WorldWideScience

Sample records for vulgaris hildenborough sulfate

  1. Post-Translational Modifications of Desulfovibrio vulgaris Hildenborough Sulfate Reduction Pathway Proteins

    Energy Technology Data Exchange (ETDEWEB)

    Gaucher, S.P.; Redding, A.M.; Mukhopadhyay, A.; Keasling, J.D.; Singh, A.K.

    2008-03-01

    Recent developments in shotgun proteomics have enabled high-throughput studies of a variety of microorganisms at a proteome level and provide experimental validation for predicted open reading frames in the corresponding genome. More importantly, advances in mass spectrometric data analysis now allow mining of large proteomics data sets for the presence of post-translational modifications(PTMs). Although PTMs are a critical aspectof cellular activity, such information eludes cell-wide studies conducted at the transcript level. Here, we analyze several mass spectrometric data sets acquired using two-dimensional liquid chromatography tandem mass spectrometry, 2D-LC/MS/MS, for the sulfate reducing bacterium, Desulfovibrio vulgaris Hildenborough. Our searches of the raw spectra led us to discover several post-translationally modified peptides in D. vulgaris. Of these, several peptides containing a lysine with a +42 Da modification were found reproducibly across all data sets. Both acetylation and trimethylation have the same nominal +42 Da mass, and are therefore candidates for this modification. Several spectra were identified having markers for trimethylation, while one is consistent with an acetylation. Surprisingly, these modified peptides predominantly mapped to proteins involved in sulfate respiration. Other highly expressed proteins in D. vulgaris, such as enzymes involved in electron transport and other central metabolic processes, did not contain this modification. Decoy database searches were used to control for random spectrum/sequence matches. Additional validation for these modifications was provided by alternate workflows, for example, two-dimensional gel electrophoresis followed by mass spectrometry analysis of the dissimilatory sulfite reductase gamma-subunit(DsrC) protein. MS data for DsrC in this alternate workflow also contained the +42 Da modification at the same loci. Furthermore, the DsrC homologue in another sulfate reducing bacterium

  2. Distinctive Oxidative Stress Responses to Hydrogen Peroxide in Sulfate Reducing Bacteria Desulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Aifen; He, Zhili; Redding, A.M.; Mukhopadhyay, Aindrila; Hemme, Christopher L.; Joachimiak, Marcin P.; Bender, Kelly S.; Keasling, Jay D.; Stahl, David A.; Fields, Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Wall, Judy D.; Zhou, Jizhong

    2009-01-01

    Response of Desulfovibrio vulgaris Hildenborough to hydrogen peroxide (H2O2, 1 mM) was investigated with transcriptomic, proteomic and genetic approaches. Microarray data demonstrated that gene expression was extensively affected by H2O2 with the response peaking at 120 min after H2O2 treatment. Genes affected include those involved with energy production, sulfate reduction, ribosomal structure and translation, H2O2 scavenging, posttranslational modification and DNA repair as evidenced by gene coexpression networks generated via a random matrix-theory based approach. Data from this study support the hypothesis that both PerR and Fur play important roles in H2O2-induced oxidative stress response. First, both PerR and Fur regulon genes were significantly up-regulated. Second, predicted PerR regulon genes ahpC and rbr2 were derepressedin Delta PerR and Delta Fur mutants and induction of neither gene was observed in both Delta PerR and Delta Fur when challenged with peroxide, suggesting possible overlap of these regulons. Third, both Delta PerR and Delta Fur appeared to be more tolerant of H2O2 as measured by optical density. Forth, proteomics data suggested de-repression of Fur during the oxidative stress response. In terms of the intracellular enzymatic H2O2 scavenging, gene expression data suggested that Rdl and Rbr2 may play major roles in the detoxification of H2O2. In addition, induction of thioredoxin reductase and thioredoxin appeared to be independent of PerR and Fur. Considering all data together, D. vulgaris employed a distinctive stress resistance mechanism to defend against increased cellular H2O2, and the temporal gene expression changes were consistent with the slowdown of cell growth at the onset of oxidative stress.

  3. Toward a rigorous network of protein-protein interactions of the model sulfate reducer Desulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Chhabra, S.R.; Joachimiak, M.P.; Petzold, C.J.; Zane, G.M.; Price, M.N.; Gaucher, S.; Reveco, S.A.; Fok, V.; Johanson, A.R.; Batth, T.S.; Singer, M.; Chandonia, J.M.; Joyner, D.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Singh, A.K.; Keasling, J.D.

    2011-05-01

    Protein–protein interactions offer an insight into cellular processes beyond what may be obtained by the quantitative functional genomics tools of proteomics and transcriptomics. The aforementioned tools have been extensively applied to study E. coli and other aerobes and more recently to study the stress response behavior of Desulfovibrio 5 vulgaris Hildenborough, a model anaerobe and sulfate reducer. In this paper we present the first attempt to identify protein-protein interactions in an obligate anaerobic bacterium. We used suicide vector-assisted chromosomal modification of 12 open reading frames encoded by this sulfate reducer to append an eight amino acid affinity tag to the carboxy-terminus of the chosen proteins. Three biological replicates of the 10 ‘pulled-down’ proteins were separated and analyzed using liquid chromatography-mass spectrometry. Replicate agreement ranged between 35% and 69%. An interaction network among 12 bait and 90 prey proteins was reconstructed based on 134 bait-prey interactions computationally identified to be of high confidence. We discuss the biological significance of several unique metabolic features of D. vulgaris revealed by this protein-protein interaction data 15 and protein modifications that were observed. These include the distinct role of the putative carbon monoxide-induced hydrogenase, unique electron transfer routes associated with different oxidoreductases, and the possible role of methylation in regulating sulfate reduction.

  4. Towards a rigorous network of protein-protein interactions of the model sulfate reducer Desulfovibrio vulgaris Hildenborough.

    Directory of Open Access Journals (Sweden)

    Swapnil R Chhabra

    Full Text Available Protein-protein interactions offer an insight into cellular processes beyond what may be obtained by the quantitative functional genomics tools of proteomics and transcriptomics. The aforementioned tools have been extensively applied to study Escherichia coli and other aerobes and more recently to study the stress response behavior of Desulfovibrio vulgaris Hildenborough, a model obligate anaerobe and sulfate reducer and the subject of this study. Here we carried out affinity purification followed by mass spectrometry to reconstruct an interaction network among 12 chromosomally encoded bait and 90 prey proteins based on 134 bait-prey interactions identified to be of high confidence. Protein-protein interaction data are often plagued by the lack of adequate controls and replication analyses necessary to assess confidence in the results, including identification of potential false positives. We addressed these issues through the use of biological replication, exponentially modified protein abundance indices, results from an experimental negative control, and a statistical test to assign confidence to each putative interacting pair applicable to small interaction data studies. We discuss the biological significance of metabolic features of D. vulgaris revealed by these protein-protein interaction data and the observed protein modifications. These include the distinct role of the putative carbon monoxide-induced hydrogenase, unique electron transfer routes associated with different oxidoreductases, and the possible role of methylation in regulating sulfate reduction.

  5. Effect of the deletion of qmoABC and the promoter distal gene encoding a hypothetical protein on sulfate-reduction in Desulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Zane, Grant M.; Yen, Huei-chi Bill; Wall, Judy D.

    2010-03-18

    The pathway of electrons required for the reduction of sulfate in sulfate-reducing bacteria (SRB) is not yet fully characterized. In order to determine the role of a transmembrane protein complex suggested to be involved in this process, a deletion of Desulfovibrio vulgaris Hildenborough was created by marker exchange mutagenesis that eliminated four genes putatively encoding the QmoABC complex and a hypothetical protein (DVU0851). The Qmo complex (quinone-interacting membrane-bound oxidoreductase) is proposed to be responsible for transporting electrons to the dissimilatory adenosine-5?phosphosulfate (APS) reductase in SRB. In support of the predicted role of this complex, the deletion mutant was unable to grow using sulfate as its sole electron acceptor with a range of electron donors. To explore a possible role for the hypothetical protein in sulfate reduction, a second mutant was constructed that had lost only the gene that codes for DVU0851. The second constructed mutant grew with sulfate as the sole electron acceptor; however, there was a lag that was not present with the wild-type or complemented strain. Neither deletion strain was significantly impaired for growth with sulfite or thiosulfate as terminal electron acceptor. Complementation of the D(qmoABC-DVU0851) mutant with all four genes or only the qmoABC genes restored its ability to grow by sulfate respiration. These results confirmed the prediction that the Qmo complex is in the electron pathway for sulfate-reduction and revealed that no other transmembrane complex could compensate when Qmo was lacking.

  6. Oxygen-dependent growth of the obligate anaerobe Desulfovibrio vulgaris Hildenborough.

    OpenAIRE

    Johnson, M S; Zhulin, I B; Gapuzan, M E; Taylor, B L

    1997-01-01

    Desulfovibrio vulgaris Hildenborough, a sulfate-reducing bacterium classified as an obligate anaerobe, swam to a preferred oxygen concentration of 0.02 to 0.04% (0.24 to 0.48 microM), a level which also supported growth. Oxygen concentrations of 0.08% and higher arrested growth. We propose that in zones of transition from an oxic to an anoxic environment, D. vulgaris protects anoxic microenvironments from intrusion of oxygen.

  7. Identification and Characterization of the Major Porin of Desulfovibrio vulgaris Hildenborough

    Science.gov (United States)

    Zeng, Lucy; Wooton, Etsuko; Stahl, David A.

    2017-01-01

    ABSTRACT Due in large part to their ability to facilitate the diffusion of a diverse range of solutes across the outer membrane (OM) of Gram-negative bacteria, the porins represent one of the most prominent and important bacterial membrane protein superfamilies. Notably, for the Gram-negative bacterium Desulfovibrio vulgaris Hildenborough, a model organism for studies of sulfate-reducing bacteria, no genes for porins have been identified or proposed in its annotated genome. Results from initial biochemical studies suggested that the product of the DVU0799 gene, which is one of the most abundant proteins of the D. vulgaris Hildenborough OM and purified as a homotrimeric complex, was a strong porin candidate. To investigate this possibility, this protein was further characterized biochemically and biophysically. Structural analyses via electron microscopy of negatively stained protein identified trimeric particles with stain-filled depressions and structural modeling suggested a β-barrel structure for the monomer, motifs common among the known porins. Functional studies were performed in which crude OM preparations or purified DVU0799 was reconstituted into proteoliposomes and the proteoliposomes were examined for permeability against a series of test solutes. The results obtained establish DVU0799 to be a pore-forming protein with permeability properties similar to those observed for classical bacterial porins, such as those of Escherichia coli. Taken together, these findings identify this highly abundant OM protein to be the major porin of D. vulgaris Hildenborough. Classification of DVU0799 in this model organism expands the database of functionally characterized porins and may also extend the range over which sequence analysis strategies can be used to identify porins in other bacterial genomes. IMPORTANCE Porins are membrane proteins that form transmembrane pores for the passive transport of small molecules across the outer membranes of Gram-negative bacteria

  8. Unintended Laboratory-Driven Evolution Reveals Genetic Requirements for Biofilm Formation by Desulfovibrio vulgaris Hildenborough

    Directory of Open Access Journals (Sweden)

    Kara B. De León

    2017-10-01

    Full Text Available Biofilms of sulfate-reducing bacteria (SRB are of particular interest as members of this group are culprits in corrosion of industrial metal and concrete pipelines as well as being key players in subsurface metal cycling. Yet the mechanism of biofilm formation by these bacteria has not been determined. Here we show that two supposedly identical wild-type cultures of the SRB Desulfovibrio vulgaris Hildenborough maintained in different laboratories have diverged in biofilm formation. From genome resequencing and subsequent mutant analyses, we discovered that a single nucleotide change within DVU1017, the ABC transporter of a type I secretion system (T1SS, was sufficient to eliminate biofilm formation in D. vulgaris Hildenborough. Two T1SS cargo proteins were identified as likely biofilm structural proteins, and the presence of at least one (with either being sufficient was shown to be required for biofilm formation. Antibodies specific to these biofilm structural proteins confirmed that DVU1017, and thus the T1SS, is essential for localization of these adhesion proteins on the cell surface. We propose that DVU1017 is a member of the lapB category of microbial surface proteins because of its phenotypic similarity to the adhesin export system described for biofilm formation in the environmental pseudomonads. These findings have led to the identification of two functions required for biofilm formation in D. vulgaris Hildenborough and focus attention on the importance of monitoring laboratory-driven evolution, as phenotypes as fundamental as biofilm formation can be altered.

  9. Salt Stress in Desulfovibrio vulgaris Hildenborough: An integratedgenomics approach

    Energy Technology Data Exchange (ETDEWEB)

    Mukhopadhyay, Aindrila; He, Zhili; Alm, Eric J.; Arkin, Adam P.; Baidoo, Edward E.; Borglin, Sharon C.; Chen, Wenqiong; Hazen, Terry C.; He, Qiang; Holman, Hoi-Ying; Huang, Katherine; Huang, Rick; Hoyner,Dominique C.; Katz, Natalie; Keller, Martin; Oeller, Paul; Redding,Alyssa; Sun, Jun; Wall, Judy; Wei, Jing; Yang, Zamin; Yen, Huei-Che; Zhou, Jizhong; Keasling Jay D.

    2005-12-08

    The ability of Desulfovibrio vulgaris Hildenborough to reduce, and therefore contain, toxic and radioactive metal waste has made all factors that affect the physiology of this organism of great interest. Increased salinity is an important and frequent fluctuation faced by D. vulgaris in its natural habitat. In liquid culture, exposure to excess salt resulted in striking elongation of D. vulgaris cells. Using data from transcriptomics, proteomics, metabolite assays, phospholipid fatty acid profiling, and electron microscopy, we used a systems approach to explore the effects of excess NaCl on D. vulgaris. In this study we demonstrated that import of osmoprotectants, such as glycine betaine and ectoine, is the primary mechanism used by D. vulgaris to counter hyperionic stress. Several efflux systems were also highly up-regulated, as was the ATP synthesis pathway. Increases in the levels of both RNA and DNA helicases suggested that salt stress affected the stability of nucleic acid base pairing. An overall increase in the level of branched fatty acids indicated that there were changes in cell wall fluidity. The immediate response to salt stress included up-regulation of chemotaxis genes, although flagellar biosynthesis was down-regulated. Other down-regulated systems included lactate uptake permeases and ABC transport systems. The results of an extensive NaCl stress analysis were compared with microarray data from a KCl stress analysis, and unlike many other bacteria, D. vulgaris responded similarly to the two stresses. Integration of data from multiple methods allowed us to develop a conceptual model for the salt stress response in D. vulgaris that can be compared to those in other microorganisms.

  10. Global Analysis of Heat Shock Response in Desulfovibrio vulgaris Hildenborough.

    Energy Technology Data Exchange (ETDEWEB)

    Chhabra, S.R.; He, Q.; Huang, K.H.; Gaucher, S.P.; Alm, E.J.; He,Z.; Hadi, M.Z.; Hazen, T.C.; Wall, J.D.; Zhou, J.; Arkin, A.P.; Singh, A.K.

    2005-09-16

    Desulfovibrio vulgaris Hildenborough belongs to a class ofsulfate-reducing bacteria (SRB) and is found ubiquitously in nature.Given the importance of SRB-mediated reduction for bioremediation ofmetal ion contaminants, ongoing research on D. vulgaris has been in thedirection of elucidating regulatory mechanisms for this organism under avariety of stress conditions. This work presents a global view of thisorganism's response to elevated growth temperature using whole-celltranscriptomics and proteomics tools. Transcriptional response (1.7-foldchange or greater; Z>1.5) ranged from 1,135 genes at 15 min to 1,463genes at 120 min for a temperature up-shift of 13oC from a growthtemperature of 37oC for this organism and suggested both direct andindirect modes of heat sensing. Clusters of orthologous group categoriesthat were significantly affected included posttranslationalmodifications; protein turnover and chaperones (up-regulated); energyproduction and conversion (down-regulated), nucleotide transport,metabolism (down-regulated), and translation; ribosomal structure; andbiogenesis (down-regulated). Analysis of the genome sequence revealed thepresence of features of both negative and positive regulation whichincluded the CIRCE element and promoter sequences corresponding to thealternate sigma factors ?32 and ?54. While mechanisms of heat shockcontrol for some genes appeared to coincide with those established forEscherichia coli and Bacillus subtilis, the presence of unique controlschemes for several other genes was also evident. Analysis of proteinexpression levels using differential in-gel electrophoresis suggestedgood agreement with transcriptional profiles of several heat shockproteins, including DnaK (DVU0811), HtpG (DVU2643), HtrA (DVU1468), andAhpC (DVU2247). The proteomics study also suggested the possibility ofposttranslational modifications in the chaperones DnaK, AhpC, GroES(DVU1977), and GroEL (DVU1976) and also several periplasmic ABCtransporters.

  11. Energy metabolism in Desulfovibrio vulgaris Hildenborough: insights from transcriptome analysis

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, Patricia M.; He, Qiang; Valente, Filipa M.A.; Xavier, Antonio V.; Zhou, Jizhong; Pereira, Ines A.C.; Louro, Ricardo O.

    2007-11-01

    Sulphate-reducing bacteria are important players in the global sulphur and carbon cycles, with considerable economical and ecological impact. However, the process of sulphate respiration is still incompletely understood. Several mechanisms of energy conservation have been proposed, but it is unclear how the different strategies contribute to the overall process. In order to obtain a deeper insight into the energy metabolism of sulphate-reducers whole-genome microarrays were used to compare the transcriptional response of Desulfovibrio vulgaris Hildenborough grown with hydrogen/sulphate, pyruvate/sulphate, pyruvate with limiting sulphate, and lactate/thiosulphate, relative to growth in lactate/sulphate. Growth with hydrogen/sulphate showed the largest number of differentially expressed genes and the largest changes in transcript levels. In this condition the most up-regulated energy metabolism genes were those coding for the periplasmic [NiFeSe]hydrogenase, followed by the Ech hydrogenase. The results also provide evidence for the involvement of formate cycling and the recently proposed ethanol pathway during growth in hydrogen. The pathway involving CO cycling is relevant during growth on lactate and pyruvate, but not during growth in hydrogen as the most down-regulated genes were those coding for the CO-induced hydrogenase. Growth on lactate/thiosulphate reveals a down-regulation of several energymetabolism genes similar to what was observed in the presence of nitrite. This study identifies the role of several proteins involved in the energy metabolism of D. vulgaris and highlights several novel genes related to this process, revealing a more complex bioenergetic metabolism than previously considered.

  12. Purification and characterization of Desulfovibrio vulgaris (Hildenborough) hydrogenase expressed in Escherichia coli.

    NARCIS (Netherlands)

    Voordouw, G.; Hagen, W.R.; Kruse-Wolters, M.; Berkel-Arts, van A.; Veeger, C.

    1987-01-01

    Hydrogenase from Desulfovibrio vulgaris (Hildenborough) is a heterologous dimer of molecular mass 46 + 13.5 kDa. Its two structural genes have been cloned on a 4664-base-pair fragment of known sequence in the vector pUC9. Expression of hydrogenase polypeptides in Escherichia coli transformed with

  13. Identification of Small RNAs in Desulfovibrio vulgaris Hildenborough

    International Nuclear Information System (INIS)

    Burns, Andrew; Joachimiak, Marcin; Deutschbauer, Adam; Arkin, Adam; Bender, Kelly

    2010-01-01

    Desulfovibrio vulgaris is an anaerobic sulfate-reducing bacterium capable of facilitating the removal of toxic metals such as uranium from contaminated sites via reduction. As such, it is essential to understand the intricate regulatory cascades involved in how D. vulgaris and its relatives respond to stressors in such sites. One approach is the identification and analysis of small non-coding RNAs (sRNAs); molecules ranging in size from 20-200 nucleotides that predominantly affect gene regulation by binding to complementary mRNA in an anti-sense fashion and therefore provide an immediate regulatory response. To identify sRNAs in D. vulgaris, a bacterium that does not possess an annotated hfq gene, RNA was pooled from stationary and exponential phases, nitrate exposure, and biofilm conditions. The subsequent RNA was size fractionated, modified, and converted to cDNA for high throughput transcriptomic deep sequencing. A computational approach to identify sRNAs via the alignment of seven separate Desulfovibrio genomes was also performed. From the deep sequencing analysis, 2,296 reads between 20 and 250 nt were identified with expression above genome background. Analysis of those reads limited the number of candidates to ∼87 intergenic, while ∼140 appeared to be antisense to annotated open reading frames (ORFs). Further BLAST analysis of the intergenic candidates and other Desulfovibrio genomes indicated that eight candidates were likely portions of ORFs not previously annotated in the D. vulgaris genome. Comparison of the intergenic and antisense data sets to the bioinformatical predicted candidates, resulted in ∼54 common candidates. Current approaches using Northern analysis and qRT-PCR are being used toverify expression of the candidates and to further develop the role these sRNAs play in D. vulgaris regulation.

  14. Energetic Consequences of nitrite stress in Desulfovibrio vulgarisHildenborough, inferred from global transcriptional analysis

    Energy Technology Data Exchange (ETDEWEB)

    He, Qiang; Huang, Katherine H.; He, Zhili; Alm, Eric J.; Fields,Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Wall, Judy D.; Zhou, Jizhong

    2005-11-03

    Many of the proteins that are candidates for bioenergetic pathways involved with sulfate respiration in Desulfovibrio spp. have been studied, but complete pathways and overall cell physiology remain to be resolved for many environmentally relevant conditions. In order to understand the metabolism of these microorganisms under adverse environmental conditions for improved bioremediation efforts, Desulfovibrio vulgaris Hildenborough was used as a model organism to study stress response to nitrite, an important intermediate in the nitrogen cycle. Previous physiological studies demonstrated that growth was inhibited by nitrite and that nitrite reduction was observed to be the primary mechanism of detoxification. Global transcriptional profiling with whole-genome microarrays revealed coordinated cascades of responses to nitrite in pathways of energy metabolism, nitrogen metabolism, oxidative stress response, and iron homeostasis. In agreement with previous observations, nitrite-stressed cells showed a decrease in the expression of genes encoding sulfate reduction functions in addition to respiratory oxidative phosphorylation and ATP synthase activity. Consequently, the stressed cells had decreased expression of the genes encoding ATP-dependent amino acid transporters and proteins involved in translation. Other genes up-regulated in response to nitrite include the genes in the Fur regulon, which is suggested to be involved in iron homeostasis, and genes in the Per regulon, which is predicted to be responsible for oxidative stress response.

  15. Genetic Adaptation to Salt Stress in Experimental Evolution of Desulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Aifen; Hillesland, Kristina; He, Zhili; Joachimiak, Marcin; Zane, Grant; Dehal, Paramvir; Arkin, Adam; Stahl, David; Wall, Judy; Hazen, Terry; Zhou, Jizhong; Baidoo, Edward; Benke, Peter; Mukhopadhyay, Aindrila

    2010-05-17

    High salinity is one of the most common environmental stressors. In order to understand how environmental organisms adapt to salty environment, an experiment evolution with sulfate reducing bacteria Desulfovibrio vugaris Hildenborough was conducted. Control lines and salt-stressed lines (6 lines each) grown in minimal medium LS4D or LS4D + 100 mM NaCl were transferred for 1200 generations. The salt tolerance was tested with LS4D supplemented with 250 mM NaCl. Statistical analysis of the growth data suggested that all lines adapted to their evolutionary environment. In addition, the control lines performed better than the ancestor with faster growth rate, higher biomass yield and shorter lag phase under salty environment they did not evolve in. However, the salt-adapted lines performed better than the control lines on measures of growth rate and yield under salty environment, suggesting that the salt?evolved lines acquired mutations specific to having extra salt in LS4D. Growth data and gene transcription data suggested that populations tended to improve till 1000 generations and active mutations tended to be fixed at the stage of 1000 generations. Point mutations and insertion/deletions were identified in isolated colonies from salt-adapted and control lines via whole genome sequencing. Glu, Gln and Ala appears to be the major osmoprotectant in evolved salt-stressed line. Ongoing studies are now characterizing the contribution of specific mutations identified in the salt-evolved D. vulgaris.

  16. Hydrogen-peroxide-induced oxidative stress responses in Desulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, A.; He, Z.; Redding-Johanson, A.M.; Mukhopadhyay, A.; Hemme, C.L.; Joachimiak, M.P.; Bender, K.S.; Keasling, J.D.; Stahl, D.A.; Fields, M.W.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Zhou, J.; Luo, F.; Deng, Y.; He, Q.

    2010-07-01

    To understand how sulphate-reducing bacteria respond to oxidative stresses, the responses of Desulfovibrio vulgaris Hildenborough to H{sub 2}O{sub 2}-induced stresses were investigated with transcriptomic, proteomic and genetic approaches. H{sub 2}O{sub 2} and induced chemical species (e.g. polysulfide, ROS) and redox potential shift increased the expressions of the genes involved in detoxification, thioredoxin-dependent reduction system, protein and DNA repair, and decreased those involved in sulfate reduction, lactate oxidation and protein synthesis. A gene coexpression network analysis revealed complicated network interactions among differentially expressed genes, and suggested possible importance of several hypothetical genes in H{sub 2}O{sub 2} stress. Also, most of the genes in PerR and Fur regulons were highly induced, and the abundance of a Fur regulon protein increased. Mutant analysis suggested that PerR and Fur are functionally overlapped in response to stresses induced by H{sub 2}O{sub 2} and reaction products, and the upregulation of thioredoxin-dependent reduction genes was independent of PerR or Fur. It appears that induction of those stress response genes could contribute to the increased resistance of deletion mutants to H{sub 2}O{sub 2}-induced stresses. In addition, a conceptual cellular model of D. vulgaris responses to H{sub 2}O{sub 2} stress was constructed to illustrate that this bacterium may employ a complicated molecular mechanism to defend against the H{sub 2}O{sub 2}-induced stresses.

  17. Overcoming the anaerobic hurdle in phenotypic microarrays: Generation andvisualization of growth curve data for Desulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Borglin, Sharon E; Joyner, Dominique; Jacobsen, Janet; Mukhopadhyay, Aindrila; Hazen, Terry C.

    2008-10-04

    Growing anaerobic microorganisms in phenotypic microarrays (PM) and 96-well microtiter plates is an emerging technology that allows high throughput survey of the growth and physiology and/or phenotype of cultivable microorganisms. For non-model bacteria, a method for phenotypic analysis is invaluable, not only to serve as a starting point for further evaluation, but also to provide a broad understanding of the physiology of an uncharacterized wild-type organism or the physiology/phenotype of a newly created mutant of that organism. Given recent advances in genetic characterization and targeted mutations to elucidate genetic networks and metabolic pathways, high-throughput methods for determining phenotypic differences are essential. Here we outline challenges presented in studying the physiology and phenotype of a sulfate reducing anaerobic delta proteobacterium, Desulfovibrio vulgaris Hildenborough. Modifications of the commercially available OmniLog(TM) system (Hayward, CA) for experimental setup, and configuration, as well as considerations in PM data analysis are presented. Also highlighted here is data viewing software that enables users to view and compare multiple PM data sets. The PM method promises to be a valuable strategy in our systems biology approach to D. vulgaris studies and is readily applicable to other anaerobic and aerobic bacteria.

  18. Global transcriptional, physiological and metabolite analyses of Desulfovibrio vulgaris Hildenborough responses to salt adaptation

    Energy Technology Data Exchange (ETDEWEB)

    He, Z.; Zhou, A.; Baidoo, E.; He, Q.; Joachimiak, M. P.; Benke, P.; Phan, R.; Mukhopadhyay, A.; Hemme, C.L.; Huang, K.; Alm, E.J.; Fields, M.W.; Wall, J.; Stahl, D.; Hazen, T.C.; Keasling, J.D.; Arkin, A.P.; Zhou, J.

    2009-12-01

    The response of Desulfovibrio vulgaris Hildenborough to salt adaptation (long-term NaCl exposure) was examined by physiological, global transcriptional, and metabolite analyses. The growth of D. vulgaris was inhibited by high levels of NaCl, and the growth inhibition could be relieved by the addition of exogenous amino acids (e.g., glutamate, alanine, tryptophan) or yeast extract. Salt adaptation induced the expression of genes involved in amino acid biosynthesis and transport, electron transfer, hydrogen oxidation, and general stress responses (e.g., heat shock proteins, phage shock proteins, and oxidative stress response proteins). Genes involved in carbon metabolism, cell motility, and phage structures were repressed. Comparison of transcriptomic profiles of D. vulgaris responses to salt adaptation with those of salt shock (short-term NaCl exposure) showed some similarity as well as a significant difference. Metabolite assays showed that glutamate and alanine were accumulated under salt adaptation, suggesting that they may be used as osmoprotectants in D. vulgaris. A conceptual model is proposed to link the observed results to currently available knowledge for further understanding the mechanisms of D. vulgaris adaptation to elevated NaCl.

  19. Transcriptional Response of Desulfovibrio vulgaris Hildenborough to Oxidative Stress Mimicking Environmental Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Pereira, Patricia M.; He, Qiang; Xavier, Antonio V.; Zhou, Jizhong; Pereira, Ines A.C.; Louro, Ricardo O.

    2008-03-12

    Sulphate-reducing bacteria are anaerobes readily found in oxic-anoxic interfaces. Multiple defence pathways against oxidative conditions were identified in these organisms and proposed to be differentially expressed under different concentrations of oxygen, contributing to their ability to survive oxic conditions. In this study, Desulfovibrio vulgaris Hildenborough cells were exposed to the highest concentration of oxygen that sulphate-reducing bacteria are likely to encounter in natural habitats, and the global transcriptomic response was determined. 307 genes were responsive, with cellular roles in energy metabolism, protein fate, cell envelope and regulatory functions, including multiple genes encoding heat shock proteins, peptidases and proteins with heat shock promoters. Of the oxygen reducing mechanisms of D. vulgaris only the periplasmic hydrogen-dependent mechanism is up-regulated, involving the [NiFeSe]hydrogenase, formate dehydrogenase(s) and the Hmc membrane complex. The oxidative defence response concentrates on damage repair by metal-free enzymes. These data, together with the down regulation of the Fur operon, which restricts the availability of iron, and the lack of response of the PerR operon, suggest that a major effect of this oxygen stress is the inactivation and/or degradation of multiple metalloproteins present in D. vulgaris as a consequence of oxidative damage to their metal clusters.

  20. Localization of cytochromes in the outer membrane of Desulfovibrio vulgaris (Hildenborough) and their role in anaerobic biocorrosion.

    Science.gov (United States)

    Van Ommen Kloeke, F; Bryant, R D; Laishley, E J

    1995-12-01

    A protocol was developed whereby the outer and cytoplasmic membranes of the sulfate-reducing bacterium Desulfovibrio vulgaris (Hildenborough) were isolated and partially characterized. The isolated outer membrane fractions from cultures grown under high (100 ppm) and low (5 ppm) Fe2+ conditions were compared by SDS-PAGE electrophoresis, and showed that several protein bands were derepressed under the low iron conditions, most notably at 50 kDa, and 77.5 kDa. Outer membrane isolated from low iron cultured cells was found to contain two proteins, 77.5 kDa and 62.5 kDa in size, that reacted with a heme-specific stain and were referred to as high molecular weight cytochromes. Studies conducted on the low iron isolated outer membrane by a phosphate/mild steel hydrogen evolution system showed that addition of the membrane fraction caused an immediate acceleration in H2 production. A new model for the anaerobic biocorrosion of mild steel is proposed.

  1. Generalized schemes for high throughput manipulation of the Desulfovibrio vulgaris Hildenborough genome

    Energy Technology Data Exchange (ETDEWEB)

    Chhabra, S.R.; Butland, G.; Elias, D.; Chandonia, J.-M.; Fok, V.; Juba, T.; Gorur, A.; Allen, S.; Leung, C.-M.; Keller, K.; Reveco, S.; Zane, G.; Semkiw, E.; Prathapam, R.; Gold, B.; Singer, M.; Ouellet, M.; Sazakal, E.; Jorgens, D.; Price, M.; Witkowska, E.; Beller, H.; Hazen, T.C.; Biggin, M.; Auer, M.; Wall, J.; Keasling, J.

    2011-07-15

    The ability to conduct advanced functional genomic studies of the thousands of sequenced bacteria has been hampered by the lack of available tools for making high- throughput chromosomal manipulations in a systematic manner that can be applied across diverse species. In this work, we highlight the use of synthetic biological tools to assemble custom suicide vectors with reusable and interchangeable DNA “parts” to facilitate chromosomal modification at designated loci. These constructs enable an array of downstream applications including gene replacement and creation of gene fusions with affinity purification or localization tags. We employed this approach to engineer chromosomal modifications in a bacterium that has previously proven difficult to manipulate genetically, Desulfovibrio vulgaris Hildenborough, to generate a library of over 700 strains. Furthermore, we demonstrate how these modifications can be used for examining metabolic pathways, protein-protein interactions, and protein localization. The ubiquity of suicide constructs in gene replacement throughout biology suggests that this approach can be applied to engineer a broad range of species for a diverse array of systems biological applications and is amenable to high-throughput implementation.

  2. Study of Nitrate Stress in Desulfovibrio vulgaris Hildenborough Using iTRAQ Proteomics

    Energy Technology Data Exchange (ETDEWEB)

    Redding, A.M.; Mukhopadhyay, A.; Joyner, D.; Hazen, T.C.; Keasling, J.D.

    2006-10-12

    The response of Desulfovibrio vulgaris Hildenborough (DvH),a sulphate-reducing bacterium, to nitrate stress was examined usingquantitative proteomic analysis. DvH was stressed with 105 m M sodiumnitrate(NaNO3), a level that caused a 50 percent inhibition in growth.The protein profile of stressed cells was compared with that of cellsgrown in the absence of nitrate using the iTRAQ peptide labellingstrategy and tandem liquid chromatography separation coupled with massspectrometry (quadrupoletime-of-flight) detection. A total of 737 uniqueproteins were identified by two or more peptides, representing 22 percentof the total DvH proteome and spanning every functional category. Theresults indicate that this was a mild stress, as proteins involved incentral metabolism and the sulphate reduction pathway were unperturbed.Proteins involved in the nitrate reduction pathway increased. Increasesseen in transport systems for proline, glycine^ betaineandglutamateindicate that the NaNO3 exposure led to both salt stress and nitratestress.Up-regulation observed in oxidative stress response proteins (Rbr,RbO, etc.) and a large number of ABC transport systems as well as in iron^ sulphur -cluster-containing proteins, however, appear to be specific tonitrate exposure. Finally, a number of hypothetical proteins were amongthe most significant changers, indicating that there may be unknownmechanisms initiated upon nitrate stress in DvH.

  3. Single-cell analysis of growth and cell division of the anaerobe Desulfovibrio vulgaris Hildenborough

    Directory of Open Access Journals (Sweden)

    Anouchka eFievet

    2015-12-01

    Full Text Available Recent years have seen significant progress in understanding basic bacterial cell cycle properties such as cell growth and cell division. While characterization and regulation of bacterial cell cycle is quite well documented in the case of fast growing aerobic model organisms, no data has been so far reported for anaerobic bacteria. This lack of information in anaerobic microorganisms can mainly be explained by the absence of molecular and cellular tools such as single cell microscopy and fluorescent probes usable for anaerobes and essential to study cellular events and/or subcellular localization of the actors involved in cell cycle.In this study, single-cell microscopy has been adapted to study for the first time, in real time, the cell cycle of a bacterial anaerobe, Desulfovibrio vulgaris Hildenborough (DvH. This single-cell analysis provides mechanistic insights into the cell division cycle of DvH, which seems to be governed by the recently discussed so-called incremental model that generates remarkably homogeneous cell sizes. Furthermore, cell division was reversibly blocked during oxygen exposure. This may constitute a strategy for anaerobic cells to cope with transient exposure to oxygen that they may encounter in their natural environment, thereby contributing to their aerotolerance. This study lays the foundation for the first molecular, single-cell assay that will address factors that cannot otherwise be resolved in bulk assays and that will allow visualization of a wide range of molecular mechanisms within living anaerobic cells.

  4. Analysis of a Ferric Uptake Regulator (Fur) Mutant ofDesulfovibrio vulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Bender, Kelly S.; Yen, Huei-Che Bill; Hemme, Christopher L.; Yang, Zamin K.; He, Zhili; He, Qiang; Zhou, Jizhong; Huang, Katherine H.; Alm, Eric J.; Hazen, Terry C.; Arkin, Adam P.; Wall, Judy D.

    2007-09-21

    Previous experiments examining the transcriptional profileof the anaerobe Desulfovibrio vulgaris demonstrated up-regulation of theFur regulon in response to various environmental stressors. To test theinvolvement of Fur in the growth response and transcriptional regulationof D. vulgaris, a targeted mutagenesis procedure was used for deletingthe fur gene. Growth of the resulting ?fur mutant (JW707) was notaffected by iron availability, but the mutant did exhibit increasedsensitivity to nitrite and osmotic stresses compared to the wild type.Transcriptional profiling of JW707 indicated that iron-bound Fur acts asa traditional repressor for ferrous iron uptake genes (feoAB) and othergenes containing a predicted Fur binding site within their promoter.Despite the apparent lack of siderophore biosynthesis genes within the D.vulgaris genome, a large 12-gene operon encoding orthologs to TonB andTolQR also appeared to be repressed by iron-bound Fur. While other genespredicted to be involved in iron homeostasis were unaffected by thepresence or absence of Fur, alternative expression patterns that could beinterpreted as repression or activation by iron-free Fur were observed.Both the physiological and transcriptional data implicate a globalregulatory role for Fur in the sulfate-reducing bacterium D.vulgaris.

  5. Large-Scale, Continuous-Flow Production of Stressed Biomass (Desulfovibrio vulgaris Hildenborough)

    Energy Technology Data Exchange (ETDEWEB)

    Geller, Jil T.; Borglin, Sharon E.; Fortney, Julian L.; Lam, Bonita R.; Hazen, Terry C.; Biggin, Mark D.

    2010-05-01

    The Protein Complex Analysis Project (PCAP, http://pcap.lbl.gov/), focuses on high-throughput analysis of microbial protein complexes in the anaerobic, sulfate-reducing organism, DesulfovibriovulgarisHildenborough(DvH).Interest in DvHas a model organism for bioremediation of contaminated groundwater sites arises from its ability to reduce heavy metals. D. vulgarishas been isolated from contaminated groundwater of sites in the DOE complex. To understand the effect of environmental changes on the organism, midlog-phase cultures are exposed to nitrate and salt stresses (at the minimum inhibitory concentration, which reduces growth rates by 50percent), and compared to controls of cultures at midlogand stationary phases. Large volumes of culture of consistent quality (up to 100 liters) are needed because of the relatively low cell density of DvHcultures (one order of magnitude lower than E. coli, for example) and PCAP's challenge to characterize low-abundance membrane proteins. Cultures are grown in continuous flow stirred tank reactors (CFSTRs) to produce consistent cell densities. Stressor is added to the outflow from the CFSTR, and the mixture is pumped through a plug flow reactor (PFR), to provide a stress exposure time of 2 hours. Effluent is chilled and held in large carboys until it is centrifuged. A variety of analyses -- including metabolites, total proteins, cell density and phospholipidfatty-acids -- track culture consistency within a production run, and differences due to stress exposure and growth phase for the different conditions used. With our system we are able to produce the requisite 100 L of culture for a given condition within a week.

  6. Development of a Markerless Genetic Exchange System in Desulfovibrio vulgaris Hildenborough and Its Use in Generating a Strain with Increased Transformation Efficiency

    Energy Technology Data Exchange (ETDEWEB)

    Keller, Kimberly L.; Bender, Kelly S.; Wall, Judy D.

