and Eurasian Eagle owl). Electrocardiograms were carried out in 75 conscious birds belonging to four species of raptors. Lead II waveforms were analysed to determine amplitudes and durations of waves and intervals. Morphologic patterns of P-QRS-T deflections were analysed in the six limb leads. Rhythm, heart rate, mean electrical axis, presence of Ta wave, ST slurring, and P-on-T phenomenon were also studied. The influence of species, body weight and heart rate in electrocardiographic variables were statistically analysed (P raptors that can be used to establish comparisons for clinical purposes.

Scavengers on the move: behavioural changes in foraging search patterns during the annual cycle.

Directory of Open Access Journals (Sweden)

Pascual López-López

Full Text Available BACKGROUND: Optimal foraging theory predicts that animals will tend to maximize foraging success by optimizing search strategies. However, how organisms detect sparsely distributed food resources remains an open question. When targets are sparse and unpredictably distributed, a Lévy strategy should maximize foraging success. By contrast, when resources are abundant and regularly distributed, simple brownian random movement should be sufficient. Although very different groups of organisms exhibit Lévy motion, the shift from a Lévy to a brownian search strategy has been suggested to depend on internal and external factors such as sex, prey density, or environmental context. However, animal response at the individual level has received little attention. METHODOLOGY/PRINCIPAL FINDINGS: We used GPS satellite-telemetry data of Egyptian vultures Neophron percnopterus to examine movement patterns at the individual level during consecutive years, with particular interest in the variations in foraging search patterns during the different periods of the annual cycle (i.e. breeding vs. non-breeding. Our results show that vultures followed a brownian search strategy in their wintering sojourn in Africa, whereas they exhibited a more complex foraging search pattern at breeding grounds in Europe, including Lévy motion. Interestingly, our results showed that individuals shifted between search strategies within the same period of the annual cycle in successive years. CONCLUSIONS/SIGNIFICANCE: Results could be primarily explained by the different environmental conditions in which foraging activities occur. However, the high degree of behavioural flexibility exhibited during the breeding period in contrast to the non-breeding period is challenging, suggesting that not only environmental conditions explain individuals' behaviour but also individuals' cognitive abilities (e.g., memory effects could play an important role. Our results support the growing

Seasonal and circadian biases in bird tracking with solar GPS-tags.

Directory of Open Access Journals (Sweden)

Rafa Silva

Full Text Available Global Positioning System (GPS tags are nowadays widely used in wildlife tracking. This geolocation technique can suffer from fix loss biases due to poor satellite GPS geometry, that result in tracking data gaps leading to wrong research conclusions. In addition, new solar-powered GPS tags deployed on birds can suffer from a new "battery drain bias" currently ignored in movement ecology analyses. We use a GPS tracking dataset of bearded vultures (Gypaetus barbatus, tracked for several years with solar GPS tags, to evaluate the causes and triggers of fix and data retrieval loss biases. We compare two models of solar GPS tags using different data retrieval systems (Argos vs GSM-GPRS, and programmed with different duty cycles. Neither of the models was able to accomplish the duty cycle programed initially. Fix and data retrieval loss rates were always greater than expected, and showed non-random gaps in GPS locations. Number of fixes per month of tracking was a bad criterion to identify tags with smaller biases. Fix-loss rates were four times higher due to battery drain than due to poor GPS satellite geometry. Both tag models were biased due to the uneven solar energy available for the recharge of the tag throughout the annual cycle, resulting in greater fix-loss rates in winter compared to summer. In addition, we suggest that the bias found along the diurnal cycle is linked to a complex three-factor interaction of bird flight behavior, topography and fix interval. More fixes were lost when vultures were perching compared to flying, in rugged versus flat topography. But long fix-intervals caused greater loss of fixes in dynamic (flying versus static situations (perching. To conclude, we emphasize the importance of evaluating fix-loss bias in current tracking projects, and deploying GPS tags that allow remote duty cycle updates so that the most appropriate fix and data retrieval intervals can be selected.

Ecology of mosquitoes (Diptera: Culicidae in areas of Serra do Mar State Park, State of São Paulo, Brazil. II - Habitat distribution

Directory of Open Access Journals (Sweden)

Anthony Érico Guimarães

2000-01-01

Full Text Available The mosquito (Diptera: Culicidae ecology was studied in areas of Serra do Mar State Park, State of São Paulo, Brazil. Systematized biweekly human bait collections were made three times a day, for periods of 2 or 3 h each, in sylvatic and rural areas for 24 consecutive months (January 1991 to December 1992. A total of 24,943 adult mosquitoes belonging to 57 species were collected during 622 collective periods. Aedes scapularis, Coquillettidia chrysonotum, Cq. venezuelensis, Wyeomyia dyari, Wy. longirostris, Wy. theobaldi and Wy. palmata were more frequently collected at swampy and at flooded areas. Anopheles mediopunctatus, Culex nigripalpus, Ae. serratus, Ae. fulvus, Psorophora ferox, Ps. albipes and the Sabethini in general, were captured almost exclusively in forested areas. An. cruzii, An. oswaldoi and An. fluminensis were captured more frequently in a residence area. However, Cx. quinquefasciatus was the only one truly eusynanthropic. An. cruzii and Ae. scapularis were captured feeding on blood inside and around the residence, indicating that both species, malaria and arbovirus vectors respectively, may be involved in the transmission of these such diseases in rural areas.

Object permanence in lemurs.

Science.gov (United States)

Deppe, Anja M; Wright, Patricia C; Szelistowski, William A

2009-03-01

Object permanence, the ability to mentally represent objects that have disappeared from view, should be advantageous to animals in their interaction with the natural world. The objective of this study was to examine whether lemurs possess object permanence. Thirteen adult subjects representing four species of diurnal lemur (Eulemur fulvus rufus, Eulemur mongoz, Lemur catta and Hapalemur griseus) were presented with seven standard Piagetian visible and invisible object displacement tests, plus one single visible test where the subject had to wait predetermined times before allowed to search, and two invisible tests where each hiding place was made visually unique. In all visible tests lemurs were able to find an object that had been in clear view before being hidden. However, when lemurs were not allowed to search for up to 25-s, performance declined with increasing time-delay. Subjects did not outperform chance on any invisible displacements regardless of whether hiding places were visually uniform or unique, therefore the upper limit of object permanence observed was Stage 5b. Lemur species in this study eat stationary foods and are not subject to stalking predators, thus Stage 5 object permanence is probably sufficient to solve most problems encountered in the wild.

VULtURe snIPPets FRoM ARoUnD tHe WoRLD

African Journals Online (AJOL)

2007-05-03

May 3, 2007 ... species. The government has now modified the mad cow rules, adopting a decree allowing farmers ..... Endangered California Condors Gymnogyps californianus in ... Tree Condor Conservation Act and again putting our state ...

VULtURe snIPPets FRoM ARoUnD tHe WoRLD

African Journals Online (AJOL)

2007-05-03

May 3, 2007 ... protect this incredible bird,” said Nava. AB. 821, the Ridley-Tree Condor Preservation. Act, will remove the number one threat to the survival of the endangered California. Condor, lead ammunition, by having hunters switch to a widely available, non- lead ammunition alternative when they hunt big game ...

In vitro mutagenesis of red ginger (Alpinia purpurata)

International Nuclear Information System (INIS)

Lamseejan, S.; Ubonprasert, B.; Kareeros, P.; Pungkan, V.

1996-01-01

Gamma rays and in vitro culture techniques were used for mutation induction experiment in red ginger. Shoot clusters of red ginger were treated with gamma rays at 0, 30, 50, 70 and 90 Gy. Treated shoots were then isolated and transferred individually to fresh medium. L D 50 was calculated based on a number of surviving plants in each treatment at 30 days after irradiation. L D 50 for in vitro vulture of red ginger was approximately 20 Gy. In an attempt to isolate mutants by sub culturing 3 times at 1 month interval, two mutants were isolated. One mutant has a normal growth with numerous white streaks on green leaves. The other mutant has darkly wrinkled leaves with abnormal plant type. These mutants were both isolated from in vitro culture of red ginger treated with 10 Gy of gamma rays

Effect of 60Co gamma irradiation on cochlea function and structure in guinea pigs

International Nuclear Information System (INIS)

Wang Zhonghe; Cai Yilin; Hu Haisen

1994-01-01

In the experiment inner ears of guinea pigs were irradiated with 60 Co gamma rays using the method of simulated clinical routine irradiation in order to find the effects of ionizing radiation on the cochlea function and structure and to explore the mechanism and protective measure that lead to hearing impairment following radiotherapy to the head and neck of cancer patients. Ten weeks after irradiation it was found that ABR threshold increased with increasing dose of radiation. The mean values of ABR thresholds in 70 Gy and 90 Gy groups were 10 dB and 28 dB respectively. The number of inner and outer hair cell and pillar cell loss was counted under microscope. The number of lost cells increased with increasing dose of radiation. The severity of damage in morphology of inner, outer hair cells and pillar cells reduced progressively. The groups of 70 Gy and 90 Gy lost significantly more than groups of control and 50 Gy(P<0.05). It is concluded that the damage of hair cells of cochlea is the direct result of gamma ray irradiation of the inner ear and is the main cause of hearing impairment following irradiation

Feeding patterns of mosquitoes (Diptera: Culicidae) in six Brazilian environmental preservation areas.

Science.gov (United States)

dos Santos Silva, Júlia; Alencar, Jeronimo; Costa, Janira Martins; Seixas-Lorosa, Elias; Guimarães, Anthony Érico

2012-12-01

Feeding patterns of mosquitoes in six Brazilian environmental preservation areas were analyzed by the precipitin technique. The mosquito populations were captured using Shannon traps during different time periods. Bird, cow, dog, horse, opossum, human, and rodent antisera diagnostic tests were employed and results were analyzed by calculating the Sørensen similarity index and using the null-model test. Of the 647 analyzed specimens, 443 reacted to the utilized antisera, of which 331 reacted to one blood source, with the most frequent being birds (49.4%); and 112 specimens reacted to two blood sources, with the most frequent combination from birds + rodents (14.3%). The feed profiles demonstrated that Anopheles albitarsis, An. evansae, Aedes fulvus, Psorophora albigenu, Ps. albipes, Ps. ferox, and Mansonia titillans fed predominantly on birds. The similarity index showed that in some localities An. cruzii, Chagasia fajardi, Ae. scapularis, Ae. serratus, Haemagogus leucocelaenus, Ps. albigenu, and Ps. ferox presented similar dietary habits. The null-models test indicated that species from SMSP, INP, CGNP, and THP demonstrated an aggregate pattern, while species from SONP and SBNP showed a random pattern. The mosquitoes fed predominantly on birds, but from an epidemiological standpoint, the eclectic feeding habits were found to be constant among the mosquitoes analyzed. © 2012 The Society for Vector Ecology.

What Is It Going to Be? Pattern and Potential Function of Natal Coat Change in Sexually Dichromatic Redfronted Lemurs (Eulemur fulvus rufus)

DEFF Research Database (Denmark)

Barthold, Julia A; Fichtel, Claudia; Kappeler, Peter M

2009-01-01

with adult male coloration and female infants subsequently undergo a change in coloration. Using digital pictures and behavioral data collected on eight mother-offspring dyads from birth until the end of the coloration change, we 1) described timing and pattern of pelage development in redfronted lemur...... infants and 2) examined behavioral developmental correlates of the coloration change. The color change took place between 7 and 17 weeks of age and coincided with advanced physical independence; a pattern also found in monochromatic primate species with natal coats. No behavioral differences between male...

Micro- and macroscopic study on the porosity of marble as a function of temperature and impregnation

Science.gov (United States)

Malaga-Starzec, K.; Akesson, U.; Lindqvist, J. E.; Schouenborg, B.

2003-04-01

The thermal weathering of marble is demonstrated by the progressive granular decohesion that leads to an increased porosity and subsequently to loss of strength. In order to determine how temperature cycling initiates changes in the porosity of fresh and impregnated stones: two chemically and petrographically very different marble types were tested for water absorption and ultrasonic velocity propagation and analysed by fluorescence microscopy and nitrogen adsorption. The influence of the impregnation materials: GypStop P17 and P22, both silica sols with different particle size, on changes of the porosity was also evaluated. A separate long-term study of thermal expansion was additionally performed on fresh unimpregnated samples. The results indicated that inter-granular decohesion was more pronounced for the calictic marble than the dolomitic marble. The impregnation materials had a mitigating effect on the granular decohesion. Use of fluorescence microscopy, among the other methods, appears to give inexpensive and reliable information about internal structure of the marbles. A better understanding of the effect that temperature has on the porosity of marble could be used as a guide for election of suitable stone material for exterior use as well as an indication for appropriate conditioning of the samples before physical properties testing.

Precariedade do trabalho e da vida de catadores de recicláveis em Fortaleza, CE

Directory of Open Access Journals (Sweden)

Regina Heloisa Maciel

2011-01-01

Full Text Available The article discusses life and work conditions of young, middle-aged and elderly street pickers, focusing on experiences of childhood, adolescence and actual job. Eight workers, between 20 and 85 years of age, men and women, were interviewed. The data indicates that: all had a childhood and adolescence marked by lack of resources and emotional support, early insertion in precarious work and low education; the current work maintains the previous experiences of precarious living and working conditions and lack of prospects of inclusion in the formal work market; young workers express feelings of hopelessness and failure; middle-aged and older workers managed to build a safety net through associations of recyclable collectors; all participants reported they have to deal with bigotry revealed in the eyes "of others" for whom a collector is "garbage", "beggar, vulture", a possible "thief". Finally, all believe the work is critical to their and their families’ survival and is a "right" job.

Table scraps: inter-trophic food provisioning by pumas.

Science.gov (United States)

Elbroch, L Mark; Wittmer, Heiko U

2012-10-23

Large carnivores perform keystone ecological functions through direct predation, or indirectly, through food subsidies to scavengers or trophic cascades driven by their influence on the distributions of their prey. Pumas (Puma concolor) are an elusive, cryptic species difficult to study and little is known about their inter-trophic-level interactions in natural communities. Using new GPS technology, we discovered that pumas in Patagonia provided 232 ± 31 kg of edible meat/month/100 km(2) to near-threatened Andean condors (Vultur gryphus) and other members of a diverse scavenger community. This is up to 3.1 times the contributions by wolves (Canis lupus) to communities in Yellowstone National Park, USA, and highlights the keystone role large, solitary felids play in natural systems. These findings are more pertinent than ever, for managers increasingly advocate controlling pumas and other large felids to bolster prey populations and mitigate concerns over human and livestock safety, without a full understanding of the potential ecological consequences of their actions.

Precariedade do trabalho e da vida de catadores de recicláveis em Fortaleza, CE

Directory of Open Access Journals (Sweden)

Regina Heloisa Maciel

2011-10-01

Full Text Available The article discusses life and work conditions of young, middle-aged and elderly street pickers, focusing on experiences of childhood, adolescence and actual job. Eight workers, between 20 and 85 years of age, men and women, were interviewed. The data indicates that: all had a childhood and adolescence marked by lack of resources and emotional support, early insertion in precarious work and low education; the current work maintains the previous experiences of precarious living and working conditions and lack of prospects of inclusion in the formal work market; young workers express feelings of hopelessness and failure; middle-aged and older workers managed to build a safety net through associations of recyclable collectors; all participants reported they have to deal with bigotry revealed in the eyes "of others" for whom a collector is "garbage", "beggar, vulture", a possible "thief". Finally, all believe the work is critical to their and their families' survival and is a "right" job.

Net Effects of Ecotourism on Threatened Species Survival.

Directory of Open Access Journals (Sweden)

Ralf C Buckley

Full Text Available Many threatened species rely on ecotourism for conservation funding, but simultaneously suffer direct ecological impacts from ecotourism. For a range of IUCN-Redlisted terrestrial and marine bird and mammal species worldwide, we use population viability analyses to calculate the net effects of ecotourism on expected time to extinction, in the presence of other anthropogenic threats such as poaching, primary industries and habitat loss. Species for which these calculations are currently possible, for one or more subpopulations, include: orangutan, hoolock gibbon, golden lion tamarin, cheetah, African wild dog, New Zealand sealion, great green macaw, Egyptian vulture, and African penguin. For some but not all of these species, tourism can extend expected survival time, i.e., benefits outweigh impacts. Precise outcomes depend strongly on population parameters and starting sizes, predation, and ecotourism scale and mechanisms. Tourism does not currently overcome other major conservation threats associated with natural resource extractive industries. Similar calculations for other threatened species are currently limited by lack of basic population data.

An immunohistochemical study of the endocrine pancreas in raptors.

Science.gov (United States)

Palmieri, C; Shivaprasad, H L

2014-12-01

The cytoarchitecture of the endocrine pancreas of 10 raptors (golden eagles, peregrine falcons, Saker falcon, turkey vultures, red-tailed hawk and unspecified falcon) was examined by immunohistochemistry. Three islet types were identified: type A mixed islets composed mainly by glucagon (A)-secreting cells, type B mixed islets with predominantly insulin (B)-secreting cell component and type M mixed islets (type M) consisting of variable number of glucagon-, insulin- and somatostatin (D)-secreting cells. The latter were further characterized into Type I, II or III according to the cell distribution of the three cell types. A and D cells were also randomly scattered within the exocrine pancreas. The results of this study suggest that the classical concept in birds of a segregation of A and B cells in well-defined and distinct islets is not applicable in raptors, reflecting an evolutionary adaptation to different dietary habits and variation in developmental mechanisms. Copyright © 2014 Elsevier Ltd. All rights reserved.

Investigation of Aerodynamic Capabilities of Flying Fish in Gliding Flight

Science.gov (United States)

Park, H.; Choi, H.

In the present study, we experimentally investigate the aerodynamic capabilities of flying fish. We consider four different flying fish models, which are darkedged-wing flying fishes stuffed in actual gliding posture. Some morphological parameters of flying fish such as lateral dihedral angle of pectoral fins, incidence angles of pectoral and pelvic fins are considered to examine their effect on the aerodynamic performance. We directly measure the aerodynamic properties (lift, drag, and pitching moment) for different morphological parameters of flying fish models. For the present flying fish models, the maximum lift coefficient and lift-to-drag ratio are similar to those of medium-sized birds such as the vulture, nighthawk and petrel. The pectoral fins are found to enhance the lift-to-drag ratio and the longitudinal static stability of gliding flight. On the other hand, the lift coefficient and lift-to-drag ratio decrease with increasing lateral dihedral angle of pectoral fins.

Net Effects of Ecotourism on Threatened Species Survival.

Science.gov (United States)

Buckley, Ralf C; Morrison, Clare; Castley, J Guy

2016-01-01

Many threatened species rely on ecotourism for conservation funding, but simultaneously suffer direct ecological impacts from ecotourism. For a range of IUCN-Redlisted terrestrial and marine bird and mammal species worldwide, we use population viability analyses to calculate the net effects of ecotourism on expected time to extinction, in the presence of other anthropogenic threats such as poaching, primary industries and habitat loss. Species for which these calculations are currently possible, for one or more subpopulations, include: orangutan, hoolock gibbon, golden lion tamarin, cheetah, African wild dog, New Zealand sealion, great green macaw, Egyptian vulture, and African penguin. For some but not all of these species, tourism can extend expected survival time, i.e., benefits outweigh impacts. Precise outcomes depend strongly on population parameters and starting sizes, predation, and ecotourism scale and mechanisms. Tourism does not currently overcome other major conservation threats associated with natural resource extractive industries. Similar calculations for other threatened species are currently limited by lack of basic population data.

Monogenea of fishes from the lagoon flats of Palmyra Atoll in the Central Pacific

Directory of Open Access Journals (Sweden)

Victor Manuel Vidal-Martinez

2017-11-01

Full Text Available A survey of the monogeneans of fishes from the lagoon flats of Palmyra Atoll detected 16 species already reported from the Indo-West Pacific faunal region. A total of 653 individual fish from 44 species were collected from the sand flats bordering the lagoon of the atoll. Eighteen species of fish were infected with monogeneans. The monogenean species recovered were: Benedenia hawaiiensis on Acanthurus xanthopterus, Chaetodon auriga, Chaetodon lunula, Mulloidichthys flavolineatus, Pseudobalistes flavimarginatus and Rhinecanthus aculeatus; Ancyrocephalus ornatus on Arothron hispidus; Euryhaliotrema annulocirrus on Chaetodon auriga and Chaetodon lunula; Euryhaliotrema chrysotaeniae on Lutjanus fulvus; Euryhaliotrema grandis on Chaetodon auriga and Chaetodon lunula; Haliotrema acanthuri on Acanthurus triostegus; Haliotrema aurigae on Chaetodon auriga and Chaetodon lunula; Haliotrema dempsteri on Acanthurus xanthopterus; Haliotrema minutospirale on Mulloidichthys flavolineatus; Haliotrematoides patellacirrus on Lutjanus monostigma; Neohaliotrema bombini on Abudefduf septemfasciatus and Abudefduf sordidus; Acleotrema girellae and Acleotrema parastromatei on Kyphosus cinerascens; Cemocotylella elongata on Caranx ignobilis, Caranx melampygus and Caranx papuensis; Metamicrocotyla macracantha on Crenimugil crenilabris; and Pseudopterinotrema albulae on Albula glossodonta. All these monogenean–host combinations represent new geographical records. The monogenean species composition of the Palmyra Atoll is similar to that of the Hawaiian Islands. However, the number of species recovered was lower compared with other localities within the Indo-West Pacific, perhaps due to the geographical isolation of Palmyra Atoll.

Phylogeographic analysis of the true lemurs (genus Eulemur) underlines the role of river catchments for the evolution of micro-endemism in Madagascar.

Science.gov (United States)

Markolf, Matthias; Kappeler, Peter M

2013-11-14

Due to its remarkable species diversity and micro-endemism, Madagascar has recently been suggested to serve as a biogeographic model region. However, hypothesis-based tests of various diversification mechanisms that have been proposed for the evolution of the island's micro-endemic lineages are still limited. Here, we test the fit of several diversification hypotheses with new data on the broadly distributed genus Eulemur using coalescent-based phylogeographic analyses. Time-calibrated species tree analyses and population genetic clustering resolved the previously polytomic species relationships among eulemurs. The most recent common ancestor of eulemurs was estimated to have lived about 4.45 million years ago (mya). Divergence date estimates furthermore suggested a very recent diversification among the members of the "brown lemur complex", i.e. former subspecies of E. fulvus, during the Pleistocene (0.33-1.43 mya). Phylogeographic model comparisons of past migration rates showed significant levels of gene flow between lineages of neighboring river catchments as well as between eastern and western populations of the redfronted lemur (E. rufifrons). Together, our results are concordant with the centers of endemism hypothesis (Wilmé et al. 2006, Science 312:1063-1065), highlight the importance of river catchments for the evolution of Madagascar's micro-endemic biota, and they underline the usefulness of testing diversification mechanisms using coalescent-based phylogeographic methods.

Potential Sympatric Vectors and Mammalian Hosts of Venezuelan Equine Encephalitis Virus in Southern Mexico.

Science.gov (United States)

Sotomayor-Bonilla, Jesús; Abella-Medrano, Carlos Antonio; Chaves, Andrea; Álvarez-Mendizábal, Paulina; Rico-Chávez, Óscar; Ibáñez-Bernal, Sergio; Rostal, Melinda K; Ojeda-Flores, Rafael; Barbachano-Guerrero, Arturo; Gutiérrez-Espeleta, Gustavo; Aguirre, A Alonso; Daszak, Peter; Suzán, Gerardo

2017-07-01

Arboviruses are important zoonotic agents with complex transmission cycles and are not well understood because they may involve many vectors and hosts. We studied sympatric wild mammals and hematophagous mosquitoes having the potential to act as hosts and vectors in two areas of southern Mexico. Mosquitoes, bats, and rodents were captured in Calakmul (Campeche) and Montes Azules (Chiapas), between November 2010 and August 2011. Spleen samples from 146 bats and 14 rodents were tested for molecular evidence of Venezuelan equine encephalitis virus (VEEV), eastern equine encephalitis virus (EEEV), western equine encephalitis virus (WEEV), and West Nile virus (WNV) using PCR protocols. Bat ( Artibeus lituratus , Carollia sowelli , Glossophaga soricina , and Sturnira parvidens) and rodent ( Sigmodon hispidus and Oryzomys alfaroi ) species were positive for VEEV. No individuals were positive for WNV, EEEV, or WEEV. A total of 1,298 mosquitoes were collected at the same sites, and five of the mosquito species collected were known VEEV vectors (Aedes fulvus, Mansonia indubitans, Psorophora ferox, Psorophora cilipes, and Psorophora confinnis). This survey simultaneously presents the first molecular evidence, to our knowledge, of VEEV in bats and rodents from southern Mexico and the identification of potential sympatric vectors. Studies investigating sympatric nonhuman hosts, vectors, and arboviruses must be expanded to determine arboviral dynamics in complex systems in which outbreaks of emerging and reemerging zoonoses are continuously occurring.

La précarité au Québec : un concept parmi d’autres pour parler des jeunes

Directory of Open Access Journals (Sweden)

Madeleine Gauthier

2011-04-01

Full Text Available Ce texte met en contexte l’usage du concept de précarité au Québec. Celui-ci a surtout été utilisé parmi beaucoup d’autres pour décrire la situation des jeunes au moment de la crise de l’emploi des décennies 1970 et 1980. Il a parfois contribué, par son attribution à l’ensemble des jeunes, à laisser les plus vulnérables dans l’ombre et à amplifier l’effet du travail atypique sur l’avenir de toute une génération. Un usage plus modéré du concept s’est imposé progressivement en présence de faits plus justement vérifiés. Sa force de persuasion a pu susciter des stratégies tant individuelles que collectives en faveur des jeunes. Ce retour dans le temps a permis de montrer que les jeunes sont sensibles à la conjoncture mais n’en restent pas pour autant les victimes. Est-ce à cause du type d’État (de Gøsta Esping-Anderson, évoqué par Mircea Vultur que le concept n’a eu qu’une importance relative au Québec ? La question se pose-t-elle dans une approche pragmatique du changement ?"Precariousness" in Québec: one of several concepts applied to young peopleThis paper examines the concept of "precariousness" in a Québec context. This concept was one of several used to describe the situation of young people during the employment crisis of the 1970s and 1980s. It was applied to young people as a whole and thus sometimes favoured a tendency to gloss over the highly vulnerable situations and to amplify the effect of non-standard employment on the future of an entire generation. More moderate use of the concept gradually prevailed with more accurate data. It was a persuasive concept that did bring about individual and collective strategies to help young people. This look backward in time shows that young people are sensitive to the economy and its performance. They are nonetheless not permanently victims of economic downturn. Is the type of welfare state (Esping-Anderson as argued by Vultur the reason why

Towards establishing a combined rate law of nucleation and crystal growth - The case study of gypsum precipitation

Science.gov (United States)

Rendel, Pedro M.; Gavrieli, Ittai; Wolff-Boenisch, Domenik; Ganor, Jiwchar

2018-03-01

The main obstacle in the formulation of a quantitative rate-model for mineral precipitation is the absence of a rigorous method for coupling nucleation and growth processes. In order to link both processes, we conducted a series of batch experiments in which gypsum nucleation was followed by crystal growth. Experiments were carried out using various stirring methods in several batch vessels made of different materials. In the experiments, the initial degree of supersaturation of the solution with respect to gypsum (Ωgyp) was set between 1.58 and 1.82. Under these conditions, heterogeneous nucleation is the dominant nucleation mode. Based on changes in SO42- concentration with time, the induction time of gypsum nucleation and the following rate of crystal growth were calculated for each experiment. The induction time (6-104 h) was found to be a function of the vessel material, while the rates of crystal growth, which varied over three orders of magnitude, were strongly affected by the stirring speed and its mode (i.e. rocking, shaking, magnetic stirrer, and magnetic impeller). The SO42- concentration data were then used to formulate a forward model that couples the simple rate laws for nucleation and crystal growth of gypsum into a single kinetic model. Accordingly, the obtained rate law is based on classical nucleation theory and heterogeneous crystal growth.

Decreasing prevalence and seasonal variation of gunshot trauma in raptors admitted to the wildlife center of Virginia: 1993-2002.

Science.gov (United States)

Richards, Jean; Lickey, Adrienne; Sleeman, Jonathan M

2005-09-01

A retrospective study was conducted to identify the epidemiologic factors associated with gunshot injuries in raptors presented to the Wildlife Center of Virginia from 1993 to 2002. Of the 3,156 raptors admitted, 118 raptors (3.7%), representing 15 species, were admitted with gunshot trauma as the primary cause of morbidity and mortality. The majority of cases consisted of four species: red-tailed hawk (Buteo jamaicensis; 47%), red-shouldered hawk (Buteo lineatus; 14%), turkey vulture (Cathartes aura; 10%), and bald eagle (Haliaeetus leucocephalus; 8%). For species with greater than 40 admissions during the study period, the proportion of gunshot trauma of all causes of morbidity and mortality ranged from raptors with gunshot trauma were admitted during the fall and winter months (75%) compared with the spring and summer (25%). A significant decrease in the absolute number of gunshot cases per year was observed over the time period studied. The population-level effect of gunshot trauma is unknown for these species; however, it appears to be minor compared with other causes of morbidity and mortality.

Vultures and others scavenger vertebrates associated with man-sized pig carcasses: a perspective in Forensic Taphonomy

Directory of Open Access Journals (Sweden)

Caroline Demo

2013-10-01

Full Text Available The activity of vertebrates that feed on corpses can modify the chronology of the decomposition process and interfere with postmortem interval estimates. Further, by destroying the soft parts of the cadaver, scattering, burying or causing the disappearance of bones, it can entirely change the crime scene. In this study, we simulated a clandestine cemetery in an area of Cerrado located inside a farm in Brasília, Distrito Federal. Three domestic pigs of the size of a human of about 60 kg were placed on the ground in different periods of 2010 and 2011. We recorded four species of birds and one of mammal eating the carcasses: 1 Cathartidae: Coragyps atratus (Bechstein, 1973, Cathartes aura (Linnaeus, 1758, Sarcoramphus papa (Linnaeus, 1758; 2 Falconidae: Caracara plancus (Miller, 1777; and 3 Felidae: Leopardus pardalis (Lund, 1840. The behavior of these animals interfered in the decomposition process and resulted in the dispersion and loss of bony parts.

Phenotype overlap in Xylella fastidiosa is controlled by the cyclic di-GMP phosphodiesterase Eal in response to antibiotic exposure and diffusible signal factor-mediated cell-cell signaling.

Science.gov (United States)

de Souza, Alessandra A; Ionescu, Michael; Baccari, Clelia; da Silva, Aline M; Lindow, Steven E

2013-06-01

Eal is an EAL domain protein in Xylella fastidiosa homologous to one involved in resistance to tobramycin in Pseudomonas aeruginosa. EAL and HD-GYP domain proteins are implicated in the hydrolysis of the secondary messenger bis-(3'-5')-cyclic dimeric GMP (cyclic di-GMP). Cell density-dependent communication mediated by a Diffusible Signal Factor (DSF) also modulates cyclic di-GMP levels in X. fastidiosa, thereby controlling the expression of virulence genes and genes involved in insect transmission. The possible linkage of Eal to both extrinsic factors such as antibiotics and intrinsic factors such as quorum sensing, and whether both affect virulence, was thus addressed. Expression of eal was induced by subinhibitory concentrations of tobramycin, and an eal deletion mutant was more susceptible to this antibiotic than the wild-type strain and exhibited phenotypes similar to those of an rpfF deletion mutant blocked in DSF production, such as hypermotility, reduced biofilm formation, and hypervirulence to grape. Consistent with that, the rpfF mutant was more susceptible than the wild-type strain to tobramycin. Therefore, we propose that cell-cell communication and antibiotic stress can apparently lead to similar modulations of cyclic di-GMP in X. fastidiosa, resulting in similar phenotypes. However, the effect of cell density is dominant compared to that of antibiotic stress, since eal is suppressed by RpfF, which may prevent inappropriate behavioral changes in response to antibiotic stress when DSF accumulates.

Molecular characterization of Cryptosporidium spp. from fecal samples of birds kept in captivity in Brazil.

Science.gov (United States)

Nakamura, Alex Akira; Simões, Daniel Castendo; Antunes, Rômulo Godik; da Silva, Deuvânia Carvalho; Meireles, Marcelo Vasconcelos

2009-12-03

The aim of this study was to determine the prevalence of Cryptosporidium species and genotypes in birds kept in captivity in Brazil. A total of 966 samples from 18 families of birds was collected and stored in 5% potassium dichromate solution at 4 degrees C until processing. Oocysts were purified in Sheather sugar solution following extraction of genomic DNA. Molecular analyses were performed using nested-PCR for amplification of fragments of the 18S subunit of rRNA gene and of the actin gene. Amplification of Cryptosporidium DNA fragments was obtained in 47 (4.86%) samples. Sequencing of amplified fragments and phylogenetic analyses allowed the identification of Cryptosporidium baileyi in a black vulture (Coragyps atratus), a domestic chicken (Gallus gallus domesticus) and a saffron finch (Sicalis flaveola); Cryptosporidium galli in canaries (Serinus canaria), a cockatiel (Nymphicus hollandicus) and lesser seed-finches (Oryzoborus angolensis); Cryptosporidium meleagridis in a domestic chicken (G. g. domesticus); Cryptosporidium parvum in a cockatiel (N. hollandicus); Cryptosporidium avian genotype I in a canary (S. canaria) and an Indian peafowl (Pavo cristatus); Cryptosporidium avian genotype II in ostriches (Struthio camelus) and Cryptosporidium avian genotype III in a cockatiel (N. hollandicus) and a peach-faced lovebird (Agapornis roseicolis).

A SMAP Supervised Classification of Landsat Images for Urban Sprawl Evaluation

Directory of Open Access Journals (Sweden)

Flavia Di Palma

2016-07-01

Full Text Available The negative impacts of land take on natural components and economic resources affect planning choices and territorial policies. The importance of land take monitoring, in Italy, has been only recently considered, but despite this awareness, in the great part of the country, effective monitoring and containment measures have not been started, yet. This research proposes a methodology to map and monitor land use changes. To this end, a time series from 1985–2010, based on the multi-temporal Landsat data Thematic Mapper (TM, has been analyzed in the Vulture Alto-Bradano area, a mountain zone of the Basilicata region (Southern Italy. Results confirm a double potentiality of using these data: on the one hand, the use of multi-temporal Landsat data allows going very back in time, producing accurate datasets that provide a phenomenon trend over time; on the other hand, these data can be considered a first experience of open data in the field of spatial information. The proposed methodology provides agencies, local authorities and practitioners with a valuable tool to implement monitoring actions. This represents the first step to pursue territorial governance methods based on sustainability, limiting the land take.

Shape similarities and differences in the skulls of scavenging raptors.

Science.gov (United States)

Guangdi, S I; Dong, Yiyi; Ma, Yujun; Zhang, Zihui

2015-04-01

Feeding adaptations are a conspicuous feature of avian evolution. Bill and cranial shape as well as the jaw muscles are closely related to diet choice and feeding behaviors. Diurnal raptors of Falconiformes exhibit a wide range of foraging behaviors and prey preferences, and are assigned to seven dietary groups in this study. Skulls of 156 species are compared from the dorsal, lateral and ventral views, by using geometric morphometric techniques with those landmarks capturing as much information as possible on the overall shape of cranium, bill, orbits, nostrils and attachment area for different jaw muscles. The morphometric data showed that the skull shape of scavengers differ significantly from other raptors, primarily because of different feeding adaptations. As a result of convergent evolution, different scavengers share generalized common morphology, possessing relatively slender and lower skulls, longer bills, smaller and more sideward orbits, and more caudally positioned quadrates. Significant phylogenetic signals suggested that phylogeny also played important role in shape variation within scavengers. New World vultures can be distinguished by their large nostrils, narrow crania and small orbits; Caracaras typically show large palatines, crania and orbits, as well as short, deep and sharp bill.