    2009-07-21

    In recent years, the genetic manipulation of the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough has seen enormous progress. In spite of this progress, the current marker exchange deletion method does not allow for easy selection of multiple sequential gene deletions in a single strain because of the limited number of selectable markers available in D. vulgaris. To broaden the repertoire of genetic tools for manipulation, an in-frame, markerless deletion system has been developed. The counterselectable marker that makes this deletion system possible is the pyrimidine salvage enzyme, uracil phosphoribosyltransferase, encoded by upp. In wild-type D. vulgaris, growth was shown to be inhibited by the toxic pyrimidine analog 5-fluorouracil (5-FU); whereas, a mutant bearing a deletion of the upp gene was resistant to 5-FU. When a plasmid containing the wild-type upp gene expressed constitutively from the aph(3')-II promoter (promoter for the kanamycin resistance gene in Tn5) was introduced into the upp deletion strain, sensitivity to 5-FU was restored. This observation allowed us to develop a two-step integration and excision strategy for the deletion of genes of interest. Since this inframe deletion strategy does not retain an antibiotic cassette, multiple deletions can be generated in a single strain without the accumulation of genes conferring antibiotic resistances. We used this strategy to generate a deletion strain lacking the endonuclease (hsdR, DVU1703) of a type I restriction-modification system, that we designated JW7035. The transformation efficiency of the JW7035 strain was found to be 100 to 1000 times greater than that of the wild-type strain when stable plasmids were introduced via electroporation.

  7. 1H, 13C and 15N chemical shift assignments of the thioredoxin from the obligate anaerobe Desulfovibrio vulgaris Hildenborough.

    Science.gov (United States)

    Garcin, Edwige B; Bornet, Olivier; Pieulle, Laetitia; Guerlesquin, Françoise; Sebban-Kreuzer, Corinne

    2011-10-01

    Thioredoxins are ubiquitous key antioxidant enzymes which play an essential role in cell defense against oxidative stress. They maintain the redox homeostasis owing to the regulation of thiol-disulfide exchange. In the present paper, we report the full resonance assignments of (1)H, (13)C and (15)N atoms for the reduced and oxidized forms of Desulfovibrio vulgaris Hildenborough thioredoxin 1 (Trx1). 2D and 3D heteronuclear NMR experiments were performed using uniformly (15)N-, (13)C-labelled Trx1. Chemical shifts of 97% of the backbone and 90% of the side chain atoms were obtained for the oxidized and reduced form (BMRB deposits with accession number 17299 and 17300, respectively).

  8. Temporal transcriptomic analysis of Desulfovibrio vulgaris Hildenborough transition into stationary phase growth during electrondonor depletion

    Energy Technology Data Exchange (ETDEWEB)

    Clark, M.E.; He, Q.; He, Z.; Huang, K.H.; Alm, E.J.; Wan, X.-F.; Hazen, T.C.; Arkin, A.P.; Wall, J.D.; Zhou, J.-Z.; Fields, M.W.

    2006-08-01

    Desulfovibrio vulgaris was cultivated in a defined medium, and biomass was sampled for approximately 70 h to characterize the shifts in gene expression as cells transitioned from the exponential to the stationary phase during electron donor depletion. In addition to temporal transcriptomics, total protein, carbohydrate, lactate, acetate, and sulfate levels were measured. The microarray data were examined for statistically significant expression changes, hierarchical cluster analysis, and promoter element prediction and were validated by quantitative PCR. As the cells transitioned from the exponential phase to the stationary phase, a majority of the down-expressed genes were involved in translation and transcription, and this trend continued at the remaining times. There were general increases in relative expression for intracellular trafficking and secretion, ion transport, and coenzyme metabolism as the cells entered the stationary phase. As expected, the DNA replication machinery was down-expressed, and the expression of genes involved in DNA repair increased during the stationary phase. Genes involved in amino acid acquisition, carbohydrate metabolism, energy production, and cell envelope biogenesis did not exhibit uniform transcriptional responses. Interestingly, most phage-related genes were up-expressed at the onset of the stationary phase. This result suggested that nutrient depletion may affect community dynamics and DNA transfer mechanisms of sulfate-reducing bacteria via the phage cycle. The putative feoAB system (in addition to other presumptive iron metabolism genes) was significantly up-expressed, and this suggested the possible importance of Fe{sup 2+} acquisition under metal-reducing conditions. The expression of a large subset of carbohydrate-related genes was altered, and the total cellular carbohydrate levels declined during the growth phase transition. Interestingly, the D. vulgaris genome does not contain a putative rpoS gene, a common attribute

  9. Growth of the obligate anaerobe Desulfovibrio vulgaris Hildenborough under continuous low oxygen concentration sparging: impact of the membrane-bound oxygen reductases.

    Science.gov (United States)

    Ramel, Fanny; Brasseur, Gael; Pieulle, Laetitia; Valette, Odile; Hirschler-Réa, Agnès; Fardeau, Marie Laure; Dolla, Alain

    2015-01-01

    Although obligate anaerobe, the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough (DvH) exhibits high aerotolerance that involves several enzymatic systems, including two membrane-bound oxygen reductases, a bd-quinol oxidase and a cc(b/o)o3 cytochrome oxidase. Effect of constant low oxygen concentration on growth and morphology of the wild-type, single (Δbd, Δcox) and double deletion (Δcoxbd) mutant strains of the genes encoding these oxygen reductases was studied. When both wild-type and deletion mutant strains were cultured in lactate/sulfate medium under constant 0.02% O2 sparging, they were able to grow but the final biomasses and the growth yield were lower than that obtained under anaerobic conditions. At the end of the growth, lactate was not completely consumed and when conditions were then switched to anaerobic, growth resumed. Time-lapse microscopy revealed that a large majority of the cells were then able to divide (over 97%) but the time to recover a complete division event was longer for single deletion mutant Δbd than for the three other strains. Determination of the molar growth yields on lactate suggested that a part of the energy gained from lactate oxidation was derived toward cells protection/repairing against oxidative conditions rather than biosynthesis, and that this part was higher in the single deletion mutant Δbd and, to a lesser extent, Δcox strains. Our data show that when DvH encounters oxidative conditions, it is able to stop growing and to rapidly resume growing when conditions are switched to anaerobic, suggesting that it enters active dormancy sate under oxidative conditions. We propose that the pyruvate-ferredoxin oxidoreductase (PFOR) plays a central role in this phenomenon by reversibly switching from an oxidative-sensitive fully active state to an oxidative-insensitive inactive state. The oxygen reductases, and especially the bd-quinol oxidase, would have a crucial function by maintaining reducing conditions

  10. Growth of the obligate anaerobe Desulfovibrio vulgaris Hildenborough under continuous low oxygen concentration sparging: impact of the membrane-bound oxygen reductases.

    Directory of Open Access Journals (Sweden)

    Fanny Ramel

    Full Text Available Although obligate anaerobe, the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough (DvH exhibits high aerotolerance that involves several enzymatic systems, including two membrane-bound oxygen reductases, a bd-quinol oxidase and a cc(b/oo3 cytochrome oxidase. Effect of constant low oxygen concentration on growth and morphology of the wild-type, single (Δbd, Δcox and double deletion (Δcoxbd mutant strains of the genes encoding these oxygen reductases was studied. When both wild-type and deletion mutant strains were cultured in lactate/sulfate medium under constant 0.02% O2 sparging, they were able to grow but the final biomasses and the growth yield were lower than that obtained under anaerobic conditions. At the end of the growth, lactate was not completely consumed and when conditions were then switched to anaerobic, growth resumed. Time-lapse microscopy revealed that a large majority of the cells were then able to divide (over 97% but the time to recover a complete division event was longer for single deletion mutant Δbd than for the three other strains. Determination of the molar growth yields on lactate suggested that a part of the energy gained from lactate oxidation was derived toward cells protection/repairing against oxidative conditions rather than biosynthesis, and that this part was higher in the single deletion mutant Δbd and, to a lesser extent, Δcox strains. Our data show that when DvH encounters oxidative conditions, it is able to stop growing and to rapidly resume growing when conditions are switched to anaerobic, suggesting that it enters active dormancy sate under oxidative conditions. We propose that the pyruvate-ferredoxin oxidoreductase (PFOR plays a central role in this phenomenon by reversibly switching from an oxidative-sensitive fully active state to an oxidative-insensitive inactive state. The oxygen reductases, and especially the bd-quinol oxidase, would have a crucial function by maintaining

  11. Sustainable syntrophic growth of Dehalococcoides ethenogenes strain 195 with Desulfovibrio vulgaris Hildenborough and Methanobacterium congolense: Global transcriptomic and proteomic analyses

    Energy Technology Data Exchange (ETDEWEB)

    Men, Y.; Feil, H.; VerBerkmoes, N.C.; Shah, M.B.; Johnson, D.R.; Lee, P.K.H; West, K.A.; Zinder, S.H.; Andersen, G.L.; Alvarez-Cohen, L.

    2011-03-01

    Dehalococcoides ethenogenes strain 195 (DE195) was grown in a sustainable syntrophic association with Desulfovibrio vulgaris Hildenborough (DVH) as a co-culture, as well as with DVH and the hydrogenotrophic methanogen Methanobacterium congolense (MC) as a tri-culture using lactate as the sole energy and carbon source. In the co- and tri-cultures, maximum dechlorination rates of DE195 were enhanced by approximately three times (11.0±0.01 lmol per day for the co-culture and 10.1±0.3 lmol per day for the tri-culture) compared with DE195 grown alone (3.8±0.1 lmol per day). Cell yield of DE195 was enhanced in the co-culture (9.0±0.5 x 107 cells per lmol Cl{sup -} released, compared with 6.8±0.9x 107 cells per lmol Cl{sup -} released for the pure culture), whereas no further enhancement was observed in the tri-culture (7.3±1.8x 107 cells per lmol Cl{sup -} released). The transcriptome of DE195 grown in the co-culture was analyzed using a whole-genome microarray targeting DE195, which detected 102 significantly up- or down-regulated genes compared with DE195 grown in isolation, whereas no significant transcriptomic difference was observed between co- and tri-cultures. Proteomic analysis showed that 120 proteins were differentially expressed in the co-culture compared with DE195 grown in isolation. Physiological, transcriptomic and proteomic results indicate that the robust growth of DE195 in co- and tri-cultures is because of the advantages associated with the capabilities of DVH to ferment lactate to provide H2 and acetate for growth, along with potential benefits from proton translocation, cobalamin-salvaging and amino acid biosynthesis, whereas MC in the tri-culture provided no significant additional benefits beyond those of DVH.

  12. Periplasmic Cytochrome c(3) of Desulfovibrio vulgaris Is Directly Involved in H2-Mediated Metal but Not Sulfate Reduction

    International Nuclear Information System (INIS)

    Elias, Dwayne A.; Suflita, Joseph M.; McInerney, Michael J.; Krumholz, Lee R.

    2004-01-01

    Kinetic parameters and the role of cytochrome c3 in sulfate, Fe(III), and U(VI) reduction were investigated in Desulfovibrio vulgaris Hildenborough. While sulfate reduction followed Michaelis-Menten kinetics (Km 220 uM), loss of Fe(III) and U(VI) was first-order at all concentrations tested. Initial reduction rates of all electron acceptors were similar for cells grown with H2 and sulfate, while cultures grown using lactate and sulfate had similar rates of metal loss but lower sulfate reduction activities. The similarities in metal, but not sulfate, reduction with H2 and lactate suggest divergent pathways. Respiration assays and reduced minus oxidized spectra were carried out to determine c-type cytochrome involvement in electron acceptor reduction. c-type cytochrome oxidation was immediate with Fe(III) and U(VI) in the presence of H2, lactate, or pyruvate. Sulfidogenesis occurred with all three electron donors and effectively oxidized the c-type cytochrome in lactate or pyruvate-reduced, but not H2-reduced cells. Correspondingly, electron acceptor competition assays with lactate or pyruvate as electron donors showed that Fe(III) inhibited U(VI) reduction, and U(VI) inhibited sulfate loss. However, sulfate reduction was slowed but not halted when H2 was the electron donor in the presence of Fe(III) or U(VI). U(VI) loss was still impeded by Fe(III) when H2 was used. Hence, we propose a modified pathway for the reduction of sulfate, Fe(III), and U(VI) which helps explain why these bacteria cannot grow using these metals. We further propose that cytochrome c3 is an electron carrier involved in lactate and pyruvate oxidation and is the reductase for alternate electron acceptors with higher redox potentials than sulfate

  13. Pathway confirmation and flux analysis of central metabolic pathways in Desulfovibrio vulgaris Hildenborough using Gas Chromatography-Mass Spectrometry and Fourier Transform-Ion Cyclotron Resonance Mass Spectrometry

    International Nuclear Information System (INIS)

    Tang, Yinjie; Pingitore, Francesco; Mukhopadhyay, Aindrila; Phan, Richard; Hazen, Terry C.; Keasling, Jay D.

    2007-01-01

    Flux distribution in central metabolic pathways of Desulfovibrio vulgaris Hildenborough was examined using 13C tracer experiments. Consistent with the current genome annotation and independent evidence from enzyme activity assays, the isotopomer results from both GC-MS and Fourier Transform-Ion Cyclotron Resonance mass spectrometry (FT-ICR MS) indicate the lack of oxidatively functional TCA cycle and an incomplete pentose phosphate pathway. Results from this study suggest that fluxes through both pathways are limited to biosynthesis. The data also indicate that >80 percent of the lactate was converted to acetate and the reactions involved are the primary route of energy production (NAD(P)H and ATP production). Independent of the TCA cycle, direct cleavage of acetyl-CoA to CO and 5,10-methyl-THF also leads to production of NADH and ATP. Although the genome annotation implicates a ferredoxin-dependent oxoglutarate synthase, isotopic evidence does not support flux through this reaction in either the oxidative or reductive mode; therefore, the TCA cycle is incomplete. FT-ICR MS was used to locate the labeled carbon distribution in aspartate and glutamate and confirmed the presence of an atypical enzyme for citrate formation suggested in previous reports (the citrate synthesized by this enzyme is the isotopic antipode of the citrate synthesized by the (S)-citrate synthase). These findings enable a better understanding of the relation between genome annotation and actual metabolic pathways in D. vulgaris, and also demonstrate FT-ICR MS as a powerful tool for isotopomer analysis, overcoming problems in both GC-MS and NMR spectroscopy

  14. Cell wide responses to low oxygen exposure in Desulfovibriovulgaris Hildenborough

    Energy Technology Data Exchange (ETDEWEB)

    Mukhopadhyay, A.; Redding, A.; Joachimiak, M.; Arkin, A.; Borglin, S.; Dehal, P.; Chakraborty, R.; Geller, J.; Hazen, T.; He, Q.; Joyner, D.; Martin, V.; Wall, J.; Yang, Z.; Zhou, J.; Keasling, J.

    2007-03-11

    The responses of the anaerobic, sulfate-reducing Desulfovibrio vulgaris Hildenborough to low oxygen exposure (0.1% O{sub 2}) were monitored via transcriptomics and proteomics. Exposure to 0.1% O{sub 2} caused a decrease in growth rate without affecting viability. A concerted up regulation in the predicted peroxide stress response regulon (PerR) genes was observed in response to the 0.1% O{sub 2} exposure. Several of these candidates also showed increases in protein abundance. Among the remaining small number of transcript changes was the up regulation of the predicted transmembrane tetraheme cytochrome c3 complex. Other known oxidative stress response candidates remained unchanged during this low O{sub 2} exposure. To fully understand the results of the 0.1% O{sub 2} exposure, transcriptomics and proteomics data were collected for exposure to air using a similar experimental protocol. In contrast to the 0.1% O{sub 2} exposure, air exposure was detrimental to both the growth rate and viability and caused dramatic changes at both the transcriptome and proteome levels. Interestingly, the transcripts of the predicted PerR regulon genes were down regulated during air exposure. Our results highlight the differences in the cell wide response to low and high O{sub 2} levels of in D. vulgaris and suggest that while exposure to air is highly detrimental to D. vulgaris, this bacterium can successfully cope with periodic exposure to low O{sub 2} levels in its environment.

  15. Impact of elevated nitrate on sulfate-reducing bacteria: A comparative study of Desulfovibrio vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    He, Q.; He, Z.; Joyner, D.C.; Joachimiak, M.; Price, M.N.; Yang, Z.K.; Yen, H.-C. B.; Hemme, C. L.; Chen, W.; Fields, M.; Stahl, D. A.; Keasling, J. D.; Keller, M.; Arkin, A. P.; Hazen, T. C.; Wall, J. D.; Zhou, J.

    2010-07-15

    Sulfate-reducing bacteria have been extensively studied for their potential in heavy-metal bioremediation. However, the occurrence of elevated nitrate in contaminated environments has been shown to inhibit sulfate reduction activity. Although the inhibition has been suggested to result from the competition with nitrate-reducing bacteria, the possibility of direct inhibition of sulfate reducers by elevated nitrate needs to be explored. Using Desulfovibrio vulgaris as a model sulfate-reducing bacterium, functional genomics analysis reveals that osmotic stress contributed to growth inhibition by nitrate as shown by the upregulation of the glycine/betaine transporter genes and the relief of nitrate inhibition by osmoprotectants. The observation that significant growth inhibition was effected by 70 mM NaNO{sub 3} but not by 70 mM NaCl suggests the presence of inhibitory mechanisms in addition to osmotic stress. The differential expression of genes characteristic of nitrite stress responses, such as the hybrid cluster protein gene, under nitrate stress condition further indicates that nitrate stress response by D. vulgaris was linked to components of both osmotic and nitrite stress responses. The involvement of the oxidative stress response pathway, however, might be the result of a more general stress response. Given the low similarities between the response profiles to nitrate and other stresses, less-defined stress response pathways could also be important in nitrate stress, which might involve the shift in energy metabolism. The involvement of nitrite stress response upon exposure to nitrate may provide detoxification mechanisms for nitrite, which is inhibitory to sulfate-reducing bacteria, produced by microbial nitrate reduction as a metabolic intermediate and may enhance the survival of sulfate-reducing bacteria in environments with elevated nitrate level.

  16. Methods for Engineering Sulfate Reducing Bacteria of the Genus Desulfovibrio

    Energy Technology Data Exchange (ETDEWEB)

    Chhabra, Swapnil R; Keller, Kimberly L.; Wall, Judy D.

    2011-03-15

    Sulfate reducing bacteria are physiologically important given their nearly ubiquitous presence and have important applications in the areas of bioremediation and bioenergy. This chapter provides details on the steps used for homologous-recombination mediated chromosomal manipulation of Desulfovibrio vulgaris Hildenborough, a well-studied sulfate reducer. More specifically, we focus on the implementation of a 'parts' based approach for suicide vector assembly, important aspects of anaerobic culturing, choices for antibiotic selection, electroporation-based DNA transformation, as well as tools for screening and verifying genetically modified constructs. These methods, which in principle may be extended to other sulfate-reducing bacteria, are applicable for functional genomics investigations, as well as metabolic engineering manipulations.

  17. Vulgaris

    Directory of Open Access Journals (Sweden)

    Mukaddes Kavala

    2012-01-01

    Full Text Available Background. Thyroid disorders may affect all of the organ systems of the body and they are also highly associated with a wide variety of skin disorders. The aim of this study was to investigate the prevalence of thyroid function abnormalities and thyroid autoimmunity in patients with pemphigus vulgaris (PV and to determine the association between thyroid disorders and clinical involvement and systemic corticosteroid treatment in patients with PV. Methods. The study consisted of eighty patients with PV and eighty healthy individuals. Thyroid functions (fT3, fT4, and TSH and thyroid autoimmunity (anti-thyroid peroxidase (anti-TPO, and anti-thyroglobulin (anti-Tg antibodies were investigated in both groups. Primary thyroid disease (PTD was diagnosed with one or more of the following diagnostic criteria: (i positive antithyroid antibodies, (ii primary thyroid function abnormalities. Results. Significant changes in the serum thyroid profile were found in 16% (13/80 of the PV group and 5% (4/80 of the control group. Positive titers of antithyroid antibodies (anti-TPO and anti-Tg were observed in 7 patients (9% with PV and one in the control group (1,2%. Hashimoto thyroiditis was diagnosed in 9% of PV patients and it was found to be more prevalent in the mucosal form of PV. PTD was found in 13 of (%16 PV patients which was significantly high compared to controls. PTD was not found to be associated with systemic corticosteroid use. Free T3 levels were significantly lower in PV group compared to the control group and free T4 levels were significantly higher in PV group compared to the controls. Conclusions. PV may exist together with autoimmune thyroid diseases especially Hashimoto thyroiditis and primer thyroid diseases. Laboratory work-up for thyroid function tests and thyroid autoantibodies should be performed to determine underlying thyroid diseases in patients with PV.

  18. Response of Desulfovibrio vulgaris to Alkaline Stress

    Energy Technology Data Exchange (ETDEWEB)

    Stolyar, S.; He, Q.; He, Z.; Yang, Z.; Borglin, S.E.; Joyner, D.; Huang, K.; Alm, E.; Hazen, T.C.; Zhou, J.; Wall, J.D.; Arkin, A.P.; Stahl, D.A.

    2007-11-30

    The response of exponentially growing Desulfovibrio vulgarisHildenborough to pH 10 stress was studied using oligonucleotidemicroarrays and a study set of mutants with genes suggested by microarraydata to be involved in the alkaline stress response deleted. The datashowed that the response of D. vulgaris to increased pH is generallysimilar to that of Escherichia coli but is apparently controlled byunique regulatory circuits since the alternative sigma factors (sigma Sand sigma E) contributing to this stress response in E. coli appear to beabsent in D. vulgaris. Genes previously reported to be up-regulated in E.coli were up-regulated in D. vulgaris; these genes included three ATPasegenes and a tryptophan synthase gene. Transcription of chaperone andprotease genes (encoding ATP-dependent Clp and La proteases and DnaK) wasalso elevated in D. vulgaris. As in E. coli, genes involved in flagellumsynthesis were down-regulated. The transcriptional data also identifiedregulators, distinct from sigma S and sigma E, that are likely part of aD. vulgaris Hildenborough-specific stress response system.Characterization of a study set of mutants with genes implicated inalkaline stress response deleted confirmed that there was protectiveinvolvement of the sodium/proton antiporter NhaC-2, tryptophanase A, andtwo putative regulators/histidine kinases (DVU0331 andDVU2580).

  19. Subcellular localization of proteins in the anaerobic sulfate reducer Desulfovibrio vulgaris via SNAP-tag labeling and photoconversion

    Energy Technology Data Exchange (ETDEWEB)

    Gorur, A.; Leung, C. M.; Jorgens, D.; Tauscher, A.; Remis, J. P.; Ball, D. A.; Chhabra, S.; Fok, V.; Geller, J. T.; Singer, M.; Hazen, T. C.; Juba, T.; Elias, D.; Wall, J.; Biggin, M.; Downing, K. H.; Auer, M.

    2010-06-01

    Systems Biology studies the temporal and spatial 3D distribution of macromolecular complexes with the aim that such knowledge will allow more accurate modeling of biological function and will allow mathematical prediction of cellular behavior. However, in order to accomplish accurate modeling precise knowledge of spatial 3D organization and distribution inside cells is necessary. And while a number of macromolecular complexes may be identified by its 3D structure and molecular characteristics alone, the overwhelming number of proteins will need to be localized using a reporter tag. GFP and its derivatives (XFPs) have been traditionally employed for subcelllar localization using photoconversion approaches, but this approach cannot be taken for obligate anaerobic bacteria, where the intolerance towards oxygen prevents XFP approaches. As part of the GTL-funded PCAP project (now ENIGMA) genetic tools have been developed for the anaerobe sulfate reducer Desulfovibrio vulgaris that allow the high-throughput generation of tagged-protein mutant strains, with a focus on the commercially available SNAP-tag cell system (New England Biolabs, Ipswich, MA), which is based on a modified O6-alkylguanine-DNA alkyltransferase (AGT) tag, that has a dead-end reaction with a modified O6-benzylguanine (BG) derivative and has been shown to function under anaerobic conditions. After initial challenges with respect to variability, robustness and specificity of the labeling signal we have optimized the labeling. Over the last year, as a result of the optimized labeling protocol, we now obtain robust labeling of 20 out of 31 SNAP strains. Labeling for 13 strains were confirmed at least five times. We have also successfully performed photoconversion on 5 of these 13 strains, with distinct labeling patterns for different strains. For example, DsrC robustly localizes to the periplasmic portion of the inner membrane, where as a DNA-binding protein localizes to the center of the cell, where the

  20. Pathway of Fermentative Hydrogen Production by Sulfate-reducing Bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Wall, Judy D. [Univ. of Missouri, Columbia, MO (United States)

    2015-02-16

    Biofuels are a promising source of sustainable energy. Such biofuels are intermediate products of microbial metabolism of renewable substrates, in particular, plant biomass. Not only are alcohols and solvents produced in this degradative process but energy-rich hydrogen as well. Non photosynthetic microbial hydrogen generation from compounds other than sugars has not been fully explored. We propose to examine the capacity of the abundant soil anaerobes, sulfate-reducing bacteria, for hydrogen generation from organic acids. These apparently simple pathways have yet to be clearly established. Information obtained may facilitate the exploitation of other microbes not yet readily examined by molecular tools. Identification of the flexibility of the metabolic processes to channel reductant to hydrogen will be useful in consideration of practical applications. Because the tools for genetic and molecular manipulation of sulfate-reducing bacteria of the genus Desulfovibrio are developed, our efforts will focus on two strains, D. vulgaris Hildenborough and Desulfovibrio G20.Therefore total metabolism, flux through the pathways, and regulation are likely to be limiting factors which we can elucidate in the following experiments.

  1. Expression profiling of hypothetical genes in Desulfovibrio vulgaris leads to improved functional annotation

    Energy Technology Data Exchange (ETDEWEB)

    Elias, Dwayne A.; Mukhopadhyay, Aindrila; Joachimiak, Marcin P.; Drury, Elliott C.; Redding, Alyssa M.; Yen, Huei-Che B.; Fields, Matthew W.; Hazen, Terry C.; Arkin, Adam P.; Keasling, Jay D.; Wall, Judy D.

    2008-10-27

    Hypothetical and conserved hypothetical genes account for>30percent of sequenced bacterial genomes. For the sulfate-reducing bacterium Desulfovibrio vulgaris Hildenborough, 347 of the 3634 genes were annotated as conserved hypothetical (9.5percent) along with 887 hypothetical genes (24.4percent). Given the large fraction of the genome, it is plausible that some of these genes serve critical cellular roles. The study goals were to determine which genes were expressed and provide a more functionally based annotation. To accomplish this, expression profiles of 1234 hypothetical and conserved genes were used from transcriptomic datasets of 11 environmental stresses, complemented with shotgun LC-MS/MS and AMT tag proteomic data. Genes were divided into putatively polycistronic operons and those predicted to be monocistronic, then classified by basal expression levels and grouped according to changes in expression for one or multiple stresses. 1212 of these genes were transcribed with 786 producing detectable proteins. There was no evidence for expression of 17 predicted genes. Except for the latter, monocistronic gene annotation was expanded using the above criteria along with matching Clusters of Orthologous Groups. Polycistronic genes were annotated in the same manner with inferences from their proximity to more confidently annotated genes. Two targeted deletion mutants were used as test cases to determine the relevance of the inferred functional annotations.

  2. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MKHLVIATRGSKLALWQAEHIKSLIETEHAGKVDVSLKIIKTKGDIILDVPL...GEFDAIVMATAGLKRLGLAAPHHEVLAPPRFLPAVGQGALGIEFREDRADLRDMLAFLDHRPTRIRVEAERGFLAGLEGGCQVPIAGHAVMTGDDNFRIEGLVADLKGERVIRRTLEGTGANARNRGLELASQVLADGAAEILDEVYASGAADRQ

  3. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available thase [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MQAARVEGYLATCLAGRGIPPRLQSAMEYSLLAGGKRLRPVL...DMDYTGRDDIDLAALRTMHAMKTGALIRCSCVAGALLGGAPASAVEQVAGYGAAIGAAFQIVDDILDETGDEAQLGKPVGSDVEQGKVTYPSLLGIERSRALAQEQADIAVTCLADFEGEDADFLRALAQYIVDRVS

  4. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available me MiaB [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MHDRTFHIETFGCQMNVNDSDWLARALMERGFSPAPFGEA...SVFVNIMQGCDNFCAYCIVPYTRGRQKSRATGTILDECRALLDRGAREITLLGQNVNSFGQDSHGDGTTFAQLLHKVAALP

  5. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein/permease protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MSGIDEEHMGGYQGADAGDASGQD...IAMGVPNADDRMIMRAADVAGVTEFARNHPAGFGLQVGERGMALSGGQRQAVALARALLHDPDVLILDEPTSNMDTGSEFAFKQRLRALLGDKTLVLITHRMSVIDLVDRLVVVDGGRIVADGPRDAVIKALRSTGVQAAPAARFRKNGTVGAAGGAA

  6. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tase, alpha subunit [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MQQAPRSIVIGGEAGQGLVTIGDMLVRT...LIRSGYGVLVAQHYMSRVRGGHNTYNIRVGAGDVLAPTDDVHVLVALDQRTVTEQGPRLGDGLLILDERLDPGSLNALRVPFAALAGRPLYENIAALGVLAALLGLER

  7. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rio vulgaris subsp. vulgaris str. Hildenborough] MKGIKVMLVDDEESFVRTLAERMQMRDAGTKVALTGEEALQLVSTGEVPDVMVLDLRMP...GVDGMEVLRRVKKDYPKVQVIVLTGHGTEKDEEEARRLGAFEYHKKPVDIDILVRDIRRAFRETLEDTMVAATLAQAGDYEGAKQILDESDK

  8. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available brio vulgaris subsp. vulgaris str. Hildenborough] MHDTIPEYIRDGAQDMLAQGGVQKLGLKKEGGTWEIDGSIQSDDFQIYVSRISLTPSE...LPNWEREAQKFVPELKRLIIYGTRREGMFKLIDESDLVVTTYALLRRDLEELQNHTFNCIILDEAQNIKNPNTITARSVRRIKADMRLCLSGTPIENNLFELWSLFEF

  9. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein/permease protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MGEPSTTQRASLPLLRRIGRYFLP...LFNLSVSDNITYGTPNVGAGRIEAAAHAAFAHEFVQQLAQGYDTVLGERGVKLSGGQKQRLTIARALLKDAPLLILDEATS

  10. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available fovibrio vulgaris subsp. vulgaris str. Hildenborough] MFITLSERFGLLLAGGFAIMTLAPLDKLGPGRTRSWRATALLVVLFSLFTILGT...DLVEVIGLPMILLNGVGAAIFVQALRMQMHFRDLRDSSQARQILSIANRTLPHLRAGLSAASARATAEIILDETRVAAVAL

  11. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MRIREALLDVLKGLLKTTPREEPLADTSVTEEGRSRTQRPGTMRQP...PALDIGTSGMACSMPVGDLAEEAQTVAPDALVDDIRKRFEDGQQHNGLAVVDANTHPMGLVMDYHLNRQLSAQYGVALYSRRAVTCVMDPAPTILDE

  12. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MQHDDTIAAIATPLGQGGIGIIRISGPASLEVLRALFRPSSSRFGGFR...STPEGCRSVHVAAASGDGVESLVTAIRAAVLAATGAGEPEAGELAPNMRQAAALDKAATILDELAGDIRAHVPYDLCGVRLDGACAALMDVTGQSTPEAILDAIFASFCIGK

  13. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available vibrio vulgaris subsp. vulgaris str. Hildenborough] MKDEESGISEGRGRRHAPHEDMPAGDPCAGLVDTDTEYAHPADVAEHIENLSLEKQ...VCVLRNLPAEDAAEALAELDEHVRVDLLENLDADVAAQILAEMSPDDAADVLDELDEDHRDVLLNNLDTEDADEIRHLMAFDPDTAGGVMNTEIVILDEQLTADQAIL

  14. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available brio vulgaris subsp. vulgaris str. Hildenborough] MPKQGMTQTQTVETLSFDDAGLANQLFGAQNGNLDIIAERSGTSIDTCGNAVTVSGEN...KRIILTRPAVEAGEKLGFLPGDLVEKVNPYLRPLYDALHDMLDFQKVTDMLETGVIEIAPLAFMRGRTLNDAFIILDEAQN

  15. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available family protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MKAPLVSIIIPVWNLWELTCACLDSIRAHTPGN...ESRTPGRKEHDAANATLLNRRCSGCFGPDLHRHALRDGFAIALTPWLDTYLTLPPGREAALTREHITDFDPGRCWETLQGEPLWHGGYEMLCSILDEAGRHAESAGVR

  16. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available transporter, ATP binding protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MSLLSLRNLTKTFGG...EEKRAIERAVRELEFVGLADQHDNLAKNLSYGNQRLLEIARALATDPRFIILDEPAGGMNDQETAALIGTIRAIRDRGISVLLIEHDMSLVMKVCEKLVVLEYGALIAEGTPSVIKRDPRVIEAYLGADSDI

  17. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available pha subunits [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MFVRSVIAFATPNPTGLTMFLNEHQSKRLFEEAGI...GGTAEEELAAWVRETAFPKPVVSFVAGRTAPPGRRLGHAGAILDEADGGIAGKVRALCDAGIAVCPDLGSLPAAVRQALG

  18. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available esulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MSKHCIHIEGARQHNLKNVDIDIPRDELVVVCGPSGSGKSTLAFDIVYAE...GQPATTLSGGEAQRIKISRELGKRSLPGTLYILDEPTTGLHMHEVGKLIRVLHQLVDRGATVVVIEHNTDVILSSDHVIDLGPGGGENGGRIVSAGTPEEIIADSASVTGAFLVQERAIRNGG

  19. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available otein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MFIGVLGVVASTAVFVGLILSWRMQAELEDFGHENLASFMDT...ADGKPAIGTYIPAESPVYQAIEKGQEYVGVANVVGQPFLTHYRPIRDARGQFTIALFAGVPLLQPSFTEMFAGAKVGGAGYTFILDE

  20. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tS [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MTNPSPKLTPMFEQYLRIKEDYPDALLFYRMGDFYELFFDDAETT...NMAGKSTVLRQTAIICLLAQMGAFVPAREASIGIADRIFSRVGASDNLAQGQSTFMVEMMETARILRQASKRSLVILDEIGRGTSTFDGMALAWAVVEELTRRAGGGI

  1. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available e [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MAHPFLHRLTLRLDAQRAAGLDRTVMTPETRTTRHVILDGQRLCNF...GDLARLDRRLTAWRHETTAETASAAPLTEGAPLSSPPATCPTASPPPHGDASPVILTESLFSMDGTVTSMDALATLRSRHGAFVILDE

  2. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available putative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MSRTIIPFGPQHPVLPEPLHLKLVVEDETVVEAIPALG...YVHRGLETLASIRDYNQMVYVVERVCGICSCIHAMCYCQSLECMMNVEVPRRAKVLRTIWSELHRIHSHLLWLGLFADGFGFESLFMQFWKVRERVMDINEATAGNRVVISTNIVGGVRRDLSPEHQKWILDE

  3. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ibrio vulgaris subsp. vulgaris str. Hildenborough] MTLEARTLRALEYDKVLHHLARYCVSEAGREACLALAPCPGSDALADATALLEDARR...ITLMALSALPVPAAPGSSLPAWTTVHAFIGDEQSLEDHVSTFTAQITHLGRVWDGLDDSTLVILDEFGAGTDPAQGAALAQAVLDELMAHGASVIAATHFPALKAYAL

  4. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ative [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MTHTNDDTKSTTIATVDTDDKPDTVVDDGDTLAAVQPADTPE...LDIAKLPRDVRKEADKQLRRLAAMHPDSSEATVTRTYLEWLSELPWRKLSRDRLDIRKAKVILDEDHFGLDKVKDRILEYLSVRKLNPDSKGPILCFAGPPGVGKTSL

  5. Transcriptomic and proteomic analyses of Desulfovibrio vulgaris biofilms: carbon and energy flow contribute to the distinct biofilm growth state.

    Science.gov (United States)

    Clark, Melinda E; He, Zhili; Redding, Alyssa M; Joachimiak, Marcin P; Keasling, Jay D; Zhou, Jizhong Z; Arkin, Adam P; Mukhopadhyay, Aindrila; Fields, Matthew W

    2012-04-16

    Desulfovibrio vulgaris Hildenborough is a sulfate-reducing bacterium (SRB) that is intensively studied in the context of metal corrosion and heavy-metal bioremediation, and SRB populations are commonly observed in pipe and subsurface environments as surface-associated populations. In order to elucidate physiological changes associated with biofilm growth at both the transcript and protein level, transcriptomic and proteomic analyses were done on mature biofilm cells and compared to both batch and reactor planktonic populations. The biofilms were cultivated with lactate and sulfate in a continuously fed biofilm reactor, and compared to both batch and reactor planktonic populations. The functional genomic analysis demonstrated that biofilm cells were different compared to planktonic cells, and the majority of altered abundances for genes and proteins were annotated as hypothetical (unknown function), energy conservation, amino acid metabolism, and signal transduction. Genes and proteins that showed similar trends in detected levels were particularly involved in energy conservation such as increases in an annotated ech hydrogenase, formate dehydrogenase, pyruvate:ferredoxin oxidoreductase, and rnf oxidoreductase, and the biofilm cells had elevated formate dehydrogenase activity. Several other hydrogenases and formate dehydrogenases also showed an increased protein level, while decreased transcript and protein levels were observed for putative coo hydrogenase as well as a lactate permease and hyp hydrogenases for biofilm cells. Genes annotated for amino acid synthesis and nitrogen utilization were also predominant changers within the biofilm state. Ribosomal transcripts and proteins were notably decreased within the biofilm cells compared to exponential-phase cells but were not as low as levels observed in planktonic, stationary-phase cells. Several putative, extracellular proteins (DVU1012, 1545) were also detected in the extracellular fraction from biofilm cells

  6. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch grown in the field and sugar beet (Beta vulgaris L. grown in hydroponics

    Directory of Open Access Journals (Sweden)

    Hamdi eEl-Jendoubi

    2014-01-01

    Full Text Available Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch trees grown in the field and sugar beet (Beta vulgaris L. cv. ‘Orbis’ grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated and basal (untreated leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs.

  7. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch) grown in the field and sugar beet (Beta vulgaris L.) grown in hydroponics.

    Science.gov (United States)

    El-Jendoubi, Hamdi; Vázquez, Saúl; Calatayud, Angeles; Vavpetič, Primož; Vogel-Mikuš, Katarina; Pelicon, Primož; Abadía, Javier; Abadía, Anunciación; Morales, Fermín

    2014-01-01

    Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch) trees grown in the field and sugar beet (Beta vulgaris L. cv. "Orbis") grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated) and basal (untreated) leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume) and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs.

  8. Separation and Enrichment of Lectin from Zihua Snap-Bean (Phaseolus vulgaris Seeds by PEG 600–Ammonium Sulfate Aqueous Two-Phase System

    Directory of Open Access Journals (Sweden)

    Bin Jiang

    2017-09-01

    Full Text Available A fast and efficient method based on a polyethylene glycol (PEG 600/(NH42SO4 aqueous two-phase system for extracting lectin from Zihua snap-bean (Phaseolus vulgaris seeds was established. According to a Box–Behnken design (BBD, involving four factors at three levels each subjected to analysis of variance (ANOVA and response surface analysis, the protein recovery and the purification factor of lectin in the top phase were used as the response values of the variance analysis to acquire the multivariate quadratic regression model. SDS–PAGE electrophoresis and the hemagglutination test were used to detect the distribution of lectin in the aqueous two-phase system (ATPS. The obtained data indicated that lectin was preferentially partitioned into the PEG-rich phase, and the ATPS, composed of 15% (NH42SO4 (w/w, 18% PEG 600 (w/w, 0.4 g/5 g NaCl and 1 mL crude extract, showed good selectivity for lectin when the pH value was 7.5. Under the optimal conditions, most of the lectin was assigned to the top phase in the ATPS, and the hemagglutination activity of the purified lectin in the top phase was 3.08 times that of the crude extract. Consequently, the PEG 600/(NH42SO4 aqueous two-phase system was an effective method for separating and enriching lectin directly from the crude extract of Zihua snap-bean seeds.

  9. Ichthyosis vulgaris

    DEFF Research Database (Denmark)

    Thyssen, J P; Godoy-Gijon, E; Elias, P M

    2013-01-01

    in this review article, FLG mutations are observed in approximately 7·7% of Europeans and 3·0% of Asians, but appear to be infrequent in darker-skinned populations. This clinical review article provides an overview of ichthyosis vulgaris epidemiology, related disorders and pathomechanisms. Not only does......-deficient skin, and epidemiological studies have found higher levels of hand eczema, irritant contact dermatitis, nickel sensitization and serum vitamin D levels. When relevant, individuals should be informed about an increased risk of developing dermatitis when repeatedly or continuously exposed to nickel...... or irritants. Moreover, with our current knowledge, individuals with ichthyosis vulgaris should be protected against neonatal exposure to cats to prevent atopic dermatitis and should abstain from smoking to prevent asthma. Finally, they should be advised against excessive exposure to factors that decrease skin...

  10. Acne vulgaris.

    Science.gov (United States)

    Moradi Tuchayi, Sara; Makrantonaki, Evgenia; Ganceviciene, Ruta; Dessinioti, Clio; Feldman, Steven R; Zouboulis, Christos C

    2015-09-17

    Acne vulgaris is a chronic inflammatory disease - rather than a natural part of the life cycle as colloquially viewed - of the pilosebaceous unit (comprising the hair follicle, hair shaft and sebaceous gland) and is among the most common dermatological conditions worldwide. Some of the key mechanisms involved in the development of acne include disturbed sebaceous gland activity associated with hyperseborrhoea (that is, increased sebum production) and alterations in sebum fatty acid composition, dysregulation of the hormone microenvironment, interaction with neuropeptides, follicular hyperkeratinization, induction of inflammation and dysfunction of the innate and adaptive immunity. Grading of acne involves lesion counting and photographic methods. However, there is a lack of consensus on the exact grading criteria, which hampers the conduction and comparison of randomized controlled clinical trials evaluating treatments. Prevention of acne relies on the successful management of modifiable risk factors, such as underlying systemic diseases and lifestyle factors. Several treatments are available, but guidelines suffer from a lack of data to make evidence-based recommendations. In addition, the complex combination treatment regimens required to target different aspects of acne pathophysiology lead to poor adherence, which undermines treatment success. Acne commonly causes scarring and reduces the quality of life of patients. New treatment options with a shift towards targeting the early processes involved in acne development instead of suppressing the effects of end products will enhance our ability to improve the outcomes for patients with acne.

  11. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available idine decarboxylase [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] gb|AAS94902.1| ... ... ... carboxynorspermidine decarboxylase [Desulfovibrio ... vulgaris subsp. vulgaris str. Hildenbo...rough] ... Length = 362 ... Query: 17 ... SPCFVIDEDRLVANAAILDEVQRRTGARVLLALKGFAA...WSTFPLLSRAQGGVLHGTCASS 76 ... SPCFVIDEDRLVANAAILDEVQRRTGARVLLALKGFAAWSTFPLLSRAQGGVLHGTCASS Sbjct: 1 ... SPCFVIDEDRLVANAAILDE

  12. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available porter [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] gb|AAS96283.1| magnesium trans...porter ... [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] ... Length = ...127 ... Query: 141 TAGGVMNTEIVILDEQLTADQAILQIRREIEDKENPYYAYVVDIDDRLIGVLSLRDLLLS 200... ... TAGGVMNTEIVILDEQLTADQAILQIRREIEDKENPYYAYVVDIDDRLIGVLSLRDLLLS Sbjct: 1 ... TAGGVMNTEIVILDEQLTADQAIL

  13. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available tase [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] gb|AAS94860.1| thioredoxin reduc...tase ... [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] ... Length = 29...7 ... Query: 4 ... AFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGMELA 63 ... ... ... AFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGMELA Sbjct: 1 ... AFDLIILGGGVAGMTSAIYAARANLRVLILDE

  14. ORF Sequence: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available transporter, ATP-binding protein [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MVRLEGIGKSFGPVR...LDIDPAARVCDLSMGERQRVEILKLLYRDSRVLILDEPTAVLTPGETEQLFEALHRMAENGKAIVFISHKMQEVLALADEI

  15. Identification of Molecular and Cellular Responses of Desulfovibrio vulgaris Biofilms under Culture Conditions Relevant to Field Conditions for Bioreduction of Toxic Metals and Radionuclides. Final report

    International Nuclear Information System (INIS)

    Wall, Judy D.

    2011-01-01

    Our findings demonstrated that D. vulgaris surface-adhered populations produce extracellular structures, and that the cells have altered carbon and energy flux compared to planktonic cells. Biofilms did not have greatly increased carbohydrate accumulation. Interestingly genes present on the native plasmid found in D. vulgaris Hildenborough were necessary for wild type biofilm formation. In addition, extracellular appendages dependent on functions or proteins encoded by flaG or fliA also contributed to biofilm formation. Studies with SRB biofilms have indicated that the reduction and precipitation of metals can occur within the biofilm matrix; however, little work has been done to elucidate the physiological state of surface-adhered cells during metal reduction (Cr6+, U6+) and how this process is affected by nutrient feed levels (i.e., the stimulant).

  16. Identification of Molecular and Cellular Responses of Desulfovibrio vulgaris Biofilms under Culture Conditions Relevant to Field Conditions for Bioreduction of Toxic Metals and Radionuclides

    Energy Technology Data Exchange (ETDEWEB)

    Judy D. Wall

    2011-06-09

    Our findings demonstrated that D. vulgaris surface-adhered populations produce extracellular structures, and that that the cells have altered carbon and energy flux compared to planktonic cells. Biofilms did not have greatly increased carbohydrate accumulation. Interestingly genes present on the native plasmid found in D. vulgaris Hildenborough were necessary for wild type biofilm formation. In addition, extracellular appendages dependent on functions or proteins encoded by flaG or fliA also contributed to biofilm formation. Studies with SRB biofilms have indicated that the reduction and precipitation of metals can occur within the biofilm matrix; however, little work has been done to elucidate the physiological state of surface-adhered cells during metal reduction (Cr6+, U6+) and how this process is affected by nutrient feed levels (i.e., the stimulant).

  17. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available imerase/dehydratase family protein [Desulfovibrio ... vulgaris subsp. vulgaris str. Hildenborough] ... ...s subsp. vulgaris ... str. Hildenborough] ... Length = 282 ... Query: ...1 ... MKITLFGGAGFLGSHVCDKLSEAGHDVTVVDLRPSPYLRPDQTMITGNILDEELVARAVE 60 ... MKITLFGGAGFLGSHVCDKLSEAGHDVTVVDLRPSPYLRPDQTMITGNILDE...ELVARAVE Sbjct: 1 ... MKITLFGGAGFLGSHVCDKLSEAGHDVTVVDLRPSPYLRPDQTMITGNILDEELVARAVE 60 ...

  18. Acne vulgaris: endocriene aspecten

    NARCIS (Netherlands)

    Dekkers, O. M.; Thio, B. H.; Romijn, J. A.; Smit, J. W. A.

    2006-01-01

    Androgens play an important part in the development of acne vulgaris. Androgen levels in patients with acne are higher than those in controls and people with the androgen insensitivity syndrome do not develop acne. Local factors other than androgen plasma levels, also play a part in the development

  19. Sonography of acne vulgaris.

    Science.gov (United States)

    Wortsman, Ximena; Claveria, Pedro; Valenzuela, Fernando; Molina, Maria Teresa; Wortsman, Jacobo

    2014-01-01

    The purpose of this study was to assess the sonographic morphology of the clinical and subclinical pathology of facial acne vulgaris. We studied patients with facial acne vulgaris diagnosed by certified dermatologists, and using a standardized protocol for sonographic examinations, we sequentially described the sonographic pathomorphologic characteristics. Lesions of particular interest to the referring clinician were also analyzed separately. Additionally, acne involvement was staged clinically and sonographically (SOS-Acne) using morphologic definitions of the relevant lesions and predefined scoring systems for gradation of the severity of acne lesions. A total of 245 acne lesions in 20 consecutive patients were studied. Sonographic abnormalities consisted of pseudocysts, folliculitis, fistulas, and calcinosis. Most conditions were subclinical and mostly due to lesion extensions deep into the dermis and hypodermis (52% of pseudocysts and 68% of fistulas). The statistical concordance between acne severity scores assigned by two separate clinicians was strong (κ = 0.8020), but the corresponding sonographic scores generally showed more severe and clinically occult involvement. Facial acne vulgaris often involves deeper tissues, beyond the reach of the spatially restricted clinical examination; these subclinical conditions can be detected and defined with sonography. Additionally, acne vulgaris is amenable to sonographic scoring.

  20. Strongylus vulgaris and colic

    DEFF Research Database (Denmark)

    Nielsen, Martin Krarup; Jacobsen, Stine; Olsen, Susanne Nautrup

    Strongylus vulgaris is regarded the most pathogenic helminth parasite infecting horses. It was once estimated to be the primary cause of colic in horses and has been termed the horse killer. Disease is ascribed to thromboembolism caused by larvae migrating in the mesenteric arteries eventually...

  1. Barium Sulfate

    Science.gov (United States)

    ... uses a computer to put together x-ray images to create cross-sectional or three dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called radiopaque contrast media. It works by coating the esophagus, stomach, or ...

  2. Survey of large protein complexes D. vulgaris reveals great structural diversity

    Energy Technology Data Exchange (ETDEWEB)

    Han, B.-G.; Dong, M.; Liu, H.; Camp, L.; Geller, J.; Singer, M.; Hazen, T. C.; Choi, M.; Witkowska, H. E.; Ball, D. A.; Typke, D.; Downing, K. H.; Shatsky, M.; Brenner, S. E.; Chandonia, J.-M.; Biggin, M. D.; Glaeser, R. M.

    2009-08-15

    An unbiased survey has been made of the stable, most abundant multi-protein complexes in Desulfovibrio vulgaris Hildenborough (DvH) that are larger than Mr {approx} 400 k. The quaternary structures for 8 of the 16 complexes purified during this work were determined by single-particle reconstruction of negatively stained specimens, a success rate {approx}10 times greater than that of previous 'proteomic' screens. In addition, the subunit compositions and stoichiometries of the remaining complexes were determined by biochemical methods. Our data show that the structures of only two of these large complexes, out of the 13 in this set that have recognizable functions, can be modeled with confidence based on the structures of known homologs. These results indicate that there is significantly greater variability in the way that homologous prokaryotic macromolecular complexes are assembled than has generally been appreciated. As a consequence, we suggest that relying solely on previously determined quaternary structures for homologous proteins may not be sufficient to properly understand their role in another cell of interest.

  3. Pathway confirmation and flux analysis of central metabolicpathways in Desulfovibrio vulgaris Hildenborough using gaschromatography-mass spectrometry and fourier transform-ion cyclotronresonance mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Yinjie; Pingitore, Francesco; Mukhopadhyay, Aindrila; Phan,Richard; Hazen, Terry C.; Keasling, Jay D.

    2006-07-11

    It has been proposed that during growth under anaerobic oroxygen-limited conditions Shewanella oneidensis MR-1 uses theserine-isocitrate lyase pathway common to many methylotrophic anaerobes,in which formaldehyde produced from pyruvate is condensed with glycine toform serine. The serine is then transformed through hydroxypyruvate andglycerate to enter central metabolism at phosphoglycerate. To examine itsuse of the serine-isocitrate lyase pathway under anaerobic conditions, wegrew S. oneidensis MR-1 on [1-13C]lactate as the sole carbon source witheither trimethylamine N-oxide (TMAO) or fumarate as an electron acceptor.Analysis of cellular metabolites indicates that a large percentage(>75 percent) of lactate was partially oxidized to either acetate orpyruvate. The 13C isotope distributions in amino acids and other keymetabolites indicate that, under anaerobic conditions, a complete serinepathway is not present, and lactate is oxidized via a highly reversibleserine degradation pathway. The labeling data also suggest significantactivity in the anaplerotic (malic enzyme and phosphoenolpyruvatecarboxylase) and glyoxylate shunt (isocitrate lyase and malate synthase)reactions. Although the tricarboxylic acid (TCA) cycle is often observedto be incomplete in many other anaerobes (absence of 2-oxoglutaratedehydrogenase activity), isotopic labeling supports the existence of acomplete TCA cycle in S. oneidensis MR-1 under TMAO reductioncondition.

  4. Pathway confirmation and flux analysis of central metabolic pathways in Desulfovibrio vulgaris Hildenborough using gas chromatography-mass spectrometry and fourier transform-ion cyclotron resonance mass spectrometry

    International Nuclear Information System (INIS)

    Tang, Yinjie; Pingitore, Francesco; Mukhopadhyay, Aindrila; Phan, Richard; Hazen, Terry C.; Keasling, Jay D.

    2006-01-01

    It has been proposed that during growth under anaerobic or oxygen-limited conditions Shewanella oneidensis MR-1 uses the serine-isocitrate lyase pathway common to many methylotrophic anaerobes, in which formaldehyde produced from pyruvate is condensed with glycine to form serine. The serine is then transformed through hydroxypyruvate and glycerate to enter central metabolism at phosphoglycerate. To examine its use of the serine-isocitrate lyase pathway under anaerobic conditions, we grew S. oneidensis MR-1 on [1-13C] lactate as the sole carbon source with either trimethylamine N-oxide (TMAO) or fumarate as an electron acceptor. Analysis of cellular metabolites indicates that a large percentage (>75 percent) of lactate was partially oxidized to either acetate or pyruvate. The 13C isotope distributions in amino acids and other key metabolites indicate that, under anaerobic conditions, a complete serine pathway is not present, and lactate is oxidized via a highly reversible serine degradation pathway. The labeling data also suggest significant activity in the anaplerotic (malic enzyme and phosphoenolpyruvatecarboxylase) and glyoxylate shunt (isocitrate lyase and malate synthase) reactions. Although the tricarboxylic acid (TCA) cycle is often observed to be incomplete in many other anaerobes (absence of 2-oxoglutaratede hydrogenase activity), isotopic labeling supports the existence of a complete TCA cycle in S. oneidensis MR-1 under TMAO reduction condition

  5. Bambusa vulgaris and Raffia bambusa

    African Journals Online (AJOL)

    Michael

    2016-12-02

    Dec 2, 2016 ... Keywords: Heavy Metals, Sorption, Biomass, Bambusa vulgaris, Raffia bambusa. 1 Introduction ..... copper ion values were quite high at 87 ppm and 80 ppm respectively .... biomass to the charge and size of the ions being.

  6. ORF Alignment: NC_003212 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ATP-binding protein [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] gb|AAS96105.1| AB...C ... transporter, ATP-binding protein [Desulfovibrio vulgaris ... subsp. vulgaris str. Hilden... ... LQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIK--PTAGIVR 58 ... Query: 124 LDAKMDILDMDEEMAERYLNEGFSGGEKKRNEILQLLMIEPKLAILDE

  7. ORF Alignment: NC_003210 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ATP-binding protein [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] gb|AAS96105.1| AB...C ... transporter, ATP-binding protein [Desulfovibrio vulgaris ... subsp. vulgaris str. Hilden... ... LQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIK--PTAGIVR 58 ... Query: 124 LDAKMDILDMDEEMAERYLNEGFSGGEKKRNEILQLLMIEPKLAILDE

  8. ORF Alignment: NC_002973 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ATP-binding protein [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] gb|AAS96105.1| AB...C ... transporter, ATP-binding protein [Desulfovibrio vulgaris ... subsp. vulgaris str. Hilden... ... LQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIK--PTAGIVR 58 ... Query: 124 LDAKMDILDMDEEMAERYLNEGFSGGEKKRNEILQLLMIEPKLAILDE

  9. Sulfate adsorption on goethite

    Energy Technology Data Exchange (ETDEWEB)

    Rietra, R P.J.J.; Hiemstra, T; Riemsdijk, W.H. van

    1999-10-15

    Recent spectroscopic work has suggested that only one surface species of sulfate is dominant on hematite. Sulfate is therefore a very suitable anion to test and develop adsorption models for variable charge minerals. The authors have studied sulfate adsorption on goethite covering a large range of sulfate concentrations, surface coverages, pH values, and electrolyte concentrations. Four different techniques were used to cover the entire range of conditions. For characterization at low sulfate concentrations, below the detection limit of sulfate with ICP-AES, the authors used proton-sulfate titrations at constant pH. Adsorption isotherms were studied for the intermediate sulfate concentration range. Acid-base titrations in sodium sulfate and electromobility were used for high sulfate concentrations. All the data can be modeled with one adsorbed species if it is assumed that the charge of adsorbed sulfate is spatially distributed in the interface. The charge distribution of sulfate follows directly from modeling the proton-sulfate adsorption stoichoimemtry sine this stoichiometry is independent of the intrinsic affinity constant of sulfate. The charge distribution can be related to the structure of the surface complex by use of the Pauling bond valence concept and is in accordance with the microscopic structure found by spectroscopy. The intrinsic affinity constant follows from the other measurements. Modeling of the proton-ion stoichoimetry with the commonly used 2-pK models, where adsorbed ions are treated as point charges, is possible only if at least two surface species for sulfate are used.

  10. Two Component Signal Transduction in Desulfovibrio Species

    Energy Technology Data Exchange (ETDEWEB)

    Luning, Eric; Rajeev, Lara; Ray, Jayashree; Mukhopadhyay, Aindrila

    2010-05-17

    The environmentally relevant Desulfovibrio species are sulfate-reducing bacteria that are of interest in the bioremediation of heavy metal contaminated water. Among these, the genome of D. vulgaris Hildenborough encodes a large number of two component systems consisting of 72 putative response regulators (RR) and 64 putative histidinekinases (HK), the majority of which are uncharacterized. We classified the D. vulgaris Hildenborough RRs based on their output domains and compared the distribution of RRs in other sequenced Desulfovibrio species. We have successfully purified most RRs and several HKs as His-tagged proteins. We performed phospho-transfer experiments to verify relationships between cognate pairs of HK and RR, and we have also mapped a few non-cognate HK-RR pairs. Presented here are our discoveries from the Desulfovibrio RR categorization and results from the in vitro studies using purified His tagged D. vulgaris HKs and RRs.

  11. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available rotein [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] gb|AAS96558.1| Snf2 family pr...otein ... [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] ... Length =...YLNFLREYGFGGILADEMGLGKTVQTLSFVQHMVESGKIG 60 ... Query: 703 ... ELQNHTFNCIILDEAQNIKNPNTITARSVRRIKADMRLCLSGTPIENNLFE...LWSLFEFLM 762 ... ELQNHTFNCIILDEAQNIKNPNTITARSVRRIKADMRLCLSGTPIENNLFELWSL...FEFLM Sbjct: 121 ... ELQNHTFNCIILDEAQNIKNPNTITARSVRRIKADMRLCLSGTPIENNLFELWSLFEFLM 180 ... Query: 823 ... LAEEQAELYTAL

  12. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available me family protein [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] gb|AAS97536.1| AMP-...binding ... enzyme family protein [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborou...gh] ... Length = 533 ... Query: 7 ... REMTLGRILDETAAKFPDNDAVVYVDRDYRQTYREFVSVVD...DLARGLMALGVKRGDKVAL 66 ... REMTLGRILDETAAKFPDNDAVVYVDRDYRQTYREFVSVVDDLARGLMALGVKRGDKVAL Sbjct: 1 ... REMTLGRILDE

  13. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available GTPase TrmE [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] gb|AAS95559.1| tRNA ... ... ... modification GTPase TrmE [Desulfovibrio vulgaris subsp. ... vulgaris str. Hildenborough] ... ...SRDLVAQADLVL 300 ... Query: 365 ESLVTAIRAAVXXXXXXXXXXXXXXXXNMRQAAALDKAATILDELAGDIRAHVPYDLCGV 424 ... ESL...VTAIRAAV ... NMRQAAALDKAATILDELAGDIRAHVPYDLCGV Sbjct: 361 ESLVTAIRAAVLAATGAGEPEAGELAPNMRQAAALDKAATILDELAGDIRAHVPYDLCGV 420 ...

  14. Methanogenic archaea and sulfate reducing bacteria co-cultured on acetate: teamwork or coexistence?

    Science.gov (United States)

    Ozuolmez, Derya; Na, Hyunsoo; Lever, Mark A; Kjeldsen, Kasper U; Jørgensen, Bo B; Plugge, Caroline M

    2015-01-01

    Acetate is a major product of fermentation processes and an important substrate for sulfate reducing bacteria and methanogenic archaea. Most studies on acetate catabolism by sulfate reducers and methanogens have used pure cultures. Less is known about acetate conversion by mixed pure cultures and the interactions between both groups. We tested interspecies hydrogen transfer and coexistence between marine methanogens and sulfate reducers using mixed pure cultures of two types of microorganisms. First, Desulfovibrio vulgaris subsp. vulgaris (DSM 1744), a hydrogenotrophic sulfate reducer, was cocultured together with the obligate aceticlastic methanogen Methanosaeta concilii using acetate as carbon and energy source. Next, Methanococcus maripaludis S2, an obligate H2- and formate-utilizing methanogen, was used as a partner organism to M. concilii in the presence of acetate. Finally, we performed a coexistence experiment between M. concilii and an acetotrophic sulfate reducer Desulfobacter latus AcSR2. Our results showed that D. vulgaris was able to reduce sulfate and grow from hydrogen leaked by M. concilii. In the other coculture, M. maripaludis was sustained by hydrogen leaked by M. concilii as revealed by qPCR. The growth of the two aceticlastic microbes indicated co-existence rather than competition. Altogether, our results indicate that H2 leaking from M. concilii could be used by efficient H2-scavengers. This metabolic trait, revealed from coculture studies, brings new insight to the metabolic flexibility of methanogens and sulfate reducers residing in marine environments in response to changing environmental conditions and community compositions. Using dedicated physiological studies we were able to unravel the occurrence of less obvious interactions between marine methanogens and sulfate-reducing bacteria.

  15. Methanogenic archaea and sulfate reducing bacteria co-cultured on acetate: teamwork or coexistence?

    Directory of Open Access Journals (Sweden)

    Derya eOzuolmez

    2015-05-01

    Full Text Available Acetate is a major product of fermentation processes and an important substrate for sulfate reducing bacteria and methanogenic archaea. Most studies on acetate catabolism by sulfate reducers and methanogens have used pure cultures. Less is known about acetate conversion by mixed pure cultures and the interactions between both groups. We tested interspecies hydrogen transfer and coexistence between marine methanogens and sulfate reducers using mixed pure cultures of two types of microorganisms. First, Desulfovibrio vulgaris subsp. vulgaris (DSM 1744, a hydrogenotrophic sulfate reducer, was cocultured together with the obligate aceticlastic methanogen Methanosaeta concilii using acetate as carbon and energy source. Next, Methanococcus maripaludis S2, an obligate H2- and formate-utilizing methanogen, was used as a partner organism to M. concilii in the presence of acetate. Finally, we performed a coexistence experiment between M. concilii and an acetotrophic sulfate reducer Desulfobacter latus AcSR2. Our results showed that D. vulgaris was able to reduce sulfate and grow from hydrogen leaked by M. concilii. In the other coculture, M. maripaludis was sustained by hydrogen leaked by M. concilii as revealed by qPCR. The growth of the two aceticlastic microbes indicated co-existence rather than competition. Altogether, our results indicate that H2 leaking from M. concilii could be used by efficient H2-scavengers. This metabolic trait, revealed from coculture studies, brings new insight to the metabolic flexibility of methanogens and sulfate reducers residing in marine environments in response to changing environmental conditions and community compositions. Using dedicated physiological studies we were able to unravel the occurrence of less obvious interactions between marine methanogens and sulfate-reducing bacteria.

  16. Potential Health Effects of Enzymatic Protein Hydrolysates from Chlorella vulgaris

    Directory of Open Access Journals (Sweden)

    Mahsa Sedighi

    2016-06-01

    Full Text Available Background and Objective: Chlorella vulgaris is a multi-cellular edible algal species with abundant proteins. Extraction of high value protein fractions for pharmaceutical and nutritional applications can significantly increase the commercial value of microalga biomasses. There is no known report on the anticancer peptides derived from the Chlorella vulgaris abundant protein.Materials and Methods: This study examined the antimicrobial and anticancer effects of peptides from a hydrolyzed Chlorella vulgaris protein with 62 kDa molecular weight. Protein hydrolysis was done by pepsin as a gastrointestinal protease, and was monitored through protein content measurement, sodium dodecyl sulfate polyacrylamide gel electrophoresis, and high performance liquidchromatography measurements. Inhibitory effect of the produced peptides on Escherichia coli cells and breast cancer cell lines was assayed.Results and Conclusion: Hydrolyzed peptides induced a decrease of about 34.1% in the growth of Escherichia coli, and the peptides of 3 to 5 kDa molecular weight had strong impact on the viability of breast cancer cells with IC50 value of 50 μg μl-1. The peptide fractions demonstrating antimicrobial and anti-cancer activities have the potential for use as functional food ingredients for health benefits. These results demonstrate that inexpensive algae proteinscould be a new alternative to produce anticancer peptides.Conflict of interest: The authors declare that there is no conflict of interest.

  17. Effect of growth conditions on microbial activity and iron-sulfide production by Desulfovibrio vulgaris

    International Nuclear Information System (INIS)

    Zhou, Chen; Vannela, Raveender; Hayes, Kim F.; Rittmann, Bruce E.

    2014-01-01

    Highlights: • Extended incubation time to 16 days allowed significant FeS crystallization. • A weakly acidic pH greatly enhanced particle growth of mackinawite. • Microbial metabolism of different donors systematically altered the ambient pH. • Greater sulfide accumulation stimulated mackinawite transformation to greigite. - Abstract: Sulfate-reducing bacteria (SRB) can produce iron sulfide (FeS) solids with mineralogical characteristics that may be beneficial for a variety of biogeochemical applications, such as long-term immobilization of uranium. In this study, the growth and metabolism of Desulfovibrio vulgaris, one of the best-studied SRB species, were comprehensively monitored in batch studies, and the biogenic FeS solids were characterized by X-ray diffraction. Controlling the pH by varying the initial pH, the iron-to-sulfate ratio, or the electron donor – affected the growth of D. vulgaris and strongly influenced the formation and growth of FeS solids. In particular, lower pH (from initial conditions or a decrease caused by less sulfate reduction, FeS precipitation, or using pyruvate as the electron donor) produced larger-sized mackinawite (Fe 1+x S). Greater accumulation of free sulfide, from more sulfate reduction by D. vulgaris, also led to larger-sized mackinawite and particularly stimulated mackinawite transformation to greigite (Fe 3 S 4 ) when the free sulfide concentration was 29.3 mM. Furthermore, sufficient free Fe 2+ led to the additional formation of vivianite [Fe 3 (PO 4 ) 2 ·8(H 2 O)]. Thus, microbially relevant conditions (initial pH, choice of electron donor, and excess or deficiency of sulfide) are tools to generate biogenic FeS solids of different characteristics

  18. Pemphigus Vulgaris with Solitary Toxic Thyroid Nodule

    Directory of Open Access Journals (Sweden)

    Mostafa Alfishawy

    2014-01-01

    Full Text Available Background. Pemphigus vulgaris is an autoimmune vesiculobullous disease, affecting the skin and mucous membranes. It is reported to be associated with other autoimmune diseases including autoimmune thyroid diseases. However we report herein a case of pemphigus vulgaris associated with autonomous toxic nodule. Case Presentation. A 51-year-old woman was evaluated for blisters and erosions that develop on her trunk, face, and extremities, with a five-year history of progressively enlarging neck mass, and a past medical history of pemphigus vulgaris seven years ago. The condition was associated with palpitation, dyspnea, and heat intolerance. Thyroid function tests and thyroid scan were compatible with the diagnosis of thyrotoxicosis due to autonomous toxic nodule. Exacerbation of pemphigus vulgaris was proved by skin biopsy from the patient which revealed histologic picture of pemphigus vulgaris. Conclusion. Autoimmune thyroid diseases are reported to associate pemphigus vulgaris. To our knowledge, this case is the first in the English literature to report association between pemphigus vulgaris and autonomous toxic nodule and highlights the possibility of occurrence of pemphigus vulgaris with a nonautoimmune thyroid disease raising the question: is it just a coincidence or is there an explanation for the occurrence of both conditions together?

  19. Vegetative propagation of Bambusa vulgaris

    Directory of Open Access Journals (Sweden)

    Rafael Malfitano Braga

    2017-06-01

    Full Text Available Bamboo is an important source of raw material of multiple uses. The development of simple techniques for its propagation is a practical way to enable its implementation in ownership of low technology. The present work had the objective of evaluating artisanal propagation methods for Bambusa vulgaris. Two types of propagules were tested, with buds budded or not, and three relative positions to the removal of vegetative material on the culm. The best propagule was with only one node, extracted from the lower thirds of the stem, presenting 72% of rooting. This result demonstrates its potential for seedling production of this species under low tech.

  20. Rare earth sulfates

    International Nuclear Information System (INIS)

    Komissarova, L.N.; Shatskij, V.M.; Pokrovskij, A.N.; Chizhov, S.M.; Bal'kina, T.I.; Suponitskij, Yu.L.

    1986-01-01

    Results of experimental works on the study of synthesis conditions, structure and physico-chemical properties of rare earth, scandium and yttrium sulfates, have been generalized. Phase diagrams of solubility and fusibility, thermodynamic and crystallochemical characteristics, thermal stability of hydrates and anhydrous sulfates of rare earths, including normal, double (with cations of alkali and alkaline-earth metals), ternary and anion-mixed sulfates of rare earths, as well as their adducts, are considered. The state of ions of rare earths, scandium and yttrium in aqueous sulfuric acid solutions is discussed. Data on the use of rare earth sulfates are given

  1. Berberis vulgaris: specifications and traditional uses

    Science.gov (United States)

    Rahimi-Madiseh, Mohammad; Lorigoini, Zahra; Zamani-gharaghoshi, Hajar; Rafieian-kopaei, Mahmoud

    2017-01-01

    The medicinal plants from genus Berberis are particularly important in traditional medicine and the food basket of Iranians. Given various plants from genus Berberis and their economic, nutritional, and medicinal status in Iran, this study seeks to investigate the findings of recent studies on the phytochemical characteristics, specifications, and uses of Berberis vulgaris. In this review article, 350 articles were initially retrieved from reliable scientific databases using relevant search terms. Then, 230 articles were selected and 120 were excluded after a primary analysis. Finally, 98 articles related to the subject under study were meticulously examined and the required data were extracted and classified according to the research purposes. The findings were divided into eight separate sections: Introducing Berberidaceae family, different species of Berberis, pharmaceutical organs, B. vulgaris nutrition facts and minerals, the antioxidants and alkaloids compounds in fruit and other organs, action mechanisms of preventing and treating diseases, traditional uses of B. vulgaris, and its properties reported by recent studies. The results briefly indicate that B. vulgaris contains a large number of phytochemical materials including ascorbic acid, vitamin K, several triterpenoids, more than 10 phenolic compounds and more than 30 alkaloids. Therefore B. vulgaris may have anti-cancer, anti-inflammatory, antioxidant, antidiabetic, antibacterial, analgesic and anti-nociceptive and hepato-protective effects. Regarding the use of different organs of B. vulgaris in traditional medicine and their confirmed effects in the recent studies, it is possible to use different organs of B. vulgaris, especially fruit, to develop new drugs. PMID:28656092

  2. Berberis vulgaris: specifications and traditional uses

    Directory of Open Access Journals (Sweden)

    Mohammad Rahimi-Madiseh

    2017-05-01

    Full Text Available The medicinal plants from genus Berberis are particularly important in traditional medicine and the food basket of Iranians. Given various plants from genus Berberis and their economic, nutritional, and medicinal status in Iran, this study seeks to investigate the findings of recent studies on the phytochemical characteristics, specifications, and uses of Berberis vulgaris. In this review article, 350 articles were initially retrieved from reliable scientific databases using relevant search terms. Then, 230 articles were selected and 120 were excluded after a primary analysis. Finally, 98 articles related to the subject under study were meticulously examined and the required data were extracted and classified according to the research purposes. The findings were divided into eight separate sections: Introducing Berberidaceae family, different species of Berberis, pharmaceutical organs, B. vulgaris nutrition facts and minerals, the antioxidants and alkaloids compounds in fruit and other organs, action mechanisms of preventing and treating diseases, traditional uses of B. vulgaris, and its properties reported by recent studies. The results briefly indicate that B. vulgaris contains a large number of phytochemical materials including ascorbic acid, vitamin K, several triterpenoids, more than 10 phenolic compounds and more than 30 alkaloids. Therefore B. vulgaris may have anti-cancer, anti-inflammatory, antioxidant, antidiabetic, antibacterial, analgesic and anti-nociceptive and hepato-protective effects. Regarding the use of different organs of B. vulgaris in traditional medicine and their confirmed effects in the recent studies, it is possible to use different organs of B. vulgaris, especially fruit, to develop new drugs.

  3. Management strategies for acne vulgaris

    Directory of Open Access Journals (Sweden)

    Whitney KM

    2011-04-01

    Full Text Available Kristen M Whitney1, Chérie M Ditre21Philadelphia College of Osteopathic Medicine, Philadelphia, PA, USA; 2Skin Enhancement Center and Cosmetic Dermatology, Department of Dermatology, University of Pennsylvania School of Medicine, Philadelphia, PA, USADate of preparation: 30th November 2010Conflicts of interest: None declaredClinical question: What are the most effective treatment(s for mild, moderate, severe, and hormonally driven acne?Results: Mild acne responds favorably to topical treatments such as benzoyl peroxide, salicylic acid, and a low-dose retinoid. Moderate acne responds well to combination therapy comprising-topical benzoyl peroxide, antibiotics, and/or retinoids, as well as oral antibiotics in refractory cases and oral contraceptive pills for female acne patients. Severe nodulocystic acne vulgaris responds best to oral isotretinoin therapy. In female patients with moderate to severe acne, facial hair, loss of scalp hair and irregular periods, polycystic ovarian syndrome should be considered and appropriate treatment with hormonal modulation given. Adjunctive procedures can also be considered for all acne patients.Implementation: Pitfalls to avoid when treating acne: treatment of acne in women of childbearing age; familiarization of all acne treatments in order to individualize management for patients; indications for specialist referral.Keywords: acne vulgaris, benzoyl peroxide, retinoids, antibiotics, light and laser therapy, photodynamic therapy, photopneumatic therapy, chemical peels

  4. The ceric sulfate dosimeter

    DEFF Research Database (Denmark)

    Bjergbakke, Erling

    1970-01-01

    The process employed for the determination of absorbed dose is the reduction of ceric ions to cerous ions in a solution of ceric sulfate and cerous sulfate in 0.8N sulfuric acid: Ce4+→Ce 3+ The absorbed dose is derived from the difference in ceric ion concentration before and after irradiation...

  5. Heparan sulfate biosynthesis

    DEFF Research Database (Denmark)

    Multhaupt, Hinke A B; Couchman, John R

    2012-01-01

    Heparan sulfate is perhaps the most complex polysaccharide known from animals. The basic repeating disaccharide is extensively modified by sulfation and uronic acid epimerization. Despite this, the fine structure of heparan sulfate is remarkably consistent with a particular cell type. This suggests...... that the synthesis of heparan sulfate is tightly controlled. Although genomics has identified the enzymes involved in glycosaminoglycan synthesis in a number of vertebrates and invertebrates, the regulation of the process is not understood. Moreover, the localization of the various enzymes in the Golgi apparatus has......-quality resolution of the distribution of enzymes. The EXT2 protein, which when combined as heterodimers with EXT1 comprises the major polymerase in heparan sulfate synthesis, has been studied in depth. All the data are consistent with a cis-Golgi distribution and provide a starting point to establish whether all...

  6. streptococcus pneumoniae , klebsiella pneumoniae proteus vulgaris

    African Journals Online (AJOL)

    DR. AMINU

    2-20mm) on Streptococcus pneumoniae and Proteus vulgaris when compared to the ... The result from this preliminary study suggests that the plant contains active compounds that .... Veterinary and Medical Laboratory Technology, Vom,. Jos.

  7. Pulse Clarithromycin Therapy In Severe ACNE Vulgaris

    Directory of Open Access Journals (Sweden)

    Rathi Sanjay K

    2002-01-01

    Full Text Available Three patients with severe acne vulgaris, not responding with long courses of doxycycline, minocycline and erythromycin were given oral clarithromycin in pulsed regimen. The patients were given 7 days course of clarithromycin 250mg twice daily, which was repeated after a gap of 10 days. Such 3 courses were given. The lesions responded significantly. No significant side effect was noted. Pulse clarithromycin therapy seems to be a good alternative and effective tool in the management of severe acne vulgaris.

  8. Neonatal and infantile acne vulgaris: an update.

    Science.gov (United States)

    Serna-Tamayo, Cristian; Janniger, Camila K; Micali, Giuseppe; Schwartz, Robert A

    2014-07-01

    Acne may present in neonates, infants, and small children. Neonatal and infantile acne vulgaris are not considered to be rare. The presentation of acne in this patient population sometimes represents virilization and may portend later development of severe adolescent acne. Neonatal and infantile acne vulgaris must be distinguished from other cutaneous disorders seen in newborns and infants. Infantile acne tends to be more pleomorphic and inflammatory, thus requiring more vigorous therapy than neonatal acne.

  9. Management strategies for acne vulgaris

    Science.gov (United States)

    Whitney, Kristen M; Ditre, Chérie M

    2011-01-01

    Clinical question: What are the most effective treatment(s) for mild, moderate, severe, and hormonally driven acne? Results: Mild acne responds favorably to topical treatments such as benzoyl peroxide, salicylic acid, and a low-dose retinoid. Moderate acne responds well to combination therapy comprising-topical benzoyl peroxide, antibiotics, and/or retinoids, as well as oral antibiotics in refractory cases and oral contraceptive pills for female acne patients. Severe nodulocystic acne vulgaris responds best to oral isotretinoin therapy. In female patients with moderate to severe acne, facial hair, loss of scalp hair and irregular periods, polycystic ovarian syndrome should be considered and appropriate treatment with hormonal modulation given. Adjunctive procedures can also be considered for all acne patients. Implementation: Pitfalls to avoid when treating acne: treatment of acne in women of child-bearing age; familiarization of all acne treatments in order to individualize management for patients; indications for specialist referral. PMID:21691566

  10. Ferrous Sulfate (Iron)

    Science.gov (United States)

    ... are allergic to ferrous sulfate, any other medications tartrazine (a yellow dye in some processed foods and ... in, tightly closed, and out of reach of children. Store it at room temperature and away from ...