Scarab Beetle (Coleoptera: Scarabaeidae Fauna in Ardabil Province, North West Iran

Directory of Open Access Journals (Sweden)

G Mowlavi

2008-12-01

Full Text Available "nBackground: Dung beetles of Coleoptera associated to undisturbed cattle droppings in pastures present great diver¬sity and abundance. Dung beetles also play an important role for transmission of some helminthes to human and cat¬tle. This study was made to survey the biodiversity and abundance of these beetles in Ardebil Province, western Iran."nMethods: According to the field study all beetles attracted to fresh cow dung in five areas of Ardebil Province in¬cluding Namin, Ardabil, Meshkinshahr, Neer and Sarein were collected and identified. They were collected during summer 2007 from June to September, with general peaks appearing to be correlated with temperature mainly at 11 a.m to 15 p.m. The samples were identified using appropriate systematic key "nResults: A total of 231 specimens belonging to 9 beetle genera and at least 15 species were identified as Euoniticel¬lus fulvus, Sisyphus schaffaer, Euonthophagus taurus, Copris lunaris, Chironitis pamphilus, Gymnopleurus coriarus, Euonthophagus amyntas, Caccobius schreberi, Onthophagus speculifer, Onthophagus furcatus, Aphodius, lugens, Apho¬dius fimetarius, A. scrutator, Geotrupes spiniger and G. stercorarius"nThe most abundant and diverse subfamilies were Coprinae, Geotrupinae, and Aphodiinae. "nConclusion: We found 15 species of dung beetles occurred in the region. The prevalence of each species is varied depending on location. Some of them play an important role for helminths transmission of veterinary and public health importance. The finding will provide a clue for pasture management as well as public health monitoring and surveillance of the disease transmitted by dung beetles. 

Use of black vulture (Coragyps atratus in complementary and alternative therapies for cancer in Colombia: A qualitative study

Directory of Open Access Journals (Sweden)

Sánchez-Pedraza Ricardo

2012-05-01

Full Text Available Abstract Background Although Coragyps atratus has been used as a traditional therapy for patients with cancer, the scientific literature does not contain enough information on how this therapy is used or the mechanisms that explain this therapeutic practice. Objectives To understand the methods of use and the reasons given by patients and caregivers for the use of Coragyps atratus in cancer treatment. Methods This study used a qualitative design based on twenty in-depth interviews of patients with cancer or caregivers of patients with the disease. The analysis of the text was based on an inductive thematic approach. Results Resistance to disease and immune enhancement are properties attributed to Coragyps atratus when used for cancer treatment. The most recommended method of use is fresh blood ingestion, and the associated mechanism of action is transfer of immune factors to the individual who consumes it. Conclusions Use of Coragyps atratus as a treatment for cancer is a popular alternative therapy in Colombia. More studies are needed to understand the clinical effects of this intervention in cancer patients. Spanish abstract Introducción Aunque Coragyps atratus se usa tradicionalmente como terapia para pacientes con cáncer, no existe suficiente información en la literatura científica sobre su forma de utilización ni sobre los mecanismos explicativos que subyacen a esta práctica terapéutica. Objetivos Conocer métodos de utilización y mecanismos explicativos dados por los pacientes y cuidadores de pacientes sobre el uso de Coragyps atratus en el tratamiento del cáncer. Materiales y métodos Diseño cualitativo basado en veinte entrevistas en profundidad de pacientes con cáncer o cuidadores de pacientes con esta enfermedad. Análisis de texto basado en enfoque temático inductivo. Resultados Al Coragyps atratus se le atribuyen propiedades de resistencia y fortalecimiento del sistema inmune de personas enfermas de cáncer. La forma de utilización mas común es la ingesta de la sangre fresca y el mecanismo de acción asociado es la transferencia de defensas a quien lo consume. Conclusiones La utilización del Coragyps atratus como tratamiento para el cáncer es una terapia alternativa usada popularmente en Colombia. El uso de este animal debe estudiarse más a fondo para conocer los efectos clínicos en los pacientes con cáncer.

Use of black vulture (Coragyps atratus) in complementary and alternative therapies for cancer in Colombia: A qualitative study

Science.gov (United States)

2012-01-01

Background Although Coragyps atratus has been used as a traditional therapy for patients with cancer, the scientific literature does not contain enough information on how this therapy is used or the mechanisms that explain this therapeutic practice. Objectives To understand the methods of use and the reasons given by patients and caregivers for the use of Coragyps atratus in cancer treatment. Methods This study used a qualitative design based on twenty in-depth interviews of patients with cancer or caregivers of patients with the disease. The analysis of the text was based on an inductive thematic approach. Results Resistance to disease and immune enhancement are properties attributed to Coragyps atratus when used for cancer treatment. The most recommended method of use is fresh blood ingestion, and the associated mechanism of action is transfer of immune factors to the individual who consumes it. Conclusions Use of Coragyps atratus as a treatment for cancer is a popular alternative therapy in Colombia. More studies are needed to understand the clinical effects of this intervention in cancer patients. Spanish abstract Introducción Aunque Coragyps atratus se usa tradicionalmente como terapia para pacientes con cáncer, no existe suficiente información en la literatura científica sobre su forma de utilización ni sobre los mecanismos explicativos que subyacen a esta práctica terapéutica. Objetivos Conocer métodos de utilización y mecanismos explicativos dados por los pacientes y cuidadores de pacientes sobre el uso de Coragyps atratus en el tratamiento del cáncer. Materiales y métodos Diseño cualitativo basado en veinte entrevistas en profundidad de pacientes con cáncer o cuidadores de pacientes con esta enfermedad. Análisis de texto basado en enfoque temático inductivo. Resultados Al Coragyps atratus se le atribuyen propiedades de resistencia y fortalecimiento del sistema inmune de personas enfermas de cáncer. La forma de utilización mas común es la ingesta de la sangre fresca y el mecanismo de acción asociado es la transferencia de defensas a quien lo consume. Conclusiones La utilización del Coragyps atratus como tratamiento para el cáncer es una terapia alternativa usada popularmente en Colombia. El uso de este animal debe estudiarse más a fondo para conocer los efectos clínicos en los pacientes con cáncer. PMID:22651097

A Vulture is Not a Dove: The Politics of Indigeneity and Resistance to Canadian Extractivism in the Americas

Directory of Open Access Journals (Sweden)

Steven Schnoor

2017-12-01

Full Text Available Canadian mining activities have exploded throughout Latin America over the past 15-20 years, bringing a host of problems and leading to burgeoning resistance movements. This paper argues that a growing strategy deployed by Canadian mining companies, and the regimes that support them, in their engagements with Indigenous communities in the Global South who are resisting extractive activities on their territories, entails cultivating Indigenous subjectivities in ways that co-opt their aspirations for decolonization, self-determination, and demands for the recognition of Indigenous rights. That energy is then channelled into supporting, indeed demanding, the very model of extractive capitalism that Canadian mining regimes wish to develop in the region. Drawing upon theories of governmentality and the work of Canadian Indigenous scholars Glen Coulthard and Taiaiake Alfred on the politics of recognition and decolonization, this paper chronicles struggles over Indigeneity as a political subjectivity through three ongoing extractive-related conflicts in Guatemala, Chile, and Panama.

Spatial complexity of carcass location influences vertebrate scavenger efficiency and species composition.

Science.gov (United States)

Smith, Joshua B; Laatsch, Lauren J; Beasley, James C

2017-08-31

Scavenging plays an important role in shaping communities through inter- and intra-specific interactions. Although vertebrate scavenger efficiency and species composition is likely influenced by the spatial complexity of environments, heterogeneity in carrion distribution has largely been disregarded in scavenging studies. We tested this hypothesis by experimentally placing juvenile bird carcasses on the ground and in nests in trees to simulate scenarios of nestling bird carrion availability. We used cameras to record scavengers removing carcasses and elapsed time to removal. Carrion placed on the ground was scavenged by a greater diversity of vertebrates and at > 2 times the rate of arboreal carcasses, suggesting arboreal carrion may represent an important resource to invertebrate scavengers, particularly in landscapes with efficient vertebrate scavenging communities. Nonetheless, six vertebrate species scavenged arboreal carcasses. Rat snakes (Elaphe obsolete), which exclusively scavenged from trees, and turkey vultures (Cathartes aura) were the primary scavengers of arboreal carrion, suggesting such resources are potentially an important pathway of nutrient acquisition for some volant and scansorial vertebrates. Our results highlight the intricacy of carrion-derived food web linkages, and how consideration of spatial complexity in carcass distribution (i.e., arboreal) may reveal important pathways of nutrient acquisition by invertebrate and vertebrate scavenging guilds.

The diversity and biogeography of late Pleistocene birds from the lowland Neotropics

Science.gov (United States)

Steadman, David W.; Oswald, Jessica A.; Rincón, Ascanio D.

2015-05-01

The Neotropical lowlands sustain the world's richest bird communities, yet little that we know about their history is based on paleontology. Fossils afford a way to investigate distributional shifts in individual species, and thus improve our understanding of long-term change in Neotropical bird communities. We report a species-rich avian fossil sample from a late Pleistocene tar seep (Mene de Inciarte) in northwestern Venezuela. A mere 175 identified fossils from Mene de Inciarte represent 73 species of birds, among which six are extinct, and eight others no longer occur within 100 km. These 14 species consist mainly of ducks (Anatidae), snipe (Scolopacidae), vultures/condors (Vulturidae), hawks/eagles (Accipitridae), and blackbirds (Icteridae). Neotropical bird communities were richer in the late Pleistocene than today; their considerable extinction may be related to collapse of the large mammal fauna at that time. The species assemblage at Mene de Inciarte suggests that biogeographic patterns, even at continental scales, have been remarkably labile over short geological time frames. Mene de Inciarte is but one of 300 + tar seeps in Venezuela, only two of which have been explored for fossils. We may be on the cusp of an exciting new era of avian paleontology in the Neotropics.

Avian risk behavior and fatalities at the Altamont Wind Resource Area: March 1998 - February 1999

Energy Technology Data Exchange (ETDEWEB)

Thelander, C.; Rugge, L.

2000-05-08

Since 1981, more than 7,000 wind turbines have been installed in the Altamont Wind Resource Area in north-central California. Currently, about 5,000 turbines are operating. Past research efforts demonstrated that wind turbines frequently kill birds, especially raptors. Little is known about the specific flight and perching behaviors by birds near wind turbines. A better understanding of these interactions may one day yield insights on how to minimize bird fatalities. This Phase 1 progress report summarizes research findings obtained at 20 study plots totaling 785 turbines of various configurations and conducted between March 1998 and February 1999. The authors examined bird use and behaviors and collected data on fatalities at the same turbines throughout the course of the surveys. They completed 745 30-minute point counts (1,702 bird observations) that quantified bird risk behaviors and bird use of the study plots. The four most frequently observed bird species were red-tailed hawks, common ravens, turkey vultures, and golden eagles. During the same period, the authors recorded 95 bird fatalities. Raptors represent 51% (n=49) of the kills found. The data indicate that the relative abundance of species observed does not predict the relative frequency of fatalities per species. Phase II of the research is underway.

Black Kite Populations Are Suffering Declining Trends in Kurukshetra And Likely to Experience Further Depletion - An Analysis Of Causes

Directory of Open Access Journals (Sweden)

Tirshem Kumar Kaushik

2014-01-01

Full Text Available Black Kite Milvus migrans was seen capturing and captivating everything nearby the offal and garbage sites in Kurukshetra environs until recent past. Today it has been observed that between 2000 and 2010, its depletion is speeding fast, although not noticed in the scientific and social world. The skies in late morning hours are empty. Garbage sites demonstrate the absence of criss-crossing flights of this Kite. The popular sites of the roosting in the shape of Peepal Ficus religiosa, Banyan Ficus benghalensis and Mango Mangifera indica trees have been cut down in the first place. In Kurukshetra, the prime reason for the depletion could be attributed to destruction of foraging grounds (Elimination of garbage dumping sites, cutting down of traditional roosting and nesting sites and construction of colonies in the nearby erstwhile agriculture fields. The contiguous agriculture fields are devoid of any traditional trees like Peepal, Mango and hence no roosting and nesting places. The soaring Kites in the high skies in the forenoon and afternoon sessions were more or less absent. So much so that huge Garbage sites at Panipat Railway compound had no Black Kites. Shockingly, it seems that like Vultures, Black Kites are on their way to elimination in Haryana.

Avian risk behavior and fatalities at the Altamont Wind Resource Area: March 1998 - February 1999

International Nuclear Information System (INIS)

Thelander, C.; Rugge, L.

2000-01-01

Since 1981, more than 7,000 wind turbines have been installed in the Altamont Wind Resource Area in north-central California. Currently, about 5,000 turbines are operating. Past research efforts demonstrated that wind turbines frequently kill birds, especially raptors. Little is known about the specific flight and perching behaviors by birds near wind turbines. A better understanding of these interactions may one day yield insights on how to minimize bird fatalities. This Phase 1 progress report summarizes research findings obtained at 20 study plots totaling 785 turbines of various configurations and conducted between March 1998 and February 1999. The authors examined bird use and behaviors and collected data on fatalities at the same turbines throughout the course of the surveys. They completed 745 30-minute point counts (1,702 bird observations) that quantified bird risk behaviors and bird use of the study plots. The four most frequently observed bird species were red-tailed hawks, common ravens, turkey vultures, and golden eagles. During the same period, the authors recorded 95 bird fatalities. Raptors represent 51% (n=49) of the kills found. The data indicate that the relative abundance of species observed does not predict the relative frequency of fatalities per species. Phase II of the research is underway

Nuevo examen de los grabados paleolíticos de El Pendo (Cantabria, España. Consideraciones sobre las aves del arte paleolítico de la Península Ibérica

Directory of Open Access Journals (Sweden)

García Díez, Marcos

2011-06-01

Full Text Available Birds are very scarce in Palaeolithic rock art. Since 1907 figures of razorbill and raptors (probably vulture have been described at the end of the Pendo cave, both attributed to an Upper Palaeolithic origin (from Aurignacian to Lower Magdalenian, depending on the authors. The new revision of the group of engravings shows the presence of an unambiguous bird, but the morphology of the figure did not permit its precise taxonomic identification. The work also presents a revision of the birds known in Iberian Palaeolithic rock art.

La presencia de aves en el repertorio iconográfico del arte rupestre paleolítico es muy escasa. Desde 1907 se vienen describiendo unas figuras de alca y de rapaz (probablemente buitre en la parte final de la cueva de El Pendo. Los autores las asignan a un momento antiguo, desde el Auriñaciense hasta el Magdaleniense inferior. Una nueva lectura del conjunto de grabados permite apuntar la presencia inequívoca de una imagen de ave, sin características que permitan su identificación taxonómica precisa. El trabajo revisa, además, las imágenes de aves conocidas en el arte rupestre paleolítico de la Península Ibérica.

Fault fluid evolution at the outermost edges of the southern Apennines fold-and-thrust belt, Italy

Science.gov (United States)

Agosta, Fabrizio; Belviso, Claudia; Cavalcante, Francesco; Vita Petrullo, Angela

2017-04-01

This work focuses on the structural architecture and mineralization of a high-angle, extensional fault zone that crosscuts the Middle Pleistocene tuffs and pyroclastites of the Vulture Volcano, southern Italy. This fault zone is topped by a few m-thick travertine deposit formed by precipitation, in a typical lacustrine depositional environment, from a fault fluid that included a mixed, biogenic- and mantle-derived CO2. The detailed analysis of its different mineralization can shed new lights into the shallow crustal fluid flow that took place during deformation of the outer edge of the southern Apennines fold-and-thrust belt. In fact, the study fault zone is interpreted as a shallow-seated, tear fault associated with a shallow thrust fault displacing the most inner portion of the Bradano foredeep basin infill, and was thus active during the latest stages of contractional deformation. Far from the fault zone, the fracture network is made up of three high-angle joint sets striking N-S, E-W and NW-SE, respectively. The former two sets can be interpreted as the older structural elements that pre-dated the latter one, which is likely due to the current stress state that affects the whole Italian peninsula. In the vicinity of the fault zone, a fourth joint high-angle set striking NE-SW is also present, which becomes the most dominant fracture set within the study footwall fault damage zone. Detailed X-ray diffraction analysis of the powder obtained from hand specimens representative of the multiple mineralization present within the fault zone, and in the surrounding volcanites, are consistent with circulation of a fault fluid that modified its composition with time during the latest stages of volcanic activity and contractional deformation. Specifically, veins infilled with and slickenside coated by jarosite, Opal A and/or goethite are found in the footwall fault damage zone. Based upon the relative timing of formation of the aforementioned joint sets, deciphered after

Illegal captive lemurs in Madagascar: Comparing the use of online and in-person data collection methods.

Science.gov (United States)

Reuter, Kim E; Schaefer, Melissa S

2017-11-01

Although it is illegal to capture, sell, and trade lemurs, the live capture of lemurs in Madagascar is ongoing and may have impacted over 28,000 lemurs between 2010 and 2013. Only one study has examined this trade and did so using in-person interviews in northern Madagascar. The current study sought to expand this existing dataset and examine the comparability of online surveys to more traditional on-location data collection methods. In this study, we collected data through a web-based survey resulting in 302 sightings of 685 captive lemurs. We also collected data from 171 hotel and 43 restaurant websites and social media profiles. Survey submissions included sightings of 30 species from 10 genera, nearly twice as many species as identified via the in-person interviews. Lemur catta, Varecia variegata, and Eulemur fulvus were the most common species sighted in captivity. Captive lemurs were reported in 19 of Madagascar's 22 administrative regions and most were seen in urban areas near their habitat ranges. This represents a wider geographic distribution of captive lemurs than previously found through in-person interviews. The online survey results were broadly similar to those of the in-person surveys though greater in species and geographic diversity demonstrating advantages to the use of online surveys. The online research methods were low in cost (USD $100) compared to on-location data collection (USD $12,000). Identified disadvantages included sample bias; most of the respondents to the online survey were researchers and many captive sightings were near study sites. The results illustrate the benefits of incorporating a social science approach using online surveys as a complement to traditional fieldwork. Am. J. Primatol. 79:e22541, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Producción y calidad de la leche bubalina

Directory of Open Access Journals (Sweden)

Exequiel Maria Patiño

2011-11-01

Full Text Available El búfalo, al igual que los bovinos, son clasificados zoológicamente en la familia Bovidae y en la subfamilia bovinae. Los bovinos pertenecen a la especie Bos taurus y los búfalos a la Bubalus. Dentro de esta última encontramos a su vez tres sub especies, Bubalis, Karebau o Carabao y Fulvus.La especie Bubalus también es clasificada como búfalo de agua (Bubalus bubalis bubalis y de pantano (Bubalus bubalis karebau.El Bubalus bubalis sp. también denominado búfalo doméstico o asiático muchas veces es confundido con el bisonte americano (Bison bison, mal llamado búfalo americano o con el búfalo africano (Syncerus caffer también conocido como búfalo salvaje de África.El búfalo doméstico posee un número menor de cromosomas que el bovino (50 en lugar de 60, lo que hace incompatible su cruzamiento, aclarando a su vez que el búfalo de río o agua tiene 50 cromosomas, y el de pantano 48, lo cual hace viable su cruzamiento. El búfalo se encuentra actualmente en todos los continentes. Tuvo su origen en Asia y se registran datos de su existencia como animal doméstico desde hace 4.500 años, en la región ocupada actualmente por India y Pakistán.De Asia fue llevado a África, luego a Europa, Oceanía y posteriormente a América. La población bubalina actual en el mundo según la FAO (2008 es de 180,7 millones de cabezas, de las cuales Asia tiene el 96,40% del total de dicha existencia, África cuenta con el 2,78%, América con 0,63%, Europa con el 0,18% y Oceanía con el 0,001%.