  11. Holothurian Fucosylated Chondroitin Sulfate

    Directory of Open Access Journals (Sweden)

    Vitor H. Pomin

    2014-01-01

    Full Text Available Fucosylated chondroitin sulfate (FucCS is a structurally distinct glycosaminoglycan found in sea cucumber species. It has the same backbone composition of alternating 4-linked glucuronic acid and 3-linked N-acetyl galactosamine residues within disaccharide repeating units as regularly found in mammalian chondroitin sulfates. However, FucCS has also sulfated fucosyl branching units 3-O-linked to the acid residues. The sulfation patterns of these branches vary accordingly with holothurian species and account for different biological actions and responses. FucCSs may exhibit anticoagulant, antithrombotic, anti-inflammatory, anticancer, antiviral, and pro-angiogenic activities, besides its beneficial effects in hemodialysis, cellular growth modulation, fibrosis and hyperglycemia. Through an historical overview, this document covers most of the science regarding the holothurian FucCS. Both structural and medical properties of this unique GAG, investigated during the last 25 years, are systematically discussed herein.

  12. DHEA-sulfate test

    Science.gov (United States)

    ... DHEA sulfate may be due to: Adrenal gland disorders that produce lower than normal amounts of adrenal hormones, including adrenal insufficiency and Addison disease The pituitary gland not producing normal amounts of its hormones ( hypopituitarism ) ...

  13. Use of immunomagnetic separation for the detection of Desulfovibrio vulgaris from environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Chakraborty, R.; Hazen, T.C.; Joyner, D.C.; Kusel, K.; Singer, M.E.; Sitte, J.; Torok, T.

    2011-04-15

    Immunomagnetic separation (IMS) has proved highly efficient for recovering microorganisms from heterogeneous samples. Current investigation targeted the separation of viable cells of the sulfate-reducing bacterium, Desulfovibrio vulgaris. Streptavidin-coupled paramagnetic beads and biotin labeled antibodies raised against surface antigens of this microorganism were used to capture D. vulgaris cells in both bioreactor grown laboratory samples and from extremely low-biomass environmental soil and subsurface drilling samples. Initial studies on detection, recovery efficiency and viability for IMS were performed with laboratory grown D. vulgaris cells using various cell densities. Efficiency of cell isolation and recovery (i.e., release of the microbial cells from the beads following separation) was followed by microscopic imaging and acridine orange direct counts (AODC). Excellent recovery efficiency encouraged the use of IMS to capture Desulfovibrio spp. cells from low-biomass environmental samples. The environmental samples were obtained from a radionuclide-contaminated site in Germany and the chromium (VI)-contaminated Hanford site, an ongoing bioremediation project of the U.S. Department of Energy. Field deployable IMS technology may greatly facilitate environmental sampling and bioremediation process monitoring and enable transcriptomics and proteomics/metabolomics-based studies directly on cells collected from the field.

  14. Direct Sulfation of Limestone

    DEFF Research Database (Denmark)

    Hu, Guilin; Dam-Johansen, Kim; Wedel, Stig

    2007-01-01

    The direct sulfation of limestone was studied in a laboratory fixed-bed reactor. It is found that the direct sulfation of limestone involves nucleation and crystal grain growth of the solid product (anhydrite). At 823 K and at low-conversions (less than about 0.5 %), the influences of SO2, O-2...... and CO2 on the direct sulfation of limestone corresponds to apparent reaction orders of about 0.2, 0.2 and -0.5, respectively. Water is observed to promote the sulfation reaction and increase the apparent reaction orders of SO2 and O-2. The influence of O-2 at high O-2 concentrations (> about 15...... %) becomes negligible. In the temperature interval from 723 K to 973 K, an apparent activation energy of about 104 kJ/mol is observed for the direct sulfation of limestone. At low temperatures and low conversions, the sulfation process is most likely under mixed control by chemical reaction and solid...

  15. Evaluation of plant species for use in the control of acid sulfated soils in Paipa, Boyacá

    Directory of Open Access Journals (Sweden)

    Andrea Angélica Bernal Figueroa

    2014-07-01

    Full Text Available Acid sulfated soils are characterized by high amounts of iron and sulfur, which in presence of air are oxidized and form sulfuric horizons extremely acidic, generating environmental changes ranging from water pollution to problems associated with fertility and crop production, among others. This research was conducted in order to identify suitable plant species to control the acidity of these soils in the town of Paipa, Boyacá, Colombia. A completely randomized experimental design with 6 treatments and 3 replications was implemented in potting shed; there, the response of Beta vulgaris L. (forage beet, Brassica rapa L. (forage turnip and Raphanus sativus L. (forage radish on the acidity of sulfated acid soil, contrasted with a non-sulfated soil, was evaluated, after correction with liming. To assess the effects, pH and exchangeable acidity (H+ + Al+3 cmolc/kg were measured in the two types of soil before and after seeding ; the agronomic response of plants in each treatment was determined at the end of the growing season (120 days after seeding . On acid sulfated soils, species B. rapa, R. sativus and B. vulgaris along with the complementary use of liming as corrective induced a reduction in exchangeable acidity; B. rapa and R. sativus showed better growth potential and resistance, while B. vulgaris was affected in height and root diameter.

  16. Microbial reduction of structural iron in interstratified illite-smectite minerals by a sulfate-reducing bacterium.

    Science.gov (United States)

    Liu, D; Dong, H; Bishop, M E; Zhang, J; Wang, H; Xie, S; Wang, S; Huang, L; Eberl, D D

    2012-03-01

    Clay minerals are ubiquitous in soils, sediments, and sedimentary rocks and could coexist with sulfate-reducing bacteria (SRB) in anoxic environments, however, the interactions of clay minerals and SRB are not well understood. The objective of this study was to understand the reduction rate and capacity of structural Fe(III) in dioctahedral clay minerals by a mesophilic SRB, Desulfovibrio vulgaris and the potential role in catalyzing smectite illitization. Bioreduction experiments were performed in batch systems, where four different clay minerals (nontronite NAu-2, mixed-layer illite-smectite RAr-1 and ISCz-1, and illite IMt-1) were exposed to D. vulgaris in a non-growth medium with and without anthraquinone-2,6-disulfonate (AQDS) and sulfate. Our results demonstrated that D. vulgaris was able to reduce structural Fe(III) in these clay minerals, and AQDS enhanced the reduction rate and extent. In the presence of AQDS, sulfate had little effect on Fe(III) bioreduction. In the absence of AQDS, sulfate increased the reduction rate and capacity, suggesting that sulfide produced during sulfate reduction reacted with the phyllosilicate Fe(III). The extent of bioreduction of structural Fe(III) in the clay minerals was positively correlated with the percentage of smectite and mineral surface area of these minerals. X-ray diffraction, and scanning and transmission electron microscopy results confirmed formation of illite after bioreduction. These data collectively showed that D. vulgaris could promote smectite illitization through reduction of structural Fe(III) in clay minerals. © 2011 Blackwell Publishing Ltd.

  17. Growth of desulfovibrio in lactate or ethanol media low in sulfate in association with H2-utilizing methanogenic bacteria.

    Science.gov (United States)

    Bryant, M P; Campbell, L L; Reddy, C A; Crabill, M R

    1977-05-01

    In the analysis of an ethanol-CO(2) enrichment of bacteria from an anaerobic sewage digestor, a strain tentatively identified as Desulfovibrio vulgaris and an H(2)-utilizing methanogen resembling Methanobacterium formicicum were isolated, and they were shown to represent a synergistic association of two bacterial species similar to that previously found between S organism and Methanobacterium strain MOH isolated from Methanobacillus omelianskii. In lowsulfate media, the desulfovibrio produced acetate and H(2) from ethanol and acetate, H(2), and, presumably, CO(2) from lactate; but growth was slight and little of the energy source was catabolized unless the organism was combined with an H(2)-utilizing methanogenic bacterium. The type strains of D. vulgaris and Desulfovibrio desulfuricans carried out the same type of synergistic growth with methanogens. In mixtures of desulfovibrio and strain MOH growing on ethanol, lactate, or pyruvate, diminution of methane produced was stoichiometric with the moles of sulfate added, and the desulfovibrios grew better with sulfate addition. The energetics of the synergistic associations and of the competition between the methanogenic system and sulfate-reducing system as sinks for electrons generated in the oxidation of organic materials such as ethanol, lactate, and acetate are discussed. It is suggested that lack of availability of H(2) for growth of methanogens is a major factor in suppression of methanogenesis by sulfate in natural ecosystems. The results with these known mixtures of bacteria suggest that hydrogenase-forming, sulfate-reducing bacteria could be active in some methanogenic ecosystems that are low in sulfate.

  18. PEMANFAATAN MIKROALGA LAUT Chlorella vulgaris SUMBER DHA DAN EPA

    OpenAIRE

    Anggraeni, Peni

    2016-01-01

    Penelitian tentang mikroalga laut jenis Chlorella vulgaris telah dilakukan. Chlorella vulgaris dipilih sebagai bahan penambah gizi untuk di fortifikasi kedalam makanan . Penelitian ini bertujuan untuk mengetahui kandungan gizi dengan menganalisis kandungan DHA dan EPA. Penelitian ini dilakukan dengan mengkultur fitoplankton Chlorella vulgaris dan dipanen setelah media kultur mencapai fase Stasioner. Kemudian, dikeringkan dengan menggunakan freeze dryer, biomassa kering dianalisis kandungan DH...

  19. Complementary therapies for acne vulgaris.

    Science.gov (United States)

    Cao, Huijuan; Yang, Guoyan; Wang, Yuyi; Liu, Jian Ping; Smith, Caroline A; Luo, Hui; Liu, Yueming

    2015-01-19

    Acne is a chronic skin disease characterised by inflamed spots and blackheads on the face, neck, back, and chest. Cysts and scarring can also occur, especially in more severe disease. People with acne often turn to complementary and alternative medicine (CAM), such as herbal medicine, acupuncture, and dietary modifications, because of their concerns about the adverse effects of conventional medicines. However, evidence for CAM therapies has not been systematically assessed. To assess the effects and safety of any complementary therapies in people with acne vulgaris. We searched the following databases from inception up to 22 January 2014: the Cochrane Skin Group Specialised Register, the Cochrane Central Register of Controlled Trials (CENTRAL; 2014,Issue 1), MEDLINE (from 1946), Embase (from 1974), PsycINFO (from 1806), AMED (from 1985), CINAHL (from 1981), Scopus (from 1966), and a number of other databases listed in the Methods section of the review. The Cochrane CAM Field Specialised Register was searched up to May 2014. We also searched five trials registers and checked the reference lists of articles for further references to relevant trials. We included parallel-group randomised controlled trials (or the first phase data of randomised cross-over trials) of any kind of CAM, compared with no treatment, placebo, or other active therapies, in people with a diagnosis of acne vulgaris. Three authors collected data from each included trial and evaluated the methodological quality independently. They resolved disagreements by discussion and, as needed, arbitration by another author. We included 35 studies, with a total of 3227 participants. We evaluated the majority as having unclear risk of selection, attrition, reporting, detection, and other biases. Because of the clinical heterogeneity between trials and the incomplete data reporting, we could only include four trials in two meta-analyses, with two trials in each meta-analysis. The categories of CAM included

  20. Complementary therapies for acne vulgaris

    Science.gov (United States)

    Cao, Huijuan; Yang, Guoyan; Wang, Yuyi; Liu, Jian Ping; Smith, Caroline A; Luo, Hui; Liu, Yueming

    2015-01-01

    Background Acne is a chronic skin disease characterised by inflamed spots and blackheads on the face, neck, back, and chest. Cysts and scarring can also occur, especially in more severe disease. People with acne often turn to complementary and alternative medicine (CAM), such as herbal medicine, acupuncture, and dietary modifications, because of their concerns about the adverse effects of conventional medicines. However, evidence for CAM therapies has not been systematically assessed. Objectives To assess the effects and safety of any complementary therapies in people with acne vulgaris. Search methods We searched the following databases from inception up to 22 January 2014: the Cochrane Skin Group Specialised Register, the Cochrane Central Register of Controlled Trials (CENTRAL; 2014, Issue 1), MEDLINE (from 1946), Embase (from 1974), PsycINFO (from 1806), AMED (from 1985), CINAHL (from 1981), Scopus (from 1966), and a number of other databases listed in the Methods section of the review. The Cochrane CAM Field Specialised Register was searched up to May 2014. We also searched five trials registers and checked the reference lists of articles for further references to relevant trials. Selection criteria We included parallel-group randomised controlled trials (or the first phase data of randomised cross-over trials) of any kind of CAM, compared with no treatment, placebo, or other active therapies, in people with a diagnosis of acne vulgaris. Data collection and analysis Three authors collected data from each included trial and evaluated the methodological quality independently. They resolved disagreements by discussion and, as needed, arbitration by another author. Main results We included 35 studies, with a total of 3227 participants. We evaluated the majority as having unclear risk of selection, attrition, reporting, detection, and other biases. Because of the clinical heterogeneity between trials and the incomplete data reporting, we could only include four

  1. Ferti-irrigational impact of sugar mill effluent on agronomical characteristics of Phaseolus vulgaris (L.) in two seasons.

    Science.gov (United States)

    Kumar, Vinod; Chopra, A K

    2014-11-01

    Ferti-irrigation response of 5, 10, 25, 50, 75, and 100 % concentrations of the sugar mill effluent (SME) on French bean (Phaseolus vulgaris L., cv. Annapurna) in the rainy and summer seasons was investigated. The fertigant concentrations produced significant (P potassium (K(+)), calcium (Ca(2+)), magnesium (Mg(2+)), total Kjeldahl nitrogen (TKN), phosphate (PO4 (3-)), sulfate (SO4 (2-)), ferrous (Fe(2+)), cadmium (Cd), chromium (Cr), copper (Cu), manganese (Mn), and zinc (Zn), in both seasons. The contents of Cr, Cu, Mn, and Zn except Cd were found to be below the maximum levels permitted for soils in India. The agronomic performance of P. vulgaris was gradually increased at lower concentrations, i.e., from 5 to 25 %, and decreased at higher concentrations, i.e., from 50 to 100 %, of the SME in both seasons when compared to controls. The accumulations of heavy metals were increased in the soil and P. vulgaris from 5 to 100 % concentrations of the SME in both seasons. The contents of Cu, Mn, and Zn except Cd and Cr were noted under the permissible limit of Food and Agriculture Organization (FAO)/World Health Organization (WHO) standards. Most contents of biochemical components like crude proteins, crude fiber, and total carbohydrates were found with 25 % concentration of the SME in both seasons. The contamination factor (Cf) of various metals was in the order of Cd > Cr > Zn > Mn > Cu for soil and Mn > Zn > Cu > Cr > Cd for P. vulgaris in both seasons after fertigation with SME. Therefore, the SME can be used to improve the soil fertility and yield of P. vulgaris after appropriate dilution.

  2. Sulfate metabolism. I. Sulfate uptake and redistribution of acid rain sulfate by edible plants

    International Nuclear Information System (INIS)

    Dallam, R.D.

    1987-01-01

    Sulfur is the major component of polluted air in industrialized societies. Atmospheric sulfur is converted to sulfuric acid through a series of chemical reactions which can eventually reenter many ecosystems. When edible plants are grown in soils containing varying amounts of sulfate, the roots take up and transport inorganic sulfate to the stems and leaves. The sulfate taken up by the roots and the amount transported to the stem and leaves was found to be a function of the concentration of sulfate in the soil. Inorganic sulfate taken up by a corn plant seedling can be rapidly converted to organic sulfate by the root system. Nine days after one of a pair of pea plants was inoculated with artificial acid rain sulfate (dilute H 2 35 SO 4 ) it was found that the sulfate was translocated not only in the inoculated plant, but also to the uninoculated pea plant in the same container. Also, when the leaves of a mature potato plant were inoculated with artificial acid rain sulfate it was found that the sulfate was translocated into the edible potatoes. Fractionation of the potatoes showed that most of the sulfate was water soluble of which 30% was inorganic sulfate and 70% was in the form of organic sulfur. One third of the non-water soluble translocated acid rain sulfate was equally divided between lipid and non-lipid organic sulfur of the potato. 9 references, 2 figures, 5 tables

  3. Ichthyosis vulgaris: the filaggrin mutation disease.

    Science.gov (United States)

    Thyssen, J P; Godoy-Gijon, E; Elias, P M

    2013-06-01

    Ichthyosis vulgaris is caused by loss-of-function mutations in the filaggrin gene (FLG) and is characterized clinically by xerosis, scaling, keratosis pilaris, palmar and plantar hyperlinearity, and a strong association with atopic disorders. According to the published studies presented in this review article, FLG mutations are observed in approximately 7·7% of Europeans and 3·0% of Asians, but appear to be infrequent in darker-skinned populations. This clinical review article provides an overview of ichthyosis vulgaris epidemiology, related disorders and pathomechanisms. Not only does ichthyosis vulgaris possess a wide clinical spectrum, recent studies suggest that carriers of FLG mutations may have a generally altered risk of developing common diseases, even beyond atopic disorders. Mechanistic studies have shown increased penetration of allergens and chemicals in filaggrin-deficient skin, and epidemiological studies have found higher levels of hand eczema, irritant contact dermatitis, nickel sensitization and serum vitamin D levels. When relevant, individuals should be informed about an increased risk of developing dermatitis when repeatedly or continuously exposed to nickel or irritants. Moreover, with our current knowledge, individuals with ichthyosis vulgaris should be protected against neonatal exposure to cats to prevent atopic dermatitis and should abstain from smoking to prevent asthma. Finally, they should be advised against excessive exposure to factors that decrease skin barrier functions and increase the risk of atopic dermatitis. © 2013 The Authors. BJD © 2013 British Association of Dermatologists.

  4. Fulminante, rituximab-resistente, mucocutane pemphigus vulgaris

    NARCIS (Netherlands)

    Gostyński, A.; Ammatuna, E.; Huls, G.; Wouthuyzen-Bakker, M.; Jonkman, M. F.; Horváth, B.

    2017-01-01

    Pemphigus vulgaris is an autoimmune disease mediated by auto-antibodies against desmoglein 1 and 3. First line treatment for pemphigus consists of systemic corticosteroids and anti-CD20 therapy (rituximab) to eliminate B-cells. Since 2005, more than 100 patients with pemphigus have been treated with

  5. Dissolution of sulfate scales

    Energy Technology Data Exchange (ETDEWEB)

    Hen, J.

    1991-11-26

    This patent describes a composition for the removal of sulfate scale from surfaces. It comprises: an aqueous solution of about 0.1 to 1.0 molar concentration of an aminopolycarboxylic acid (APCA) containing 1 to 4 amino groups or a salt thereof, and about 0.1 to 1.0 molar concentration of a second component which is diethylenetriaminepenta (methylenephosphonic acid) (DTPMP) or a salt thereof, or aminotri (methylenephosphonic acid) (ATMP) or a salt thereof as an internal phase enveloped by a hydrocarbon membrane phase which is itself emulsified in an external aqueous phase, the hydrocarbon membrane phase continuing a complexing agent weaker for the cations of the sulfate scale than the APCA and DTPMP or ATMP, any complexing agent for the cations in the external aqueous phase being weaker than that in the hydrocarbon membrane phase.

  6. Radioimmunoassay of dehydroepiandrosterone sulfate

    International Nuclear Information System (INIS)

    Vieira, J.G.H.; Furlanetto, R.P.; Russo, E.M.K.; Noguti, K.O.; Chacra, A.R.

    1980-01-01

    The development of a radioimmunological method for the measurement of dehydroepiandrosterone sulfate in serum is described. For the immunization of rabbits, a DHA-3-hemissuccinate-bovine serum albumin conjugate was synthetized and a highly specific anti-serum was produced. The method developed requires only simple dilution prior to assay and the normal values for the different age groups were determined in 146 normal individuals. (Author) [pt

  7. Sulfation of chondroitin. Specificity, degree of sulfation, and detergent effects with 4-sulfating and 6-sulfating microsomal systems

    International Nuclear Information System (INIS)

    Sugumaran, G.; Silbert, J.E.

    1988-01-01

    Microsomal preparations from chondroitin 6-sulfate-producing chick embryo epiphyseal cartilage, and from chondroitin 4-sulfate-producing mouse mastocytoma cells, were incubated with UDP-[14C]glucuronic acid and UDP-N-acetylgalactosamine to form non-sulfated proteo[14C]chondroitin. Aliquots of the incubations were then incubated with 3'-phosphoadenylylphosphosulfate (PAPS) in the presence or absence of various detergents. In the absence of detergents, there was good sulfation of this endogenous proteo[14C]chondroitin by the original microsomes from both sources. Detergents, with the exception of Triton X-100, markedly inhibited sulfation in the mast cell system but not in the chick cartilage system. These results indicate that sulfation and polymerization are closely linked on cell membranes and that in some cases this organization can be disrupted by detergents. When aliquots of the original incubation were heat inactivated, and then reincubated with new microsomes from chick cartilage and/or mouse mastocytoma cells plus PAPS, there was no significant sulfation of this exogenous proteo[14C] chondroitin with either system unless Triton X-100 was added. Sulfation of exogenous chondroitin and chondroitin hexasaccharide was compared with sulfation of endogenous and exogenous proteo[14C]chondroitin. Sulfate incorporation into hexasaccharide and chondroitin decreased as their concentrations (based on uronic acid) approached that of the proteo[14C]chondroitin. At the same time, the degree of sulfation in percent of substituted hexosamine increased. However, the degree of sulfation did not reach that of the endogenous proteo[14C]chondroitin. Hexasaccharide and chondroitin sulfation were stimulated by the presence of Triton X-100. However, in contrast to the exogenous proteo[14C]chondroitin, there was some sulfation of hexasaccharide and chondroitin in the absence of this detergent

  8. Changes in hemostasis in foals naturally infected with Strongylus vulgaris

    DEFF Research Database (Denmark)

    Pihl, Tina Holberg; Krarup Nielsen, Martin; Jacobsen, Stine

    2017-01-01

    Strongylus vulgaris has been found endemic in equine populations subject to parasite control by targeted selective anthelmintic therapy. This study investigated hemostasis in foals naturally infected with S. vulgaris and monitored this response over the course of progressing infection stages...... 4. Strongylus vulgaris antibody levels were statistically associated with D-dimer (P = .0076) and fibrinogen (P = .0004) concentrations. Naturally acquired infection with S. vulgaris was associated with changes suggestive of mild activation of coagulation, fibrinolysis, and inflammation. The results....... The hemostatic indices D-dimer, antithrombin III (ATIII), fibrinogen, prothrombin time (PT), and activated partial thromboplastin time were evaluated in weekly blood samples for up to 50 weeks in 12 foals born into a herd with high prevalence of S. vulgaris. Results were compared with weekly S. vulgaris antibody...

  9. Variation in the Breeding System of Prunella vulgaris L

    OpenAIRE

    Qu, Luping; Widrlechner, Mark P.

    2011-01-01

    Prunella vulgaris (Lamiaceae), commonly known as selfheal, is a perennial herb with a long history of use in traditional medicine. Recent studies have found that P. vulgaris possesses anti-inflammatory, antiviral, and antibacterial properties, and it is likely that this will lead to increased commercial demand for this species. To date, research publications on P. vulgaris cultivation and genetics are scarce. Using accessions originally collected from different geographical regions, we invest...

  10. Enhanced sulfate reduction with acidogenic sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Wang Aijie; Ren Nanqi; Wang Xu; Lee Duujong

    2008-01-01

    Sulfate reduction in a continuous flow, acidogenic reactor using molasses wastewater as the carbon source was studied at varying chemical oxygen demand/sulfate (COD/SO 4 2- ) ratios. At a critical COD/SO 4 2- ratio of 2.7, neither COD nor sulfate were in excess for extra production of ethanol or acetate in the reactor. An acetic-type microbial metabolism was established with sulfate-reducing bacteria (SRB) significantly consuming hydrogen and volatile fatty acids produced by acidogenic bacteria and hydrogen producing acetogens in degrading COD, thereby yielding sulfate removal rate >94.6%. A low critical COD/SO 4 2- ratio of 1.6 was also observed with the enriched ASRB population in reactor which overcomes the barrier to the treatment capability of sulfate-laden wastewater treatment with limited COD supply

  11. Comparison of transcriptional heterogeneity of eight genes between batch Desulfovibrio vulgaris biofilm and planktonic culture at a single-cell level

    Directory of Open Access Journals (Sweden)

    Zhenhua eQi

    2016-04-01

    Full Text Available Sulfate-reducing bacteria (SRB biofilm formed on metal surfaces can change the physicochemical properties of metals and cause metal corrosion. To enhance understanding of differential gene expression in Desulfovibrio vulgaris under planktonic and biofilm growth modes, a single-cell based RT-qPCR approach was applied to determine gene expression levels of 8 selected target genes in four sets of the 31 individual cells isolated from each growth condition (i.e., biofilm formed on a stainless steel (SS) and planktonic cultures, exponential and stationary phases. The results showed obvious gene-expression heterogeneity for the target genes among D. vulgaris single cells of both biofilm and planktonic cultures. In addition, an increased gene-expression heterogeneity in the D. vulgaris biofilm when compared with the planktonic culture was also observed for seven out of eight selected genes, which may be contributing to the increased complexity in terms of structures and morphology in the biofilm. Moreover, the results showed up-regulation of DVU0281 gene encoding exopolysaccharide biosynthesis protein, and down-regulation of genes involved in energy metabolism (i.e., DVU0434 and DVU0588, stress responses (i.e., DVU2410 and response regulator (i.e., DVU3062 in the D. vulgaris biofilm cells. Finally, the gene (DVU2571 involved in iron transportation was found down-regulated, and two genes (DVU1340 and DVU1397 involved in ferric uptake repressor and iron storage were up-regulated in D. vulgaris biofilm, suggesting their possible roles in maintaining normal metabolism of the D. vulgaris biofilm under environments of high concentration of iron. This study showed that the single-cell based analysis could be a useful approach in deciphering metabolism of microbial biofilms.

  12. [Diet in pathogenesis of acne vulgaris].

    Science.gov (United States)

    Ozdarska, Katarzyna; Osucha, Karolina; Savitskyi, Stepan; Malejczyk, Jacek; Galus, Ryszard

    2017-10-23

    Acne vulgaris is one of the most common dermatologic condition especially among adolescents. Acne is related to excess sebum production by sebaceous glands, inflammation both within and adjacent to the comedones, hyperproliferation of Propionibacterium acnes. Some of investigations show association between acne and diet. Milk increases the level of IGF-1 leading to the synthesis of androgen-mediated increases sebum production. Chocolate predispose to hyperglycemia and insulinemia which aggravate of acne vulgaris. High levels of omega-6 fatty acids have been associated with increase of acne in contrast to omega-3 fatty acids, which decrease inflammation. Food have huge impact on development and severity of acne and may exert beneficial effect in the treatment of this disorder.

  13. The Psychosocial Impact of Acne Vulgaris

    Science.gov (United States)

    Hazarika, Neirita; Archana, M

    2016-01-01

    Background: Acne vulgaris causes erythematous papulopustular lesions in active stage and often leave behind residual scarring and pigmentation. Its onset in adolescence may add to the emotional and psychological challenges experienced during this period. Aims: To assess the impact of acne on the various psychosocial domains of daily life. Materials and Methods: This was a prospective, cross-sectional study done in the dermatology out-patient department of a tertiary care hospital from January to March 2015. A total of 100 consecutive, newly diagnosed patients of acne vulgaris, aged 15 years and above were included in this study. The relationship between acne vulgaris and its sequelae was analyzed with ten different domains of daily life by using dermatology life quality index (DLQI) questionnaire. Results: Females (56%), 15–20 year olds (61%), facial lesions (60%), and Grade II acne (70%) were most common. Acne scars were noted in 75% patients, whereas 79% cases had post-acne hyperpigmentation. Thirty-seven percent patients had DLQI scores of (6–10) interpreted as moderate effect on patient's life. Statistically significant correlation (P acne; embarrassment with site and grade of acne; daily activities with grade of acne and post-acne pigmentation; choice of clothes with site of acne; social activities with gender, site and grade of acne; effect on work/study with grade of acne; interpersonal problems with site and post-acne pigmentation; sexual difficulties with grade of acne. Limitation: It was a hospital-based study with small sample size. Conclusion: Significant impact of acne and its sequelae was noted on emotions, daily activities, social activities, study/work, and interpersonal relationships. Assurance and counseling along with early treatment of acne vulgaris is important to reduce disease-related psychosocial sequelae and increase the efficacy of treatment. PMID:27688440

  14. The Psychosocial Impact of Acne Vulgaris.

    Science.gov (United States)

    Hazarika, Neirita; Archana, M

    2016-01-01

    Acne vulgaris causes erythematous papulopustular lesions in active stage and often leave behind residual scarring and pigmentation. Its onset in adolescence may add to the emotional and psychological challenges experienced during this period. To assess the impact of acne on the various psychosocial domains of daily life. This was a prospective, cross-sectional study done in the dermatology out-patient department of a tertiary care hospital from January to March 2015. A total of 100 consecutive, newly diagnosed patients of acne vulgaris, aged 15 years and above were included in this study. The relationship between acne vulgaris and its sequelae was analyzed with ten different domains of daily life by using dermatology life quality index (DLQI) questionnaire. Females (56%), 15-20 year olds (61%), facial lesions (60%), and Grade II acne (70%) were most common. Acne scars were noted in 75% patients, whereas 79% cases had post-acne hyperpigmentation. Thirty-seven percent patients had DLQI scores of (6-10) interpreted as moderate effect on patient's life. Statistically significant correlation (P < 0.05) found were as follows: Physical symptoms with grade of acne; embarrassment with site and grade of acne; daily activities with grade of acne and post-acne pigmentation; choice of clothes with site of acne; social activities with gender, site and grade of acne; effect on work/study with grade of acne; interpersonal problems with site and post-acne pigmentation; sexual difficulties with grade of acne. It was a hospital-based study with small sample size. Significant impact of acne and its sequelae was noted on emotions, daily activities, social activities, study/work, and interpersonal relationships. Assurance and counseling along with early treatment of acne vulgaris is important to reduce disease-related psychosocial sequelae and increase the efficacy of treatment.

  15. The psychosocial impact of acne vulgaris

    Directory of Open Access Journals (Sweden)

    Neirita Hazarika

    2016-01-01

    Full Text Available Background: Acne vulgaris causes erythematous papulopustular lesions in active stage and often leave behind residual scarring and pigmentation. Its onset in adolescence may add to the emotional and psychological challenges experienced during this period. Aims: To assess the impact of acne on the various psychosocial domains of daily life. Materials and Methods: This was a prospective, cross-sectional study done in the dermatology out-patient department of a tertiary care hospital from January to March 2015. A total of 100 consecutive, newly diagnosed patients of acne vulgaris, aged 15 years and above were included in this study. The relationship between acne vulgaris and its sequelae was analyzed with ten different domains of daily life by using dermatology life quality index (DLQI questionnaire. Results: Females (56%, 15–20 year olds (61%, facial lesions (60%, and Grade II acne (70% were most common. Acne scars were noted in 75% patients, whereas 79% cases had post-acne hyperpigmentation. Thirty-seven percent patients had DLQI scores of (6–10 interpreted as moderate effect on patient's life. Statistically significant correlation (P < 0.05 found were as follows: Physical symptoms with grade of acne; embarrassment with site and grade of acne; daily activities with grade of acne and post-acne pigmentation; choice of clothes with site of acne; social activities with gender, site and grade of acne; effect on work/study with grade of acne; interpersonal problems with site and post-acne pigmentation; sexual difficulties with grade of acne. Limitation: It was a hospital-based study with small sample size. Conclusion: Significant impact of acne and its sequelae was noted on emotions, daily activities, social activities, study/work, and interpersonal relationships. Assurance and counseling along with early treatment of acne vulgaris is important to reduce disease-related psychosocial sequelae and increase the efficacy of treatment.

  16. [Acne vulgaris: morphologic, endocrinologic and psychosomatic aspects].

    Science.gov (United States)

    Welp, K; Gieler, U

    1990-12-01

    25 male patients suffering from acne vulgaris were examined by means of endocrinological, morphological, and 5 psychometric procedures in order to check the correlations and interactions between the psychological and dermatological aspects of the disease. In comparison with a control group, the acne patients did not show any striking endocrinological abnormalities; we found no correlation between the extensiveness of the lesions and the level of DHEA sulphate. All the psychological tests yielded results deviating from those achieved by the representative controls, but they were comparable with those of other patients suffering from psychosomatic diseases. The individual feeling of being "disfigured" found its expression in self-consciousness, lack of trust in his/her own body, as well as the clinically relevant difference between his/her conception of self and the ideal of self. During times of enhanced psychosocial strains subjectively assumed by the patients, the lesions increased and the patients were disturbed in social interaction and communication. Surprisingly, we did not find any correlation between the clinical status and significant psychometric findings. Our results show that in acne vulgaris, the individual experience of wanting physical attractiveness, associated with a predominantly neurotic depressive personal structure, may play a central part in a disturbed process of interaction with the environment and suggest the influence of psychic factors in the pathogenesis of acne vulgaris.

  17. Syndecan heparan sulfate proteoglycans

    DEFF Research Database (Denmark)

    Gomes, Angélica Maciel; Sinkeviciute, Dovile; Multhaupt, Hinke A.B.

    2016-01-01

    discuss how, in partial catabolic processes, new roles for HSPGs emerge that affect cell behavior. Examples from tumor studies are emphasized, since HSPGs may be altered in composition and distribution and may also represent targets for the development of new therapeutics....... signaling can therefore be complex, but it is now known that syndecans are capable of independent signaling. This review is divided in two sections, and will first discuss how the assembly of heparan sulfate, the anabolic process, encodes information related to ligand binding and signaling. Second, we...

  18. 2-Amino-4-hydroxyethylaminoanisole sulfate

    DEFF Research Database (Denmark)

    Madsen, Jakob T; Andersen, Klaus E

    2016-01-01

    positive patch test reactions to the coupler 2-amino-4-hydroxyethylaminoanisole sulfate 2% pet. from 2005 to 2014. METHODS: Patch test results from the Allergen Bank database for eczema patients patch tested with 2-amino-4-hydroxyethylaminoanisole sulfate 2% pet. from 2005 to 2014 were reviewed. RESULTS......: A total of 902 dermatitis patients (154 from the dermatology department and 748 from 65 practices) were patch tested with amino-4-hydroxyethylaminoanisole sulfate 2% pet. from 2005 to 2014. Thirteen (1.4%) patients had a positive patch test reaction. Our results do not indicate irritant reactions....... CONCLUSIONS: 2-Amino-4-hydroxyethylaminoanisole sulfate is a new but rare contact allergen....

  19. Morpholine-4-carboxamidinium sulfate

    Directory of Open Access Journals (Sweden)

    Ioannis Tiritiris

    2016-01-01

    Full Text Available The asymmetric unit of the title salt, 2C5H12N3O+·SO42−, comprises two cations and one sulfate ion. In both cations, the C, N and O atoms of the morpholine rings are disordered over two sets of sites, with refined occupancies of 0.849 (3:0.151 (3 for cation I and 0.684 (4:0.316 (4 for cation II. The C—N bond lengths in both central C3N units of the carboxamidinium ions range between 1.253 (12 and 1.362 (5 Å, indicating a degree of double-bond character. The central C atoms are bonded to the three N atoms in a nearly ideal trigonal–planar geometry and the positive charges are delocalized in both CN3 planes. The crystal structure is stabilized by a three-dimensional network of N—H...O hydrogen bonds between the cations and the sulfate ion. Scheme tiny font, charges and delocalized bonds almost invisible

  20. Antioxidant effect of Citrullus vulgaris (watermelon) extract against ...

    African Journals Online (AJOL)

    The Antioxidant effect of Citrullus Vulgaris (Watermelon) extract was evaluated against lipid oxidation in freshly caught fishes during cooking. GC-MS analysis of Hexane and total phenolic extract of Citrullus Vulgaris flesh reveals that the extracts contain 55 compounds which includes 5- hydroxymethyl furfural, ...

  1. Energy-Based Devices in Treatment of Acne Vulgaris.

    Science.gov (United States)

    Handler, Marc Z; Bloom, Bradley S; Goldberg, David J

    2016-05-01

    Acne vulgaris is a chronic dermatologic complaint with a multifactorial cause. Traditionally, antibiotics and retinoids have been used to manage the condition; patient compliance has been an ongoing issue. A variety of energy-based devices have been reported to be effective in the treatment of acne vulgaris. To review and summarize the current literature specific to treatment of acne vulgaris with energy-based devices. A review of the current literature of energy-based devices used for the treatment of acne vulgaris. Although limited randomized controlled trials for the treatment of acne have been performed, significant clinical improvement of acne vulgaris, especially of inflammatory lesions, has been demonstrated with a variety of energy-based devices. Newer approaches may lead to even better results.

  2. INTRACELLULAR SYNTHESIS OF CHONDROITIN SULFATE

    Science.gov (United States)

    Dziewiatkowski, Dominic D.

    1962-01-01

    In autoradiograms of slices of costal cartilage, incubated for 4 hours in a salt solution containing S35-sulfate and then washed extensively and dehydrated, about 85 per cent of the radioactivity was assignable to the chondrocytes. From alkaline extracts of similarly prepared slices of cartilage, 64 to 83 per cent of the total sulfur-35 in the slices was isolated as chondroitin sulfate by chromatography on an anion-exchange resin. In view of the estimate that only about 15 per cent of the radioactivity was in the matrix, the isolation of 64 to 83 per cent of the total sulfur-35 as chondroitin sulfate is a strong argument that the chondrocytes are the loci in which chondroitin sulfate(s) is synthesized. PMID:13888910

  3. Clinical characteristics and epidermal barrier function of papulopustular rosacea: A comparison study with acne vulgaris.

    Science.gov (United States)

    Zhou, Maosong; Xie, Hongfu; Cheng, Lin; Li, Ji

    2016-01-01

    To evaluate the clinical characteristics and epidermal barrier function of papulopustular rosacea by comparing with acne vulgaris. Four hundred and sixty-three papulopustular rosacea patients and four hundred and twelve acne vulgaris patients were selected for the study in Xiangya Hospital of Central South University from March 2015 to May 2016. They were analyzed for major facial lesions, self-conscious symptoms and epidermal barrier function. Erythema, burning, dryness and itching presented in papulopustular rosacea patients were significantly higher than that in acne vulgaris patients ( P acne vulgaris patients ( P acne vulgaris patients ( P acne vulgaris patients in comparison with that of healthy subjects ( P >0.05, P acne vulgaris patients and healthy subjects ( P acne vulgaris patients than that of healthy subjects ( P acne vulgaris. The epidermal barrier function was damaged in papulopustular rosacea patients while not impaired in that of acne vulgaris patients.

  4. Nootropic effect of meadowsweet (Filipendula vulgaris) extracts.

    Science.gov (United States)

    Shilova, I V; Suslov, N I

    2015-03-01

    The effects of the extracts of the aboveground parts of Filipendula vulgaris Moench on the behavior and memory of mice after hypoxic injury and their physical performance in the open-field test were studied using the models of hypoxia in a sealed volume, conditioned passive avoidance response (CPAR), and forced swimming with a load. The extracts improved animal resistance to hypoxia, normalized orientation and exploration activities, promoted CPAR retention after hypoxic injury, and increased physical performance. Aqueous extract of meadowsweet had the most pronounced effect that corresponded to the effect of the reference drug piracetam. These effects were probably caused by modulation of hippocampal activity.