Education can improve the negative perception of a threatened long-lived scavenging bird, the Andean condor

Science.gov (United States)

Cailly Arnulphi, Verónica B.; Lambertucci, Sergio A.

2017-01-01

Human-wildlife conflicts currently represent one of the main conservation problems for wildlife species around the world. Vultures have serious conservation concerns, many of which are related to people's adverse perception about them due to the belief that they prey on livestock. Our aim was to assess local perception and the factors influencing people's perception of the largest scavenging bird in South America, the Andean condor. For this, we interviewed 112 people from Valle Fértil, San Juan province, a rural area of central west Argentina. Overall, people in the area mostly have an elementary education, and their most important activity is livestock rearing. The results showed that, in general, most people perceive the Andean condor as an injurious species and, in fact, some people recognize that they still kill condors. We identified two major factors that affect this perception, the education level of villagers and their relationship with livestock ranching. Our study suggests that conservation of condors and other similar scavengers depends on education programs designed to change the negative perception people have about them. Such programs should be particularly focused on ranchers since they are the ones who have the worst perception of these scavengers. We suggest that highlighting the central ecological role of scavengers and recovering their cultural value would be fundamental to reverse their persecution and their negative perception by people. PMID:28950019

Interspecific comparison of the performance of soaring migrants in relation to morphology, meteorological conditions and migration strategies.

Directory of Open Access Journals (Sweden)

Ugo Mellone

Full Text Available BACKGROUND: Performance of migrating birds can be affected by a number of intrinsic and extrinsic factors like morphology, meteorological conditions and migration strategies. We compared travel speeds of four raptor species during their crossing of the Sahara desert. Focusing the analyses on this region allows us to compare different species under equivalent conditions in order to disentangle which factors affect migratory performance. METHODOLOGY/PRINCIPAL FINDING: We tracked raptors using GPS satellite transmitters from Sweden, Spain and Italy, and evaluated their migratory performance at both an hourly and a daily scale. Hourly data (flight speed and altitude for intervals of two hours were analyzed in relation to time of day, species and season, and daily data (distance between roosting sites in relation to species, season, day length and tailwind support. CONCLUSIONS/SIGNIFICANCE: Despite a clear variation in morphology, interspecific differences were generally very small, and did only arise in spring, with long-distance migrants (>5000 km: osprey and Western marsh-harrier being faster than species that migrate shorter distances (Egyptian vulture and short-toed eagle. Our results suggest that the most important factor explaining hourly variation in flight speed is time of day, while at a daily scale, tailwind support is the most important factor explaining variation in daily distance, raising new questions about the consequences of possible future changes in worldwide wind patterns.

Naturally induced humoral immunity to West Nile virus infection in raptors.

Science.gov (United States)

Nemeth, Nicole M; Kratz, Gail E; Bates, Rebecca; Scherpelz, Judy A; Bowen, Richard A; Komar, Nicholas

2008-09-01

West Nile virus (WNV) infection can be fatal to many bird species, including numerous raptors, though population- and ecosystem-level impacts following introduction of the virus to North America have been difficult to document. Raptors occupy a diverse array of habitats worldwide and are important to ecosystems for their role as opportunistic predators. We documented initial (primary) WNV infection and then regularly measured WNV-specific neutralizing antibody titers in 16 resident raptors of seven species, plus one turkey vulture. Most individuals were initially infected and seroconverted between July and September of 2003, though three birds remained seronegative until summer 2006. Many of these birds became clinically ill upon primary infection, with clinical signs ranging from loss of appetite to moderate neurological disease. Naturally induced WNV neutralizing antibody titers remained essentially unchanged in some birds, while eight individuals experienced secondary rises in titer presumably due to additional exposures at 1, 2, or 3 years following primary infection. No birds experienced clinical signs surrounding or following the time of secondary exposure, and therefore antibodies were considered protective. Results of this study have implications for transmission dynamics of WNV and health of raptor populations, as well as the interpretation of serologic data from free-ranging and captive birds. Antibodies in raptors surviving WNV may persist for multiple years and protect against potential adverse effects of subsequent exposures.

Anatomy and histochemistry of spread-wing posture in birds. 2. Gliding flight in the California gull, Larus californicus: a paradox of fast fibers and posture.

Science.gov (United States)

Meyers, R A; Mathias, E

1997-09-01

Gliding flight is a postural activity which requires the wings to be held in a horizontal position to support the weight of the body. Postural behaviors typically utilize isometric contractions in which no change in length takes place. Due to longer actin-myosin interactions, slow contracting muscle fibers represent an economical means for this type of contraction. In specialized soaring birds, such as vultures and pelicans, a deep layer of the pectoralis muscle, composed entirely of slow fibers, is believed to perform this function. Muscles involved in gliding posture were examined in California gulls (Larus californicus) and tested for the presence of slow fibers using myosin ATPase histochemistry and antibodies. Surprisingly small numbers of slow fibers were found in the M. extensor metacarpi radialis, M. coracobrachialis cranialis, and M. coracobrachialis caudalis, which function in wrist extension, wing protraction, and body support, respectively. The low number of slow fibers in these muscles and the absence of slow fibers in muscles associated with wing extension and primary body support suggest that gulls do not require slow fibers for their postural behaviors. Gulls also lack the deep belly to the pectoralis found in other gliding birds. Since bird muscle is highly oxidative, we hypothesize that fast muscle fibers may function to maintain wing position during gliding flight in California gulls.

Energy beyond food: foraging theory informs time spent in thermals by a large soaring bird.

Directory of Open Access Journals (Sweden)

Emily L C Shepard

Full Text Available Current understanding of how animals search for and exploit food resources is based on microeconomic models. Although widely used to examine feeding, such constructs should inform other energy-harvesting situations where theoretical assumptions are met. In fact, some animals extract non-food forms of energy from the environment, such as birds that soar in updraughts. This study examined whether the gains in potential energy (altitude followed efficiency-maximising predictions in the world's heaviest soaring bird, the Andean condor (Vultur gryphus. Animal-attached technology was used to record condor flight paths in three-dimensions. Tracks showed that time spent in patchy thermals was broadly consistent with a strategy to maximise the rate of potential energy gain. However, the rate of climb just prior to leaving a thermal increased with thermal strength and exit altitude. This suggests higher rates of energetic gain may not be advantageous where the resulting gain in altitude would lead to a reduction in the ability to search the ground for food. Consequently, soaring behaviour appeared to be modulated by the need to reconcile differing potential energy and food energy distributions. We suggest that foraging constructs may provide insight into the exploitation of non-food energy forms, and that non-food energy distributions may be more important in informing patterns of movement and residency over a range of scales than previously considered.

Use of black vulture (Coragyps atratus) in complementary and alternative therapies for cancer in Colombia: A qualitative study

OpenAIRE

Sánchez-Pedraza Ricardo; Gamba-Rincón Magda R; González-Rangel Andrés L

2012-01-01

Abstract Background Although Coragyps atratus has been used as a traditional therapy for patients with cancer, the scientific literature does not contain enough information on how this therapy is used or the mechanisms that explain this therapeutic practice. Objectives To understand the methods of use and the reasons given by patients and caregivers for the use of Coragyps atratus in cancer treatment. Methods This study used a qualitative design based on twenty in-depth interviews of patients...

Feed Supplementation with Thermo-Tolerant, Lactic Acid-Producing Bacteria as Probiotics for Swine Husbandry

International Nuclear Information System (INIS)

Tongpim, Saowanit; Khammeng, Terdsak; Luanthisong, Pirat; Sakai, Kenji; Piadang, Nattayana

2006-09-01

This research work had an objective to employ the thermo tolerant, lactic acid-producing bacteria, Bacillus coagulans strain NF 1 7 as feed additive for swine raising. The bacterial isolate NF 1 7, kept in the culture collection of Khon Kaen University that could tolerate high temperature and produce lactic acid, was employed in this experiment. Cell suspension of isolate NF 1 7 was exposed to gamma irradiation at various doses (1-5 KGy). The isolated survivors were screened on the basis of forming larger colonies and clear zones than the parent strain NF 1 7 when grown on Glucose- Yeast extract-Peptone (GYP) containing CaCO 3 . We obtained 55 effective isolates which the isolate L 5 I2 to 14(5), designated as K 1 4 was chosen for further experiments. Isolate K 1 4 together with the parent strain were characterized using morphological, physiological and biochemical tests. They were all identified as Bacillus coagulans. All isolates had optimal growth pH of 6.5 and grew best at 42.50 o C. The strain K 1 4 could tolerate the temperature as high as 59 o C and was then employed in the fermentation of food waste that collected from the university cafeteria. It was found that food waste could support growth of Bacillus K 1 4 and produce about 107 to 108 CFU/g food waste within 1-3 days. Nutritional value of the fermented food waste in the form of protein was also increased. When mixing this selected bacterium as feed additive in daily pig rations, it was found that Bacillus K 1 4 helped increase feed conversion ratio and reduced the mortality in weaned piglets. Experiments were also performed with the growing pigs. It showed that Bacillus Sp. K 1 4 significantly improved the feed conversion ratio

Heterospecific sociality of birds on beaches from southeastern Brazil

Directory of Open Access Journals (Sweden)

César Cestari

2009-12-01

Full Text Available Studies on the sociality of heterospecific assemblages of birds have promoted a greater understanding of the types of interactions and survivorship between coexisting species. This study verified the group compositions in bird assemblages and analyzed the sociality of migratory and resident species on sandy beaches of southeastern Brazil. A transect was established on the median portion of beaches and all the groups of bird species (monospecific, heterospecific and solitary individuals were registered four days per month from November 2006 to April 2007. The sociality of each species was calculated by its frequency in heterospecific groups, its proportional number of contacts with other species in heterospecific groups, and the number of species that it associated with. Semipalmated Sandpiper Calidris pusilla (Linnaeus, 1766 and Semipalmated Plover Charadrius semipalmatus Bonaparte, 1825 (both migratory had the highest degree of sociality and did not show a preference to associate with either residents or migratory species. Sanderling Calidris alba (Pallas, 1764 (migratory occupied the third position in the sociality rank and associated with migratory species frequently. Southern Caracara Carara plancus (Miller, 1777 and Black Vulture Coragyps atratus (Beschstein, 1793 (both resident were uniquely found among heterospecific groups with necrophagous and resident species. Kelp Gull Larus dominicanus Lichtenstein, 1823 (resident associated more frequently with resident species. The sociality in assemblages of birds may promote advantages such as an increased collective awareness in dangerous situations and indication of sites with abundant food sources.

Lipegfilgrastim in the management of chemotherapy-induced neutropenia of cancer patients

Directory of Open Access Journals (Sweden)

Guariglia R

2016-01-01

Full Text Available Roberto Guariglia,1 Maria Carmen Martorelli,1 Rosa Lerose,2 Donatella Telesca,2 Maria Rita Milella,2 Pellegrino Musto3 1Unit of Hematology and Stem Cell Transplantation, 2Pharmacy Service, 3Scientific Direction, IRCCS, Referral Cancer Center of Basilicata, Rionero in Vulture, Potenza, Italy Abstract: Neutropenia and febrile neutropenia (FN are frequent and potentially fatal toxicities of myelosuppressive anticancer treatments. The introduction of granulocyte colony-stimulating factors (G-CSFs in clinical practice has remarkably reduced the duration and severity of neutropenia, as well as the incidence of FN, thus allowing the administration of chemotherapeutic agents at the optimal dose and time with lower risk. The current scenario of G-CSFs in Europe includes filgrastim, lenograstim, some G-CSF biosimilars, and pegfilgrastim. Recently, a novel long-acting G-CSF, lipegfilgrastim, became available. Lipegfilgrastim is a glycopegylated G-CSF, alternative to pegfilgrastim, and has shown in randomized trials, to be equivalent to pegfilgrastim in reducing the incidence of severe neutropenia and FN in patients with breast cancer receiving chemotherapy, with a similar safety profile. Furthermore, lipegfilgrastim was more effective than the placebo in reducing the incidence of severe neutropenia, its duration, and time to absolute neutrophil count recovery, in patients with non-small cell lung cancer receiving myelosuppressive therapy. Although the number of studies currently published is still limited, lipegfilgrastim seems to be a promising drug in the management of chemotherapy-induced neutropenia. Keywords: neutropenia, febrile neutropenia, granulocyte colony-stimulating factors, G-CSF, pegfilgrastim, lipegfilgrastim

Late Pleistocene songbirds of Liang Bua (Flores, Indonesia); the first fossil passerine fauna described from Wallacea

Science.gov (United States)

Sutikna, Thomas; Saptomo, Wahyu; Jatmiko; Wasisto, Sri; Tocheri, Matthew W.; Mayr, Gerald

2017-01-01

Background Passerines (Aves: Passeriformes) dominate modern terrestrial bird communities yet their fossil record is limited. Liang Bua is a large cave on the Indonesian island of Flores that preserves Late Pleistocene–Holocene deposits (∼190 ka to present day). Birds are the most diverse faunal group at Liang Bua and are present throughout the stratigraphic sequence. Methods We examined avian remains from the Late Pleistocene deposits of Sector XII, a 2 × 2 m area excavated to about 8.5 m depth. Although postcranial passerine remains are typically challenging to identify, we found several humeral characters particularly useful in discriminating between groups, and identified 89 skeletal elements of passerines. Results At least eight species from eight families are represented, including the Large-billed Crow (Corvus cf. macrorhynchos), the Australasian Bushlark (Mirafra javanica), a friarbird (Philemon sp.), and the Pechora Pipit (Anthus cf. gustavi). Discussion These remains constitute the first sample of fossil passerines described in Wallacea. Two of the taxa no longer occur on Flores today; a large sturnid (cf. Acridotheres) and a grassbird (Megalurus sp.). Palaeoecologically, the songbird assemblage suggests open grassland and tall forests, which is consistent with conditions inferred from the non-passerine fauna at the site. Corvus cf. macrorhynchos, found in the Homo floresiensis-bearing layers, was likely part of a scavenging guild that fed on carcasses of Stegodon florensis insularis alongside vultures (Trigonoceps sp.), giant storks (Leptoptilos robustus), komodo dragons (Varanus komodoensis), and probably H. floresiensis as well. PMID:28828271

Nuisance ecology: do scavenging condors exact foraging costs on pumas in Patagonia?

Science.gov (United States)

Elbroch, L Mark; Wittmer, Heiko U

2013-01-01

Predation risk describes the energetic cost an animal suffers when making a trade off between maximizing energy intake and minimizing threats to its survival. We tested whether Andean condors (Vultur gryphus) influenced the foraging behaviors of a top predator in Patagonia, the puma (Puma concolor), in ways comparable to direct risks of predation for prey to address three questions: 1) Do condors exact a foraging cost on pumas?; 2) If so, do pumas exhibit behaviors indicative of these risks?; and 3) Do pumas display predictable behaviors associated with prey species foraging in risky environments? Using GPS location data, we located 433 kill sites of 9 pumas and quantified their kill rates. Based upon time pumas spent at a carcass, we quantified handling time. Pumas abandoned >10% of edible meat at 133 of 266 large carcasses after a single night, and did so most often in open grasslands where their carcasses were easily detected by condors. Our data suggested that condors exacted foraging costs on pumas by significantly decreasing puma handling times at carcasses, and that pumas increased their kill rates by 50% relative to those reported for North America to compensate for these losses. Finally, we determined that the relative risks of detection and associated harassment by condors, rather than prey densities, explained puma "giving up times" (GUTs) across structurally variable risk classes in the study area, and that, like many prey species, pumas disproportionately hunted in high-risk, high-resource reward areas.

Evolutionary computation in zoology and ecology.

Science.gov (United States)

Boone, Randall B

2017-12-01

Evolutionary computational methods have adopted attributes of natural selection and evolution to solve problems in computer science, engineering, and other fields. The method is growing in use in zoology and ecology. Evolutionary principles may be merged with an agent-based modeling perspective to have individual animals or other agents compete. Four main categories are discussed: genetic algorithms, evolutionary programming, genetic programming, and evolutionary strategies. In evolutionary computation, a population is represented in a way that allows for an objective function to be assessed that is relevant to the problem of interest. The poorest performing members are removed from the population, and remaining members reproduce and may be mutated. The fitness of the members is again assessed, and the cycle continues until a stopping condition is met. Case studies include optimizing: egg shape given different clutch sizes, mate selection, migration of wildebeest, birds, and elk, vulture foraging behavior, algal bloom prediction, and species richness given energy constraints. Other case studies simulate the evolution of species and a means to project shifts in species ranges in response to a changing climate that includes competition and phenotypic plasticity. This introduction concludes by citing other uses of evolutionary computation and a review of the flexibility of the methods. For example, representing species' niche spaces subject to selective pressure allows studies on cladistics, the taxon cycle, neutral versus niche paradigms, fundamental versus realized niches, community structure and order of colonization, invasiveness, and responses to a changing climate.

Late Pleistocene songbirds of Liang Bua (Flores, Indonesia; the first fossil passerine fauna described from Wallacea

Directory of Open Access Journals (Sweden)

Hanneke J.M. Meijer

2017-08-01

Full Text Available Background Passerines (Aves: Passeriformes dominate modern terrestrial bird communities yet their fossil record is limited. Liang Bua is a large cave on the Indonesian island of Flores that preserves Late Pleistocene–Holocene deposits (∼190 ka to present day. Birds are the most diverse faunal group at Liang Bua and are present throughout the stratigraphic sequence. Methods We examined avian remains from the Late Pleistocene deposits of Sector XII, a 2 × 2 m area excavated to about 8.5 m depth. Although postcranial passerine remains are typically challenging to identify, we found several humeral characters particularly useful in discriminating between groups, and identified 89 skeletal elements of passerines. Results At least eight species from eight families are represented, including the Large-billed Crow (Corvus cf. macrorhynchos, the Australasian Bushlark (Mirafra javanica, a friarbird (Philemon sp., and the Pechora Pipit (Anthus cf. gustavi. Discussion These remains constitute the first sample of fossil passerines described in Wallacea. Two of the taxa no longer occur on Flores today; a large sturnid (cf. Acridotheres and a grassbird (Megalurus sp.. Palaeoecologically, the songbird assemblage suggests open grassland and tall forests, which is consistent with conditions inferred from the non-passerine fauna at the site. Corvus cf. macrorhynchos, found in the Homo floresiensis-bearing layers, was likely part of a scavenging guild that fed on carcasses of Stegodon florensis insularis alongside vultures (Trigonoceps sp., giant storks (Leptoptilos robustus, komodo dragons (Varanus komodoensis, and probably H. floresiensis as well.

Antibody Prevalence and Isolation of Viable Toxoplasma gondii from Raptors in the Southeastern USA.

Science.gov (United States)

Love, David; Kwok, Oliver C; Verma, Shiv Kumar; Dubey, Jitender P; Bellah, Jamie

2016-07-01

Raptors are good indicators of the prevalence of Toxoplasma gondii in the environment because they prey on small mammals and birds. These prey species are a major source of infection in domestic cats ( Felis catus ), which shed the environmentally resistant oocysts. We assessed T. gondii infection in 281 opportunistically available raptors at a rehabilitation facility between 2012 and 2014. Antibodies to T. gondii were assayed by a modified agglutination test (cutoff 1:25) and found in serum of 22/71 Red-tailed Hawks ( Buteo jamaicensis ), 25/54 Barred Owls ( Strix varia ), 9/41 Red-shouldered Hawks ( Buteo lineatus ), 13/28 Great Horned Owls ( Bubo virginianus ), 6/20 Broad-winged Hawks ( Buteo platypterus ), 2/16 Eastern Screech Owls (Megascops asio), 12/13 Bald Eagles ( Haliaeetus leucocephalus ), 6/12 Cooper's Hawks ( Accipiter cooperii ), 1/8 Black Vultures ( Coragyps atratus ), and 1/1 Golden Eagle ( Aquila chrysaetos ). Antibodies were not detected in 5 Barn Owls ( Tyto alba ), 3 American Kestrels ( Falco sparverius ), 1 Mississippi Kite ( Ictinia mississippiensis ), and 1 Osprey ( Pandion haliaetus ). Viable T. gondii was isolated from the tissues of 1 antibody-positive Barred Owl and identified as a strain having type II alleles at all 10 loci tested, except one (ToxoDB polymerase chain reaction-restriction fragment length polymorphism genotype 3). Type II strain is the most common strain in the US. Results of this study indicate a high prevalence of T. gondii in some raptor species and the first reported genotyping from a Barred Owl.

Genetic regulation of parasite infection: empirical evidence of the functional significance of an IL4 gene SNP on nematode infections in wild primates

Directory of Open Access Journals (Sweden)

Kappeler Peter M

2011-04-01

Full Text Available Abstract Background Susceptibility to parasite infection affects fitness-related processes, such as mate choice and survival, yet its genetic regulation remains poorly understood. Interleukin-4 (IL4 plays a central role in the humoral immune defence against nematode parasite infections, inducing IgE switch and regulation of worm expulsion from the intestines. The evolutionary and functional significance of single nucleotide polymorphisms (SNPs in IL4-genes is known, yet empirical information on the effect of IL4 SNPs on gastro-intestinal infections is lacking. Using samples from a population of wild red-fronted lemurs (Eulemur fulvus rufus, Primates: Lemuridae, from western Madagascar, we explored the association of IL4-gene promoter polymorphisms with nematode infections and investigated a possible functional role of the IL4 polymorphism on male reproductive success. Results Using sequence analyses of lemur DNA we detected a new SNP in the IL4 gene promoter area. Carriers of the genotype T/T showed higher nematode infection intensities than individuals of genotypes C/T and C/C. Genetic population analyses using data from more than 10 years, suggested higher reproductive success of T/T males than expected. Conclusions Our results suggest a regulatory effect of an IL4 gene promoter polymorphism on the intensity of parasite infections in a natural population of red-fronted lemurs, with a seemingly disadvantageous genotype represented in low frequencies. Long-term population analyses, however, point in the direction of a negative frequency-dependent association, giving a fitness advantage to the rare genotype. Due to low frequencies of the genotype in question conclusive evidence of a functional role of IL4 polymorphism cannot be drawn here; still, we suggest the use of IL4 polymorphism as a new molecular tool for quick assessment of individual genetic constitution with regard to nematode infection intensities, contributing to a better

A reappraisal of azhdarchid pterosaur functional morphology and paleoecology.

Science.gov (United States)

Witton, Mark P; Naish, Darren

2008-05-28

Azhdarchid pterosaurs were among the most widespread and successful of pterosaur clades, but their paleoecology remains controversial. Morphological features common to all azhdarchids include a long, shallow rostrum; elongate, cylindrical cervical vertebrae that formed a long and unusually inflexible neck; and proportionally short wings with an abbreviated fourth phalanx. While azhdarchids have been imagined as vulture-like scavengers, sediment probers, swimmers, waders, aerial predators, or stork-like generalists, most recent authors have regarded them as skim-feeders, trawling their lower jaws through water during flight and seizing aquatic prey from the water's surface. Although apparently widely accepted, the skim-feeding model lacks critical support from anatomy and functional morphology. Azhdarchids lack the many cranial specialisations exhibited by extant skim-feeding birds, most notably the laterally compressed lower jaw and shock absorbing apparatus required for this feeding style. Well-preserved azhdarchid skulls are rare, but their rostra and lower jaws appear to have been sub-triangular in cross-section, and thus dissimilar to those of skim-feeders and sediment probers. Taphonomic data indicates that azhdarchids predominately inhabited inland settings, and azhdarchid morphology indicates that they were poorly suited for all proposed lifestyles bar wading and terrestrial foraging. However, azhdarchid footprints show that their feet were relatively small, padded and slender, and thus not well suited for wading. We argue that azhdarchids were stork- or ground hornbill-like generalists, foraging in diverse environments for small animals and carrion. Proficient terrestrial abilities and a relatively inflexible neck are in agreement with this interpretation.

A reappraisal of azhdarchid pterosaur functional morphology and paleoecology.

Directory of Open Access Journals (Sweden)

Mark P Witton

Full Text Available Azhdarchid pterosaurs were among the most widespread and successful of pterosaur clades, but their paleoecology remains controversial. Morphological features common to all azhdarchids include a long, shallow rostrum; elongate, cylindrical cervical vertebrae that formed a long and unusually inflexible neck; and proportionally short wings with an abbreviated fourth phalanx. While azhdarchids have been imagined as vulture-like scavengers, sediment probers, swimmers, waders, aerial predators, or stork-like generalists, most recent authors have regarded them as skim-feeders, trawling their lower jaws through water during flight and seizing aquatic prey from the water's surface. Although apparently widely accepted, the skim-feeding model lacks critical support from anatomy and functional morphology. Azhdarchids lack the many cranial specialisations exhibited by extant skim-feeding birds, most notably the laterally compressed lower jaw and shock absorbing apparatus required for this feeding style. Well-preserved azhdarchid skulls are rare, but their rostra and lower jaws appear to have been sub-triangular in cross-section, and thus dissimilar to those of skim-feeders and sediment probers. Taphonomic data indicates that azhdarchids predominately inhabited inland settings, and azhdarchid morphology indicates that they were poorly suited for all proposed lifestyles bar wading and terrestrial foraging. However, azhdarchid footprints show that their feet were relatively small, padded and slender, and thus not well suited for wading. We argue that azhdarchids were stork- or ground hornbill-like generalists, foraging in diverse environments for small animals and carrion. Proficient terrestrial abilities and a relatively inflexible neck are in agreement with this interpretation.

Aktualisasi Etika Kepemimpinan Jawa dalam Asthabrata

Directory of Open Access Journals (Sweden)

Pardi Suratno

2009-12-01

Full Text Available Nama Asthabrata sangat populer dalam kehidupan masyarakat Jawa karena sering muncul dalarn pagelaran wayang purwa. Ajaran Asthabrata mendapat apresiasi yang sangat luas oleh masyarakat Indonesia karena memuat ajaran kepemimpinan yang dapat dijadikan aspirasi bagi semua pihak yang sedang dan akan mengabdikan hidupnya bagi bangsa dan negara. Asthabrata merupakan kreativitas pujangga Jawa karena tidak dikcnal dalam Ramayana India (baru muncul dalam Ramayana Kakawin, Semua Asthabrata menampilkan figur pemimpin dalam sosok delapan dewa. Dalam perkernbangan lebih lanjut, budayawan Jawa memilih menampilkan figur pemimpin itu dalam sifat-sifat benda alam, yakni bumi, matahari, bulan, bintang, laut, angin, dan awan. Penampilan figur pernimpin dalam sifat benda-benda alam tersebut lebih netral sebagai pilihan cerdas pujangga Jawa. Abstract: The name of Asthabrata is very popular among Javanese live because of its frequent appearance in the wayang purwa performance. Asthabrata teachings have got a wide appreciation from Indonesian people because it carries leadership teachings which can be an aspiration to everyone who is dedicating and will dedicate their lives to their nation and country. Asthabrata is the creativity of the Javanese men of letters for not discovered in Indian's Ramayana (not until Ramayana Kakawin. All Asthabrata present a leader figure in the characters of eight gods. In further progress, Javanese culture vultures chose to present the leader figure in the characters of natural objects. namely earth, Sun, moon, star, ocean, wind, and cloud. The performance of a leader figure in the characters of the natural objects is more neutral as a smart choice of Javanese man of letters. " Keywords: creativity, Asthabrata, leader

Effects of exotic fish farms on bird communities in lake and marine ecosystems

Science.gov (United States)

Jiménez, Jaime E.; Arriagada, Aldo M.; Fontúrbel, Francisco E.; Camus, Patricio A.; Ávila-Thieme, M. Isidora

2013-08-01

Salmon farming is a widespread activity around the world, also known to promote diverse environmental effects on aquatic ecosystems. However, information regarding the impact of salmon farming on bird assemblages is notably scarce. We hypothesize that salmon farming, by providing food subsidies and physical structures to birds, will change their local community structure. To test this hypothesis, we conducted a seasonal monitoring of bird richness, abundance, and composition at paired salmon pen and control plots in two marine and two lake sites in southern Chile, from fall 2002 to summer 2004. Overall, salmon farming had no significant effects on species richness, but bird abundance was significantly and noticeably higher in salmon pens than in controls. Such aggregation was mainly accounted for by the trophic guilds of omnivores, diving piscivores, carrion eaters, and perching piscivores, but not by invertebrate feeders, herbivores, and surface feeders. Species composition was also significantly and persistently different between salmon pens and controls within each lake or marine locality. The patterns described above remained consistent across environment types and seasons indicating that salmon farming is changing the community structure of birds in both lake and marine habitats by promoting functional and aggregation responses, particularly by favoring species with broader niches. Such local patterns may thus anticipate potential threats from the ongoing expansion of the salmon industry to neighboring areas in Chile, resulting in regional changes of bird communities, toward a less diverse one and dominated by opportunistic, common, and generalist species such as gulls, vultures, and cormorants.

Feed Supplementation with Thermo-Tolerant, Lactic Acid-Producing Bacteria as Probiotics for Swine Husbandry

Energy Technology Data Exchange (ETDEWEB)

Tongpim, Saowanit [Dept. of Microbiology, Fac. of Science, Khon Kaen Univ., Khon Kaen (Thailand); Khammeng, Terdsak [Dept. of Animal Science, Fac. of Agriculture, Khon kaen Univ., Khon kaen (Thailand); Luanthisong, Pirat [Rajamangala Univ., of Technology Isan, Karasin Campus, Karasin (Thailand); Sakai, Kenji [Dept. of Agricultural Chemistry, Fac. of Engineering, Oita Univ., Oita (Japan); Piadang, Nattayana [Office of Atoms for Peace, Bangkok (Thailand)

2006-09-15

This research work had an objective to employ the thermo tolerant, lactic acid-producing bacteria, Bacillus coagulans strain NF{sub 1}7 as feed additive for swine raising. The bacterial isolate NF{sub 1}7, kept in the culture collection of Khon Kaen University that could tolerate high temperature and produce lactic acid, was employed in this experiment. Cell suspension of isolate NF{sub 1}7 was exposed to gamma irradiation at various doses (1-5 KGy). The isolated survivors were screened on the basis of forming larger colonies and clear zones than the parent strain NF{sub 1}7 when grown on Glucose- Yeast extract-Peptone (GYP) containing CaCO{sub 3}. We obtained 55 effective isolates which the isolate L{sub 5}I2 to 14(5), designated as K{sub 1}4 was chosen for further experiments. Isolate K{sub 1}4 together with the parent strain were characterized using morphological, physiological and biochemical tests. They were all identified as Bacillus coagulans. All isolates had optimal growth pH of 6.5 and grew best at 42.50 {sup o}C. The strain K{sub 1}4 could tolerate the temperature as high as 59 {sup o}C and was then employed in the fermentation of food waste that collected from the university cafeteria. It was found that food waste could support growth of Bacillus K{sub 1}4 and produce about 107 to 108 CFU/g food waste within 1-3 days. Nutritional value of the fermented food waste in the form of protein was also increased. When mixing this selected bacterium as feed additive in daily pig rations, it was found that Bacillus K{sub 1}4 helped increase feed conversion ratio and reduced the mortality in weaned piglets. Experiments were also performed with the growing pigs. It showed that Bacillus Sp. K{sub 1}4 significantly improved the feed conversion ratio

Metabolic activation of volatile organic compounds and polycyclic aromatic hydrocarbons coated onto airborne PM{sub 2.5} in isolated human alveolar macrophages; Etude de l'activation metabolique des composes organiques volatils et des hydrocarbures aromatiques polycycliques d'un aerosol anthropogenique par des macrophages alveolaires humains en culture primaire

Energy Technology Data Exchange (ETDEWEB)

Saint-Georges, F.; Mulliez, P. [Hopital Saint Philibert - GHICL-FLM, Service de Pneumologie, 59 - Lomme (France); Saint-Georges, F.; Abbas, I.; Garcon, G.; Billet, S.; Verdin, A.; Shirali, P. [LCE-EA2598, Lab. de Recherche en toxicologie Industrielle et Environnementale - ULCO-MREI, 59 - Dunkerque (France); Gosset, P. [Hopital Saint Vincent, Laboratoire d' Anatomie et de Cytologie Pathologiques - GHICL-FLM, 59 - Lille (France); Courcot, D. [LCE-EA2598, Lab. de Catalyse et Environnement - ULCO-MREI, 59 - Dunkerque (France)

2009-01-15

To contribute to improve the knowledge of the underlying mechanisms of action involved in air pollution Particulate Matter (PM)-induced cytotoxicity, we were interested in the metabolic activation of Volatile Organic Compounds (VOC) and/or Polycyclic Aromatic Hydrocarbons (PAH)-coated onto Dunkerque City's PM{sub 2.5} in human Alveolar Macrophages (AM) isolated from Bronchoalveolar Lavage Fluid (BALF). This in vitro cell lung model is very close to the normal in vivo situation, notably in the characteristics that AM display in terms of gene expression of phase I and phase II-metabolizing enzymes. The bronchoscopic examinations and BAL procedures were carried out without any complications. The exposure of AM, during 24, 48 or 72 h, to increasing concentrations of the collected aerosol induced significant variations of the activities of the extracellular lactate dehydrogenase and the mitochondrial dehydrogenase. The lethal concentrations at 10% and 50% were 14.93 and 74.63 {mu}g/mL for AM, respectively, and indicated the relatively higher sensibility of such target lung cells. VOC and/or PAH-coated at low levels onto the surface of the particulate fraction significantly induced gene expression of cytochrome P450 (GYP) 1A1, CYP2E1, NADPH Quinone oxido-reductase (NQO)-1) and Glutathione S-Transferase (GST)P1 and M3, versus controls, suggesting thereby the formation of biologically reactive metabolites. Moreover, these results suggested the role of physical vector of carbonaceous core of PM, which can, therefore, increase both the penetration and the retention of attached-VOC into the cells, thereby enabling them to exert a more durable induction. Hence, we concluded that the metabolic activation of the very low doses of VOC and/or PAH-coated onto Dunkerque City's PM{sub 2.5} is one of the underlying mechanisms of action closely involved in its cytotoxicity in isolated human AM in culture. (author)

Soaring migratory birds avoid wind farm in the Isthmus of Tehuantepec, southern Mexico.

Science.gov (United States)

Villegas-Patraca, Rafael; Cabrera-Cruz, Sergio A; Herrera-Alsina, Leonel

2014-01-01

The number of wind farms operating in the Isthmus of Tehuantepec, southern Mexico, has rapidly increased in recent years; yet, this region serves as a major migration route for various soaring birds, including Turkey Vultures (Cathartes aura) and Swainson's Hawks (Buteo swainsoni). We analyzed the flight trajectories of soaring migrant birds passing the La Venta II wind farm during the two migratory seasons of 2011, to determine whether an avoidance pattern existed or not. We recorded three polar coordinates for the flight path of migrating soaring birds that were detected using marine radar, plotted the flight trajectories and estimated the number of trajectories that intersected the polygon defined by the wind turbines of La Venta II. Finally, we estimated the actual number of intersections per kilometer and compared this value with the null distributions obtained by running 10,000 simulations of our datasets. The observed number of intersections per kilometer fell within or beyond the lower end of the null distributions in the five models proposed for the fall season and in three of the four models proposed for the spring season. Flight trajectories had a non-random distribution around La Venta II, suggesting a strong avoidance pattern during fall and a possible avoidance pattern during spring. We suggest that a nearby ridgeline plays an important role in this pattern, an issue that may be incorporated into strategies to minimize the potential negative impacts of future wind farms on soaring birds. Studies evaluating these issues in the Isthmus of Tehuantepec have not been previously published; hence this work contributes important baseline information about the movement patterns of soaring birds and its relationship to wind farms in the region.