  5. Clinico- Pathological Study Of Ichthyosis Vulgaris

    Directory of Open Access Journals (Sweden)

    Nandy Utpal

    1997-01-01

    Full Text Available A clinico- pathological study of 28 cases of ichthyosis vulgaris appeared with in the age of 5 years. The presence of the disease since birth was also found. While most (24 patients showed a diminution of severity in summer with an aggravation during winter, 4 patients followed the opposite seasonal pattern. Only in 4 patients, fine scales in the scalp were detected. One patient showed an affection of flexures. There was also a low occurrence of palmo- planter hyperkeratosis, follicular keratosis, fissuring of hands and feet and atopy.

  6. Observations on the epidemiology and control of Strongylus vulgaris infections.

    Science.gov (United States)

    Eysker, M; Wemmenhove, R

    1987-01-01

    The epidemiology and control of helminth infections in the horse were studied in four small grazing experiments between 1981 and 1984 at the University of Utrecht. At autopsy in November or December negligible Strongylus vulgaris burdens were found in the cranial mesenteric artery of four groups of ponies, which had been treated with an anthelmintic in July and subsequently transferred to a clean pasture. Considerable arterial S. vulgaris burdens were seen in three groups of ponies which were treated with an anthelmintic in July without a move to clean pasture, and in another group of ponies in 1984, which was set stocked on a pasture used for horses in 1983 and which was treated with an anthelmintic (albendazole) 2 days before turnout in April and subsequently in May, June and July. A tracer pony, grazed with this group between the middle of September and the middle of November, harboured an even higher burden of arterial S. vulgaris larvae. The arterial S. vulgaris in the latter group could not be the result of contamination of the pasture with S. vulgaris eggs before July, as in the three other groups with considerable arterial S. vulgaris burdens. Pasture larval counts showed that S. vulgaris larvae do not only overwinter, but are able to survive in considerable numbers until autumn, longer than most other gastrointestinal nematodes. There were some indications that translation of infective larvae, which overwintered on pasture in some free living stage, occurred between May and July.

  7. The epidemiology of acne vulgaris in late adolescence.

    Science.gov (United States)

    Lynn, Darren D; Umari, Tamara; Dunnick, Cory A; Dellavalle, Robert P

    2016-01-01

    Acne vulgaris is the most common skin condition affecting late adolescents across the globe. Although prior studies have evaluated epidemiologic patterns of acne vulgaris in various ethnicities and regions, adequate understanding of the worldwide burden of the disease associated with patients in their late adolescence (15-19-year olds) remains lacking. To assess the global burden of the disease associated with acne vulgaris for late adolescents (15-19-year olds) and provide an overview of the epidemiology, pathophysiology, and treatment options for acne in this population. Database summary study. Global Burden of Disease Study 2010 database. Global Burden of Disease regions comprised countries with prevalence of acne vulgaris between the ages of 15 and 19 years. Geographic region-level disability-adjusted life year rates (per 100,000 persons) associated with acne vulgaris in years 1990 through 2010. Median percentage change in disability-adjusted life year rates was estimated for each region across the specified study period. Acne vulgaris-associated disease burden exhibits global distribution and has continued to grow in prevalence over time within this population. This continued growth suggests an unmet dermatologic need worldwide for this disorder and potential opportunities for improved access and delivery of dermatologic care. Our analysis of the literature reveals numerous opportunities for enhanced patient care. To that end, we highlight some of the effective and promising treatments currently available and address important factors, such as sex, nationality, genetics, pathophysiology, and diet, as they relate to acne vulgaris in late adolescence.

  8. Berberis vulgaris for cardiovascular disorders: a scoping literature review

    Directory of Open Access Journals (Sweden)

    Abdelrahman Abushouk

    2017-05-01

    Full Text Available Cardiovascular disorders are the leading cause of mortality worldwide. Berberis vulgaris (B. vulgaris is a commonly used plant in traditional medicine. In recent studies, B. vulgaris showed antiarrhythmic, antihypertensive, anticholinergic, and cardioprotective effects. We reviewed the literature to explore the possible prophylactic and therapeutic roles of B. vulgaris in cardiovascular medicine. A computer literature search was conducted to identify all relevant studies that have investigated the role of B. vulgaris in prevention or treatment of cardiovascular diseases.We also searched the citations of the retrieved articles. Using a systematic approach, we conducted a scoping review that included a total of 37 articles. Twelve studies examined the antihypertensive effects of B. vulgaris, seven studies investigated its antiarrhythmic effects, while its inotropic and cardioprotective effects were evaluated in four and eight studies, respectively. B. vulgaris showed a beneficial effect in reducing blood pressure, enhancing cardiac contractility, and protection from reperfusion injury. However, the mechanisms of these effects are still under investigation. Moreover, it could modify major risk factors for cardiovascular disorders, such as oxidative stress, hyperglycemia, and hyperlipidemia. Further studies are needed to translate these findings into effective cardiovascular medications.

  9. Heparan sulfate and cell division

    Directory of Open Access Journals (Sweden)

    Porcionatto M.A.

    1999-01-01

    Full Text Available Heparan sulfate is a component of vertebrate and invertebrate tissues which appears during the cytodifferentiation stage of embryonic development. Its structure varies according to the tissue and species of origin and is modified during neoplastic transformation. Several lines of experimental evidence suggest that heparan sulfate plays a role in cellular recognition, cellular adhesion and growth control. Heparan sulfate can participate in the process of cell division in two distinct ways, either as a positive or negative modulator of cellular proliferation, or as a response to a mitogenic stimulus.

  10. Eradication of the corrosion-causing bacterial strains Desulfovibrio vulgaris and Desulfovibrio desulfuricans using photodisinfection

    Energy Technology Data Exchange (ETDEWEB)

    Street, C.N.; Gibbs, A.J. [Biocorrosion Solutions Inc., Edmonton, AB (Canada)

    2010-07-01

    Microbiologically influenced corrosion (MIC) can cause oil and gas pipelines to fail prematurely. The free-floating bacteria collects on the inner pipeline surface to form complex adherent biofilms. This study evaluated the use of photodisinfection as a means of treating 2 sulfate-reducing bacterial strains known to contribute to MIC. The sulfate-reducing strains Desulfovibrio vulgaris and Desulfovibrio desulfuricans were studied experimentally to a concentration of 10{sup 7} colony-forming units per millimeter. Bacterial inocula was made to an optical density of 0.150 at 420 nm in order to assess biofilm growth. The study showed that photodisinfection was able to eradicate more than 99 per cent of the bacterial populations prepared in the study. The method was highly effective in removing the biofilms known to cause MIC in oil and gas pipelines. A close-loop dynamic flow system model will be prepared to evaluate the ability of photodisinfection to inhibit bacterially-influenced corrosion of steel coupons. 24 refs., 3 tabs., 1 fig.

  11. Final report on the safety assessment of sodium cetearyl sulfate and related alkyl sulfates as used in cosmetics.

    Science.gov (United States)

    Fiume, Monice; Bergfeld, Wilma F; Belsito, Donald V; Klaassen, Curtis D; Marks, James G; Shank, Ronald C; Slaga, Thomas J; Snyder, Paul W; Alan Andersen, F

    2010-05-01

    Sodium cetearyl sulfate is the sodium salt of a mixture of cetyl and stearyl sulfate. The other ingredients in this safety assessment are also alkyl salts, including ammonium coco-sulfate, ammonium myristyl sulfate, magnesium coco-sulfate, sodium cetyl sulfate, sodium coco/hydrogenated tallow sulfate, sodium coco-sulfate, sodium decyl sulfate, sodium ethylhexyl sulfate, sodium myristyl sulfate, sodium oleyl sulfate, sodium stearyl sulfate, sodium tallow sulfate, sodium tridecyl sulfate, and zinc coco-sulfate. These ingredients are surfactants used at concentrations from 0.1% to 29%, primarily in soaps and shampoos. Many of these ingredients are not in current use. The Cosmetic Ingredient Review (CIR) Expert Panel previously completed a safety assessment of sodium and ammonium lauryl sulfate. The data available for sodium lauryl sulfate and ammonium lauryl sulfate provide sufficient basis for concluding that sodium cetearyl sulfate and related alkyl sulfates are safe in the practices of use and concentration described in the safety assessment.

  12. [Microstructural changes in hardened beans (Phaseolus vulgaris)].

    Science.gov (United States)

    Mujica, Maria Virginia; Granito, Marisela; Soto, Naudy

    2015-06-01

    (Phaseolus vulgaris). The hardening of Phaseolus vulgaris beans stored at high temperature and high relative humidity is one of the main constraints for consumption. The objective of this research was to evaluate by scanning electron microscopy, structural changes in cotyledons and testa of the hardened beans. The freshly harvested grains were stored for twelve months under two conditions: 5 ° C-34% RH and 37 ° C-75% RH, in order to promote hardening. The stored raw and cooked grains were lyophilized and fractured. The sections of testa and cotyledons were observed in an electron microscope JSM-6390. After twelve months, grains stored at 37 ° C-75% RH increased their hardness by 503%, whereas there were no significant changes in grains stored at 5 ° C-34% RH. At the microstructural level, the cotyledons of the raw grains show clear differences in appearance of the cell wall, into the intercellular space size and texture matrix protein. There were also differences in compaction of palisade and sub-epidermal layer in the testa of raw grains. After cooking, cotyledon cells of the soft grains were well separated while these ofhard grains were seldom separated. In conclusion, the found differences in hard and soft grains showed a significant participation of both structures, cotyledons and testa, in the grains hardening.

  13. Vascular cognitive impairment in Pemphigus vulgaris: a case report

    Directory of Open Access Journals (Sweden)

    José Ibiapina Siqueira- Neto

    Full Text Available ABSTRACT Pemphigus vulgaris is a systemic auto-immune medical condition that mainly manifests with changes in skin and vasculopathy. This is a case report of a 69-year-old male with confirmed histopathologic diagnosis of Pemphigus vulgaris presenting ulterior Cognitive Impairment, mostly in executive function. The patient was treated using steroids, immunomodulatory therapy, fluoxetine and galantamine. Neuropsychological testing and magnetic resonance (MRI were performed. This is the first report of correlational cognitive impairment with Pemphigus vulgaris in the literature. Physicians should be aware of vascular causes for cognitive impairment in patients presenting auto-immune conditions.

  14. Controlled tests of ivermectin against migrating Strongylus vulgaris in ponies.

    Science.gov (United States)

    Slocombe, J O; McCraw, B M

    1981-06-01

    Twelve pony foals were reared worm-free and inoculated with Strongylus vulgaris. On day 7 after inoculation, 6 ponies were given ivermectin IM at a dose of 200 micrograms/kg of body weight and on day 28 were necropsied. Ivermectin was effective in eliminating early 4th-stage S vulgaris larvae and reducing clinical signs associated with acute arteritis. After administrative ivermectin was effective against early 4th-stage Strongylus vulgaris larvae in ponies when administered at 100, 300, or 800 micrograms/kg of body weight. The purpose of the present study was to report on a more extensive trial, using a single dosage of ivermectin.

  15. Primula latifolia Lapeyr. and Primula vulgaris Hudson flavonoids.

    Science.gov (United States)

    Colombo, Paola S; Flamini, Guido; Fico, Gelsomina

    2014-01-01

    Three flavonoids were isolated from the leaf MeOH extracts of Primula latifolia Lapeyr. and Primula vulgaris Hudson collected from Italian Alps: rutin (1) and kaempferol 3-neohesperidoside (2) from P. latifolia, and kaempferol 3-β-O-glucopyranosyl-(1 → 2) gentiobioside (3) from P. vulgaris. The structures were assigned on the basis of their (1)H and (13)C NMR data, including those derived from 2D NMR, as well as on HPLC-MS results. This article is the first to report on P. vulgaris tissue flavonoids after Harborne's study in 1968 and the first work ever on these compounds from P. latifolia.

  16. Reduction and precipitation of neptunium(V) by sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Banaszak, J. E.; Rittmann, B. E.; Reed, D. T.

    1999-01-01

    Migration of neptunium, as NpO 2 + , has been identified as a potentially important pathway for actinide release at nuclear waste repositories and existing sites of subsurface contamination. Reduction of Np(V) to Np(IV) will likely reduce its volubility, resulting in lowered subsurface migration. The ability of sulfate-reducing bacteria (SRB) to utilize Np(V) as an electron acceptor was investigated, because these bacteria are active in many anaerobic aquifers and are known to facilitate the reduction of metals and radionuclides. Pure and mixed cultures of SRB were able to precipitate neptunium during utilization of pyruvate, lactate, and hydrogen as electron donors in the presence and absence of sulfate. The neptunium in the precipitate was identified as Np(IV) using X-ray absorption near edge spectroscopy (XANES) analysis. In mixed-culture studies, the addition of hydrogen to consortia grown by pyruvate fermentation stimulated neptunium reduction and precipitation. Experiments with pure cultures of Desulfovibrio vulgaris, growing by lactate fermentation in the absence of sulfate or by sulfate reduction, confirm that the organism is active in neptunium reduction and precipitation. Based on our results, the activity of SRB in the subsurface may have a significant, and potentially beneficial, impact on actinide mobility by reducing neptunium volubility

  17. A CLINICAL STUDY OF ACNE VULGARIS

    Directory of Open Access Journals (Sweden)

    Melathil Sadanandan Sadeep

    2017-11-01

    Full Text Available BACKGROUND Acne vulgaris is a highly prevalent chronic inflammatory disease of pilosebaceous unit affecting teenagers and young adults. Prognosis of acne is generally good, especially in mild acne. But, this disease reduces the self-esteem, their sense of identity and can severely compromise quality of life. All clinicians caring for children and adolescents should be familiar with this problem. Early diagnosis, proper treatment and timely counselling reduce the overall impact of disease to individuals. MATERIALS AND METHODS This is a prospective study conducted in the Department of Dermatology at Government Medical College, Kottayam, Kerala, in 200 patients who presented to the outpatient clinic with a clinical diagnosis of acne vulgaris who have not yet received any medical treatment for the disease and consented to participate in the study. RESULTS Male-to-female ratio of 1.43:1. 61.5% patients were in the 2nd decade. 4% were more than 30 years old. Duration of the disease at the time of presentation ranged from 3 weeks to 30 years. 42.5% complained of mild itching and 18.5% had burning sensation. 48.5% attribute exacerbation of disease after food intake. 72.5% acne patients had seborrhoea. Hirsutism and Acanthosis nigricans were present in 7.31% and 4.87% female patients, respectively. 50% with hirsutism and 25% with Acanthosis nigricans had polycystic ovarian disease and severe grades of acne. 25.6% females complained of premenstrual exacerbation of the disease. 26% of the patients showed exacerbation in summer. Smokers had severe grades of acne vulgaris compared to nonsmokers. Comedones were present in all and they were the predominant lesions in majority. Inflammatory papules were the 2nd most common lesions. Severe grades of acne were more common in patients with age ≥20 years. Severity of the disease increases with long duration of the disease. Relatively high incidence of post-acne scarring and post-inflammatory hyperpigmentation was

  18. Propionibacterium acnes in the pathogenesis and immunotherapy of acne vulgaris.

    Science.gov (United States)

    Liu, Pei-Feng; Hsieh, Yao-Dung; Lin, Ya-Ching; Two, Aimee; Shu, Chih-Wen; Huang, Chun-Ming

    2015-01-01

    Acne vulgaris, a multi-factorial disease, is one of the most common skin diseases, affecting an estimated 80% of Americans at some point during their lives. The gram-positive and anaerobic Propionibacterium acnes (P. acnes) bacterium has been implicated in acne inflammation and pathogenesis. Therapies for acne vulgaris using antibiotics generally lack bacterial specificity, promote the generation of antibiotic-resistant bacterial strains, and cause adverse effects. Immunotherapy against P. acnes or its antigens (sialidase and CAMP factor) has been demonstrated to be effective in mice, attenuating P. acnes-induced inflammation; thus, this method may be applied to develop a potential vaccine targeting P. acnes for acne vulgaris treatment. This review summarizes reports describing the role of P. acnes in the pathogenesis of acne and various immunotherapy-based approaches targeting P. acnes, suggesting the potential effectiveness of immunotherapy for acne vulgaris as well as P. acnes-associated diseases.

  19. Genetic diversity study of common bean (Phaseolus vulgaris L ...

    African Journals Online (AJOL)

    SAM

    2014-09-03

    Sep 3, 2014 ... Key words: Genetic diversity, ISSR, Phaseolus vulgaris. INTRODUCTION ..... effective germplasm conservation and for setting germ- plasm collection ... conservation and research programs of the species. Furthermore, the ...

  20. Distribution of Shewanella putrefaciens and Desulfovibrio vulgaris in ...

    African Journals Online (AJOL)

    Distribution of Shewanella putrefaciens and Desulfovibrio vulgaris in sulphidogenic biofilms of industrial cooling water systems determined by fluorescent in situ hybridisation. Elise S McLeod, Raynard MacDonald, Volker S. Brozel ...

  1. Bambusa vulgaris : determination of mechanical strength as bio ...

    African Journals Online (AJOL)

    composite material. The manufactured bio-composite was made from combinations of two materials, which are bamboo scientifically named as Bambusa Vulgaris and a polymer named HDPE. The main objective of this paper is to expose the ...

  2. Effects of Kidney Bean, Phaseolus vulgaris Meal on the Growth ...

    African Journals Online (AJOL)

    , Oreochromis niloticus (mean weight 1.36 + 0.05 g) fed diets containing varying levels of the kidney bean, Phaseolus vulgaris were investigated under laboratory conditions. The kidney bean was incorporated at separate levels of 60, 40, ...

  3. Sulfur isotopic and proteomic profiles of sulfate reducers grown under differential steady-states

    Science.gov (United States)

    Leavitt, W.; Venceslau, S.; Waldbauer, J.; Smith, D. A.; Boidi, F. J.; Bradley, A. S.

    2016-12-01

    Microbial sulfate reducers (MSR) drive the Earth's biogeochemical sulfur cycle. At the heart of this energy metabolism is a cascade of redox transformations coupling organic carbon and/or hydrogen oxidation to the dissimilatory reduction of sulfate to sulfide. The product sulfide is depleted in the heavier isotopes of sulfur, relative to the reactant sulfate, consistent with a normal kinetic isotope effect. However, the magnitude of the net fractionation during MSR can range over a range of 70 permil, consistent with a multi-step set of reactions. This range in MSR fractionation has been shown to mainly depend on: i) the cell-specific sulfate reduction rate (csSRR), and ii) the ambient sulfate concentration. However, the fractionation under identical conditions differs among strains (Bradley et al. 2016. Geobio), and so must also be mediated by strain-specific processes, such as the nature and quantity of individual proteins involved in sulfate reduction, electron transport, and growth. In recent work we have examined the influence of electron donor, electron acceptor, and co-limitation under controlled steady-state culture conditions in order better inform models of MSR isotope fractionation, and the physiological and isotopic response to differential environmental forcings (e.g. Leavitt et al. (2013) PNAS). Recent models of the fractionation response to MSR rate (c.f. Bradley 2016; Wing & Halevy, 2016) make specific predictions for the responses of the cellular metabolome and proteome. Here we compare the steady-state S-isotopic fractionation and proteome of `fast' versus `slow' grown D. vulgaris, using replicate chemostats under electron donor limitation. We observe clear and statistically robust changes in some key central MSR and C-metabolism enzymes, though a host of the critical energy-transfer enzymes show no statistically discernable change. We discuss these results in light of recent theoretical advances and their relevance to modern and ancient

  4. Hepatoprotective activity of Thymus vulgaris extract against Toxoplasma gondii infection

    Directory of Open Access Journals (Sweden)

    Nagwa Mostafa El-Sayed

    2017-05-01

    Full Text Available Objective: To evaluate the hepatoprotective activity of Thymus vulgaris (T. vulgaris extract against Toxoplasma gondii (T. gondii infection in experimentally infected mice. Methods: Sixty mice were divided into six groups (Group I–Group VI. Group I was normal control (non-infected, non-treated; Group II was non-infected and treated with T. vulgaris extract (500 mg/kg; Group III was T. gondii infected-non-immunosuppressed control; Group IV consisted of infected immunosuppressed mice; Group V was infected and treated with T. vulgaris extract; Group VI consisted of infected immunosuppressed mice treated with T. vulgaris extract. Hepatoprotective effect of T. vulgaris extract was evaluated by histopathological examination of tissue sections stained with hematoxylin and eosin, determination of liver function parameters (alanine aminotransaminase, aspartate aminotransaminase and alkaline phosphates, total bilirubin, total protein concentrations and assessment of hepatocytes genotoxicity by comet assay.Antigenotoxic effect of T. vulgaris was assessed by several comet assay parameters that were provided by the image analysis software, including % tailed cells, % of DNA in the tail, tail length, and tail moment. Results: Treatment with T. vulgaris in both Groups V and VI improved T. gondii induced pathological lesions in the infected liver that regressed to near the normal picture especially in Group V. Also, it restored the altered values of liver function parameters near to the normal levels significantly (P < 0.05 compared with Groups III and IV respectively. Regarding comet assay parameters, all of them were significantly increased (P < 0.05 after T. gondii infection (Group III and reached the greatest values in infected immunosuppressed group (Group IV compared to the normal controls (Group I. With treatment by T. vulgaris in Groups V and VI, there was a significant decrease (P < 0.05 in all values compared to Groups III and V respectively. The

  5. Bioremediation of the textile waste effluent by Chlorella vulgaris

    OpenAIRE

    El-Kassas, Hala Yassin; Mohamed, Laila Abdelfattah

    2014-01-01

    The microalgae biomass production from textile waste effluent is a possible solution for the environmental impact generated by the effluent discharge into water sources. The potential application of Chlorella vulgaris for bioremediation of textile waste effluent (WE) was investigated using 22 Central Composite Design (CCD). This work addresses the adaptation of the microalgae C. vulgaris in textile waste effluent (WE) and the study of the best dilution of the WE for maximum biomass production...

  6. Novel techniques for enhancement and segmentation of acne vulgaris lesions.

    Science.gov (United States)

    Malik, A S; Humayun, J; Kamel, N; Yap, F B-B

    2014-08-01

    More than 99% acne patients suffer from acne vulgaris. While diagnosing the severity of acne vulgaris lesions, dermatologists have observed inter-rater and intra-rater variability in diagnosis results. This is because during assessment, identifying lesion types and their counting is a tedious job for dermatologists. To make the assessment job objective and easier for dermatologists, an automated system based on image processing methods is proposed in this study. There are two main objectives: (i) to develop an algorithm for the enhancement of various acne vulgaris lesions; and (ii) to develop a method for the segmentation of enhanced acne vulgaris lesions. For the first objective, an algorithm is developed based on the theory of high dynamic range (HDR) images. The proposed algorithm uses local rank transform to generate the HDR images from a single acne image followed by the log transformation. Then, segmentation is performed by clustering the pixels based on Mahalanobis distance of each pixel from spectral models of acne vulgaris lesions. Two metrics are used to evaluate the enhancement of acne vulgaris lesions, i.e., contrast improvement factor (CIF) and image contrast normalization (ICN). The proposed algorithm is compared with two other methods. The proposed enhancement algorithm shows better result than both the other methods based on CIF and ICN. In addition, sensitivity and specificity are calculated for the segmentation results. The proposed segmentation method shows higher sensitivity and specificity than other methods. This article specifically discusses the contrast enhancement and segmentation for automated diagnosis system of acne vulgaris lesions. The results are promising that can be used for further classification of acne vulgaris lesions for final grading of the lesions. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  7. Verminous (Strongylus vulgaris) myelitis in a donkey.

    Science.gov (United States)

    Mayhew, I G; Brewer, B D; Reinhard, M K; Greiner, E C

    1984-01-01

    A fifth stage Strongylus vulgaris migrated through the spinal cord of a 2-year-old, male donkey resulting in progressive paraparesis and then tetraplegia. A profound neutrophilic pleocytosis was detected on analysis of cerebrospinal fluid. The parasite appeared to have entered the mid-lumbar spinal cord, migrated to the cranial thoracic segments, exited, then re-entered the spinal cord a few segments craniad. It then traveled further cranially and was found in the third cervical spinal cord segment. Some parts of the lesion were remarkably free from tissue necrosis, hemorrhage and inflammation. Severe granulomatous myelitis with hemorrhage and necrosis were seen at other sites. The latter were quite similar to lesions seen in equine protozoal myeloencephalitis.

  8. Urease from seeds of 'Citrullus vulgaris'

    International Nuclear Information System (INIS)

    Hargreaves, A.B.; Souza Marcondes, N. de; Elias, C.A.

    1976-01-01

    The effect of the urea analogs acetanide and hidroxi-urea on the enzyme kinetic of urease obtained from seeds of 'Citrullus vulgaris' fruits has been studied. The action of the sulphydryl reagents and the enzyme and the effect of x-rays and the protective action of the cysteamine are also studied. Acetamide has no effect on urease kinetic. Hydroxi-urea acts as a competitive inhibitor of urease. Spectrophotometric experiments suggest that the studied urease decomposes hidroxi-urea with liberation of hydroxilamine. The sulphydril reagent, p-hydroxi-mercuribenzoate inhibts the enzyme. Cysteine and dithiotreitol reactivate the enzyme activity in no more than 50% even when excess of the substances is used. Urease is very sensitive to x-rays. Cysteamine acts as a protective agent of the enzyme. Dithiotreitol reinforces this protective action [pt

  9. Ichthyosis vulgaris and pycnodysostosis: An unusual occurrence

    Directory of Open Access Journals (Sweden)

    Vinayak Y. Kshirsagar

    2012-11-01

    Full Text Available Pycnodysostosis is a rare autosomal recessive disorder whose generesponsible for this phenotype (CTSK, mapped to human chromosome1q21, code for the enzyme cathepsin K, a lysosomal cysteineprotease; with an estimated incidence of 1.7 per 1 million births. This clinical entity includes micromelic dwarfism, increased radiological bone density, dysplasia of the skull, acro-osteolysis, straightening of the mandibular angle and in some cases, dysplasia of the acromial end of the clavicle. Oral and maxillo-facial manifestations of this disease are very clear. Herein we reported a case of pycnodysostosis, showing short stature with widening of the sutures, unfused anterior and posterior fontanelles, crowding of teeth with dental caries and typical radiological features associated with ichthyosis vulgaris and palmoplantar keratoderma.

  10. Hormonal and dietary factors in acne vulgaris versus controls.

    Science.gov (United States)

    Stewart, Thomas Jonathan; Bazergy, Carl

    2018-01-01

    Background : Acne vulgaris is an inflammatory skin disorder with not as yet fully understood pathogenesis. In this controlled study, we assessed acne vulgaris patients for several possible pathogenic factors such as vitamin D deficiency, vegan diet, increased body mass index (BMI) and positive anti-transglutaminase antibody. Methods : We screened 10 years of records at a family medicine clinic for patients diagnosed with acne vulgaris. In eligible subjects, we collected data regarding 25-hydroxylvitamin D levels, BMI, dietary preference and serum IgA tissue transglutaminase levels. Controls were age- (+/- 12 months) and sex-matched patients seen during the study period without a diagnosis of acne vulgaris. Results : 453 patients were given a diagnosis of acne vulgaris during the study period. Compared with controls, we found significant associations between vitamin D deficiency (4.0U/mL) and a diagnosis of acne vulgaris. Conclusions : Our study adds important information to the current body of literature in pursuit of elucidating the pathogenesis of this complex multifactorial disease.

  11. Changes in serum desnutrin levels in patients with acne vulgaris.

    Science.gov (United States)

    Demir, Betul; Ucak, Haydar; Cicek, Demet; Aydin, Suleyman; Erden, Ilker; Dertlioglu, Selma Bakar

    2014-01-01

    Androgens and insulin may contribute to increased sebum production in the pathogenesis of acne vulgaris. We investigated the association between serum desnutrin levels and acne vulgaris in the pathogenesis of insulin resistance. 25 patients presenting with acne vulgaris and 25 control subjects participated in this study. Fasting blood glucose, triglycerides, LDL, VLDL, HDL, total cholesterol, insulin, C-peptide and thyroid function tests were measured. The homeostasis model assessment of insulin resistance (HOMA-IR) was used to calculate insulin resistance. Desnutrin levels were determined by enzyme-linked immunosorbent assay (ELISA) according to the manufacturer's protocol. Patients with acne vulgaris had a mean serum desnutrin level of (8.83 ± 1.13 μIU/mL), which was statistically significantly lower in the control group (10:58 ± 3.43 μIU/mL). In patients with acne vulgaris the serum glucose levels, insulin levels and HOMA-IR values (87.92 ± 7:46 mg/dL, 11.33 ± 5.93 μIU/mL, 2.49 ± 1.40, respectively) were significantly higher than the control group (77.36 ± 9.83 mg/dL, 5.82 ± 2.68 μIU/mL, 1.11 ± 0.51, respectively) (p = 0.01, pacne vulgaris, as a result of increased levels of serum glucose and insulin, the function of desnutrin was suppressed, perhaps contributing to insulin resistance.

  12. High Frequency of Fibromyalgia in Patients With Acne Vulgaris.

    Science.gov (United States)

    Yazmalar, Levent; Çelepkolu, Tahsin; Batmaz, İbrahim; Sariyildiz, Mustafa Akif; Sula, Bilal; Alpayci, Mahmut; An, İsa; Burkan, Yahya Kemal; Uçak, Haydar; Çevik, Remzi

    2016-06-01

    This study aims to investigate the frequency of fibromyalgia syndrome and to specify fibromyalgia syndrome-associated clinical symptoms in patients with acne vulgaris. Eighty-eight patients (28 males, 60 females; mean age 23.2±5.1 years; range 18 to 40 years) with acne vulgaris and age, sex- and body mass index-similar 76 healthy controls (14 males, 62 females; mean age 24.5±2.9 years; range 18 to 35 years) were included. Acne vulgaris was evaluated by using the Global Acne Scale, while Hospital Anxiety and Depression Scale was used to evaluate anxiety. Fibromyalgia-associated pain, sleep disturbance, anxiety, and menstrual cycle disturbance were significantly more frequent in patients with acne vulgaris than controls. Also, the severity of anxiety and the number of tender points were significantly higher in the acne vulgaris patients than controls. This study indicates that patients with acne vulgaris have increased frequency of fibromyalgia syndrome than healthy controls (21.6% versus 5.3%, respectively).

  13. Chlorella vulgaris: A Multifunctional Dietary Supplement with Diverse Medicinal Properties.

    Science.gov (United States)

    Panahi, Yunes; Darvishi, Behrad; Jowzi, Narges; Beiraghdar, Fatemeh; Sahebkar, Amirhossein

    2016-01-01

    Chlorella vulgaris is a green unicellular microalgae with biological and pharmacological properties important for human health. C. vulgaris has a long history of use as a food source and contains a unique and diverse composition of functional macro- and micro-nutrients including proteinsChlorella vulgaris is a green unicellular microalgae with biological and pharmacological properties important for human health. C. vulgaris has a long history of use as a food source and contains a unique and diverse composition of functional macro- and micro-nutrients including proteins, omega-3 polyunsaturated fatty acids, polysaccharides, vitamins and minerals. Clinical trials have suggested that supplementation with C. vulgaris can ameliorate amelioration hyperlipidemia and hyperglycemia, and protect against oxidative stress, cancer and chronic obstructive pulmonary disease. In this review, we summarize the findings on the health benefits of Chlorella supplementation and the molecular mechanisms underlying these effects., omega-3 polyunsaturated fatty acids, polysaccharides, vitamins and minerals. Clinical trials have suggested that supplementation with C. vulgaris can ameliorate amelioration hyperlipidemia and hyperglycemia, and protect against oxidative stress, cancer and chronic obstructive pulmonary disease. In this review, we summarize the findings on the health benefits of Chlorella supplementation and the molecular mechanisms underlying these effects.

  14. Pemphigus Vulgaris and Infections: A Retrospective Study on 155 Patients

    Directory of Open Access Journals (Sweden)

    Nafiseh Esmaili

    2013-01-01

    Full Text Available Background. Autoimmune process and immunosuppressive therapy of pemphigus vulgaris would predispose the patients to infections. Aim. We aimed to study the prevalence of infection and pathogenic agents in pemphigus vulgaris patients admitted to dermatology service. Material and methods. This retrospective study was conducted on 155 pemphigus vulgaris patients (68 males, 87 females admitted to dermatology service between 2009 and 2011. In this study, the diagnosis of pemphigus vulgaris was confirmed by light microscopic and direct immunofluorescence findings. Data were collected through a questionnaire. Results. Of 155 pemphigus vulgaris patients, 33 had infection at admission and 9 acquired nosocomial infection. In addition, 37 cases of oral candidiasis and 15 cases of localized herpes simplex were recorded. Totally, 94 cases of infection were recorded. The occurrence of infection was significantly related to the severity of disease, number of hospital admissions, and presence of diabetes mellitus. The most common pathogenic germs isolated from cultures were Staphylococcus aureus and Escherichia coli. Conclusion. Severity of pemphigus vulgaris and diabetes were directly related with tendency to infections. Staphylococcus aureus and Escherichia coli were the most common pathogenic agents. Due to limitations of retrospective study, a prospective study is recommended.

  15. Role of olfaction in Octopus vulgaris reproduction.

    Science.gov (United States)

    Polese, Gianluca; Bertapelle, Carla; Di Cosmo, Anna

    2015-01-01

    The olfactory system in any animal is the primary sensory system that responds to chemical stimuli emanating from a distant source. In aquatic animals "Odours" are molecules in solution that guide them to locate food, partners, nesting sites, and dangers to avoid. Fish, crustaceans and aquatic molluscs possess sensory systems that have anatomical similarities to the olfactory systems of land-based animals. Molluscs are a large group of aquatic and terrestrial animals that rely heavily on chemical communication with a generally dispersed sense of touch and chemical sensitivity. Cephalopods, the smallest class among extant marine molluscs, are predators with high visual capability and well developed vestibular, auditory, and tactile systems. Nevertheless they possess a well developed olfactory organ, but to date almost nothing is known about the mechanisms, functions and modulation of this chemosensory structure in octopods. Cephalopod brains are the largest of all invertebrate brains and across molluscs show the highest degree of centralization. The reproductive behaviour of Octopus vulgaris is under the control of a complex set of signal molecules such as neuropeptides, neurotransmitters and sex steroids that guide the behaviour from the level of individuals in evaluating mates, to stimulating or deterring copulation, to sperm-egg chemical signalling that promotes fertilization. These signals are intercepted by the olfactory organs and integrated in the olfactory lobes in the central nervous system. In this context we propose a model in which the olfactory organ and the olfactory lobe of O. vulgaris could represent the on-off switch between food intake and reproduction. Copyright © 2014 Elsevier Inc. All rights reserved.

  16. Chondroitin sulfate/dermatan sulfate sulfatases from mammals and bacteria.

    Science.gov (United States)

    Wang, Shumin; Sugahara, Kazuyuki; Li, Fuchuan

    2016-12-01

    Sulfatases that specifically catalyze the hydrolysis of the sulfate groups on chondroitin sulfate (CS)/dermatan sulfate (DS) poly- and oligosaccharides belong to the formylglycine-dependent family of sulfatases and have been widely found in various mammalian and bacterial organisms. However, only a few types of CS/DS sulfatase have been identified so far. Recently, several novel CS/DS sulfatases have been cloned and characterized. Advanced studies have provided significant insight into the biological function and mechanism of action of CS/DS sulfatases. Moreover, further studies will provide powerful tools for structural and functional studies of CS/DS as well as related applications. This article reviews the recent progress in CS/DS sulfatase research and is expected to initiate further research in this field.

  17. Effectivity of Beta vulgaris L. Extract with various Solvent Fractions to Aedes aegypti Larval Mortality

    Directory of Open Access Journals (Sweden)

    Mutiara Widawati

    2013-06-01

    Full Text Available Dengue vector control is mostly done by using plant-based insecticides. Insecticides from the vegetable and fruit extracts of the leaves of plants that contain compounds alkaloids, saponins, flavonoids, tannins, triterpenoids, and polyphenols can be used as an alternative to naturally control Ae. aegypti. The purpose of this study was to determine the effectiveness of the B. vulgaris L. extract larvacide against larvae of Ae. aegypti. The materials that been used was B. vulgaris L. fruit parts which was milled and dried to become a powder form. 800 g of dry powder was extracted by 70% methanol by percolation method with occasional stirring for 3 days. The extract was concentrated using an evaporator. 60 g remaining residue was dissolved in distilled water and re-extracted with diethyl ether, chloroform, and ethyl acetate. Each fraction extract was dried with anhydrous sodium sulfate and the solvent was distilled. The extract was tested qualitatively to determine the content of secondary metabolites. Larvacide test performed by dissolving each extracts in dimetilsulphoxide (DMSO at concentrations of 0.1, 0.5 and 1%. The larvae used was larval of Ae. aegypti age of seven days. Death larvae counted every day for seven days to determine the effect of the contact. Tests carried out at a temperature of 27±1°C by immersing 25 larvae at each concentration of the extract with 50 mL volume and three replications was performed. The data obtained were analyzed further with different test. The results showed that fruit extract contains flavonoids, alkoloid, sterols, triterpenes, saponins and tannins. Highest mortality happened which was 82.5% and the lowest mortality happened with a concentration of 0.1% diethyl ether extract fraction. The extracts that are dissolved in various solvent fractions have not been effective as a larvacide until the highest concentration which was 1%. Methanol and polar solvent extracts of the fruit has a larvacide potency a bit

  18. ORF Alignment: NC_002937 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available nthase, beta/alpha subunits [Desulfovibrio vulgaris ... subsp. vulgaris str. Hildenborough] gb|AAS966...10.1| ... succinyl-CoA synthase, beta/alpha subunits ... [Desulfovibrio vulgaris subsp. vulgaris str. ... Hilde...GIGQSLCAGVGGDPYI 180 ... Query: 664 RLGHAGAILDEADGGIAGKVRALCDAGIAVCPDLGSLPAAVRQALG 709 ... RLGHAGAILDEAD...GGIAGKVRALCDAGIAVCPDLGSLPAAVRQALG Sbjct: 241 RLGHAGAILDEADGGIAGKVRALCDAGIAVCPDLGSLPAAVRQALG 286

  19. Semi-synthesis of chondroitin sulfate-E from chondroitin sulfate-A

    OpenAIRE

    Cai, Chao; Solakyildirim, Kemal; Yang, Bo; Beaudet, Julie M.; Weyer, Amanda; Linhardt, Robert J.; Zhang, Fuming

    2012-01-01

    Chondroitin sulfate-E (chondroitin-4, 6-disulfate) was prepared from chondroitin sulfate-A (chondroitin-4 - sulfate) by regioselective sulfonation, performed using trimethylamine sulfur trioxide in formamide under argon. The structure of semi-synthetic chondroitin sulfate-E was analyzed by PAGE, 1H NMR, 13C NMR, 2D NMR and disaccharide analysis and compared with natural chondroitin sulfate-E. Both semi-synthetic and natural chondroitin sulfate-E were each biotinylated and immobilized on BIAco...

  20. The Difference in Interleukin-19 Serum on Degrees of Acne Vulgaris Severity

    Directory of Open Access Journals (Sweden)

    Moerbono Mochtar

    2018-01-01

    Full Text Available Introduction. Acne vulgaris is a multifactorial disease. Recent study showed that inflammation does have a central role in the formation of both inflammatory and noninflammatory lesions in acne vulgaris. There are various findings of proinflammatory cytokines related to acne vulgaris, but no previous study correlate interleukin- (IL- 19 to acne vulgaris. This pilot study aims to look at difference in IL-19 serum concentration on degrees of severity of acne vulgaris. Methods. This is an analytical observational cross-sectional study. Sample subjects were patients with acne vulgaris who met the inclusion criteria. Enzyme-linked immunosorbent assay (ELISA study was applied to measure IL-19 serum. Result. Analysis test found statistically significant difference between IL-19 serum concentration of group of patients with mild acne vulgaris and that of group of patients with severe acne vulgaris. Moreover, analysis revealed significant difference between IL-19 serum concentration of group of patients with moderate acne vulgaris and that of group of patients with severe acne vulgaris. Conclusions. There are differences in serum levels of IL-19 on the severity of acne vulgaris. The significant difference might show that inflammation has a core role in severity of acne vulgaris, and IL-19 might potentially be related to acne vulgaris.

  1. The Difference in Interleukin-19 Serum on Degrees of Acne Vulgaris Severity.

    Science.gov (United States)

    Mochtar, Moerbono; Murasmita, Alamanda; Irawanto, M Eko; Julianto, Indah; Kariosentono, Harijono; Waskito, Fajar

    2018-01-01

    Acne vulgaris is a multifactorial disease. Recent study showed that inflammation does have a central role in the formation of both inflammatory and noninflammatory lesions in acne vulgaris. There are various findings of proinflammatory cytokines related to acne vulgaris, but no previous study correlate interleukin- (IL-) 19 to acne vulgaris. This pilot study aims to look at difference in IL-19 serum concentration on degrees of severity of acne vulgaris. This is an analytical observational cross-sectional study. Sample subjects were patients with acne vulgaris who met the inclusion criteria. Enzyme-linked immunosorbent assay (ELISA) study was applied to measure IL-19 serum. Analysis test found statistically significant difference between IL-19 serum concentration of group of patients with mild acne vulgaris and that of group of patients with severe acne vulgaris. Moreover, analysis revealed significant difference between IL-19 serum concentration of group of patients with moderate acne vulgaris and that of group of patients with severe acne vulgaris. There are differences in serum levels of IL-19 on the severity of acne vulgaris. The significant difference might show that inflammation has a core role in severity of acne vulgaris, and IL-19 might potentially be related to acne vulgaris.

  2. Chondroitin Sulfate Perlecan Enhances Collagen Fibril Formation

    DEFF Research Database (Denmark)

    Kvist, A. J.; Johnson, A. E.; Mörgelin, M.

    2006-01-01

    in collagen type II fibril assembly by perlecan-null chondrocytes. Cartilage perlecan is a heparin sulfate or a mixed heparan sulfate/chondroitin sulfate proteoglycan. The latter form binds collagen and accelerates fibril formation in vitro, with more defined fibril morphology and increased fibril diameters...... produced in the presence of perlecan. Interestingly, the enhancement of collagen fibril formation is independent on the core protein and is mimicked by chondroitin sulfate E but neither by chondroitin sulfate D nor dextran sulfate. Furthermore, perlecan chondroitin sulfate contains the 4,6-disulfated...... disaccharides typical for chondroitin sulfate E. Indeed, purified glycosaminoglycans from perlecan-enriched fractions of cartilage extracts contain elevated levels of 4,6-disulfated chondroitin sulfate disaccharides and enhance collagen fibril formation. The effect on collagen assembly is proportional...

  3. Sulfate reduction in freshwater peatlands

    Energy Technology Data Exchange (ETDEWEB)

    Oequist, M.

    1996-12-31

    This text consist of two parts: Part A is a literature review on microbial sulfate reduction with emphasis on freshwater peatlands, and part B presents the results from a study of the relative importance of sulfate reduction and methane formation for the anaerobic decomposition in a boreal peatland. The relative importance of sulfate reduction and methane production for the anaerobic decomposition was studied in a small raised bog situated in the boreal zone of southern Sweden. Depth distribution of sulfate reduction- and methane production rates were measured in peat sampled from three sites (A, B, and C) forming an minerotrophic-ombrotrophic gradient. SO{sub 4}{sup 2-} concentrations in the three profiles were of equal magnitude and ranged from 50 to 150 {mu}M. In contrast, rates of sulfate reduction were vastly different: Maximum rates in the three profiles were obtained at a depth of ca. 20 cm below the water table. In A it was 8 {mu}M h{sup -1} while in B and C they were 1 and 0.05 {mu}M h{sup -1}, respectively. Methane production rates, however, were more uniform across the three nutrient regimes. Maximum rates in A (ca. 1.5 {mu}g d{sup -1} g{sup -1}) were found 10 cm below the water table, in B (ca. 1.0 {mu}g d{sup -1} g{sup -1}) in the vicinity of the water table, and in C (0.75 {mu}g d{sup -1} g{sup -1}) 20 cm below the water table. In all profiles both sulfate reduction and methane production rates were negligible above the water table. The areal estimates of methane production for the profiles were 22.4, 9.0 and 6.4 mmol m{sup -2} d{sup -1}, while the estimates for sulfate reduction were 26.4, 2.5, and 0.1 mmol m{sup -2} d{sup -1}, respectively. The calculated turnover times at the sites were 1.2, 14.2, and 198.7 days, respectively. The study shows that sulfate reducing bacteria are important for the anaerobic degradation in the studied peatland, especially in the minerotrophic sites, while methanogenic bacteria dominate in ombrotrophic sites Examination

  4. Sulfate reduction in freshwater peatlands

    International Nuclear Information System (INIS)

    Oequist, M.

    1996-01-01

    This text consist of two parts: Part A is a literature review on microbial sulfate reduction with emphasis on freshwater peatlands, and part B presents the results from a study of the relative importance of sulfate reduction and methane formation for the anaerobic decomposition in a boreal peatland. The relative importance of sulfate reduction and methane production for the anaerobic decomposition was studied in a small raised bog situated in the boreal zone of southern Sweden. Depth distribution of sulfate reduction- and methane production rates were measured in peat sampled from three sites (A, B, and C) forming an minerotrophic-ombrotrophic gradient. SO 4 2- concentrations in the three profiles were of equal magnitude and ranged from 50 to 150 μM. In contrast, rates of sulfate reduction were vastly different: Maximum rates in the three profiles were obtained at a depth of ca. 20 cm below the water table. In A it was 8 μM h -1 while in B and C they were 1 and 0.05 μM h -1 , respectively. Methane production rates, however, were more uniform across the three nutrient regimes. Maximum rates in A (ca. 1.5 μg d -1 g -1 ) were found 10 cm below the water table, in B (ca. 1.0 μg d -1 g -1 ) in the vicinity of the water table, and in C (0.75 μg d -1 g -1 ) 20 cm below the water table. In all profiles both sulfate reduction and methane production rates were negligible above the water table. The areal estimates of methane production for the profiles were 22.4, 9.0 and 6.4 mmol m -2 d -1 , while the estimates for sulfate reduction were 26.4, 2.5, and 0.1 mmol m -2 d -1 , respectively. The calculated turnover times at the sites were 1.2, 14.2, and 198.7 days, respectively. The study shows that sulfate reducing bacteria are important for the anaerobic degradation in the studied peatland, especially in the minerotrophic sites, while methanogenic bacteria dominate in ombrotrophic sites Examination paper. 67 refs, 6 figs, 3 tabs

  5. Acid Sulfate Alteration on Mars

    Science.gov (United States)

    Ming, D. W.; Morris, R. V.

    2016-01-01

    A variety of mineralogical and geochemical indicators for aqueous alteration on Mars have been identified by a combination of surface and orbital robotic missions, telescopic observations, characterization of Martian meteorites, and laboratory and terrestrial analog studies. Acid sulfate alteration has been identified at all three landing sites visited by NASA rover missions (Spirit, Opportunity, and Curiosity). Spirit landed in Gusev crater in 2004 and discovered Fe-sulfates and materials that have been extensively leached by acid sulfate solutions. Opportunity landing on the plains of Meridiani Planum also in 2004 where the rover encountered large abundances of jarosite and hematite in sedimentary rocks. Curiosity landed in Gale crater in 2012 and has characterized fluvial, deltaic, and lacustrine sediments. Jarosite and hematite were discovered in some of the lacustrine sediments. The high elemental abundance of sulfur in surface materials is obvious evidence that sulfate has played a major role in aqueous processes at all landing sites on Mars. The sulfate-rich outcrop at Meridiani Planum has an SO3 content of up to 25 wt.%. The interiors of rocks and outcrops on the Columbia Hills within Gusev crater have up to 8 wt.% SO3. Soils at both sites generally have between 5 to 14 wt.% SO3, and several soils in Gusev crater contain around 30 wt.% SO3. After normalization of major element compositions to a SO3-free basis, the bulk compositions of these materials are basaltic, with a few exceptions in Gusev crater and in lacustrine mudstones in Gale crater. These observations suggest that materials encountered by the rovers were derived from basaltic precursors by acid sulfate alteration under nearly isochemical conditions (i.e., minimal leaching). There are several cases, however, where acid sulfate alteration minerals (jarosite and hematite) formed in open hydrologic systems, e.g., in Gale crater lacustrine mudstones. Several hypotheses have been suggested for the

  6. The epidemiology of acne vulgaris in late adolescence

    Science.gov (United States)

    Lynn, Darren D; Umari, Tamara; Dunnick, Cory A; Dellavalle, Robert P

    2016-01-01

    Importance Acne vulgaris is the most common skin condition affecting late adolescents across the globe. Although prior studies have evaluated epidemiologic patterns of acne vulgaris in various ethnicities and regions, adequate understanding of the worldwide burden of the disease associated with patients in their late adolescence (15–19-year olds) remains lacking. Objective To assess the global burden of the disease associated with acne vulgaris for late adolescents (15–19-year olds) and provide an overview of the epidemiology, pathophysiology, and treatment options for acne in this population. Design Database summary study. Setting Global Burden of Disease Study 2010 database. Participants Global Burden of Disease regions comprised countries with prevalence of acne vulgaris between the ages of 15 and 19 years. Main outcomes and measures Geographic region-level disability-adjusted life year rates (per 100,000 persons) associated with acne vulgaris in years 1990 through 2010. Median percentage change in disability-adjusted life year rates was estimated for each region across the specified study period. Conclusion and relevance Acne vulgaris-associated disease burden exhibits global distribution and has continued to grow in prevalence over time within this population. This continued growth suggests an unmet dermatologic need worldwide for this disorder and potential opportunities for improved access and delivery of dermatologic care. Our analysis of the literature reveals numerous opportunities for enhanced patient care. To that end, we highlight some of the effective and promising treatments currently available and address important factors, such as sex, nationality, genetics, pathophysiology, and diet, as they relate to acne vulgaris in late adolescence. PMID:26955297

  7. Serum and tissue contents of copper, calcium, iron and magnesium elements in cases of acne vulgaris after zinc therapy

    International Nuclear Information System (INIS)

    El-Said, S.M.; El-Bedewi, A.F.

    2002-01-01

    The effect of zinc therapy on some trace elements contents in serum and skin was studied in normal group (forty) and patients group with acne vulgaris (26 males and 14 females) with age ranged between 14-30 year. They were under medical treatment with 330 mg oral zinc sulfate for 12 weeks. Highly significant decreases in both serum and tissue contents of copper and calcium were detected, as well as, highly significant decrease in the serum content of magnesium was recorded. The serum content of iron was highly significantly increased and that for tissue content was slightly significantly increased. It could be concluded that zinc therapy could be valuable through modulation of copper. calcium, iron and magnesium in acne patients

  8. Sulfate Transporters in Dissimilatory Sulfate Reducing Microorganisms: A Comparative Genomics Analysis

    Directory of Open Access Journals (Sweden)

    Angeliki Marietou

    2018-03-01

    Full Text Available The first step in the sulfate reduction pathway is the transport of sulfate across the cell membrane. This uptake has a major effect on sulfate reduction rates. Much of the information available on sulfate transport was obtained by studies on assimilatory sulfate reduction, where sulfate transporters were identified among several types of protein families. Despite our growing knowledge on the physiology of dissimilatory sulfate-reducing microorganisms (SRM there are no studies identifying the proteins involved in sulfate uptake in members of this ecologically important group of anaerobes. We surveyed the complete genomes of 44 sulfate-reducing bacteria and archaea across six phyla and identified putative sulfate transporter encoding genes from four out of the five surveyed protein families based on homology. We did not find evidence that ABC-type transporters (SulT are involved in the uptake of sulfate in SRM. We speculate that members of the CysP sulfate transporters could play a key role in the uptake of sulfate in thermophilic SRM. Putative CysZ-type sulfate transporters were present in all genomes examined suggesting that this overlooked group of sulfate transporters might play a role in sulfate transport in dissimilatory sulfate reducers alongside SulP. Our in silico analysis highlights several targets for further molecular studies in order to understand this key step in the metabolism of SRMs.

  9. Antigenic analyses of tissues and excretory and secretory products from Strongylus vulgaris.

    OpenAIRE

    Wynne, E; Slocombe, J O; Wilkie, B N

    1981-01-01

    Rabbit antisera were prepared against veronal buffered saline extracts of L4 and L5 Strongylus vulgaris, adult S. vulgaris and adult Strongylus equinus retrieved from naturally infected horses. In agar gel diffusion with these antisera, adult S vulgaris and S. equinus each appeared to have at least one unique antigen; larval S. vulgaris appeared to have two species-specific and two stage-specific antigens. There were several common antigens. Excretory and secretory products were collected als...

  10. Sulfate transport in toad skin

    DEFF Research Database (Denmark)

    Larsen, Erik Hviid; Simonsen, K

    1988-01-01

    1. In short-circuited toad skin preparations exposed bilaterally to NaCl-Ringer's containing 1 mM SO2(-4), influx of sulfate was larger than efflux showing that the skin is capable of transporting sulfate actively in an inward direction. 2. This active transport was not abolished by substituting...... apical Na+ for K+. 3. Following voltage activation of the passive Cl- permeability of the mitochondria-rich (m.r.) cells sulfate flux-ratio increased to a value predicted from the Ussing flux-ratio equation for a monovalent anion. 4. In such skins, which were shown to exhibit vanishingly small leakage...... conductances, the variation of the rate coefficient for sulfate influx (y) was positively correlated with the rate coefficient for Cl- influx (x), y = 0.035 x - 0.0077 cm/sec (r = 0.9935, n = 15). 5. Addition of the phosphodiesterase inhibitor, 3-isobutyl-1-methyl-xanthine to the serosal bath of short...

  11. Protective effect of citrullus vulgaris on irradiated lymphocyte membrane ultrastructure

    International Nuclear Information System (INIS)

    Khairul Osman; Norashikin, M.S.; Hing Hiang Lian; Siti Fatimah Ibrahim; Seetha Khartini Abdul Wahab; Jamaludin Mohamed; Proom Promwichit

    2004-01-01

    Radiotherapy causes various complications including low immunity. Past research that the low immunity is due to the low amount of lymphocytes and consumption vulgaris will alleviate this problem. Based on this a study was conducted to identify vulgaris was able to produce radioprotection on the lymphocyte membrane. A total of 30 adult male Sprague-Dawley rats were used and divided into three equals groups of positive control and treatment. For seven days, positive control and negative control were force fed with normal saline of 40 ml/kg animal weight while the treatment group received 40g/kg animal weight fresh juice of citrullus vulgaris daily. After a week positive control an group were irradiated with 0.9 Gy gamma ray. Viable lymphocyte were determined using propidium iodine and acridine orange stain. Results clearly shows that positive con and treatment group were significantly different at 34 ± 3% , 80 ± 2% an 71 ± 2% respectively. SEM results shows that pores were present on the membrane of the pos while the negative control had none. Similar results were also found on the treatment group. Based on the result it had shown that citrullus vulgaris had radioprotection properties and lymphocytes were destroyed by the formation of pores on their membrane. It is very likely that the radioprotection properties could be due to the presence of antioxidants particularly vitamin A, C and lycopene. In conclusion, citrullus vulgaris could be used as a safe radioprotection agent. (Author)

  12. 21 CFR 184.1261 - Copper sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Copper sulfate. 184.1261 Section 184.1261 Food and... Substances Affirmed as GRAS § 184.1261 Copper sulfate. (a) Copper sulfate (cupric sulfate, CuSO4·5H2O, CAS... the reaction of sulfuric acid with cupric oxide or with copper metal. (b) The ingredient must be of a...

  13. Periodate Oxidation for Sulfated Glycosaminoglycans, with Special Reference to the Position of Extra Sulfate Groups in Chondroitin Polysulfates, Chondroitin Sulfate D and Chondroitin Sulfate K

    OpenAIRE

    Seno, Nobuko; Murakami, Keiko; Shibusawa, Haru

    1981-01-01

    The optimum conditions for periodate oxidation of sulfated disaccharides were investigated to determine the position of extra sulfate groups on the saturated disulfated disaccharides obtained from chondroitin polysulfates, chondroitin sulfates D and K. Under the conditions: 2mM saturated disulfated disaccharide with 20mM sodium periodate at 37°in the dark, the uronic acid residue in the disulfated disaccharide from chondroitin sulfate D was rapidly and completely destroyed, whereas that in th...

  14. Inhibitory effects of Cheongsangbangpoong-tang on both inflammatory acne lesions and facial heat in patients with acne vulgaris: A randomized controlled trial protocol.

    Science.gov (United States)

    Kim, Kyuseok; Kim, Kwan-Il; Lee, Junhee

    2016-01-22

    Due to increasing interest from acne patients concerned about the side effects associated with conventional therapies, complementary and alternative medicine (CAM) has been suggested as a new therapeutic modality for acne vulgaris. Herbal medicine is one of these CAM treatments. Cheongsangbangpoong-tang (CBT) is a common herbal formula used in patients with acne vulgaris in the clinical practice of Korean Medicine (KM). However, despite the common use of CBT in clinical practice, the current level of evidence is insufficient to support an inhibitory effect of CBT on inflammatory acne lesions and facial heat. Therefore, this study was designed to assess the inhibitory effect of CBT on both inflammatory acne lesions and facial heat. A randomized, double-blind, parallel-group, and placebo-controlled trial will be conducted. Fifty-six participants with acne vulgaris will be randomized into one of two groups: the CBT or placebo groups. After randomization, participants will be prescribed either CBT or placebo three times a day at a dose of 5 g after meals for 8 weeks. The following outcome measurements will be used in the examination of subjects: the mean percentage change and the count change of the inflammatory and non-inflammatory acne lesions, the temperature of facial points on digital infrared thermal imaging (DITI), serum cortisol, serum dehydroepiandrosterone-sulfate (DHEA-S), visual analogue scale (VAS), investigator global assessment (IGA), and severity score on the Korean Acne Grading System (KAGS) from baseline to the end of the trial. This trial will provide evidence regarding the inhibitory effect of CBT on inflammatory acne lesions and facial heat. The findings of this trial may have important implications for the more widespread use of CBT for the treatment of acne vulgaris. The trial is registered with the Clinical Research Information Service (CRiS), Republic of Korea: KCT0001468 .

  15. Arteriography in ponies with Strongylus vulgaris arteritis.

    Science.gov (United States)

    Slocombe, J O; Rendano, V T; Owen, R R; Pennock, P W; McCraw, B M

    1977-04-01

    Radiographs of the aorta and abdominal arteries were obtained from a normal anesthetized pony following catheterization of a femoral artery for nonselective, semiselective or selective arteriography. The arteries had smooth borders and regular diameters and the branches of the cranial mesenteric artery could be followed distally on the angiogram through to the smaller branches proximal to the bowel wall. Following arteriography, the pony walked normally and there were minimal alterations of the levels of serum muscle enzymes and blood lactate. The procedures for arteriography were repeated in three days. At that time the femoral artery was patent and satisfactory angiograms were obtained. Similiarly, radiographs were obtained from two ponies artificially infected with Strongylus vulgaris. The cranial msenteric artery and some of its branches, the right renal artery and segments of the aorta had irregular borders and were enlarged. Branches of the cranial mesenteric artery could not be followed distally because the flow of the contrast material was blocked. Following the above procedures, euthanasia of all ponies was expedited and the findings of arteritis, thrombosis and dilatation of arteries at necropsy compared favorably with interpretations from the radiographs. At least in the pony, arteriography can be a valuable research and diagnostic tool for the demonstration of lesions associated with verminous arteritis.

  16. Radiation induced mutations in Phaseolus vulgaris L

    International Nuclear Information System (INIS)

    Al-Rubeai, M.A.F.

    1982-01-01

    A selection of various macro- and micro-mutations was undertaken in the M2 generation of Phaseolus vulgaris cultivars after seed exposure to acute gamma radiation doses of 2.5, 5, 7, 10 and 15 Kr. The chlorophyll mutation was positively correlated with dose. Nevertheless, the highest frequency was at 7 Kr. Several interesting morphological mutants were observed. There were dwarf, stiff stem, shiny small leaf, narrow leaf and green giant mutants. Two selected micromutants were superior in seed yield capacity to their parents. The high yields were related to the high number of pods per plant. In 'The Prince' (seed color: red with beige marbling) several mutants with seeds of black color marbled with beige were selected. These seeds gave M3 segregants exhibiting a range of seed colors including white. Many of these M3 plants were short, early flowering and highly sterile. The work demonstrated that the pigmentation character can readily be changed, and confirmed that the variability induced by radiation can be exploited to obtain desirable mutations. (Author) [pt

  17. 21 CFR 582.5230 - Calcium sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Calcium sulfate. 582.5230 Section 582.5230 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Supplements 1 § 582.5230 Calcium sulfate. (a) Product. Calcium sulfate. (b) Conditions of use. This substance...

  18. 21 CFR 184.1643 - Potassium sulfate.

    Science.gov (United States)

    2010-04-01

    ... hydroxide or potassium carbonate. (b) The ingredient meets the specifications of the “Food Chemicals Codex... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Potassium sulfate. 184.1643 Section 184.1643 Food... Specific Substances Affirmed as GRAS § 184.1643 Potassium sulfate. (a) Potassium sulfate (K2SO4, CAS Reg...

  19. 21 CFR 184.1443 - Magnesium sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Magnesium sulfate. 184.1443 Section 184.1443 Food... Specific Substances Affirmed as GRAS § 184.1443 Magnesium sulfate. (a) Magnesium sulfate (MgSO4·7H2O, CAS... magnesium oxide, hydroxide, or carbonate with sulfuric acid and evaporating the solution to crystallization...

  20. EFFECT OF MAGNESIUM SULFATE (A LAXATIVE) ON ...

    African Journals Online (AJOL)

    use with little success . Magnesium sulfate also known as Epsom salt or bitter salt is a hydrate salt with a chemical name of magnesium sulfate heptahydrate . Chemical formula is MgSO. 7HO and trade name is. Andrews liver salt. Dried magnesium sulfate is an osmotic laxative or a saline laxative that acts by increasing the.

  1. 21 CFR 582.5443 - Magnesium sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Magnesium sulfate. 582.5443 Section 582.5443 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Supplements 1 § 582.5443 Magnesium sulfate. (a) Product. Magnesium sulfate. (b) Conditions of use. This...

  2. Modeling and minimization of barium sulfate scale

    Science.gov (United States)

    Alan W. Rudie; Peter W. Hart

    2006-01-01

    The majority of the barium present in the pulping process exits the digester as barium carbonate. Barium carbonate dissolves in the bleach plant when the pH drops below 7 and, if barium and sulfate concentrations are too high, begins to precipitate as barium sulfate. Barium is difficult to control because a mill cannot avoid this carbonate-to-sulfate transition using...

  3. 21 CFR 582.1125 - Aluminum sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum sulfate. 582.1125 Section 582.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL... Additives § 582.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...

  4. 21 CFR 182.1125 - Aluminum sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum sulfate. 182.1125 Section 182.1125 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR... Substances § 182.1125 Aluminum sulfate. (a) Product. Aluminum sulfate. (b) Conditions of use. This substance...

  5. An Atlas of annotations of Hydra vulgaris transcriptome.

    Science.gov (United States)

    Evangelista, Daniela; Tripathi, Kumar Parijat; Guarracino, Mario Rosario

    2016-09-22

    RNA sequencing takes advantage of the Next Generation Sequencing (NGS) technologies for analyzing RNA transcript counts with an excellent accuracy. Trying to interpret this huge amount of data in biological information is still a key issue, reason for which the creation of web-resources useful for their analysis is highly desiderable. Starting from a previous work, Transcriptator, we present the Atlas of Hydra's vulgaris, an extensible web tool in which its complete transcriptome is annotated. In order to provide to the users an advantageous resource that include the whole functional annotated transcriptome of Hydra vulgaris water polyp, we implemented the Atlas web-tool contains 31.988 accesible and downloadable transcripts of this non-reference model organism. Atlas, as a freely available resource, can be considered a valuable tool to rapidly retrieve functional annotation for transcripts differentially expressed in Hydra vulgaris exposed to the distinct experimental treatments. WEB RESOURCE URL: http://www-labgtp.na.icar.cnr.it/Atlas .

  6. Regeneration of sulfated metal oxides and carbonates

    Science.gov (United States)

    Hubble, Bill R.; Siegel, Stanley; Cunningham, Paul T.

    1978-03-28

    Alkali metal or alkaline earth metal carbonates such as calcium carbonate and magnesium carbonate found in dolomite or limestone are employed for removal of sulfur dioxide from combustion exhaust gases. The sulfated carbonates are regenerated to oxides through use of a solid-solid reaction, particularly calcium sulfide with calcium sulfate to form calcium oxide and sulfur dioxide gas. The regeneration is performed by contacting the sulfated material with a reductant gas such as hydrogen within an inert diluent to produce calcium sulfide in mixture with the sulfate under process conditions selected to permit the sulfide-sulfate, solid-state reaction to occur.

  7. Epidemiology of Strongylus vulgaris infection of the horse in Morocco.

    Science.gov (United States)

    Pandey, V S

    1981-05-01

    Between August 1978 and July 1979 the anterior mesenteric artery and its branches were collected regularly from adult horses and examined for Strongylus vulgaris larvae. The incidence of infection varied from 55 to 100% (annual mean 80%). The mean monthly number of larvae ranged form 3 to 22 with an annual overall mean of 13. The arterial infection was at its minimum in December to January, rose gradually to attain the peak in June and declined thereafter. These observations indicated that S. vulgaris is an annual species in Morocco, infection occurring during the rainy season (November-April), the heavy arterial population in spring and adult population during autumn and winter.

  8. Integrated control of Strongylus vulgaris infection in horses using ivermectin.

    Science.gov (United States)

    Dunsmore, J D

    1985-05-01

    An attempt was made to control or eliminate Strongylus vulgaris from a closed group of three horses at pasture near Perth, Western Australia, by dosing with ivermectin on four occasions during the time of year when it was believed that environmental conditions would eliminate all the non-parasitic stages of that species. At necropsy, five months after the last dose of anthelmintic and after continually grazing the same pastures, no S vulgaris or arterial lesions were found in those horses and S edentatus, Draschia megastoma and Habronema species were also almost completely eliminated.

  9. Coincident systemic lupus erythematosus and psoriasis vulgaris: a case report.

    Science.gov (United States)

    Wang, Y; Da, G; Yu, Y; Han, J; Li, H

    2015-12-01

    Psoriasis vulgaris is an autoimmune chronic inflammatory skin disease, but its association with other typical autoimmune disease such as systemic lupus erythematosus has only occasionally been reported. We presented a 25-year-old female who developed systemic lupus erythematosus associated with psoriasis vulgaris. Her conditions were in good control after she got administration of prednisolone (5 mg/day) and Tripterygium Wilfordii Hook (20 mg/day). It is necessary to integrate past history and physical examination to diagnose coincident SLE and psoriasis, and combined treatment with prednisolone and Tripterygium Wilfordii Hook proves effective.

  10. Culture of the microalga chlorella vulgaris on different proportions of sugar mill effluents

    International Nuclear Information System (INIS)

    Khan, A.N.M.A.I.; Islam, M.R.; Habib, M.A.B.; Hossain, M.S.; Miah, M.I.

    2006-01-01

    Chlarella vulgaris was cultured in four different dilutions of sugar mill effluent media (SMEM). Bold's basal medium (BBM) was used as the control under laboratory conditions. Maximum cell growth and chlorophyll-a content were obtained on 10th day of the culture in 50% diluted SMEM, followed by those grown in BBM, and 75, 25 and 100% SMEM at stationary phase. The specific growth rate (mu g/day) of cells and chlorophyll-a of C. vulgaris grown in 50% SMEM varied significantly (p < 0.0 I) from those of C. vulgaris cultured in BBM, followed by other SMEM concentrations. Total biomass of C. vulgaris. cultured in 50% SMEM, was found to be significantly higher (p < 0.0 I) than that of C. vulgaris cultured in BBM, and 25, 75 and 100% SMEM concentrations. Similar trend was also observed in the case of optical density. Cell number and chlorophyll-a of C. vulgaris were highly (p < 0.01) and directly correlated with chlorophyll-a (r2 = 0.991) of C. vulgaris and optical density (r2 = 0.989) for the culture media containing C. vulgaris, respectively. Crude proteins and crude lipids of C. vulgaris. grown in 50% SMEM, were significantly (p < 0.01) higher than those of C. vulgaris cultured in other SMEM concentrations. Due to good growth performance exhibited in the 50% SMEM dilution, the sugar mill effluent may be used for efficient cultivation of C. vulgaris and possibly other micro algae. (author)

  11. Management of pemphigus vulgaris during acute phase

    Directory of Open Access Journals (Sweden)

    Kar P

    2003-03-01

    Full Text Available We present our experience with 21 patients of pemphigus vulgaris seen over a period of 10 years managed in service hospitals during acute phase of the disease. Age groups of patients ranged from 25-45 years. Eighteen (85.7% were young adults, 30-40 years of age. Fifteen (71.4% were men and 6(28.6% were women. All the cases were hospitalized in ICU, till the acute phase of the disease subsided. Complete hematological profile, urinalysis, serum biochemistry and repeated bacterial cultures from the skin were carried out in all patients at the time of admission and thereafter weekly. The treatment comprised of potassium permanganate lotion bath (1:10000 and 1 framycetin gauze dressing of the denuded areas, maintenance of fluid and electrolyte balance. All suspected infections and septicemia were treated with appropriate antibiotics. The corticosteroids were usually administered as a single dose of prednisolone 1 mg/kg/day. Cyclophosphamide was given at an initial dose of 50mg/day and the dose was escalated to 100mg/day. Once the bulk of the lesions were healed, the dose of corticosteroids was gradually lowered by approximately 50% every two weeks and cyclophosphamide was continued till patients were symptomfree. Out of 21 patients receiving corticosteroids, cyclophosphamide and other supportive therapy, 20(95% had undergone clinical resolution of the disease. During follow up study 15(71.4% patients remained symptom-free and undergone clinical remission. Five patients (23.8% had relapse, out of which 4(19% remained symptom free, after subsequent treatment. There was one death (4.7% in our study.

  12. SEZARY SYNDROME MIMICKING GENERALIZED PSORIASIS VULGARIS

    Directory of Open Access Journals (Sweden)

    Eko Rianova Lynoora

    2016-09-01

    Full Text Available Sezary syndrome is the leukemic variant of cutaneous T cell lymphoma. This disease is characterized by some reddish patches or plaques all over the skin which extends to the whole body into erythroderma, lymphadenopathy. It is also indicated by the presence of atypical lymphocytes called Sezary cells. This case report is aimed to know clinical manifestation, examination and management of Sezary syndrome which clinically resembles generalized psoriasis. A 60 years old man came with scaly reddish brown plaques almost all over his body. It was accompanied by lymphadenopathy on the supraclavicular lymph node right and left as well as intense itchy. Other clinical features were alopecia, palmoplantar hyperkeratosis, onychodysthropy, facies leonine without anesthesia on the lesion and enlargement of peripheral nerve. From a laboratory test, an increase in the number of leukocytes and, Sezary cells were found in peripheral blood smear examination; while the histopathology showed focal athrophy and acanthosis of the epidermis and dense infiltration of lymphocytes in the dermo-epidermal junction and superficial dermis. Patient received 3 x 5 mg (1 cycle of methotrexate (MTX with 0,1% cream mometasone furoate and 3x1 tablet of CTM for adjunctive therapy. Methotrexate was discontinued because there was a disturbance in liver function and deterioration of patient’s condition. After 25 days of treatment, the patient got sepsis and then passed away. Early onset of Sezary syndrome in this case is difficult to know because the clinical manifestation is similar with psoriasis vulgaris. Supporting examination such as laboratory test, blood smears and histopathology examination could help the diagnosis. The presence of lymphadenopathy, and atypical lymphocytes in the peripheral blood and the extensive skin involvement reflect the poor prognosis. The most common cause of death was sepsis.

  13. Reduced sulfation of chondroitin sulfate but not heparan sulfate in kidneys of diabetic db/db mice.

    Science.gov (United States)

    Reine, Trine M; Grøndahl, Frøy; Jenssen, Trond G; Hadler-Olsen, Elin; Prydz, Kristian; Kolset, Svein O

    2013-08-01

    Heparan sulfate proteoglycans are hypothesized to contribute to the filtration barrier in kidney glomeruli and the glycocalyx of endothelial cells. To investigate potential changes in proteoglycans in diabetic kidney, we isolated glycosaminoglycans from kidney cortex from healthy db/+ and diabetic db/db mice. Disaccharide analysis of chondroitin sulfate revealed a significant decrease in the 4-O-sulfated disaccharides (D0a4) from 65% to 40%, whereas 6-O-sulfated disaccharides (D0a6) were reduced from 11% to 6%, with a corresponding increase in unsulfated disaccharides. In contrast, no structural differences were observed in heparan sulfate. Furthermore, no difference was found in the molar amount of glycosaminoglycans, or in the ratio of hyaluronan/heparan sulfate/chondroitin sulfate. Immunohistochemical staining for the heparan sulfate proteoglycan perlecan was similar in both types of material but reduced staining of 4-O-sulfated chondroitin and dermatan was observed in kidney sections from diabetic mice. In support of this, using qRT-PCR, a 53.5% decrease in the expression level of Chst-11 (chondroitin 4-O sulfotransferase) was demonstrated in diabetic kidney. These results suggest that changes in the sulfation of chondroitin need to be addressed in future studies on proteoglycans and kidney function in diabetes.

  14. Modeling of ferric sulfate decomposition and sulfation of potassium chloride during grate‐firing of biomass

    DEFF Research Database (Denmark)

    Wu, Hao; Jespersen, Jacob Boll; Jappe Frandsen, Flemming

    2013-01-01

    Ferric sulfate is used as an additive in biomass combustion to convert the released potassium chloride to the less harmful potassium sulfate. The decomposition of ferric sulfate is studied in a fast heating rate thermogravimetric analyzer and a volumetric reaction model is proposed to describe...... the process. The yields of sulfur oxides from ferric sulfate decomposition under boiler conditions are investigated experimentally, revealing a distribution of approximately 40% SO3 and 60% SO2. The ferric sulfate decomposition model is combined with a detailed kinetic model of gas‐phase KCl sulfation...... and a model of K2SO4 condensation to simulate the sulfation of KCl by ferric sulfate addition. The simulation results show good agreements with experiments conducted in a biomass grate‐firing reactor. The results indicate that the SO3 released from ferric sulfate decomposition is the main contributor to KCl...

  15. Immunocytochemical localization of APS reductase and bisulfite reductase in three Desulfovibrio species

    NARCIS (Netherlands)

    Kremer, D.R.; Veenhuis, M.; Fauque, G.; Peck Jr., H.D.; LeGall, J.; Lampreia, J.; Moura, J.J.G.; Hansen, T.A.

    1988-01-01

    The localization of APS reductase and bisulfite reductase in Desulfovibrio gigas, D. vulgaris Hildenborough and D. thermophilus was studied by immunoelectron microscopy. Polyclonal antibodies were raised against the purified enzymes from each strain. Cells fixed with formaldehyde/glutaraldehyde were

  16. Inhibition of synthesis of heparan sulfate by selenate: Possible dependence on sulfation for chain polymerization

    International Nuclear Information System (INIS)

    Dietrich, C.P.; Nader, H.B.; Buonassisi, V.; Colburn, P.

    1988-01-01

    Selenate, a sulfation inhibitor, blocks the synthesis of heparan sulfate and chondroitin sulfate by cultured endothelial cells. In contrast, selenate does not affect the production of hyaluronic acid, a nonsulfated glycosaminoglycan. No differences in molecular weight, [ 3 H]glucosamine/[ 35 S]sulfuric acid ratios, or disaccharide composition were observed when the heparan sulfate synthesized by selenate-treated cells was compared with that of control cells. The absence of undersulfated chains in preparations from cultures exposed to selenate supports the concept that, in the intact cell, the polymerization of heparan sulfate might be dependent on the sulfation of the saccharide units added to the growing glycosaminoglycan chain

  17. Effect of Euphorbia hirta and Thymus vulgaris powders on ...

    African Journals Online (AJOL)

    The ban placed on the long term use of commercial antibiotics at subtherapeutic levels for diseases control and growth promotion in livestock production necessitated a worldwide search for available, cost effective and efficacious alternatives. Accordingly, the effects of Euphorbia hirta (EH) and Thymus vulgaris (TV) ...

  18. allelopathic effects of eucalyptus tereticornis on phaseolus vulgaris

    African Journals Online (AJOL)

    user

    1. ALLELOPATHIC EFFECTS OF EUCALYPTUS TERETICORNIS ON PHASEOLUS. VULGARIS SEEDLINGS. Sale, F.A.. Department of Forestry and Wildlife, Faculty of ..... Sale, F.A. (2009). Allelopathic influence of Acacia auriculiformis. Eucalyptus citriodora and Gliricidia sepium on germination, growth and yield of millet.

  19. Genetic diversity study of common bean ( Phaseolus vulgaris L ...

    African Journals Online (AJOL)

    In PCoA, majority individuals of Metekel (L) tended to form separate group. The result of the study confirmed the presence of genetic diversity that can be exploited to improve the productivity. This calls for a conserted efforts in the collection, conservation and sustainable use of P. vulgaris. Keywords: Genetic diversity, ISSR, ...

  20. Enzymatic Browning in Sugar Beet Leaves (Beta vulgaris L.)

    NARCIS (Netherlands)

    Vissers, Anne; Kiskini, Alexandra; Hilgers, Roelant; Marinea, Marina; Wierenga, Peter Alexander; Gruppen, Harry; Vincken, Jean Paul

    2017-01-01

    Sugar beet (Beta vulgaris L.) leaves of 8 month (8m) plants showed more enzymatic browning than those of 3 month (3m). Total phenolic content increased from 4.6 to 9.4 mg/g FW in 3m and 8m, respectively, quantitated by

  1. Bioremediation of the textile waste effluent by Chlorella vulgaris

    Directory of Open Access Journals (Sweden)

    Hala Yassin El-Kassas

    2014-01-01

    Full Text Available The microalgae biomass production from textile waste effluent is a possible solution for the environmental impact generated by the effluent discharge into water sources. The potential application of Chlorella vulgaris for bioremediation of textile waste effluent (WE was investigated using 22 Central Composite Design (CCD. This work addresses the adaptation of the microalgae C. vulgaris in textile waste effluent (WE and the study of the best dilution of the WE for maximum biomass production and for the removal of colour and Chemical Oxygen Demand (COD by this microalga. The cultivation of C. vulgaris, presented maximum cellular concentrations Cmax and maximum specific growth rates μmax in the wastewater concentration of 5.0% and 17.5%, respectively. The highest colour and COD removals occurred with 17.5% of textile waste effluent. The results of C. vulgaris culture in the textile waste effluent demonstrated the possibility of using this microalga for the colour and COD removal and for biomass production. There was a significant negative relationship between textile waste effluent concentration and Cmax at 0.05 level of significance. However, sodium bicarbonate concentration did not significantly influence the responses of Cmax and the removal of colour and COD.