A pilot golden eagle population study in the Altamont Pass Wind Resource Area, California

Energy Technology Data Exchange (ETDEWEB)

Hunt, G. [California Univ., Santa Cruz, CA (United States). Predatory Bird Research Group

1995-05-01

Orloff and Flannery (1992) estimated that several hundred reports are annually killed by turbine collisions, wire strikes, and electrocutions at the Altamont Pass Wind Resource Area (WRA). The most common fatalities were those of red-tailed hawks (Buteo jamaicensis), American kestrels (Falco sparvatius), and golden eagles (Aquila chrysaetos), with lesser numbers of turkey vultures (Cathartes aura), common ravens (Corvus corax), bam owls (Tyto alba), and others. Among the species of raptors killed at Altamont Pass, the one whose local population is most likely to be impacted is the golden eagle. Besides its being less abundant than the others, the breeding and recruitment rates of golden eagles are naturally slow, increasing their susceptibility to decline as a result of mortality influences. The golden eagle is a species afforded special federal protection because of its inclusion within the Bald Eagle Protection Act as amended in 1963. There are no provisions within the Act which would allow the killing ``taking`` of golden eagles by WRA structures. This report details the results of field studies conducted during 19941. The primary purpose of the investigation is to lay the groundwork for determining whether or not turbine strikes and other hazards related to energy at Altamont Pass may be expected to affect golden eagles on a population basis. We also seek an understanding of the physical and biotic circumstances which attract golden eagles to the WRA within the context of the surrounding landscape and the conditions under which they are killed by wind turbines. Such knowledge may suggest turbine-related or habitat modifications that would result in a lower incidence of eagle mortality.

Clinical utility of a complete diagnostic protocol for the ocular evaluation of free-living raptors.

Science.gov (United States)

Labelle, Amber L; Whittington, Julia K; Breaux, Carrie B; Labelle, Philippe; Mitchell, Mark A; Zarfoss, Mitzi K; Schmidt, Stephanie A; Hamor, Ralph E

2012-01-01

  To describe a protocol for the examination of free-living raptors and report the ophthalmic examination findings of seven raptor species native to central Illinois, namely the barred owl, Cooper's hawk, eastern screech owl, great horned owl, American kestrel, red-tailed hawk, and turkey vulture and to determine if the findings relative to visual prognosis affected eligibility for future release.   Seventy-nine free-living raptors.   Under manual restraint, complete ophthalmic examination including slit-lamp biomicroscopy and indirect funduscopy, applanation tonometry, rebound tonometry, ocular morphometrics, B-mode ultrasound, and electroretinography (ERG) were performed on each bird. Histopathology of enucleated globes was performed after euthanasia or death in selected cases.   The examination protocol was easily performed using manual restraint alone on all birds. Ocular lesions were detected in 48.1% of birds, with 47.3% affected unilaterally and 52.6% affected bilaterally. Ocular lesions were considered to be vision threatening in 29.0% of the unilaterally affected birds and 29.0% of the bilaterally affected birds. The most common case outcomes were discharge from hospital to rehabilitation facility (45.6%) followed by euthanasia (43.0%). The presence of an ocular lesion or a vision-threatening ocular lesion was not significantly associated with outcome. Reference ranges are reported for B-mode ultrasound, ocular morphometrics, and horizontal corneal diameter in all species.   Complete ophthalmic examination can be supplemented by the use of ocular morphometrics, ultrasound, and ERG in the manually restrained raptor. These advanced diagnostic techniques may be useful in developing more objective criteria for evaluating eligibility for release following rehabilitation of free-living birds of prey. © 2011 American College of Veterinary Ophthalmologists.

К ФАУНЕ И РАСПРОСТРАНЕНИЮ ВОДНЫХ ЖЕСТКОКРЫЛЫХ (INSECTA, COLEOPTERA ЮЖНОГО КАЗАХСТАНА

Directory of Open Access Journals (Sweden)

I. I. Temreshev

2016-12-01

Full Text Available Всего в результате проведенных работ было уточнено распространение на юге Казахстана для 121 вида водных жуков, относящихся к 49 родам из 15 семейств 2 подотрядов. Из них 2 вида – Platambus sogdianus Jakovlev, 1897 (Dytiscidae и Sphaeridium marginatum Fabricius, 1787 (Hydrophilidae указываются как новые для Казахстана, 4 вида - Berosus bispina Reiche & Saulcy, 1856, B. fulvus Kuvert, 1888 (Hydrophilidae, Helophorus lapponicus C.G. Tomson (Helophoridae, 1854, Ochthebius minabensis Ferro, 1983 (Hydraenidae отмечены как новые для юга страны. Для Ochthebius meridionalis Rey, 1885 (Hydraenidae, ранее отмеченного в Жамбылской области, установлено распространение на территории Южно-Казахстанской и Кызыл-Ординской областей.

Repeated conservation threats across the Americas: High levels of blood and bone lead in the Andean Condor widen the problem to a continental scale.

Science.gov (United States)

Wiemeyer, Guillermo M; Pérez, Miguel A; Torres Bianchini, Laura; Sampietro, Luciano; Bravo, Guillermo F; Jácome, N Luis; Astore, Vanesa; Lambertucci, Sergio A

2017-01-01

Wildlife lead exposure is an increasing conservation threat that is being widely investigated. However, for some areas of the world (e.g., South America) and certain species, research on this subject is still scarce or only local information is available. We analyzed the extent and intensity of lead exposure for a widely distributed threatened species, the Andean Condor (Vultur gryphus). We conducted the study at two different scales: 1) sampling of birds received for rehabilitation or necropsy in Argentina, and 2) bibliographic review and extensive survey considering exposure event for the species' distribution in South America. Wild condors from Argentina (n = 76) presented high lead levels consistent with both recent and previous exposure (up to 104 μg/dL blood level, mean 15.47 ± 21.21 μg/dL and up to 148.20 ppm bone level, mean 23.08 ± 31.39 ppm). In contrast, captive bred individuals -not exposed to lead contamination- had much lower lead levels (mean blood level 5.63 ± 3.08 μg/dL, and mean bone level 2.76 ± 3.06 ppm). Condors were exposed to lead throughout their entire range in continental Argentina, which represents almost sixty percent (>4000 km) of their geographical distribution. We also present evidence of lead exposure events in Chile, Ecuador, and Peru. Lead poisoning is a widespread major conservation threat for the Andean Condor, and probably other sympatric carnivores from South America. The high number and wide range of Andean Condors with lead values complement the results for the California Condor and other scavengers in North America suggesting lead poisoning is a continental threat. Urgent actions are needed to reduce this poison in the wild. Copyright © 2016 Elsevier Ltd. All rights reserved.

Effects of attitudes and demography on public support for endangered species conservation.

Science.gov (United States)

Liordos, Vasilios; Kontsiotis, Vasileios J; Anastasiadou, Magdalini; Karavasias, Efstathios

2017-10-01

It is critical for managers to understand how attitudes and demography affect public's preferences for species protection for designing successful conservation projects. 1080 adults in Greece were asked to rate pictures of 12 endangered species on aesthetic and negativistic attitudes, and intention to support their conservation. Factor analysis identified a group of animals for which respondents indicated high levels of support for their conservation (red deer, loggerhead sea turtle, brown bear, common pheasant, European ground squirrel, glossy ibis) and a group of animals for which respondents indicated low levels of support (black vulture, great white shark, fire-bellied toad, western barbastelle, Cretan tube web spider, Milos viper). The species that received the highest support were also rated as the most attractive and safest, excluding the fearsome brown bear. Structural models revealed that aesthetic, moralistic and negativistic attitudes were the stronger predictors of support. Aesthetic and moralistic attitudes were positively, and negativistic attitudes negatively, correlated with support for conservation in both groups. Consumptive users scored lower in aesthetics and were less supportive of protection in the high support group, while nonconsumptive users showed the opposite trend. Respondents residing in urban areas deemed animals of high support more attractive and less fearsome and were more supportive of conservation than rural residents in both groups. Females of higher education viewed animals of low support as fearsome, however they supported their conservation. Our study identified popular species that can be used as flagship species to facilitate the implementation of conservation projects. The results of this study could also be used to design a communication and outreach campaign to raise awareness about the ecosystem value of less attractive species. Copyright © 2017 Elsevier B.V. All rights reserved.

Risks to Birds Traded for African Traditional Medicine: A Quantitative Assessment

Science.gov (United States)

Williams, Vivienne L.; Cunningham, Anthony B.; Kemp, Alan C.; Bruyns, Robin K.

2014-01-01

Few regional or continent-wide assessments of bird use for traditional medicine have been attempted anywhere in the world. Africa has the highest known diversity of bird species used for this purpose. This study assesses the vulnerability of 354 bird species used for traditional medicine in 25 African countries, from 205 genera, 70 families, and 25 orders. The orders most represented were Passeriformes (107 species), Falconiformes (45 species), and Coraciiformes (24 species), and the families Accipitridae (37 species), Ardeidae (15 species), and Bucerotidae (12 species). The Barn owl (Tyto alba) was the most widely sold species (seven countries). The similarity of avifaunal orders traded is high (analogous to “morphospecies”, and using Sørensen's index), which suggests opportunities for a common understanding of cultural factors driving demand. The highest similarity was between bird orders sold in markets of Benin vs. Burkina Faso (90%), but even bird orders sold in two geographically separated countries (Benin vs. South Africa and Nigeria vs. South Africa) were 87% and 81% similar, respectively. Rabinowitz's “7 forms of rarity” model, used to group species according to commonness or rarity, indicated that 24% of traded bird species are very common, locally abundant in several habitats, and occur over a large geographical area, but 10% are rare, occur in low numbers in specific habitats, and over a small geographical area. The order with the highest proportion of rare species was the Musophagiformes. An analysis of species mass (as a proxy for size) indicated that large and/or conspicuous species tend to be targeted by harvesters for the traditional medicine trade. Furthermore, based on cluster analyses for species groups of similar risk, vultures, hornbills, and other large avifauna, such as bustards, are most threatened by selective harvesting and should be prioritised for conservation action. PMID:25162700

Resource selection by the California condor (Gymnogyps californianus relative to terrestrial-based habitats and meteorological conditions.

Directory of Open Access Journals (Sweden)

James W Rivers

Full Text Available Condors and vultures are distinct from most other terrestrial birds because they use extensive soaring flight for their daily movements. Therefore, assessing resource selection by these avian scavengers requires quantifying the availability of terrestrial-based habitats, as well as meteorological variables that influence atmospheric conditions necessary for soaring. In this study, we undertook the first quantitative assessment of habitat- and meteorological-based resource selection in the endangered California condor (Gymnogyps californianus within its California range and across the annual cycle. We found that condor use of terrestrial areas did not change markedly within the annual cycle, and that condor use was greatest for habitats where food resources and potential predators could be detected and where terrain was amenable for taking off from the ground in flight (e.g., sparse habitats, coastal areas. Condors originating from different release sites differed in their use of habitat, but this was likely due in part to variation in habitats surrounding release sites. Meteorological conditions were linked to condor use of ecological subregions, with thermal height, thermal velocity, and wind speed having both positive (selection and negative (avoidance effects on condor use in different areas. We found little evidence of systematic effects between individual characteristics (i.e., sex, age, breeding status or components of the species management program (i.e., release site, rearing method relative to meteorological conditions. Our findings indicate that habitat type and meteorological conditions can interact in complex ways to influence condor resource selection across landscapes, which is noteworthy given the extent of anthropogenic stressors that may impact condor populations (e.g., lead poisoning, wind energy development. Additional studies will be valuable to assess small-scale condor movements in light of these stressors to help minimize

Soaring migratory birds avoid wind farm in the Isthmus of Tehuantepec, southern Mexico.

Directory of Open Access Journals (Sweden)

Rafael Villegas-Patraca

Full Text Available The number of wind farms operating in the Isthmus of Tehuantepec, southern Mexico, has rapidly increased in recent years; yet, this region serves as a major migration route for various soaring birds, including Turkey Vultures (Cathartes aura and Swainson's Hawks (Buteo swainsoni. We analyzed the flight trajectories of soaring migrant birds passing the La Venta II wind farm during the two migratory seasons of 2011, to determine whether an avoidance pattern existed or not. We recorded three polar coordinates for the flight path of migrating soaring birds that were detected using marine radar, plotted the flight trajectories and estimated the number of trajectories that intersected the polygon defined by the wind turbines of La Venta II. Finally, we estimated the actual number of intersections per kilometer and compared this value with the null distributions obtained by running 10,000 simulations of our datasets. The observed number of intersections per kilometer fell within or beyond the lower end of the null distributions in the five models proposed for the fall season and in three of the four models proposed for the spring season. Flight trajectories had a non-random distribution around La Venta II, suggesting a strong avoidance pattern during fall and a possible avoidance pattern during spring. We suggest that a nearby ridgeline plays an important role in this pattern, an issue that may be incorporated into strategies to minimize the potential negative impacts of future wind farms on soaring birds. Studies evaluating these issues in the Isthmus of Tehuantepec have not been previously published; hence this work contributes important baseline information about the movement patterns of soaring birds and its relationship to wind farms in the region.

Use of a sealant to prevent prolonged air leaks after lung resection: a prospective randomized study.

Science.gov (United States)

Lequaglie, Cosimo; Giudice, Gabriella; Marasco, Rita; Morte, Aniello Della; Gallo, Massimiliano

2012-10-08

Pulmonary air leaks are common complications of lung resection and result in prolonged hospital stays and increased costs. The purpose of this study was to investigate whether, compared with standard care, the use of a synthetic polyethylene glycol matrix (CoSeal®) could reduce air leaks detected by means of a digital chest drain system (DigiVent™), in patients undergoing lung resection (sutures and/or staples alone). Patients who intraoperatively showed moderate or severe air leaks (evaluated by water submersion tests) were intraoperatively randomized to receive just sutures/staples (control group) or sutures/staples plus CoSeal® (sealant group). Differences among the groups in terms of air leaks, prolonged air leaks, time to chest tube removal, length of hospital stay and related costs were assessed. In total, 216 lung resection patients completed the study. Nineteen patients (18.1%) in the control group and 12 (10.8%) patients in the sealant group experienced postoperative air leaks, while a prolonged air leak was recorded in 11.4% (n=12) of patients in the control group and 2.7% (n=3) of patients in the sealant group. The difference in the incidence of air leaks and prolonged air leaks between the two groups was statistically significant (p=0.0002 and p=0.0013). The mean length of hospital stay was significantly shorter in the sealant group (4 days) than the control group (8 days) (p=0.0001). We also observed lower costs in the sealant group than the control group. The use of CoSeal® may decrease the occurrence and severity of postoperative air leaks after lung resection and is associated with shorter hospital stay. Not registered. The trial was approved by the Institutional Review Board of the IRCCS-CROB Basilicata Regional Cancer Institute, Rionero in Vulture, Italy.

Soaring Migratory Birds Avoid Wind Farm in the Isthmus of Tehuantepec, Southern Mexico

Science.gov (United States)

Villegas-Patraca, Rafael; Cabrera-Cruz, Sergio A.; Herrera-Alsina, Leonel

2014-01-01

The number of wind farms operating in the Isthmus of Tehuantepec, southern Mexico, has rapidly increased in recent years; yet, this region serves as a major migration route for various soaring birds, including Turkey Vultures (Cathartes aura) and Swainson's Hawks (Buteo swainsoni). We analyzed the flight trajectories of soaring migrant birds passing the La Venta II wind farm during the two migratory seasons of 2011, to determine whether an avoidance pattern existed or not. We recorded three polar coordinates for the flight path of migrating soaring birds that were detected using marine radar, plotted the flight trajectories and estimated the number of trajectories that intersected the polygon defined by the wind turbines of La Venta II. Finally, we estimated the actual number of intersections per kilometer and compared this value with the null distributions obtained by running 10,000 simulations of our datasets. The observed number of intersections per kilometer fell within or beyond the lower end of the null distributions in the five models proposed for the fall season and in three of the four models proposed for the spring season. Flight trajectories had a non-random distribution around La Venta II, suggesting a strong avoidance pattern during fall and a possible avoidance pattern during spring. We suggest that a nearby ridgeline plays an important role in this pattern, an issue that may be incorporated into strategies to minimize the potential negative impacts of future wind farms on soaring birds. Studies evaluating these issues in the Isthmus of Tehuantepec have not been previously published; hence this work contributes important baseline information about the movement patterns of soaring birds and its relationship to wind farms in the region. PMID:24647442

Stop and Smell the Pollen: The Role of Olfaction and Vision of the Oriental Honey Buzzard in Identifying Food.

Directory of Open Access Journals (Sweden)

Shu-Yi Yang

Full Text Available The importance of olfaction for various avian behaviors has become increasingly evident. So far, the use of olfaction for food detection among raptors has only been demonstrated for Cathartes vultures. The Oriental honey buzzard (Pernis orientalis is a resident and migrant in Taiwan and regularly forages in apiaries. One of its foods in apiaries is yellow pollen dough, a softball-sized mixture of pollen, soybeans, and sugar that beekeepers provide as a supplementary food for bees. Given that pollen dough is not similar to any naturally occurring food, we hypothesized that buzzards identify the dough's nutritious contents using olfaction, perhaps in combination with vision. Using a series of choice experiments in which individuals could choose between two doughs, we showed that (1 buzzards almost unerringly chose pollen-containing over pollen lacking doughs when otherwise the doughs were identical in size, shape, and yellow color; (2 buzzards always preferred yellow over black or green doughs if both doughs contained pollen; (3 buzzards still preferred pollen-containing over pollen-lacking doughs when both doughs were black, but at a lower rate than in (1. We statistically excluded the possible influences of the doughs' relative brightness or of repeat visits by the same individuals. Our experiments thus suggest the use of a 'multi-modal foraging strategy' among buzzards whereby olfaction and vision are likely to be both used in identifying food at close distances. We also estimated the olfactory receptor gene repertoire size in the buzzard's genome which is almost five times as large as that of three other raptor species. Therefore, olfaction is likely of far greater ecological importance to this species than to other raptor species. We suggest that olfaction should be considered in the design of behavioral and genetic studies to better understand the use of multiple senses in avian behaviors.

Risks to birds traded for African traditional medicine: a quantitative assessment.