  2. Novel protocol for lutein extraction from microalga Chlorella vulgaris

    DEFF Research Database (Denmark)

    D'Este, Martina; De Francisci, Davide; Angelidaki, Irini

    2017-01-01

    Lutein is a pigment generally extracted from marigold flowers. However, lutein is also found in considerable amounts in microalgae. In this study a novel method was developed to improve the extraction efficiency of lutein from microalga C. vulgaris. Differently from conventional methods, ethanol...

  3. Effect of Prunella vulgaris L extract on hyperplasia of mammary ...

    African Journals Online (AJOL)

    p < 0.01) in rats treated with highdose PVE. Conclusion: These results suggest that PVE exerts anti-HMG effect in rats induced by estrogen and progestogen. Keywords: Prunella vulgaris L; Anti-inflammatory; Anti-hyperplasia of mammary gland ...

  4. Gallium-67-citrate uptake in a case of acne vulgaris

    International Nuclear Information System (INIS)

    Kipper, M.S.; Taylor, A.; Ashburn, W.L.

    1981-01-01

    A case of increased Ga-67 uptake in a patient with active acne vulgaris is reported. The scan was requested in a search for metastatic testicular carcinoma or bleomycin pulmonary toxicity. Careful clinical evaluation including physical examination was necessary in order to avoid an erroneous scan interpretation

  5. Using bamboo (Bambusa vulgaris) as a field drainage material in ...

    African Journals Online (AJOL)

    Bamboo (Bambusa vulgaris), one of the most widespread member of its genus, was used as field drainage material in Akure, Nigeria. Pre-determined sizes of bamboo with uniform lengths and diameters were installed as sub-drains in agricultural field for drainage purposes, especially in developing countries like Nigeria.

  6. Fatty acids composition of microalgae Chlorella vulgaris can be ...

    African Journals Online (AJOL)

    Varying culture methods of Chlorella vulgaris (CV) has been associated with different nutrient composition. The aim of this study was to investigate the fatty acid contents and other nutrients of CV subjected to various culturing conditions. We found that CV cultured under 24 h light and 10% CO2 showed the best growth rates ...

  7. Nodulation and nitrogen fixation in common bean (Phaseolus vulgaris)

    African Journals Online (AJOL)

    Mamadou Gueye

    Nodulation and nitrogen fixation of field grown common bean (Phaseolus vulgaris) as influenced by fungicide seed treatment. Ndeye Fatou Diaw GUENE, Adama DIOUF and Mamadou GUEYE*. MIRCEN/ Laboratoire commun de microbiologie IRD-ISRA-UCAD, BP 1386, DAKAR, Senegal. Accepted 23 June 2003.

  8. Phosphorus use efficiency in common bean ( Phaseolus vulgaris L ...

    African Journals Online (AJOL)

    The tripartite symbiosis of common bean (Phaseolus vulgaris L.) recombinant inbred line (RIL) 147 with rhizobia and arbuscular mycorrhizal fungi (AMF) was assessed in sand culture by comparing the effects of three AMF species on the mycorrhizal root colonization, rhizobial nodulation, plant growth and phosphorus use ...

  9. Reproductive biology of common octopus Octopus vulgaris (Cuvier ...

    African Journals Online (AJOL)

    Abstract. Although common octopus catches are increasing globally, lack of information on the species reproductive biology has been a major concern in its management particularly in Kenya. The present study aimed at investigating the reproductive biology of Octopus vulgaris from Shimoni and Vanga in the Kenyan South ...

  10. The South African chokka squid Loligo vulgaris reynaudii is caught ...

    African Journals Online (AJOL)

    spamer

    during the 1970s and early 1980s that official statistics started to reveal ... a South African offshore component fishing off both .... 2: Annual landings of Loligo vulgaris reynaudii, 1971–1997, by the trawl fishery, both South African and foreign ...

  11. Composite Phaseolus vulgaris plants with transgenic roots as ...

    African Journals Online (AJOL)

    SERVER

    2008-02-19

    Feb 19, 2008 ... ... important processes in the root system will be discussed. Key words: Genetic transformation, Phaseolus vulgaris, Agrobacterium rhizogenes. INTRODUCTION. Grain legumes are important agricultural crops, especially for developing countries, where they provide proteins in vegetarian or meat-poor diets.

  12. Composite Phaseolus vulgaris plants with transgenic roots as ...

    African Journals Online (AJOL)

    Large seeded grain legumes such as the common bean (Phaseolus vulgaris) and cowpea (Vigna unguiculata) are very important crops with seeds that are major protein source for people in developing countries, but their yields and improvement lag behind the economically more important cereals. For research purposes ...

  13. An update on the management of acne vulgaris

    Directory of Open Access Journals (Sweden)

    Jonette Keri

    2009-06-01

    Full Text Available Jonette Keri1,2, Michael Shiman11Department of Dermatology and Cutaneous Surgery, University of Miami Miller School of Medicine, Miami, FL, USA; 2Dermatology Service, Miami VA Hospital, FL, USAAbstract: Acne vulgaris is a common skin disorder that can affect individuals from childhood to adulthood, most often occurring in the teenage years. Acne can have a significant physical, emotional, and social impact on an individual. Many different treatment options are available for the treatment of acne vulgaris. Commonly used topical treatments include benzoyl peroxide, antibiotics, sulfur and sodium sulfacetamide, azelaic acid, and retinoids. Systemic treatment is frequently used and includes the use of systemic antibiotics, oral contraceptives, antiandrogens, and retinoids. Other treatment modalities exist such as the use of superficial chemical peels as well as using laser and light devices for the treatment of acne. With the multitude of treatment options and the rapidly expanding newer technologies available to clinicians, it is important to review and be aware of the current literature and studies regarding the treatment of acne vulgaris.Keywords: acne vulgaris, treatment, benzoyl peroxide, antibiotics, retinoids, lasers

  14. The biomass and ecology of chokka squid Loligo vulgaris reynaudii ...

    African Journals Online (AJOL)

    Migration, stock size and ecology of chokka squid Loligo vulgaris reynaudii off the West Coast of South Africa were studied and their relationship to other regions compared by analysis of distributional, biomass, and size composition, and biological data collected from biannual research cruises from 1983-1987. Biomass ...

  15. Effects of Thymus vulgaris and Mentha pulegium on colour, nutrients ...

    African Journals Online (AJOL)

    This study was designed to investigate the effects of Thymus vulgaris (thyme) and Mentha pulegium (mentha) powders on meat colour, nutrient composition and malondialdehyde (MDA) where broiler chickens were under heat stress. Two hundred one-day-old male chicks were used in a completely randomized design with ...

  16. Response of common bean ( Phaseolus vulgaris L.) cultivars to ...

    African Journals Online (AJOL)

    Yield losses in common bean (Phaseolus vulgaris L.) may occur due to boron (B) deficiency when the susceptible cultivars are grown in calcareous boron deficient soils. The study was therefore aimed at investigating the effects of three B doses: control (0.0 kg ha-1), soil application (3.0 kg ha-1) and foliar fertilization (0.3 kg ...

  17. Evaluation of Azithromycin in Treatment of Acne Vulgaris Compared to

    African Journals Online (AJOL)

    Introduction: Acne vulgaris is the most common dermatological disorder in adolescence. Treatment is essential to prevent physical and psychological scarring. Although many treatments for acne are available, effective management has become increasingly challenging with the emergence of antibiotic-resistant strains of ...

  18. Topical antibiotic monotherapy prescribing practices in acne vulgaris.

    Science.gov (United States)

    Hoover, William D; Davis, Scott A; Fleischer, Alan B; Feldman, Steven R

    2014-04-01

    The aim of this study is to evaluate the frequency of dosing topical antibiotics as monotherapy in the treatment of acne vulgaris, and physician specialty prescribing these medications. This study is a retrospective review of all visits with a sole diagnosis of acne vulgaris (ICD-9-CM code 706.1) found on the National Ambulatory Medical Care Survey (NAMCS) in 1993-2010. We recorded the number of visits surveyed where acne vulgaris was the sole diagnosis, number of visits where topical antibiotics were the only treatment prescribed, and the specialty of physician in each encounter. Topical erythromycin or clindamycin were the sole medication prescribed in 0.81% of the visits recorded, with 60% of these prescriptions arising from dermatologists and 40% from non-dermatologists. The trend of prescribing topical antibiotic monotherapy is declining (p acnes to topical antibiotic regimens has led to the need to re-evaluate the use of topical antibiotics in the treatment of acne vulgaris. While the rate of topical antibiotic monotherapy is declining, their use should be reserved for situations where the direct need for antibiotics arises. If a clinician feels that antibiotics are a necessary component to acne therapy, they should be used as part of a combination regimen.

  19. The oral adverse effects of isotretinoin treatment in acne vulgaris ...

    African Journals Online (AJOL)

    Background: Isotretinoin is the most effective therapy to treat severe acne vulgaris and its systemic adverse effects have been well documented, but little is known on dental side effects over the course of treatment. Objectives: This prospective case-control study aimed to evaluate the oral adverse effects of isotretinoin in ...

  20. The epidemiology of acne vulgaris in late adolescence

    Directory of Open Access Journals (Sweden)

    Lynn DD

    2016-01-01

    Full Text Available Darren D Lynn,1 Tamara Umari,1 Cory A Dunnick,2,3 Robert P Dellavalle2–4 1Department of Dermatology, University of Colorado School of Medicine, 2Department of Dermatology, University of Colorado Anschutz Medical Campus, Aurora, 3Dermatology Service, US Department of Veterans Affairs, Eastern Colorado Health Care System, Denver, 4Department of Epidemiology, Colorado School of Public Health, University of Colorado Anschutz Medical Campus, Aurora, CO, USA Importance: Acne vulgaris is the most common skin condition affecting late adolescents across the globe. Although prior studies have evaluated epidemiologic patterns of acne vulgaris in various ethnicities and regions, adequate understanding of the worldwide burden of the disease associated with patients in their late adolescence (15–19-year olds remains lacking. Objective: To assess the global burden of the disease associated with acne vulgaris for late adolescents (15–19-year olds and provide an overview of the epidemiology, pathophysiology, and treatment options for acne in this population. Design: Database summary study. Setting: Global Burden of Disease Study 2010 database. Participants: Global Burden of Disease regions comprised countries with prevalence of acne vulgaris between the ages of 15 and 19 years. Main outcomes and measures: Geographic region-level disability-adjusted life year rates (per 100,000 persons associated with acne vulgaris in years 1990 through 2010. Median percentage change in disability-adjusted life year rates was estimated for each region across the specified study period. Conclusion and relevance: Acne vulgaris-associated disease burden exhibits global distribution and has continued to grow in prevalence over time within this population. This continued growth suggests an unmet dermatologic need worldwide for this disorder and potential opportunities for improved access and delivery of dermatologic care. Our analysis of the literature reveals numerous

  1. In vitro induction of lymphocyte responsiveness by a Strongylus vulgaris-derived mitogen.

    Science.gov (United States)

    Bailey, M; Lloyd, S; Martin, S C; Soulsby, E J

    1984-01-01

    Proliferation in vitro of peripheral blood lymphocytes both from horses infected with Strongylus vulgaris and from helminth-free ponies was observed in the presence of extracts of the fourth and fifth stage larvae and adults of S. vulgaris. In addition, S. vulgaris extracts induced transformation in cultures of peripheral blood lymphocytes from sheep and dogs and in mouse spleen cell cultures. Nylon wool non-adherent, T cell enriched fractions of lymphocytes from both mice and horses were stimulated by the S. vulgaris larval mitogen while no proliferation was observed in cultures containing nylon wool adherent, B cell enriched fractions. Macrophage co-operation appeared not to be necessary for S. vulgaris mitogen-induced transformation of spleen cells. The S. vulgaris mitogen stimulated a subpopulation of mouse spleen cells different from those responsive to PHA, Con A and LPS. These cells might be T helper cells since B cells were stimulated to proliferate in the presence of both T cells and S. vulgaris larval mitogen. In addition, the supernatant of in vitro cultured larvae of S. vulgaris induced slight, but significant transformation of equine peripheral blood lymphocytes. Therefore, it is possible that the S. vulgaris mitogen released by both viable parasites and degenerating larvae might induce T cell dependent production of immunoglobulin in vivo and account for the beta-globulinaemia, of which IgG(T) is a major component, in S vulgaris infected horses.

  2. Vitamin D levels in acne vulgaris patients treated with oral isotretinoin.

    Science.gov (United States)

    El-Hamd, Mohammed Abu; El Taieb, Moustafa A; Ibrahim, Hassan M; Aly, Sanaa S

    2018-02-20

    Acne vulgaris is a common inflammatory skin disease. Vitamin D deficiency plays a role in many inflammatory skin diseases. It may play a role in pathogenesis of acne vulgaris. This study aimed to assess serum levels of 25 hydroxy vitamin D in patients with acne vulgaris before and after treatment with isotretinoin and its relation with acne vulgaris severity. Ninety patients with acne vulgaris and 60 age-sex matched healthy subject as controls have been recruited in this study. Patients were treated with 0.75 mg/kg/d isotretinoin for 3 months. Serum level of 25 hydroxy vitamin D has been measured at baseline and after treatment. Serum levels of 25 hydroxy vitamin D were significantly higher in patients with acne vulgaris than healthy controls (P = .001). There was a significant inverse relation between level of 25 hydroxy vitamin D and severity of acne vulgaris before treatment (P = .001). Serum levels of 25 hydroxy vitamin D were significantly increased after isotretinoin treatment in patients with acne vulgaris (P = .001). This study concluded that vitamin D may play a potential role in pathogenesis of acne vulgaris or acne vulgaris may have a negative effect on vitamin D synthesis. Further studies are needed to confirm these potential relations. © 2018 Wiley Periodicals, Inc.

  3. Analysis of tyrosine-O-sulfation

    DEFF Research Database (Denmark)

    Bundgaard, J.R.; Sen, J.W.; Johnsen, A.H.

    2008-01-01

    Tyrosine O-sulfation was first described about 50 years ago as a post-translational modification of fibrinogen. In the following 30 years it was considered to be a rare modification affecting only a few proteins and peptides. However, in the beginning of the 1980s tyrosine (Tyr) sulfation was shown...... to be a common modification and since then an increasing number of proteins have been identified as sulfated. The target proteins belong to the classes of secretory, plasma membrane, and lysosomal proteins, which reflects the intracellular localization of the enzymes catalyzing Tyr sulfation, the tyrosylprotein...... sulfotransferases (TPSTs).Traditionally, Tyr sulfation has been analyzed by incorporation of radiolabeled sulfate into target cells followed by purification of the target protein. Subsequently, the protein is degraded enzymatically or by alkaline hydrolysis followed by thin-layer electrophoresis to demonstrate...

  4. Establishment and metabolic analysis of a model microbial community for understanding trophic and electron accepting interactions of subsurface anaerobic environments

    Directory of Open Access Journals (Sweden)

    Yang Zamin K

    2010-05-01

    Full Text Available Abstract Background Communities of microorganisms control the rates of key biogeochemical cycles, and are important for biotechnology, bioremediation, and industrial microbiological processes. For this reason, we constructed a model microbial community comprised of three species dependent on trophic interactions. The three species microbial community was comprised of Clostridium cellulolyticum, Desulfovibrio vulgaris Hildenborough, and Geobacter sulfurreducens and was grown under continuous culture conditions. Cellobiose served as the carbon and energy source for C. cellulolyticum, whereas D. vulgaris and G. sulfurreducens derived carbon and energy from the metabolic products of cellobiose fermentation and were provided with sulfate and fumarate respectively as electron acceptors. Results qPCR monitoring of the culture revealed C. cellulolyticum to be dominant as expected and confirmed the presence of D. vulgaris and G. sulfurreducens. Proposed metabolic modeling of carbon and electron flow of the three-species community indicated that the growth of C. cellulolyticum and D. vulgaris were electron donor limited whereas G. sulfurreducens was electron acceptor limited. Conclusions The results demonstrate that C. cellulolyticum, D. vulgaris, and G. sulfurreducens can be grown in coculture in a continuous culture system in which D. vulgaris and G. sulfurreducens are dependent upon the metabolic byproducts of C. cellulolyticum for nutrients. This represents a step towards developing a tractable model ecosystem comprised of members representing the functional groups of a trophic network.

  5. Bactericide for sulfate-reducing bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Shklyar, T F; Anoshina, G M; Blokhin, V Ye; Kisarrev, Ye L; Novikovsa, G M

    1981-01-01

    The aim of the invention is to find a bactericide for sulfate-reducing bacteria of oil fields in Western Siberia in order to suppress the biocorrosive activity on oil industry equipment. This goal is achieved by using M-nitroacetanylide as the bactericide of sulfate-reducing bacteria. This agent suppresses the activity of a stored culture of sulfate-reducing bacteria that comes from industrial waste waters injection wells of the Smotlor oil field.

  6. Significant role of organic sulfur in supporting sedimentary sulfate reduction in low-sulfate environments

    Science.gov (United States)

    Fakhraee, Mojtaba; Li, Jiying; Katsev, Sergei

    2017-09-01

    Dissimilatory sulfate reduction (DSR) is a major carbon mineralization pathway in aquatic sediments, soils, and groundwater, which regulates the production of hydrogen sulfide and the mobilization rates of biologically important elements such as phosphorus and mercury. It has been widely assumed that water-column sulfate is the main sulfur source to fuel this reaction in sediments. While this assumption may be justified in high-sulfate environments such as modern seawater, we argue that in low-sulfate environments mineralization of organic sulfur compounds can be an important source of sulfate. Using a reaction-transport model, we investigate the production of sulfate from sulfur-containing organic matter for a range of environments. The results show that in low sulfate environments (50%) of sulfate reduction. In well-oxygenated systems, porewater sulfate profiles often exhibit sub-interface peaks so that sulfate fluxes are directed out of the sediment. Our measurements in Lake Superior, the world's largest lake, corroborate this conclusion: offshore sediments act as sources rather than sinks of sulfate for the water column, and sediment DSR is supported entirely by the in-sediment production of sulfate. Sulfate reduction rates are correlated to the depth of oxygen penetration and strongly regulated by the supply of reactive organic matter; rate co-regulation by sulfate availability becomes appreciable below 500 μM level. The results indicate the need to consider the mineralization of organic sulfur in the biogeochemical cycling in low-sulfate environments, including several of the world's largest freshwater bodies, deep subsurface, and possibly the sulfate-poor oceans of the Early Earth.

  7. Discovery of a Heparan sulfate 3- o -sulfation specific peeling reaction

    NARCIS (Netherlands)

    Huang, Yu; Mao, Yang; Zong, Chengli; Lin, Cheng; Boons, Geert Jan|info:eu-repo/dai/nl/088245489; Zaia, Joseph

    2015-01-01

    Heparan sulfate (HS) 3-O-sulfation determines the binding specificity of HS/heparin for antithrombin III and plays a key role in herpes simplex virus (HSV) infection. However, the low natural abundance of HS 3-O-sulfation poses a serious challenge for functional studies other than the two cases

  8. 21 CFR 172.822 - Sodium lauryl sulfate.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Sodium lauryl sulfate. 172.822 Section 172.822 Food... Multipurpose Additives § 172.822 Sodium lauryl sulfate. The food additive sodium lauryl sulfate may be safely... specifications: (1) It is a mixture of sodium alkyl sulfates consisting chiefly of sodium lauryl sulfate [CH2(CH2...

  9. Brittlestars contain highly sulfated chondroitin sulfates/dermatan sulfates that promote fibroblast growth factor 2-induced cell signaling.

    Science.gov (United States)

    Ramachandra, Rashmi; Namburi, Ramesh B; Ortega-Martinez, Olga; Shi, Xiaofeng; Zaia, Joseph; Dupont, Sam T; Thorndyke, Michael C; Lindahl, Ulf; Spillmann, Dorothe

    2014-02-01

    Glycosaminoglycans (GAGs) isolated from brittlestars, Echinodermata class Ophiuroidea, were characterized, as part of attempts to understand the evolutionary development of these polysaccharides. A population of chondroitin sulfate/dermatan sulfate (CS/DS) chains with a high overall degree of sulfation and hexuronate epimerization was the major GAG found, whereas heparan sulfate (HS) was below detection level. Enzymatic digestion with different chondroitin lyases revealed exceptionally high proportions of di- and trisulfated CS/DS disaccharides. The latter unit appears much more abundant in one of four individual species of brittlestars, Amphiura filiformis, than reported earlier in other marine invertebrates. The brittlestar CS/DS was further shown to bind to growth factors such as fibroblast growth factor 2 and to promote FGF-stimulated cell signaling in GAG-deficient cell lines in a manner similar to that of heparin. These findings point to a potential biological role for the highly sulfated invertebrate GAGs, similar to those ascribed to HS in vertebrates.

  10. Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus).

    OpenAIRE

    Hassan Borji; Zahra Moosavi; Fatemeh Ahmadi

    2014-01-01

    Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors? knowledge, a complete...

  11. Perbedaan Self-Image Remaja Laki-Laki dan Perempuan Penderita Acne Vulgaris

    OpenAIRE

    Nasution, Fauziah Nami

    2016-01-01

    The research aims to find out the differences self-images on adolescent boy’s Acne Vulgaris patient and on adolescent girl’s. Self-image is the mental picture of an individual about his physical appearance Jersild (1963). Acne vulgaris is a chronic inflammation of the follicle polisebasea characterized by comedones, papules, pustules, and cysts in predilection areas, such as the face, shoulders, chest, and back. The population of the research is senior students in Medan who have Acne Vulgaris...

  12. The anaerobic treatment of sulfate containing wastewater

    NARCIS (Netherlands)

    Visser, A.

    1995-01-01


    In the anaerobic treatment of sulfate containing wastewater sulfate reducing bacteria (SRB) will compete with methanogenic- (MB) and acetogenic bacteria (AB) for the available substrates such as hydrogen, acetate, propionate and butyrate. The outcome of this competition will

  13. Immunologic and hematologic responses in ponies with experimentally induced Strongylus vulgaris infection.

    Science.gov (United States)

    Bailey, M; Martin, S C; Lloyd, S

    1989-08-01

    Immunologic and hematologic responses were examined in 4 ponies with experimentally induced Strongylus vulgaris infection and in 5 helminth-free ponies. Two ponies were inoculated with 200 larvae and 2 were inoculated with 700 larvae of S vulgaris and then were reinoculated with the same numbers of larvae 34 weeks later. Initial response of the ponies inoculated with S vulgaris was S vulgaris antigen-induced lymphocyte response that developed 1.5 to 3 weeks after inoculation and did not persist. Development of antigen-reactive lymphocytes was followed sequentially by a biphasic complement-fixing antibody response, then biphasic eosinophilia. Antibody titer to S vulgaris antigen was higher in ponies inoculated with 700 larvae, compared with that in ponies given 200 larvae of S vulgaris. Also, the second peak in antibody titer and in absolute number of eosinophils was observed earlier in ponies inoculated with 700 larvae, compared with ponies inoculated with 200 S vulgaris larvae, and subsided before or from about 24 weeks after inoculation. The prepatent period for S vulgaris infection was 24 to 25 weeks. After reinoculation with S vulgaris, a degree of increased lymphocyte responsiveness was apparent but, by 17 weeks after reinoculation, only the primary peak in the absolute number of eosinophils indicated an anamnestic response. Essentially, antibody was not detectable after reinoculation.

  14. Verruca vulgaris of the buccal mucosa: A case report

    Directory of Open Access Journals (Sweden)

    Aastha Mattoo

    2018-01-01

    Full Text Available Oral verruca vulgaris is caused by human papillomavirus (HPV infection. Verruca vulgaris most frequently occurs on the fingers, toes, soles, and dorsal surfaces of hands and is mostly asymptomatic. Varieties of verrucous and papillary lesions affect the skin as well as oral mucosa which may be either benign or reactive. Common wart is one of the most commonly observed skin growths and a lesion of childhood. Intraoral warts can occur at any age with equal incidence in both genders but are most commonly seen in the third to fifth decade. It is found commonly on the palate followed by lip, tongue, buccal mucosa, and rarely seen on gingiva. Surgical excision with adequate margins is the treatment of choice.

  15. Controlled tests of fenbendazole against migrating Strongylus vulgaris in ponies.

    Science.gov (United States)

    Slocombe, J O; McCraw, B M

    1982-03-01

    Sixteen pony foals were reared worm-free and inoculated with Strongylus vulgaris. On day 7 after inoculation, 12 ponies were given a fenbendazole 10% suspension at dose rate of 50 mg/kg of body weight by stomach tube. On day 8 after inoculation, 8 of these ponies were given the 2nd treatment of the anthelmintic and on day 9, 4 of these ponies were given the 3rd treatment. (The other 4 of the 16 ponies were given only tap water, as controls.) The ponies were necropsied at death or on day 28 after inoculation. Fenbendazole was effective in minimizing the appearance of clinical signs associated with acute arteritis and was highly efficacious in eliminating early 4th-stage S vulgaris larvae in ponies treated for 3 consecutive days (ie, days 7, 8, and 9). After administration of the anthelmintic, clinical signs of toxicosis were not observed.

  16. Thyroid neoplasms after radiation therapy for adolescent acne vulgaris

    International Nuclear Information System (INIS)

    Paloyan, E.; Lawrence, A.M.

    1978-01-01

    There is a potential hazard of thyroid cancer after exposure to external irradiation for the treatment of adolescent acne vulgaris. We noted a 60% incidence of thyroid carcinoma among 20 patients with such a history, who were operated on for thyroid nodules during a five-year period. Eighty-three percent of the patients with carcinoma had either a follicular or a mixed papillary-follicular carcinoma; 17% had a papillary carcinoma; 33% had regional node metastases; none had evidence of distant metastases. The interval between radiation exposure and thyroidectomy ranged from nine to 41 years. This association of thyroid neoplasms and a prior history of radiation for acne vulgaris may be coincidental and therefore remains to be proved by retrospective surveys of large numbers of treated patients with appropriate controls

  17. Significance of diet in treated and untreated acne vulgaris

    Science.gov (United States)

    Szmurło, Agnieszka; Sińska, Beata

    2016-01-01

    The relationship between diet and acne is highly controversial. Several studies during the last decade have led dermatologists to reflect on a potential link between diet and acne. This article presents the latest findings on a potential impact that diet can have on pathogenesis of acne vulgaris. The association between diet and acne can no longer be dismissed. Compelling evidence shows that high glycemic load diets may exacerbate acne. Dairy ingestion appears to be weakly associated with acne and the roles of omega-3 fatty acids, dietary fiber, antioxidants, vitamin A, zinc and iodine remain to be elucidated. The question of what the impact of diet is on the course of acne vulgaris still remains unclear. PMID:27279815

  18. LIPID ACCUMULATION OF CHLORELLA VULGARIS UNDER DIFFERENT PHOSPHATE CONCENTRATIONS

    Directory of Open Access Journals (Sweden)

    Magdalena Karolina Rokicka

    2017-04-01

    Full Text Available The cultivation and utilization of microalgae is now a intensively developing area of research. Some species of microalgae, under appropriate conditions, accumulate large amounts of lipids in the cells. This lipids have a suitable profile of fatty acids for biodiesel production. The culture of microalgae for lipids accumulation should be performed in certain physicochemical conditions. The aim of the study was to determine the effect of variable ortophophates concentrations in the culture medium for lipids accumulation of microalgae Chlorella vulgaris and to determine of parameters of the phosphoric shock in the medium. The study confirmed the possibility of the use of the phosphoric shock in the medium to maximize lipids accumulation by the microalgae Chlorella vulgaris. In the study, 45.23% of the oil was obtained from the biomass from the culture with phosphoric shock in the medium and 18% less of the oil was obtained from the biomass from the standard culture.

  19. Metabolic Flexibility of Sulfate Reducing Bacteria

    Directory of Open Access Journals (Sweden)

    Caroline M. Plugge

    2011-05-01

    Full Text Available Dissimilatory sulfate-reducing prokaryotes (SRB are a very diverse group of anaerobic bacteria that are omnipresent in nature and play an imperative role in the global cycling of carbon and sulfur. In anoxic marine sediments sulfate reduction accounts for up to 50% of the entire organic mineralization in coastal and shelf ecosystems where sulfate diffuses several meters deep into the sediment. As a consequence, SRB would be expected in the sulfate-containing upper sediment layers, whereas methanogenic Archaea would be expected to succeed in the deeper sulfate-depleted layers of the sediment. Where sediments are high in organic matter, sulfate is depleted at shallow sediment depths, and biogenic methane production will occur. In the absence of sulfate, many SRB ferment organic acids and alcohols, producing hydrogen, acetate, and carbon dioxide, and may even rely on hydrogen- and acetate-scavenging methanogens to convert organic compounds to methane. SRB can establish two different life styles, and these can be termed as sulfidogenic and acetogenic, hydrogenogenic metabolism. The advantage of having different metabolic capabilities is that it raises the chance of survival in environments when electron acceptors become depleted. In marine sediments, SRB and methanogens do not compete but rather complement each other in the degradation of organic matter.Also in freshwater ecosystems with sulfate concentrations of only 10-200 μM, sulfate is consumed efficiently within the top several cm of the sediments. Here, many of the δ-Proteobacteria present have the genetic machinery to perform dissimilatory sulfate reduction, yet they have an acetogenic, hydrogenogenic way of life.In this review we evaluate the physiology and metabolic mode of SRB in relation with their environment.

  20. Dyes adsorption on magnetically modified Chlorella vulgaris cells

    Czech Academy of Sciences Publication Activity Database

    Šafaříková, Miroslava; Pona, B. M. R.; Mosiniewicz-Szablewska, E.; Weyda, František; Šafařík, Ivo

    2008-01-01

    Roč. 17, č. 4 (2008), s. 486-492 ISSN 1018-4619 R&D Projects: GA MŠk OC 108; GA MPO 2A-1TP1/094 Institutional research plan: CEZ:AV0Z60870520; CEZ:AV0Z50070508 Keywords : Chlorella vulgaris * magnetically modified cells * dyes Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.463, year: 2008

  1. Variation in the Breeding System of Prunella vulgaris L.

    Science.gov (United States)

    Qu, Luping; Widrlechner, Mark P

    2011-05-01

    Prunella vulgaris (Lamiaceae), commonly known as selfheal, is a perennial herb with a long history of use in traditional medicine. Recent studies have found that P. vulgaris possesses anti-inflammatory, antiviral, and antibacterial properties, and it is likely that this will lead to increased commercial demand for this species. To date, research publications on P. vulgaris cultivation and genetics are scarce. Using accessions originally collected from different geographical regions, we investigated the breeding system of this species by observing variation in floral morphology, time of pollen release, and selfed-seed set in bagged flowers and isolated plants. Two types of floral morphology, one with exerted styles, extending past open corollas when viewed from above, and the other with shorter, inserted styles, were found among 30 accessions. Two accessions originally collected from Asia uniformly displayed exerted styles, and 27 accessions had inserted styles. One accession from Oregon displayed variation in this trait among individual plants. Microscopic observation of seven accessions, including ones with both exerted and inserted styles, revealed that they all release pollen to some degree before the flowers open. Using bagged flowers, we found that selfed-seed set varied widely among eight accessions, ranging from 6% to 94%. However, bagging may underestimate seed set for some accessions. The two accessions with the lowest rates when using bagged flowers increased in seed set by 350% and 158%, respectively, when we evaluated single, unbagged plants in isolation cages. The accession with 6% selfed-seed set when bagged also had exerted styles. These findings suggest that mating systems in P. vulgaris may be in the process of evolutionary change and that understanding breeding-system variation should be useful in developing efficient seed-regeneration protocols and breeding and selection strategies for this species.

  2. The morphology and adhesion mechanism of Octopus vulgaris suckers.

    Directory of Open Access Journals (Sweden)

    Francesca Tramacere

    Full Text Available The octopus sucker represents a fascinating natural system performing adhesion on different terrains and substrates. Octopuses use suckers to anchor the body to the substrate or to grasp, investigate and manipulate objects, just to mention a few of their functions. Our study focuses on the morphology and adhesion mechanism of suckers in Octopus vulgaris. We use three different techniques (MRI, ultrasonography, and histology and a 3D reconstruction approach to contribute knowledge on both morphology and functionality of the sucker structure in O. vulgaris. The results of our investigation are two-fold. First, we observe some morphological differences with respect to the octopus species previously studied (i.e., Octopus joubini, Octopus maya, Octopus bimaculoides/bimaculatus and Eledone cirrosa. In particular, in O. vulgaris the acetabular chamber, that is a hollow spherical cavity in other octopuses, shows an ellipsoidal cavity which roof has an important protuberance with surface roughness. Second, based on our findings, we propose a hypothesis on the sucker adhesion mechanism in O. vulgaris. We hypothesize that the process of continuous adhesion is achieved by sealing the orifice between acetabulum and infundibulum portions via the acetabular protuberance. We suggest this to take place while the infundibular part achieves a completely flat shape; and, by sustaining adhesion through preservation of sucker configuration. In vivo ultrasonographic recordings support our proposed adhesion model by showing the sucker in action. Such an underlying physical mechanism offers innovative potential cues for developing bioinspired artificial adhesion systems. Furthermore, we think that it could possibly represent a useful approach in order to investigate any potential difference in the ecology and in the performance of adhesion by different species.

  3. The morphology and adhesion mechanism of Octopus vulgaris suckers.

    Science.gov (United States)

    Tramacere, Francesca; Beccai, Lucia; Kuba, Michael; Gozzi, Alessandro; Bifone, Angelo; Mazzolai, Barbara

    2013-01-01

    The octopus sucker represents a fascinating natural system performing adhesion on different terrains and substrates. Octopuses use suckers to anchor the body to the substrate or to grasp, investigate and manipulate objects, just to mention a few of their functions. Our study focuses on the morphology and adhesion mechanism of suckers in Octopus vulgaris. We use three different techniques (MRI, ultrasonography, and histology) and a 3D reconstruction approach to contribute knowledge on both morphology and functionality of the sucker structure in O. vulgaris. The results of our investigation are two-fold. First, we observe some morphological differences with respect to the octopus species previously studied (i.e., Octopus joubini, Octopus maya, Octopus bimaculoides/bimaculatus and Eledone cirrosa). In particular, in O. vulgaris the acetabular chamber, that is a hollow spherical cavity in other octopuses, shows an ellipsoidal cavity which roof has an important protuberance with surface roughness. Second, based on our findings, we propose a hypothesis on the sucker adhesion mechanism in O. vulgaris. We hypothesize that the process of continuous adhesion is achieved by sealing the orifice between acetabulum and infundibulum portions via the acetabular protuberance. We suggest this to take place while the infundibular part achieves a completely flat shape; and, by sustaining adhesion through preservation of sucker configuration. In vivo ultrasonographic recordings support our proposed adhesion model by showing the sucker in action. Such an underlying physical mechanism offers innovative potential cues for developing bioinspired artificial adhesion systems. Furthermore, we think that it could possibly represent a useful approach in order to investigate any potential difference in the ecology and in the performance of adhesion by different species.

  4. Novel pharmacological approaches for the treatment of acne vulgaris.

    Science.gov (United States)

    Valente Duarte de Sousa, Isabel Cristina

    2014-10-01

    Acne vulgaris is the most common skin disease worldwide; yet, current treatment options, although effective, are associated with unwanted side effects, chronicity, relapses and recurrences. The adequate control of the four pathogenic mechanisms, involved in the appearance of acne lesions, is paramount to treatment success. The authors discuss and evaluate the pathogenic pathways related to the mechanisms of action of novel molecules, which are currently under investigation for the treatment of acne vulgaris. The manuscript is based on comprehensive searches made through PubMed, GoogleScholar and ClinicalTrial.gov, using different combination of key words, which include acne vulgaris, pathogenesis, treatment, sebogenesis and Propionibacterium acnes. In the near future, more effective treatments with fewer side effects are expected. The use of topical antiandrogens, acetylcholine inhibitors and PPAR modulators seem to be promising options for controlling sebum production. Retinoic acid metabolism-blocking agents and IL-1α inhibitors have the potential to become legitimate alternative options to retinoid therapy in the management of infundibular dyskeratosis. Indeed, the authors believe that there will likely be a decline in the use of antibiotics for controlling P. acnes colonization and targeting the inflammation cascade.

  5. Photon up-conversion increases biomass yield in Chlorella vulgaris.

    Science.gov (United States)

    Menon, Kavya R; Jose, Steffi; Suraishkumar, Gadi K

    2014-12-01

    Photon up-conversion, a process whereby lower energy radiations are converted to higher energy levels via the use of appropriate phosphor systems, was employed as a novel strategy for improving microalgal growth and lipid productivity. Photon up-conversion enables the utilization of regions of the solar spectrum, beyond the typical photosynthetically active radiation, that are usually wasted or are damaging to the algae. The effects of up-conversion of red light by two distinct sets of up-conversion phosphors were studied in the model microalgae Chlorella vulgaris. Up-conversion by set 1 phosphors led to a 2.85 fold increase in biomass concentration and a 3.2 fold increase in specific growth rate of the microalgae. While up-conversion by set 2 phosphors resulted in a 30% increase in biomass and 12% increase in specific intracellular neutral lipid, while the specific growth rates were comparable to that of the control. Furthermore, up-conversion resulted in higher levels of specific intracellular reactive oxygen species in C. vulgaris. Up-conversion of red light (654 nm) was shown to improve biomass yields in C. vulgaris. In principle, up-conversion can be used to increase the utilization range of the electromagnetic spectrum for improved cultivation of photosynthetic systems such as plants, algae, and microalgae. Copyright © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  6. Growth of Chlorella vulgaris and associated bacteria in photobioreactors

    Science.gov (United States)

    Lakaniemi, Aino‐Maija; Intihar, Veera M.; Tuovinen, Olli H.; Puhakka, Jaakko A.

    2012-01-01

    Summary The aim of this study was to test three flat plate photobioreactor configurations for growth of Chlorella vulgaris under non‐axenic conditions and to characterize and quantify associated bacterial communities. The photobioreactor cultivations were conducted using tap water‐based media to introduce background bacterial population. Growth of algae was monitored over time with three independent methods. Additionally, the quantity and quality of eukaryotes and bacteria were analysed using culture‐independent molecular tools based on denaturing gradient gel electrophoresis (PCR‐DGGE) and quantitative polymerase chain reaction (QPCR). Static mixers used in the flat plate photobioreactors did not generally enhance the growth at the low light intensities used. The maximum biomass concentration and maximum specific growth rate were 1.0 g l−1 and 2.0 day−1 respectively. Bacterial growth as determined by QPCR was associated with the growth of C. vulgaris. Based on PCR‐DGGE, bacteria in the cultures mainly originated from the tap water. Bacterial community profiles were diverse but reproducible in all flat plate cultures. Most prominent bacteria in the C. vulgaris cultures belonged to the class Alphaproteobacteria and especially to the genus Sphingomonas. Analysis of the diversity of non‐photosynthetic microorganisms in algal mass cultures can provide useful information on the public health aspects and unravel community interactions. PMID:21936882

  7. Enhancement of hydrolysis of Chlorella vulgaris by hydrochloric acid.

    Science.gov (United States)

    Park, Charnho; Lee, Ja Hyun; Yang, Xiaoguang; Yoo, Hah Young; Lee, Ju Hun; Lee, Soo Kweon; Kim, Seung Wook

    2016-06-01

    Chlorella vulgaris is considered as one of the potential sources of biomass for bio-based products because it consists of large amounts of carbohydrates. In this study, hydrothermal acid hydrolysis with five different acids (hydrochloric acid, nitric acid, peracetic acid, phosphoric acid, and sulfuric acid) was carried out to produce fermentable sugars (glucose, galactose). The hydrothermal acid hydrolysis by hydrochloric acid showed the highest sugar production. C. vulgaris was hydrolyzed with various concentrations of hydrochloric acid [0.5-10 % (w/w)] and microalgal biomass [20-140 g/L (w/v)] at 121 °C for 20 min. Among the concentrations examined, 2 % hydrochloric acid with 100 g/L biomass yielded the highest conversion of carbohydrates (92.5 %) into reducing sugars. The hydrolysate thus produced from C. vulgaris was fermented using the yeast Brettanomyces custersii H1-603 and obtained bioethanol yield of 0.37 g/g of algal sugars.