Directory of Open Access Journals (Sweden)

Vivienne L Williams

Full Text Available Few regional or continent-wide assessments of bird use for traditional medicine have been attempted anywhere in the world. Africa has the highest known diversity of bird species used for this purpose. This study assesses the vulnerability of 354 bird species used for traditional medicine in 25 African countries, from 205 genera, 70 families, and 25 orders. The orders most represented were Passeriformes (107 species, Falconiformes (45 species, and Coraciiformes (24 species, and the families Accipitridae (37 species, Ardeidae (15 species, and Bucerotidae (12 species. The Barn owl (Tyto alba was the most widely sold species (seven countries. The similarity of avifaunal orders traded is high (analogous to "morphospecies", and using Sørensen's index, which suggests opportunities for a common understanding of cultural factors driving demand. The highest similarity was between bird orders sold in markets of Benin vs. Burkina Faso (90%, but even bird orders sold in two geographically separated countries (Benin vs. South Africa and Nigeria vs. South Africa were 87% and 81% similar, respectively. Rabinowitz's "7 forms of rarity" model, used to group species according to commonness or rarity, indicated that 24% of traded bird species are very common, locally abundant in several habitats, and occur over a large geographical area, but 10% are rare, occur in low numbers in specific habitats, and over a small geographical area. The order with the highest proportion of rare species was the Musophagiformes. An analysis of species mass (as a proxy for size indicated that large and/or conspicuous species tend to be targeted by harvesters for the traditional medicine trade. Furthermore, based on cluster analyses for species groups of similar risk, vultures, hornbills, and other large avifauna, such as bustards, are most threatened by selective harvesting and should be prioritised for conservation action.

When David beats Goliath: the advantage of large size in interspecific aggressive contests declines over evolutionary time.

Directory of Open Access Journals (Sweden)

Paul R Martin

Full Text Available Body size has long been recognized to play a key role in shaping species interactions. For example, while small species thrive in a diversity of environments, they typically lose aggressive contests for resources with larger species. However, numerous examples exist of smaller species dominating larger species during aggressive interactions, suggesting that the evolution of traits can allow species to overcome the competitive disadvantage of small size. If these traits accumulate as lineages diverge, then the advantage of large size in interspecific aggressive interactions should decline with increased evolutionary distance. We tested this hypothesis using data on the outcomes of 23,362 aggressive interactions among 246 bird species pairs involving vultures at carcasses, hummingbirds at nectar sources, and antbirds and woodcreepers at army ant swarms. We found the advantage of large size declined as species became more evolutionarily divergent, and smaller species were more likely to dominate aggressive contests when interacting with more distantly-related species. These results appear to be caused by both the evolution of traits in smaller species that enhanced their abilities in aggressive contests, and the evolution of traits in larger species that were adaptive for other functions, but compromised their abilities to compete aggressively. Specific traits that may provide advantages to small species in aggressive interactions included well-developed leg musculature and talons, enhanced flight acceleration and maneuverability, novel fighting behaviors, and traits associated with aggression, such as testosterone and muscle development. Traits that may have hindered larger species in aggressive interactions included the evolution of morphologies for tree trunk foraging that compromised performance in aggressive contests away from trunks, and the evolution of migration. Overall, our results suggest that fundamental trade-offs, such as those

Why are some animal populations unaffected or positively affected by roads?

Science.gov (United States)

Rytwinski, Trina; Fahrig, Lenore

2013-11-01

In reviews on effects of roads on animal population abundance we found that most effects are negative; however, there are also many neutral and positive responses [Fahrig and Rytwinski (Ecol Soc 14:21, 2009; Rytwinski and Fahrig (Biol Conserv 147:87-98, 2012)]. Here we use an individual-based simulation model to: (1) confirm predictions from the existing literature of the combinations of species traits and behavioural responses to roads that lead to negative effects of roads on animal population abundance, and (2) improve prediction of the combinations of species traits and behavioural responses to roads that lead to neutral and positive effects of roads on animal population abundance. Simulations represented a typical situation in which road mitigation is contemplated, i.e. rural landscapes containing a relatively low density (up to 1.86 km/km(2)) of high-traffic roads, with continuous habitat between the roads. In these landscapes, the simulations predict that populations of species with small territories and movement ranges, and high reproductive rates, i.e. many small mammals and birds, should not be reduced by roads. Contrary to previous suggestions, the results also predict that populations of species that obtain a resource from roads (e.g. vultures) do not increase with increasing road density. In addition, our simulations support the predation release hypothesis for positive road effects on prey (both small- and large-bodied prey), whereby abundance of a prey species increased with increasing road density due to reduced predation by generalist road-affected predators. The simulations also predict an optimal road density for the large-bodied prey species if it avoids roads or traffic emissions. Overall, the simulation results suggest that in rural landscapes containing high-traffic roads, there are many species for which road mitigation may not be necessary; mitigation efforts should be tailored to the species that show negative population responses to roads.

Use of a sealant to prevent prolonged air leaks after lung resection: a prospective randomized study

Directory of Open Access Journals (Sweden)

Lequaglie Cosimo

2012-10-01

Full Text Available Abstract Background Pulmonary air leaks are common complications of lung resection and result in prolonged hospital stays and increased costs. The purpose of this study was to investigate whether, compared with standard care, the use of a synthetic polyethylene glycol matrix (CoSeal® could reduce air leaks detected by means of a digital chest drain system (DigiVent™, in patients undergoing lung resection (sutures and/or staples alone. Methods Patients who intraoperatively showed moderate or severe air leaks (evaluated by water submersion tests were intraoperatively randomized to receive just sutures/staples (control group or sutures/staples plus CoSeal® (sealant group. Differences among the groups in terms of air leaks, prolonged air leaks, time to chest tube removal, length of hospital stay and related costs were assessed. Results In total, 216 lung resection patients completed the study. Nineteen patients (18.1% in the control group and 12 (10.8% patients in the sealant group experienced postoperative air leaks, while a prolonged air leak was recorded in 11.4% (n = 12 of patients in the control group and 2.7% (n = 3 of patients in the sealant group. The difference in the incidence of air leaks and prolonged air leaks between the two groups was statistically significant (p = 0.0002 and p = 0.0013. The mean length of hospital stay was significantly shorter in the sealant group (4 days than the control group (8 days (p = 0.0001. We also observed lower costs in the sealant group than the control group. Conclusion The use of CoSeal® may decrease the occurrence and severity of postoperative air leaks after lung resection and is associated with shorter hospital stay. Trial registration Not registered. The trial was approved by the Institutional Review Board of the IRCCS-CROB Basilicata Regional Cancer Institute, Rionero in Vulture, Italy.

Implementing ecopharmacovigilance (EPV) from a pharmacy perspective: A focus on non-steroidal anti-inflammatory drugs.

Science.gov (United States)

Wang, Jun; He, Bingshu; Yan, Dan; Hu, Xiamin

2017-12-15

Environmental experts have made great efforts to control pharmaceutical pollution. However, the control of emerged environmental problems caused by medicines should draw more attention of pharmacy and pharmacovigilance researchers. Ecopharmacovigilance (EPV) as a kind of pharmacovigilance for the environment is recognized worldwide as crucial to minimize the environmental risk of pharmaceutical pollutants. But continuing to treat the pollution of pharmaceuticals as a group of substances instead of targeting individual pharmaceuticals on a prioritized basis will lead to a significant waste of resources. Considering vulture population decline caused by non-steroidal anti-inflammatory drugs (NSAIDs) residues, we presented a global-scale analysis of 139 reports of NSAIDs occurrence across 29 countries, in order to provide a specific context for implementing EPV. We found a heavy regional bias toward research in Europe, Asia and America. The top 5 most frequently studied NSAIDs included ibuprofen, diclofenac, naproxen, acetaminophen and ketoprofen. The profile of NSAIDs was dominated by acetaminophen in wastewater influents and effluents. Ibuprofen was the most abundant NSAID in surface water. Only 9 NSAIDs were reported in groundwater samples. And majority of NSAIDs were detected in solid matrices at below 1μg/g except for ketoprofen, diclofenac and ibuprofen. From a pharmacy perspective, we get some implication and propose some management practice options for EPV implementation. These include: Further popularizing and applying the concept of EPV, together with developing relevant regulatory guidance, is necessary; More attention should be paid to how to implement EPV for the pollution control of older established drugs; Triggering "a dynamic watch-list mechanism" in conjunction with "source control"; Implementing targeted sewage treatment technologies and strengthening multidisciplinary collaboration; Pharmaceutical levels in aquatic organisms as biological

Screening of plant species as ground cover on uranium mill tailings

International Nuclear Information System (INIS)

Venu Babu, P.; Eapen, S.

2012-01-01

residual mill tailings apart from containing residual radionuclides do have the capacity to support good plant growth. Several species like Rhynchosia minima, Rhynchosia, Thysanolaena maxima, Mucuna pruriens, Desmanthus virgatus, Desmodium gangeticum, Clitoria tematea, Chrysopogon fulvus and Indigofera trita were found to be quite suitable for planting on mill tailings as ground cover while a few others that registered poor growth and/or biomass perhaps can be grown in combination with other species. On the contrary a few species viz., Bothriochloa pertusa, Cenchrus ciliaris, Panicum antidotale and Pennisetum caudatum were found to be unsuitable as they could not survive in mill tailings. A combination of several plant species tested in this study coupled with a few agronomic practices can be tried on mill tailings in Jaduguda as an appropriate vegetative cover. (author)

Effects of Roads on Animal Abundance: an Empirical Review and Synthesis

Directory of Open Access Journals (Sweden)

Lenore Fahrig

2009-06-01

Full Text Available We attempted a complete review of the empirical literature on effects of roads and traffic on animal abundance and distribution. We found 79 studies, with results for 131 species and 30 species groups. Overall, the number of documented negative effects of roads on animal abundance outnumbered the number of positive effects by a factor of 5; 114 responses were negative, 22 were positive, and 56 showed no effect. Amphibians and reptiles tended to show negative effects. Birds showed mainly negative or no effects, with a few positive effects for some small birds and for vultures. Small mammals generally showed either positive effects or no effect, mid-sized mammals showed either negative effects or no effect, and large mammals showed predominantly negative effects. We synthesized this information, along with information on species attributes, to develop a set of predictions of the conditions that lead to negative or positive effects or no effect of roads on animal abundance. Four species types are predicted to respond negatively to roads: (i species that are attracted to roads and are unable to avoid individual cars; (ii species with large movement ranges, low reproductive rates, and low natural densities; and (iii and iv small animals whose populations are not limited by road-affected predators and either (a avoid habitat near roads due to traffic disturbance or (b show no avoidance of roads or traffic disturbance and are unable to avoid oncoming cars. Two species types are predicted to respond positively to roads: (i species that are attracted to roads for an important resource (e.g., food and are able to avoid oncoming cars, and (ii species that do not avoid traffic disturbance but do avoid roads, and whose main predators show negative population-level responses to roads. Other conditions lead to weak or non-existent effects of roads and traffic on animal abundance. We identify areas where further research is needed, but we also argue that the

Tradition et innovations esthétiques dans la nouvelle yéménite contemporaine Tradition and aesthetic innovations in contemporary Yemeni short stories

Directory of Open Access Journals (Sweden)

Géraldine Jenvrin

2008-04-01

Full Text Available Le nouveau recueil de Mu/hammad ‘Abd al-Wakîl Jâzim témoigne d’une transformation capitale dans la littérature yéménite contemporaine :  le passage d’une forme expérimentale en rupture avec les règles de la nouvelle traditionnelle et avec la réalité yéménite, à une autre forme plus accomplie dans laquelle les principes traditionnels de la nouvelle sont ici associés sans complexe aux formes renouvelées du genre.  La nouvelle intitulée Le maître des vautours, présente, dans une structure narrative traditionnelle, un conte fantastique moderne qui mêle réalisme, symbolisme et poésie, et dans lequel l’auteur traite à sa manière les thèmes littéraires contemporains de la dualité du rêve et de la réalité, du désenchantement et de l’enfermement perpétuel.  C’est notamment en s’inspirant de la langue, des pratiques orales, des croyances et de l’imaginaire populaire, que l’auteur, soucieux de donner un ancrage au texte dans la réalité yéménite, transfigure cette expérience existentielle moderne.The latest collection of short stories by Mu/hammad 'Abd al-Wakîl signals a major shift in contemporary Yemeni literature: from an experimental form, breaking away from both traditional short story conventions and Yemeni reality, to another, more accomplished form, unabashedly mixing traditional short story principles with renewed genre forms. The short story entitled The Vulture Master presents us, from within a traditional narrative structure, with a modern fantasy tale blending in realism, symbolism and poetry, and where the writer deals in his own way with such contemporary literary themes as disenchantment, perpetual captivity, and the duality of dream and reality. Drawing his inspiration from language itself, oral practices, beliefs and popular imagery, the writer, seeking to set his tale firmly in Yemeni reality, manages to transfigure this modern existential experiment.

Structure of the lithosphere-asthenosphere and volcanism in the Tyrrhenian Sea and surroundings

International Nuclear Information System (INIS)

Panza, G.F.; Aoudia, A.; Pontevivo, A.; Sarao, A.; Peccerillo, A.

2003-01-01

The Italian peninsula and the Tyrrhenian Sea are some of the geologically most complex regions on Earth. Such a complexity is expressed by large lateral and vertical variations of the physical properties as inferred from the lithosphere-asthenosphere structure and by the wide varieties of Polio-Quaternary magmatic rocks ranging from teacloth to calcalkaline to sodium- and potassium-alkaline and ultra- alkaline compositions. The integration of geophysical, petrological and geochemical data allows us to recognise various sectors in the Tyrrhenian Sea and surrounding areas and compare different volcanic complexes in order to better constrain the regional geodynamics. A thin crust overlying a soft mantle (10% of partial melting) is typical of the back arc volcanism of the central Tyrrhenian Sea (Magnaghi, Vavilov and Marsili) where tholeiitic rocks dominate. Similar lithosphere-asthenosphere structure is observed for Ustica, Vulture and Etna volcanoes where the geochemical signatures could be related to the contamination of the side intraplate mantle by material coming from the either ancient or active roll-back. The lithosphere-asthenosphere structure and geochemical-isotopic composition do not change significantly when we move to the Stromboli-Campanian volcanoes, where we identify a well developed low-velocity layer, about 10 km thick, below a thin lid, overlain by a thin continental crust. The geochemical signature of the nearby Ischia volcano is characteristic of the Campanian sector and the relative lithosphere-asthenosphere structure may likely represent a transition to the back arc volcanism sector acting in the central Tyrrhenian. The difference in terms of structure beneath Stromboli and the nearby Vulcano and Lipari is confirmed by different geochemical signatures. The affinity between Vulcano, Lipari and Etna could be explained by their common position along the Tindari-Letoianni-Malta fault zone. A low velocity mantle wedge, just below the Moho, is present

Systematic Raptor Monitoring as conservation tool: 12 year results in the light of landscape changes in Dadia-Lefkimi-Soufli National Park

Directory of Open Access Journals (Sweden)

Konstantinos Poirazidis

2017-10-01

Full Text Available Dadia-Lefkimi-Soufli National Park forms part of the Natura 2000 network in a region of Greece and represents one of the most diverse landscapes for raptors (birds of prey breeding in Europe. It is adjacent to Bulgaria and Turkey and is a renowned biodiversity hotspot. WWF Greece established a Systematic Raptor Monitoring scheme in this area in 2001.This study summarises the results of the first 12 years of monitoring in the National Park. Overall, 25 to 27 raptor species were recorded by pooling data, of which20 species reproduced in the National Park. Raptors with continuous presence in the National Park exhibited stable, species-specific inter-annual variation. An average of 348±15.4 raptor territories were distributed throughout the National Park for all species. The Common buzzard (Buteo buteo and the Short-toed eagle (Circaetus gallicus were the most common species year-round, followed by the Lesser-spotted eagle (Clanga pomarina and Booted eagle (Aquila pennata. The Long-legged buzzard (Buteo rufinus, Honey buzzard (Pernis apivorus and Egyptian vulture (Neophron percnopterus exhibited a noticeable drop in population numbers over the study period. A significant new entry was the re-appearance of the White-tailed eagle (Haliaeetus albicilla, which was recorded breeding again in the region after a 21-year absence. Species trends, along with their ecological traits, are discussed with respect to landscape changes in Dadia NP and minimum viable population and territory thresholds are proposed to outline essential conservation issues. Although a multi-year balance of the total number of occupied territories for all species was recorded, the number of common species increased compared to specialist species which had smaller, declining populations. The abandoning of traditional livestock farming, which induces an increase in closed-canopy forest coverage, might have led to the decline of the Lesser-spotted eagle, Long-legged buzzard and Honey

Fossil bird eggs from the Pliocene of Laetoli, Tanzania: Their taxonomic and paleoecological relationships

Science.gov (United States)

Harrison, Terry

2005-04-01

Recent paleontological investigations at the Pliocene site of Laetoli and at neighboring localities on the Eyasi Plateau of northern Tanzania have led to the recovery of a sizable collection of fossil bird eggs. The material comes from the Upper Laetolil Beds, dated at ˜3.6-3.8 Ma, and the Lower Laetolil Beds, dated at 3.8 Ma to older than 4.3 Ma. The preservation of relatively complete eggs (other than those of ratites) is an extremely rare occurrence in the fossil record, and Laetoli is the only locality in Africa that has produced such well-preserved eggs. Deposition of carbonatite air-fall tuffs led to the rapid burial of the eggs sub-aerially, and they were then preserved in paleosols that were geochemically conducive to their preservation. The collection of fossil eggs from Laetoli can be assigned to at least five different species of ground-nesting birds, including two or three species of francolins, a species of guineafowl, and a larger bird of uncertain taxonomic status about the size of a bustard. Most of the eggs can be assigned to a large species of Francolinus, similar in size to the extant F. afer and F. leucoscepus. A smaller species of francolin, about the size of Francolinus coqui or F. sephaena, is also represented, but is less common. A single egg may represent an even smaller species of francolin, about the size of Francolinus lathami or F. nahani, but its attribution to Francolinus is less certain. The evidence of at least two species of Francolinus at Laetoli indicates that francolins were already taxonomically diverse in East Africa by the mid-Pliocene. Three eggs are similar in their overall dimensions and morphology to the living Numida meleagris, the helmeted guineafowl. An avian community including at least one small species of francolin, a larger francolin, and a guineafowl (as well as ostriches and a vulture) implies that the paleoecology at Laetoli was likely to have been open woodland, bushland, savanna or grassland. However

Polyphyly of the hawk genera Leucopternis and Buteogallus (Aves, Accipitridae): multiple habitat shifts during the Neotropical buteonine diversification.

Science.gov (United States)

Amaral, Fabio S Raposo do; Miller, Matthew J; Silveira, Luís Fábio; Bermingham, Eldredge; Wajntal, Anita

2006-02-07

The family Accipitridae (hawks, eagles and Old World vultures) represents a large radiation of predatory birds with an almost global distribution, although most species of this family occur in the Neotropics. Despite great morphological and ecological diversity, the evolutionary relationships in the family have been poorly explored at all taxonomic levels. Using sequences from four mitochondrial genes (12S, ATP8, ATP6, and ND6), we reconstructed the phylogeny of the Neotropical forest hawk genus Leucopternis and most of the allied genera of Neotropical buteonines. Our goals were to infer the evolutionary relationships among species of Leucopternis, estimate their relationships to other buteonine genera, evaluate the phylogenetic significance of the white and black plumage patterns common to most Leucopternis species, and assess general patterns of diversification of the group with respect to species' affiliations with Neotropical regions and habitats. Our molecular phylogeny for the genus Leucopternis and its allies disagrees sharply with traditional taxonomic arrangements for the group, and we present new hypotheses of relationships for a number of species. The mtDNA phylogenetic trees derived from analysis of the combined data posit a polyphyletic relationship among species of Leucopternis, Buteogallus and Buteo. Three highly supported clades containing Leucopternis species were recovered in our phylogenetic reconstructions. The first clade consisted of the sister pairs L. lacernulatus and Buteogallus meridionalis, and Buteogallus urubitinga and Harpyhaliaetus coronatus, in addition to L. schistaceus and L. plumbeus. The second clade included the sister pair Leucopternis albicollis and L. occidentalis as well as L. polionotus. The third lineage comprised the sister pair L. melanops and L. kuhli, in addition to L. semiplumbeus and Buteo buteo. According to our results, the white and black plumage patterns have evolved at least twice in the group. Furthermore

Polyphyly of the hawk genera Leucopternis and Buteogallus (Aves, Accipitridae: multiple habitat shifts during the Neotropical buteonine diversification

Directory of Open Access Journals (Sweden)

Bermingham Eldredge

2006-02-01

Full Text Available Abstract Background The family Accipitridae (hawks, eagles and Old World vultures represents a large radiation of predatory birds with an almost global distribution, although most species of this family occur in the Neotropics. Despite great morphological and ecological diversity, the evolutionary relationships in the family have been poorly explored at all taxonomic levels. Using sequences from four mitochondrial genes (12S, ATP8, ATP6, and ND6, we reconstructed the phylogeny of the Neotropical forest hawk genus Leucopternis and most of the allied genera of Neotropical buteonines. Our goals were to infer the evolutionary relationships among species of Leucopternis, estimate their relationships to other buteonine genera, evaluate the phylogenetic significance of the white and black plumage patterns common to most Leucopternis species, and assess general patterns of diversification of the group with respect to species' affiliations with Neotropical regions and habitats. Results Our molecular phylogeny for the genus Leucopternis and its allies disagrees sharply with traditional taxonomic arrangements for the group, and we present new hypotheses of relationships for a number of species. The mtDNA phylogenetic trees derived from analysis of the combined data posit a polyphyletic relationship among species of Leucopternis, Buteogallus and Buteo. Three highly supported clades containing Leucopternis species were recovered in our phylogenetic reconstructions. The first clade consisted of the sister pairs L. lacernulatus and Buteogallus meridionalis, and Buteogallus urubitinga and Harpyhaliaetus coronatus, in addition to L. schistaceus and L. plumbeus. The second clade included the sister pair Leucopternis albicollis and L. occidentalis as well as L. polionotus. The third lineage comprised the sister pair L. melanops and L. kuhli, in addition to L. semiplumbeus and Buteo buteo. According to our results, the white and black plumage patterns have evolved

Plasma B-esterase activities in European raptors.

Science.gov (United States)

Roy, Claudie; Grolleau, Gérard; Chamoulaud, Serge; Rivière, Jean-Louis

2005-01-01

B-esterases are serine hydrolases composed of cholinesterases, including acetylcholinesterase (AChE) and butyrylcholinesterase (BChE), and carboxylesterase (CbE). These esterases, found in blood plasma, are inhibited by organophosphorus (OP) and carbamate (CB) insecticides and can be used as nondestructive biomarkers of exposure to anticholinesterase insecticides. Furthermore, B-esterases are involved in detoxification of these insecticides. In order to establish the level of these enzymes and to have reference values for their normal activities, total plasma cholinesterase (ChE), AChE and BChE activities, and plasma CbE activity were determined in 729 European raptors representing 20 species, four families, and two orders. The diurnal families of the Falconiforme order were represented by Accipitridae and Falconidae and the nocturnal families of the Strigiforme order by Tytonidae and Strigidae. Intraspecies differences in cholinesterase activities according to sex and/or age were investigated in buzzards (Buteo buteo), sparrowhawks (Accipiter nisus), kestrels (Falco tinnunculus), barn owls (Tyto alba), and tawny owls (Strix aluco). Sex-related differences affecting ChE and AChE activities were observed in young kestrels (2-3-mo-old) and age-related differences in kestrels (ChE and AChE), sparrowhawks (AChE), and tawny owls (ChE, AChE, and BChE). The interspecies analysis yielded a negative correlation between ChE activity and body mass taking into account the relative contribution of AChE and BChE to ChE activity, with the exception of the honey buzzard (Pernis apivorus). The lowest ChE activities were found in the two largest species, Bonelli's eagle (Hieraaetus fasciatus) and Egyptian vulture (Neophron percnopterus) belonging to the Accipitridae family. The highest ChE activities were found in the relatively small species belonging to the Tytonidae and Strigidae families and in honey buzzard of the Accipitridae family. Species of the Accipitridae, Tytonidae, and

Reproductive success of South American terns (Sterna hirundinacea from Cardos Islands, Florianópolis, SC, Brazil

Directory of Open Access Journals (Sweden)

Hélio A.A. Fracasso

2012-06-01

Full Text Available Sterna hirundinacea (Lesson, 1831 is a migratory seabird that breeds in the Pacific Coast (from Peru to Chile and along the Atlantic coast of South America from Espírito Santo (Brazil to Terra del Fuego (Argentina. This paper describes the reproductive success of South American Terns on Cardos Island, Florianopolis, Brazil in the breeding seasons of 2003, 2005 and 2006. The colony was formed in mid-May in 2003 and early April in other years, with the total number of nests ranging from 1,852 in 2006 to 2,486 in 2005. Hatching success was estimated at 76.39% in 2006, 62.73% in 2003 and 41.1% in 2005, the lowest value that could be attributed to predation by hawks Caracara plancus, lizards Tupinambis merianae and black vulture Coragyps atratus. The chicks hatched in July in 2003, and in June 2005 and 2006, and fledging success was 50.94%, 35.96 and 53.47% respectively. Cardos Island has been constantly used as a breeding site by South American Terns, and therefore represents an important area for conservation of this species. This success could be attributed to low pressure of Kelp gulls (Larus dominicanus, the main predator of seabirds along the Brazilian coast.Sterna hirundinacea (Lesson, 1831 é uma ave migratória que nidifica na costa do Pacífico (do Peru ao Chile e ao longo do Atlântico Sul do Espírito Santo (Brasil até a Terra do Fogo (Argentina. Este trabalho descreve o sucesso reprodutivo do trinta-réis do bico-vermelho na ilha dos Cardos, Florianópolis, Brasil, durante as temporadas reprodutivas de 2003, 2005 e 2006. A formação da colônia ocorreu em maio de 2003 e inicio de abril nos outros anos, com um total de ninhos variando entre 1.852 em 2006 a 2.486 em 2005. O sucesso de incubação foi estimado em 76,39% (2006, 62,73% (2003 e 41,1% em 2005, sendo que os menores valores puderam ser atribuídos a predação dos gaviões Caracara plancus, lagartos Tupinambis merianae e urubus Coragyps atratus. As primeiras eclosões foram

Reprodução de Nycticorax nycticorax (Linnaeus no litoral de Santa Catarina, Brasil Reproduction of the Nycticorax nycticorax (Linnaeus in the Santa Catarina's coast, Brazil

Directory of Open Access Journals (Sweden)

Joaquim O. Branco

2005-06-01

.71 ± 2.64 to 35.92 ± 3.47 cm³ and the largest frequencies of nestlings in November, culminating the abandonment of the colony in the middle of January. They were identified seven items in the chick regurgitations of the nestlings, and the sea fish represented 44.4% of the total weight. The main predator in the colony was the black vulture, that it acted on the eggs in the beginning of the season and the nestlings in the end.

Occurrence and origin of Escherichia coli in water and sediments at two public swimming beaches at Lake of the Ozarks State Park, Camden County, Missouri, 2011-13

Science.gov (United States)

Wilson, Jordan L.; Schumacher, John G.; Burken, Joel G.

2014-01-01

(samples collected above the shoreline) than in samples collected in ankle-deep water below the shoreline, significantly larger in the left and middle areas of the beach than the right area, and substantially larger than similar studies at E. coli- contaminated beaches on Lake Erie in Ohio. Concentrations of E. coli in the water column also were significantly larger after resuspension of sediments. Results of MST indicate a predominance of waterfowl-associated markers in nearshore sediments at Grand Glaize Beach consistent with frequent observations of goose and vulture fecal matter in sediment, especially on the left and middle areas of the beach. The combination of spatial and temporal sampling and MST indicate that an important source of E. coli contamination at Grand Glaize Beach during 2012 was E. coli released into the water column by bathers resuspending E. coli-contaminated sediments, especially during high-use days early in the recreational season.

Avaliação da predação de Podocnemis expansa e Podocnemis unifilis (Testudines, Podocnemididae no rio Javaés, Tocantins Evaluation of predation in Podocnemis expansa and Podocnemis unifilis (Testudines, Podocnemididae in the Javaés River, Tocantins

Directory of Open Access Journals (Sweden)

Giovanni Salera Junior

2009-03-01

Full Text Available Podocnemis expansa e P. unifilis são animais de vida longa, com uma demorada maturação sexual, o que influencia uma baixa taxa de substituição de indivíduos. Suas populações são caracterizadas por uma pequena mortalidade dos animais adultos, mas alta taxa de mortalidade de filhotes e embriões. Sendo a predação natural de ninhos e filhotes um dos fatores mais importantes do baixo sucesso de eclosão dessas espécies. No rio Javaés, os ovos e recém-eclodidos podem ser predados por uma grande diversidade de animais: dentre as aves, urubus (Coragyps atratus e Cathartes aura, carcará (Polyborus plancus, jaburu (Jabiru mycteria; lagartos (Tupinambis teguixin e mamíferos de pequeno porte, coati (Nasua nasua e cachorro-do-mato (Cerdocyon thous. Do total anual de desovas de P. unifilis em média 65,98% são predadas, sendo 41,68% de forma total e 24,30% parcialmente. Enquanto que apenas 5,31% das ninhadas de P. expansa são sempre parcialmente predadas. Dentre os predadores aquáticos existem diversos peixes, principalmente piranhas (Serrasalmus nattereri e jacarés (Melanosuchus niger e Caimam crocodilus. Os predadores das fêmeas de P. unifilis são: jacaré-açu (Melanosuchus niger, onça-pintada (Panthera onca e onça-parda (Puma concolor. Enquanto que as fêmeas de P. expansa em postura, somente são predadas por P. onca. As fêmeas de P. unifilis em postura são predadas num total médio de 3,93% anualmente, enquanto que para P. expansa a média anual é 5,66% das fêmeas.Podocnemis expansa and P. unifilis long lived with late sexual maturation, which influences a low replacement rate of individuals. Their populations are characterized by low adults mortality, but high mortality of embryos and hatchlings. The natural nest predation is an important factor for hatchling success. In Javaés River, the eggs and hatchlings can be predated by a large number of animals such as birds, vultures (Coragyps atratus and Cathartes aura, carcar

Abyssnian pea (Lathyrus schaeferi Kosterin pro Pisum abyssinicum A. Br. – a problematic taxon

Directory of Open Access Journals (Sweden)

O. E. Kosterin

2017-12-01

have taken place under cultivation, in Yemen or Afar Depression. A representative of P. sativum subsp. elatius was revealed, the F1 hybrids of which with the Abyssinian pea as a seed parent had fully fertile pollen. P. abyssinicum × P. fulvum crosses provide the best hybrid seed outcome among remote crosses conducted, so that P. abyssinicum can be used as a ‘bridge’ for gene introgression from P. fulvum to P. sativum. Rather a high level of reproductive isolation of the Abyssinian pea from other representatives of the genus conforms the biological species concept, however the disposition of P. abyssinicum accessions as a small cluster among accessions of P. sativum subsp. elatius on molecular phylogeny reconstructions violates the phylogenetic species concept. Most authors assume the Abyssinian pea as a species, Pisum abyssinicum, some as a subspecies, P. sativum subsp. abyssinicum (A. Br. Berger. Perhaps it would be most correct to consider it as a hybridogenic species. Because of the recent subsuming of the genus Pisum L. into the genus Lathyrus and with respect to the existing name Lathyrus abyssinicus A. Br. (a synonym of L. sativus L., the Abyssinian pea was given a new name Lathyrus schaeferi (A. Braun Kosterin (Vavilov Journal of Genetics and Breeding 21: 167. 2017 (pro Pisum abyssinicum A. Braun, in honour of Hanno Schaefer, who substantiated the revision of tribe Fabeae by molecular reconstruction of its phylogeny. The paper here translated contained new combinations of Lathyrus sectio Pisum (L. Kosterin (Vavilov Journal of Genetics and Breeding 21: 168. 2017 and Lathurus fulvus (Sibthrop et Smith Kosterin (Vavilov Journal of Genetics and Breeding 21: 168. 2017.

Aksu-Zhabagly Nature Reserve's 90-anniversary

Directory of Open Access Journals (Sweden)

Anatoliy F. Kovshar

2016-05-01

Full Text Available The Aksu-Zhabagly nature reserve is located in West Tien Shan in Kazakhstan, on the border of three countries – Kazakhstan, Kyrgyzstan and Uzbekistan (70°18'-57' E and 42°08'-30' N, with an area of 1281 km2; its length is 53 km from the most western to the most eastern point and 41 km from the most southern to the most northern point. It occupies the western limit of the Talasskiy Alatau ridge and its north-western spurs: Zhabaglytau mountains, Alatau, Bugultor, Aksutau and Ugam ridges. In the neighbouring Karatau ridge there is a palaeontological site with an area of 2.2 km2 with deposits of flora and fauna of the Jurassic period. The absolute heights above sea level are 1300–4200 m. The relief is alpine – deep canyons with steep slopes. The middle mountain zone (1300–2000 m is occupied by meadow-steppe formations with juniper sparse forests (Juniperus semiglobosa, J. seravschanica; subalpine meadows (2000–3000 m are alternated by creeping juniper thickets (Juniperus turkestanica and rocky outcrops; the alpine zone (higher than 3000 m is dominated by rocks and snowfields, and glaciers above 3500 m. The nature reserve's flora constitutes almost half of all West Tien Shan's flora and counts 1737 species, including: 235 species of fungi, 64 lichens, 63 species each of algae and mosses, as well as 1312 species of higher plants. Among those, 200 species are medicinal and 57 species are listed in the Red Data Books of Kazakhstan, Uzbekistan and Kyrgyzstan. The vertebrates fauna includes 320 species: mammals – 52 species, birds – 247 (130 of them are nesting, reptiles and amphibians – 14, fishes – 7 species. Animals inhabiting the territory include argali (Ovis ammon karelini, mountain goat (Capra sibirica, bear (Ursus arctos isabellinus, snow leopart (Uncia uncia, Turkestan lynx (Lynx lynx isabellinus; birds – bearded vulture (Gypaёtus barbatus, Himalayan snowcock (Tetraogallus himalayensis, chukar (Alectoris chukar, blue

Sediment-palaeosol successions in Calabria and Sardinia suggest spatially differentiated palaeo-vegetation patterns in southern Italy during the Last Glacial period

Science.gov (United States)

Sauer, Daniela; Zucca, Claudio; Al-Sharif, Riyad; Zwanzig, Lisa; Madrau, Salvatore; Andreucci, Stefano; Pascucci, Vincenzo; Kadereit, Annette; Scarciglia, Fabio; Brückner, Helmut

2016-04-01

Several lakes on the southern Italian peninsula provide valuable palaeoenvironmental archives of the Last Glacial period. These archives include, e.g., the long high-resolution record from varved lake sediments of Lago Grande di Monticchio, the bigger one of two maar lakes situated on top of Mt. Vulture. Its pollen record indicates (1) temperate deciduous forest during MIS5.2-MIS5.1 (St. Germain 2); (2) frequent vegetation fluctuations, then Artemisia steppe during MIS5.1-MIS4; (3) alternations between open steppe (stadials) and wooded steppe (interstadials) during MIS3; and (4) open steppe during MIS2 (Last Glacial Maximum). However, only few palaeosol records of this period have been reported from southern Italy in the literature so far. Such records would allow for gaining insight also into spatial patterns of the vegetation cover during this period that should have formed, e.g., according to relief, elevation, and continentality gradient (related to the much lower coastline during the last glacial period). So far, we have studied three sediment-palaeosol successions in southern Italy, two in the Calabria region, and one in north-western Sardinia. All of them have developed in alluvial fan deposits resting on littoral sediments of the Last Interglacial period (MIS 5). The southernmost succession studied is located near Lazzaro (south of Reggio di Calabria). It is exposed in an alluvial fan overlying the MIS5.5 terrace. Due to strong tectonic uplift (1.3 m ka-1) the alluvial fan has been dissected by the same creek which previously had built it up. Therefore, its internal structure is exposed, exhibiting a detailed sediment-palaeosol sequence. The palaeosols are mainly characterized by accumulation of soil organic matter (SOM), bioturbation and secondary carbonates. They represent Chernozem- and Phaeozem-like soils that most likely formed under steppe to forest steppe. SOM of the two uppermost Lazzaro palaeosols was 14C-dated to 26.8-28.8 ka cal BP and 28