  8. Photosynthetic and cellular toxicity of cadmium in Chlorella vulgaris.

    Science.gov (United States)

    Ou-Yang, Hui-Ling; Kong, Xiang-Zhen; Lavoie, Michel; He, Wei; Qin, Ning; He, Qi-Shuang; Yang, Bin; Wang, Rong; Xu, Fu-Liu

    2013-12-01

    The toxic effects of cadmium (Cd) on the green alga Chlorella vulgaris were investigated by following the response to Cd of various toxicity endpoints (cell growth, cell size, photochemical efficiency of PSII in the light or Φ(PSII), maximal photochemical efficiency or Fv/Fm, chlorophyll a fluorescence, esterase activity, and cell viability). These toxicity endpoints were studied in laboratory batch cultures of C. vulgaris over a long-term 96-h exposure to different Cd concentrations using flow cytometry and pulse amplitude modulated fluorometry. The sequence of sensitivity of these toxicity endpoints was: cell yield > Φ(PSII) ≈ esterase activity > Fv/Fm > chlorophyll a fluorescence ≈ cell viability. It is shown that cell apoptosis or cell death only accounted for a minor part of the reduction in cell yield even at very high algistatic free Cd²⁺ concentrations, and other mechanisms such as blocked cell divisions are major contributors to cell yield inhibition. Furthermore, cadmium may affect both the electron donors and acceptors of the electron transport chain at high free Cd²⁺ concentration. Finally, the resistance of cells to cell death was size-dependent; medium-sized cells had the highest toxicity threshold. The present study brings new insights into the toxicity mechanisms of Cd in C. vulgaris and provides a detailed comparison of the sensitivity of various Cd toxicity endpoints. © 2013 SETAC.

  9. Profile of acne vulgaris-A hospital-based study from South India

    Directory of Open Access Journals (Sweden)

    Adityan Balaji

    2009-01-01

    Full Text Available Background: Acne vulgaris is believed to be the most common disease of the skin. There is no Indian study on the profile of acne vulgaris, markers of severe forms of acne vulgaris and a possible correlation between acne vulgaris and markers of androgenicity in females. Aim: To study the profile of acne vulgaris, its seasonal variation, relationship with smoking and possible correlation between acne vulgaris and markers of androgenicity in females. Methods: The study was conducted between August 2006 and June 2008. All patients with acne vulgaris who consented to participate in the study were included. The parameters evaluated included age, gender, age of onset, duration of lesions, site of lesions, grade, relation with menstrual cycle, markers of androgenicity, number of acne lesions such as comedones, papules pustules and nodules, number and site of post-acne scarring, post-acne hyperpigmentation, seasonal variation and history of smoking. Results: A total of 309 patients with acne vulgaris were included in the study. The frequency of acne vulgaris in our study was 1.068%. Mean age of the study group was 19.78 years. Male to female ratio was 1.25:1. The most common age group involved was 16 to 20 years (59.8%. Mean age of onset was 15.97 years. Face was involved in all the patients, followed by back (28.2%, chest (20.1%, neck (9.4% and arms (10%. In the older age groups, women were more likely to report having acne vulgaris than men ( P = 0.01. The closed comedones outnumbered open comedones by a factor of 4.9:1. A total of 186 patients (60.2% had grade 1 acne vulgaris, 85 (27.5% had grade 2 acne, 8 (2.6% had grade 3 acne and 30 (9.7% had grade 4 acne vulgaris. There was a higher incidence of scarring (39.5% and post-acne hyperpigmentation (24.6% in our study. In female patients, 57.7% had premenstrual flare and 12.4% had cutaneous markers of androgenicity. There was no association between severity of acne vulgaris and other markers of

  10. Extraction of uranyl sulfate with primary amine

    International Nuclear Information System (INIS)

    Mrnka, M.; Bizek, V.; Nekovar, P.; Cizevska, S.; Schroetterova, D.

    1984-01-01

    PRIMENE JM-T was used for extraction. Its composition was found to approach the general formula C 21 H 43 NH 2 . It was found that the extraction of uranyl sulfate is lower in case of a higher steady-state concentration of sulfuric acid in the aqueous phase. Extraction is accompanied with coextraction of water. The results obtained showed that uranyl sulfate passes into the organic phase by two mechanisms: extraction with amine sulfate and extraction with free amine. A mathematical description of the process was made based on the obtained results. (E.S.)

  11. Chlorate: a reversible inhibitor of proteoglycan sulfation

    International Nuclear Information System (INIS)

    Humphries, D.E.; Silbert, J.E.

    1988-01-01

    Bovine aorta endothelial cells were cultured in medium containing [ 3 H]glucosamine, [ 35 S]sulfate, and various concentrations of chlorate. Cell growth was not affected by 10 mM chlorate, while 30 mM chlorate had a slight inhibitory effect. Chlorate concentrations greater than 10 mM resulted in significant undersulfation of chondroitin. With 30 mM chlorate, sulfation of chondroitin was reduced to 10% and heparan to 35% of controls, but [ 3 H]glucosamine incorporation on a per cell basis did not appear to be inhibited. Removal of chlorate from the culture medium of cells resulted in the rapid resumption of sulfation

  12. Effect of gene transfer of Chlorella vulgaris n-3 fatty acid desaturase ...

    African Journals Online (AJOL)

    Chlorella vulgaris had the gene of n-3 fatty acid desaturase (CvFad3) which can synthesize the precursor of n-3 polyunsaturated fatty acids (PUFAs) or to convert n-6 to n-3 PUFAs. The objective of this study was to examine whether the CvFad3 gene from C. vulgaris can be functionally expressed in mammalian cells and ...

  13. Cryopreservation of third-stage larvae of Strongylus vulgaris (large strongyle of horses).

    Science.gov (United States)

    Titoy, G A; Van Rensburg, L J

    1997-06-01

    A technique for the cryopreservation of third-stage larvae of Strongylus vulgaris is described. Infective larvae of S. vulgaris were exsheathed in a 0.16% sodium hypochlorite solution and then transferred into cryotubes containing 0.09% saline. The samples were stored in the gas phase of liquid nitrogen.

  14. Characterisation of surface antigens of Strongylus vulgaris of potential immunodiagnostic importance.

    Science.gov (United States)

    Nichol, C; Masterson, W J

    1987-08-01

    When antigens prepared by detergent washes of Strongylus vulgaris and Parascaris equorum were probed in an enzyme-linked immunosorbent assay test with horse sera from single species infections of S. vulgaris and P. equorum, a high degree of cross-reaction between the species was demonstrated. Western blot analysis of four common horse nematode species showed a large number of common antigens when probed with horse infection sera. Antisera raised in rabbits against the four species, including S. vulgaris, were also found to cross-react considerably. Rabbit anti-S. vulgaris sera were affinity adsorbed over a series of affinity chromatography columns, bound with cross-reactive surface antigens, to obtain S. vulgaris-specific antisera and thereby identify S. vulgaris-specific antigens by Western blotting. These studies revealed potentially specific antigens of apparent molecular weights of 100,000, 52,000, and 36,000. Of these bands, only the 52 kDa and 36 kDa appeared to be found on the surface as judged by 125I-labelling of intact worms by the Iodogen method, although neither protein was immunoprecipitated by horse infection sera. Finally, immunoprecipitation of in vitro translated proteins derived from larval S. vulgaris RNA suggests that two proteins may be parasite-derived. These findings are discussed both with respect to the surface of S. vulgaris and to the use of these species-specific antigens in immunodiagnosis.

  15. MAO-A inhibitory activity of quercetin from Calluna vulgaris (L.) Hull

    DEFF Research Database (Denmark)

    Saaby, Lasse; Rasmussen, Hasse Bonde; Jäger, Anna Katharina

    2009-01-01

    AIM OF THE STUDY: This study investigated MAO-A inhibitory activity of methanol extract of Calluna vulgaris (L.) Hull., which traditionally has been used as a nerve calming remedy. MATERIALS AND METHODS: A methanolic extract of Calluna vulgaris was partitioned against heptane, ethyl acetate...

  16. Polymorphism of nickel sulfate hexahydrate

    International Nuclear Information System (INIS)

    Angel, R.J.; Finger, L.W.

    1988-01-01

    NiSO 4 .6H 2 O, M r =262.85; data collections with Mo Kα radiation, λ=0.7093 A, room temperature. Monoclinic polymorph: C2/c, a=9.880(3), b=7.228(2), c=24.130(3) A, β=98.38(2) 0 , V=1704.7(6) A 3 , Z=8, D x =2.05 g cm -3 , μ=25.54 cm -1 , F(000)=1088, R=0.031 (wR=0.038) for 2176 observed reflections. Tetragonal polymorph: P4 1 2 1 2, a=6.780 (1), c=18.285 (2) A, V=840.5 (3) A 3 , Z=4, D x =2.07 g cm -3 , μ=25.81 cm -1 , F(000)=544, R=0.045 (wR=0.050) for 2102 observed reflections. The structure of the tetragonal polymorph originally determined (without H positions) by Beevers and Lipson and refined by O'Connor and Dale and Stadnicka, Glazer and Koralewski, is confirmed by refinement of X-ray diffraction data. The structure of the monoclinic polymorph is confirmed as being isostructural with NiSO 4 .6D 2 O, and a number of other hexahydrate sulfates, e.g. MgSO 4 .6H 2 O. Both structures contain isolated [Ni(H 2 O 6 ] octahedra and [SO 4 ] tetrahedra linked by hydrogen bonding. (orig.)

  17. Antigenic analyses of tissues and excretory and secretory products from Strongylus vulgaris.

    Science.gov (United States)

    Wynne, E; Slocombe, J O; Wilkie, B N

    1981-07-01

    Rabbit antisera were prepared against veronal buffered saline extracts of L4 and L5 Strongylus vulgaris, adult S. vulgaris and adult Strongylus equinus retrieved from naturally infected horses. In agar gel diffusion with these antisera, adult S vulgaris and S. equinus each appeared to have at least one unique antigen; larval S. vulgaris appeared to have two species-specific and two stage-specific antigens. There were several common antigens. Excretory and secretory products were collected also from L4 and L5 an maintained over several days in tissue culture fluid. In agar gel diffusion against the above rabbit antisera, a stage-specific antigen was found also in excretory and secretory products. In addition, excretory and secretory products had three antigens in common with adult and larval S. vulgaris, but only one of these was common to adult S. equinus. The excretory and secretory products appear, therefore, to have two species-specific and one stage-specific antigens.

  18. [Research on characteristic of interrelationship between toxic organic compound BPA and Chlorella vulgaris].

    Science.gov (United States)

    Chen, Shan-Jia; Chen, Xiu-Rong; Yan, Long; Zhao, Jian-Guo; Zhang, Fei; Jiang, Zi-Jian

    2014-04-01

    The effects of different concentrations of bisphenol A (BPA) on Chlorella vulgaris and removal capacity of BPA by Chlorella vulgaris were investigated. Results showed that a low concentration (0-20 mg x L(-1)) of BPA promoted the growth of Chlorella vulgaris, whereas a relative high concentration (20-50 mg x L(-1)) of BPA inhibited the growth of Chlorella vulgaris, and the inhibition effect was positively correlated with the concentration of BPA. Likewise, a high dose of initial BPA (> 20 mg x L(-1)) led to a decline in the content of chlorephyll a. Chlorella vulgaris had BPA removal capacity when initial BPA concentration ranged from 2 mg x L(-1) to 50 mg x L(-1). There was positive correlation between the removal rate of BPA per cell and initial BPA concentration. The removal rate of BPA was the highest when initial BPA was 50 mg x L(-1), which appeared between lag phase and logarithmic phase.

  19. The effect of the fodder species over the interchangeable bases of sulfated acid soil in municipality of Paipa (Colombia

    Directory of Open Access Journals (Sweden)

    Andrea Angélica Bernal Figueroa

    2014-05-01

    Full Text Available One of the limitations on acid sulphated soils (SSA is related to the inhibition in the absorption of interchangeable bases generated mainly by excesses of aluminum oxide of change; this affects its productivity and limits the availability of nutrients for plants. This research evaluated in greenhouse, the effect of fodder beet (Beta vulgaris L., forage turnip (Brassica rapa L. and fodder radish (Raphanus sativus L. on the interchangeable bases of an SSA, contrasted with a not sulfated ground, in order to identify species for management and rehabilitation of these soils in Paipa (Boyacá. An experimental design was implemented with 6 treatments and 3 repetitions in which the basis measurement was made in the ground before and after the species plating and the measured leaf area and plants height when their vegetative period ended. Several significative statistic differences were found (P<0.01 in the basis concentration, as well as in the variables in the leaf area and height of the plant. The results indicated that the growth of the turnip (B. rapa and horseradish (R. sativus fodder, along with the complementary use of calcareous amendments as a corrective, led to an increase in the concentrations of Ca, Mg, K, and Na in the SSA, and presented a better growth and resistance to them. Similarly, the planting of fodder beet (B. vulgaris generated positive effects in the soil; however, the height and leaf area of this species were affected in the SSA, which limits their productivity.

  20. Sulfate reduction and methanogenesis at a freshwater

    DEFF Research Database (Denmark)

    Iversen, Vibeke Margrethe Nyvang; Andersen, Martin Søgaard; Jakobsen, Rasmus

    The freshwater-seawater interface was studied in a ~9-m thick anaerobic aquifer located in marine sand and gravel with thin peat lenses. Very limited amounts of iron-oxides are present. Consequently, the dominating redox processes are sulfate reduction and methanogenesis, and the groundwater...... is enriched in dissolved sulfide, methane and bicarbonate. Under normal conditions the seawater-freshwater interface is found at a depth of 4 m at the coastline and reaches the bottom of the aquifer 40 m inland. However, occasional flooding of the area occurs, introducing sulfate to the aquifer. Groundwater...... chemistry was studied in a 120 m transect perpendicular to the coast. Cores were taken for radiotracer rate measurements of sulfate reduction and methanogenesis. In the saline part of the aquifer 35 m inland, sulfate reduction was the dominant process with rates of 0.1-10 mM/year. In the freshwater part 100...

  1. Lymphocyte mobilization by dextran sulfate in beagles

    International Nuclear Information System (INIS)

    Ragan, H.A.; Debban, K.H.

    1978-01-01

    Dogs manifesting 239 Pu-induced lymphopenia responded to the lymphocyte-mobilizing agent, dextran sulfate, to a degree similar to that observed in control dogs. No life-threatening increase in prothrombin times or hemorrhagic tendencies were observed

  2. Sulfated cellulose thin films with antithrombin affinity

    Directory of Open Access Journals (Sweden)

    2009-11-01

    Full Text Available Cellulose thin films were chemically modified by in situ sulfation to produce surfaces with anticoagulant characteristics. Two celluloses differing in their degree of polymerization (DP: CEL I (DP 215–240 and CEL II (DP 1300–1400 were tethered to maleic anhydride copolymer (MA layers and subsequently exposed to SO3•NMe3 solutions at elevated temperature. The impact of the resulting sulfation on the physicochemical properties of the cellulose films was investigated with respect to film thickness, atomic composition, wettability and roughness. The sulfation was optimized to gain a maximal surface concentration of sulfate groups. The scavenging of antithrombin (AT by the surfaces was determined to conclude on their potential anticoagulant properties.

  3. COMBINED ALUMINIUM SULFATE/HYDROXIDE PROCESS FOR ...

    African Journals Online (AJOL)

    sulfate, and used for fluoride removal from water by combining with Nalgonda Technique. ... effects on human health and could result in fluorosis. ... [23], nanoscale aluminium oxide hydroxide (AlOOH) [24] and natural zeolite [25], were among.

  4. ROE Wet Sulfate Deposition 2009-2011

    Data.gov (United States)

    U.S. Environmental Protection Agency — The raster data represent the amount of wet sulfate deposition in kilograms per hectare from 2009 to 2011. Summary data in this indicator were provided by EPA’s...

  5. Effect of metakaolin on external sulfate attack

    Energy Technology Data Exchange (ETDEWEB)

    Ramlochan, T.; Thomas, M. [Toronto Univ., Dept. of Civil Engineering, ON (Canada)

    2000-07-01

    The effect of high reactivity metakaolin (HRM) on the sulfate resistance of mortars was studied. Mortar bars with three cements of varying C{sub 3}A content were used for the experiment. After a six month exposure to a 5 per cent solution of sodium sulfate, mortar bars incorporating any level of HRM as a partial replacement for a high-C{sub 3}A was considered 'moderately sulfate resistant'; mortar bars with HRM and a moderate or low C{sub 3}A content as 'high sulfate resistant'. It was also determined that for long term sulfate resistance 15 per cent HRM or more may be required, depending on the C{sub 3}A content. The performance of HRM was found to be significantly influenced by the water-cementitious material ratio, and in turn, by permeability, suggesting that HRM might increase sulfate resistance more by lowering the permeability of the concrete than by any chemical action. 7 refs., 4 tabs., 7 figs.

  6. Celulose monossulfito a partir de Bambusa vulgaris schrad Alkaline monosulphite pulping of Bambusa vulgaris schrad

    Directory of Open Access Journals (Sweden)

    Anísio Azzini

    1979-01-01

    Full Text Available Em condições de laboratório foram produzidas pastas celulósicas pelo processo alcalino monossulfito, com várias concentrações dos reagentes químicos, sulfito de sódio e licor-verde sulfato. As propriedades dessas celuloses foram comparadas com aquelas da celulose obtida pelo processo sulfato (kraft de uso generalizado pela indústria de celulose e papel. As características físico-mecânicas e ópticas das celuloses monossulfito e sulfato foram satisfatórias e semelhantes, com exceção da resistência ao rasgo, que na celulose sulfato foi maior. Os cavacos utilizados, nas dimensões de 5,5 x 0,8 x 0,5cm, respectivamente para comprimento, largura e espessura, foram adequados ao processo sulfato e inadequados às condições do processo monossulfito, que produziu celulose com menor rendimento depurado, maior porcentagem de rejeitos e maior teor de lignina residual nas fibras, determinado pelo número kappa. A densidade básica e as dimensões das fibras variaram no sentido radial do colmo, principalmente a densidade básica, cujos valores decresceram acentuadamente da camada externa para a interna.Pulps in laboratory conditions were obtained from Bambusa vulgaris Schrad by the alkaline monosulphite process, with various concentrations of the cooking chemicals. The strength properties of these pulps were compared to those obtained by the sulphate process. The results showed that both pulps were similar, excepting the tear resistance that was higher in the sulphate one. It was observed that chips with 5.5 x 0.8 x 0.5cm, respectively to the length, width and thickness were appropriated to the sulphate process but not to the conditions of the alkaline monosulphate process, which produced pulps with low values in terms of screening yield, percentage of screenings and kappa number. The variability of bamboo culm in the radial direction was also determined regarding basic density and fiber dimensions. The results showed variations in those

  7. Influence of sulfate-reducing bacteria on the corrosion of steel in seawater: laboratory and in situ study

    International Nuclear Information System (INIS)

    Benbouzid-Rollet, N.

    1993-01-01

    A fouling reactor was designed to study, the influence of a mixed bio-film on AISI 316 L stainless steel. The bio-film was formed on the steel surface by the fermentative bacterium Vibrio natriegens. The sulfate-reducing bacterium Desulfovibrio vulgaris was then introduced in the reactor and colonized the surface, constituting approximately 5 % of the total population. The settlement of an anaerobic bacterium in the bio-film shows in it the existence of anaerobic micro-niches. Stainless steel electrochemical behavior was analyzed using open circuit potential and potentiodynamic polarization curves. Growth of the bio-film does not induce corrosion, but seems to change the cathodic oxygen reduction kinetics, diminishing the corrosion hazard. This effect increases when D. vulgaris grows in the bio-film. An ennobling of the open circuit potential was observed, similar to field cases already described. A case of drilling corrosion of carbon steel in a harbour area showed the characteristics of anaerobic corrosion related to sulfate-reducing bacteria. The total cultivatable SRB population was quantified and metabolic types were enumerated using specific electron donors. A maximum cell density of 1,1 x 10 8 cells/ cm 2 was estimated, revealing a very important growth of SRB on surfaces. Population structure was different in corroded and non-corroded areas. In corroded area, SRB utilizing benzoate and propionate were more abundant. A strain belonging to the sporulating genus Desulfotomaculum was isolated using these substrates, suggesting a partial aeration in the area of hole appearance. However, in vitro corrosion assays showed that the bacterial population sampled in this area induced a consequent weight loss of steel coupons, in the absence of oxygen. This was observed only with a diversified population, similar to that present in situ. It could not be reproduced with a mixed culture of two purified strains. (author)

  8. Polymorphism of nickel sulfate hexahydrate

    Energy Technology Data Exchange (ETDEWEB)

    Angel, R.J.; Finger, L.W.

    1988-11-15

    NiSO/sub 4/.6H/sub 2/O, M/sub r/=262.85; data collections with Mo K..cap alpha.. radiation, lambda=0.7093 A, room temperature. Monoclinic polymorph: C2/c, a=9.880(3), b=7.228(2), c=24.130(3) A, ..beta..=98.38(2)/sup 0/, V=1704.7(6) A/sup 3/, Z=8, D/sub x/=2.05 g cm/sup -3/, ..mu..=25.54 cm/sup -1/, F(000)=1088, R=0.031 (wR=0.038) for 2176 observed reflections. Tetragonal polymorph: P4/sub 1/2/sub 1/2, a=6.780 (1), c=18.285 (2) A, V=840.5 (3) A/sup 3/, Z=4, D/sub x/=2.07 g cm/sup -3/, ..mu..=25.81 cm/sup -1/, F(000)=544, R=0.045 (wR=0.050) for 2102 observed reflections. The structure of the tetragonal polymorph originally determined (without H positions) by Beevers and Lipson and refined by O'Connor and Dale and Stadnicka, Glazer and Koralewski, is confirmed by refinement of X-ray diffraction data. The structure of the monoclinic polymorph is confirmed as being isostructural with NiSO/sub 4/.6D/sub 2/O, and a number of other hexahydrate sulfates, e.g. MgSO/sub 4/.6H/sub 2/O. Both structures contain isolated (Ni(H/sub 2/O/sub 6/) octahedra and (SO/sub 4/) tetrahedra linked by hydrogen bonding.

  9. Efficacy and Safety of Topical Niacinamide for Acne Vulgaris

    Directory of Open Access Journals (Sweden)

    Zeynep Nurhan Saraçoğlu

    2011-06-01

    Full Text Available Background and Design: To investigate the efficacy and safety of topical 4% naicinamide gel cream in the treatment of mild to moderate acne vulgaris and to assess the quality of life of acne patients.Material and Method: Twenty-nine female patients aged 16-38 (mean: 23.57±5.42 years with mild to moderate acne vulgaris who presented in dermatology outpatient clinic were enrolled in the study. All patients applied 4% niacinamide gel cream (Vivatinell-acnecinamide gel cream® on their faces twice daily for eight weeks. The number of lesions (inflammatory and non-inflammatory was counted at 0, 2, 4 and 8 weeks. The side effects (erythema, desquamation, burning and dryness were recorded. The Skindex-29, a quality-of-life measure for patients with skin disease, was administered to the subjects at the beginning and the end of treatment.Results: The decrease in the mean number of inflammatory lesions was statistically significant at the end of the treatment (pre-treatment vs. post-treatment: 12.24 vs. 6.14; p =0.000. However, there was no statistically significant decrease in the number of non-inflammatory lesions at the end of the eight weeks. The niacinamide gel cream was generally well tolerated. There was statistically significant improvement in the Skindex-29 scale scores (p =0.000 at the end of the treatment.Conclusion: Topical 4% niacinamide gel cream may be an alternative treatment for inflammatory lesions of mild to moderate acne vulgaris.

  10. ACNE VULGARIS. EVALUATION OF A MEDICATED CLEANSING PAD.

    Science.gov (United States)

    ROTH, H L

    1964-03-01

    Using the technique of simultaneous, symmetrical paired comparisons, a medicated cleansing pad that can be easily used at work or at school as an adjunctive in the treatment of acne vulgaris was evaluated.The experimental pads were significantly beneficial in reducing skin oiliness and in clinical improvement of the acne. Response to standard acne therapy was faster when the pads were used adjunctively, although the significant results seen initially tended to even out as therapy continued. Use of the medicated pads produced no untoward side effects and were well accepted by patients.

  11. Primer registro de Vespula vulgaris (Hymenoptera: Vespidae) en la Argentina

    OpenAIRE

    Maité MASCIOCCHI; Jacqueline R. BEGGS; James M. CARPENTER; Juan C. CORLEY

    2010-01-01

    Vespula vulgaris (Linnaeus) es un véspido social nativo de la región Holártica. En este trabajo reportamos la primera detección de esta especie en Argentina. Obreras de esta avispa fueron capturadas cerca de la ciudad de San Carlos de Bariloche (Argentina) en Febrero de 2010, mientras se tomaban muestras de otra avispa invasora, Vespula germanica (Fabricius) o chaqueta amarilla, de morfología externa y hábitos similares a la anteriormente mencionada. Además, detallamos algunos caracteres de i...

  12. First record of Vespula vulgaris (Hymenoptera: Vespidae) in Argentina

    OpenAIRE

    Masciocchi, Maité; Beggs, Jacqueline R.; Carpenter, James M.; Corley, Juan Carlos

    2016-01-01

    Vespula vulgaris (Linnaeus) es un véspido social nativo de la región Holártica. En este trabajo reportamos la primera detección de esta especie en Argentina. Obreras de esta avispa fueron capturadas cerca de la ciudad de San Carlos de Bariloche (Argentina) en Febrero de 2010, mientras se tomaban muestras de otra avispa invasora, Vespula germanica (Fabricius) o chaqueta amarilla, de morfología externa y hábitos similares a la anteriormente mencionada. Además, detallamos algunos caracteres de i...

  13. Primer registro de Vespula vulgaris (Hymenoptera: Vespidae en la Argentina

    Directory of Open Access Journals (Sweden)

    Maité MASCIOCCHI

    2010-01-01

    Full Text Available Vespula vulgaris (Linnaeus es un véspido social nativo de la región Holártica. En este trabajo reportamos la primera detección de esta especie en Argentina. Obreras de esta avispa fueron capturadas cerca de la ciudad de San Carlos de Bariloche (Argentina en Febrero de 2010, mientras se tomaban muestras de otra avispa invasora, Vespula germanica (Fabricius o chaqueta amarilla, de morfología externa y hábitos similares a la anteriormente mencionada. Además, detallamos algunos caracteres de identificación y características biológicas.

  14. Irradiated larval vaccination of ponies against strongylus vulgaris.

    Science.gov (United States)

    Klei, T R; Torbert, B J; Chapman, M R; Ochoa, R

    1982-08-01

    Nonimmune pony foals 9 to 12 mo of age were vaccinated with third-stage Strongylus vulgaris larvae (L3) irradiated with 70, 100, or 130 Kr of gamma radiation. Ponies receiving per os inoculations of L3 irradiated with 70 or 100 Kr were protected from the clinical disease and lesions associated with challenge infections of 4,300 L3, when compared to nonvaccinated controls. Similarly, the numbers of worms from the challenging population recovered from successfully vaccinated animals were significantly lower than from nonvaccinated controls. The degree of resistance that develops in individuals can be semiquantitated based on clinical and pathological responses.

  15. Irradiated larval vaccination of ponies against Strongylus vulgaris

    International Nuclear Information System (INIS)

    Klei, T.R.; Torbert, B.J.; Chapman, M.R.; Ochoa, R.

    1982-01-01

    Nonimmune pony foals 9 to 12 mo of age were vaccinated with third-stage Strongylus vulgaris larvae (L3) irradiated with 70, 100, or 130 Kr of gamma radiation. Ponies receiving per os inoculations of L3 irradiated with 70 or 100 Kr were protected from the clinical disease and lesions associated with challenge infections of 4,300 L3, when compared to nonvaccinated controls. Similarly, the numbers of worms from the challenging population recovered from successfully vaccinated animals were significantly lower than from nonvaccinated controls. The degree of resistance that develops in individuals can be semiquantitated based on clinical and pathological responses

  16. Molecular Characterization of a Catalase from Hydra vulgaris

    OpenAIRE

    Dash, Bhagirathi; Phillips, Timothy D.

    2012-01-01

    Catalase, an antioxidant and hydroperoxidase enzyme protects the cellular environment from harmful effects of hydrogen peroxide by facilitating its degradation to oxygen and water. Molecular information on a cnidarian catalase and/or peroxidase is, however, limited. In this work an apparent full length cDNA sequence coding for a catalase (HvCatalase) was isolated from Hydra vulgaris using 3’- and 5’- (RLM) RACE approaches. The 1859 bp HvCatalase cDNA included an open reading frame of 1518 bp ...

  17. Oral Lesions: The Clue to Diagnosis of Pemphigus Vulgaris.

    Science.gov (United States)

    Kuriachan, Diana; Suresh, Rakesh; Janardhanan, Mahija; Savithri, Vindhya

    2015-01-01

    Pemphigus is a group of potentially fatal dermatoses with both cutaneous and oral manifestations. Characterized by the appearance of vesicle or bullae, their manifestations in the oral cavity often precede those on the skin by many months or may remain as the only symptoms of the disease. It is therefore important that the oral manifestations of the disease are recognized on time, to make a proper diagnosis and initiate timely treatment. Here we present a case of Pemphigus Vulgaris (PV) that presented with oral lesions at multiple sites including tongue, to highlight the importance of timely recognition of the oral lesions during routine dental practice for the diagnosis and management of this disease.

  18. Generation and characterization of chicken egg yolk antibodies against propionibacterium acnes for the prevention of acne vulgaris

    Directory of Open Access Journals (Sweden)

    Karthika Selvan

    2012-01-01

    Full Text Available Introduction: Antigen-specific antibody has been widely used for immunological analysis in the field of diagnosis as well as in pure scientific research, where the IgY antibodies can be raised against P acnes antigen. Material and Methods: To produce IgY against Propionibacterium acnes, laying hens were immunized with P acnes (MTCC No: 1951 and subsequent booster injections were given. The antibodies produced were purified from the egg yolk of immunized chicken using the polyethylene glycol and ammonium sulfate precipitation method and, further, by Diethylaminoethyl (DEAE cellulose ion-exchange column chromatography. The protein fraction of IgY was isolated from the egg yolk. The separation was rapid, and the success of each step was viewed on Sodium Dodecyl Sulphate-polyacrylamide gel electrophoresis (SDS-PAGE. The reactivity of anti-P acnes was evaluated by the Enzyme-linked immunosorbent assay (ELISA test and the dot-immunoassay. Results: With ELISA, the highest titter of 1:10000 was observed on the 150 th day after vaccination. The results of dot-immunoassay suggested that anti-P acnes IgY developed a brown color as positive reaction, which showed the antigen-antibody binding even after a maximum dilution of 1/500. These results suggest that anti-acne IgY was produced and had strong specific antibody reactivity. Conclusion: The findings indicate that anti-acne IgY is worth utilizing as a preventive agent for acne vulgaris.

  19. Evaluation of five protocols for DNA extraction from leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris.

    Science.gov (United States)

    Aubakirova, K; Omasheva, M; Ryabushkina, N; Tazhibaev, T; Kampitova, G; Galiakparov, N

    2014-02-27

    Leaves of Malus sieversii, Vitis vinifera, and Armeniaca vulgaris contain substantial amounts of secondary metabolites, which limit the high-quality DNA extraction performance. In this study, five extraction protocols were compared for their ability to produce good quality DNA from fresh and dried (with silica gel) leaves of these species. The modified protocol of Dellaporta et al., using polyvinylpyrrolidone to bind the phenolic compounds and a high molar concentration of potassium acetate to inhibit co-precipitation of polysaccharides with DNA, produced the best DNA quality for all species tested. DNA extracted by this method had a 1.77-1.96 A260/280 nm ratio and successful amplification of the 18S ribosomal DNA gene. DNA concentrations of dried leaves were lower than those obtained from fresh leaves, which was likely due to aspects of the drying procedure. All five methods for grapevine produced DNA of obvious better quality from green canes compared to leaves, due to the relatively low content of secondary metabolites in the former. For grapevine and apricot, three methods can be equally used to obtain DNA of good quality: the Doyle and Doyle modified method using CTAB and high concentration of NaCl, the Jobes et al. modified method, and the sodium dodecyl sulfate mini preparation method of Edwards et al. The protocol of Jobes et al. using LiCl for RNA removal showed the best results for most of the M. sieversii samples examined.

  20. Oxygen isotopic fractionation during bacterial sulfate reduction

    Science.gov (United States)

    Balci, N.; Turchyn, A. V.; Lyons, T.; Bruchert, V.; Schrag, D. P.; Wall, J.

    2006-12-01

    Sulfur isotope fractionation during bacterial sulfate reduction (BSR) is understood to depend on a variety of environmental parameters, such as sulfate concentration, temperature, cell specific sulfate reduction rates, and the carbon substrate. What controls oxygen isotope fractionation during BSR is less well understood. Some studies have suggested that carbon substrate is important, whereas others concluded that there is a stoichiometric relationship between the fractionations of sulfur and oxygen during BSR. Studies of oxygen fractionation are complicated by isotopic equilibration between sulfur intermediates, particularly sulfite, and water. This process can modify the isotopic composition of the extracellular sulfate pool (δ18OSO4 ). Given this, the challenge is to distinguish between this isotopic equilibration and fractionations linked to the kinetic effects of the intercellular enzymes and the incorporation of sulfate into the bacterial cell. The δ18OSO4 , in concert with the sulfur isotope composition of sulfate (δ34SSO4), could be a powerful tool for understanding the pathways and environmental controls of BSR in natural systems. We will present δ18OSO4 data measured from batch culture growth of 14 different species of sulfate reducing bacteria for which sulfur isotope data were previously published. A general observation is that δ18OSO4 shows little isotopic change (kinetic effect during BSR and/or equilibration between sulfur intermediates and the isotopically light water (~-5‰) of the growth medium. Our present batch culture data do not allow us to convincingly isolate the magnitude and the controlling parameters of the kinetic isotope effect for oxygen. However, ongoing growth of mutant bacteria missing enzymes critical in the different steps of BSR may assist in this mission.

  1. Sulfation of corrosive alkali chlorides by ammonium sulfate in a biomass fired CFB boiler

    Energy Technology Data Exchange (ETDEWEB)

    Brostroem, Markus; Backman, Rainer; Nordin, Anders [Energy Technology and Thermal Process Chemistry, Umeaa University, SE-901 87 Umeaa (Sweden); Kassman, Haakan [Vattenfall Power Consultant AB, Box 1046, SE-611 29 Nykoeping (Sweden); Helgesson, Anna; Berg, Magnus; Andersson, Christer [Vattenfall Research and Development AB, SE-814 26 Aelvkarleby (Sweden)

    2007-12-15

    Biomass and waste derived fuels contain relatively high amounts of alkali and chlorine, but contain very little sulfur. Combustion of such fuels can result in increased deposit formation and superheater corrosion. These problems can be reduced by using a sulfur containing additive, such as ammonium sulfate, which reacts with the alkali chlorides and forms less corrosive sulfates. Ammonium sulfate injection together with a so-called in situ alkali chloride monitor (IACM) is patented and known as ''ChlorOut''. IACM measures the concentrations of alkali chlorides (mainly KCl in biomass combustion) at superheater temperatures. Tests with and without spraying ammonium sulfate into the flue gases have been performed in a 96MW{sub th}/25MW{sub e} circulating fluidized bed (CFB) boiler. The boiler was fired mainly with bark and a chlorine containing waste. KCl concentration was reduced from more than 15 ppm to approximately 2 ppm during injection of ammonium sulfate. Corrosion probe measurements indicated that both deposit formation and material loss due to corrosion were decreased using the additive. Analysis of the deposits showed significantly higher concentration of sulfur and almost no chlorine in the case with ammonium sulfate. Results from impactor measurements supported that KCl was sulfated to potassium sulfate by the additive. (author)

  2. 21 CFR 524.1484e - Neomycin sulfate and polymyxin B sulfate ophthalmic solution.

    Science.gov (United States)

    2010-04-01

    ... ophthalmic solution. 524.1484e Section 524.1484e Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS OPHTHALMIC AND TOPICAL DOSAGE FORM NEW ANIMAL DRUGS § 524.1484e Neomycin sulfate and polymyxin B sulfate ophthalmic solution. (a...

  3. Enhancement of Chlorella vulgaris growth and bioremediation ability of aquarium wastewater using diazotrophs.

    Science.gov (United States)

    Ali, Sayeda Mohammed; Nasr, Hoda Shafeek; Abbas, Wafaa Tawfik

    2012-08-15

    Treatment of aquarium wastewater represents an important process to clean and recycle wastewater to be safely returned to the environment, used for cultivation or to minimize the multiple renewal of water. Chlorella vulgaris was an important freshwater microalgae which used in wastewater treatment, and increasing its potential of treatment can be achieved with existence of N2-fixing bacteria. Co-culturing of Chlorella vulgaris with the diazotrophs, Azospirillum brasilense or Azotobacter chroococcum in three different media; aquarium wastewater (AWW), sterile enriched natural aquarium wastewater (GPM) and synthetic wastewater media (SWW) were studied. Biomass yield of the microalgae was estimated by determination of chlorophylls (a and b), total carotenoid and the dry weight of C. vulgaris. Also determination of ammonia, nitrite, phosphate and nitrate in the culture were done. The presence of diazotrophs significantly increased the biomass of C. vulgaris by increasing its microalgae pigments (chlorophylls a and b, and total carotenoids). The highest pigments percentage was reported due to addition of A. brasilense to C. vulgaris (18.3-133.5%) compared to A. chroococcum (23.9-56.9%). As well as increased dry weight from 12 to 50%. There was also improved removal of nitrate, nitrite, ammonia and phosphate; where, the highest removal percentage was reported due to addition of A. chroococcum to C. vulgaris (0.0-52%) compared to A. brasilense (0.6-16.4%). A. brasilense and A. chroococcum can support C. vulgaris biomass production and bioremediation activity in the aquarium to minimize the periodical water renewal.

  4. Effects of sodium pentaborate pentahydrate exposure on Chlorella vulgaris growth, chlorophyll content, and enzyme activities.

    Science.gov (United States)

    Chen, Xueqing; Pei, Yuansheng

    2016-10-01

    Sodium pentaborate pentahydrate (SPP) is a rare mineral. In this study, SPP was synthesized from boric acid and borax through low-temperature crystallization, and its effects on the growth of the alga, Chlorella vulgaris (C. vulgaris) were assessed. The newly synthesized SPP was characterized by chemical analysis, X-ray diffraction, Fourier-transform infrared spectroscopy, Raman spectroscopy, thermogravimetric analysis, and differential thermal analysis. The changes in C. vulgaris growth, chlorophyll content, and enzyme activities upon exposure to SPP for 168h were evaluated. Results showed that SPP treatment was detrimental to C. vulgaris growth during the first 24-120h of exposure. The harmful effects, however, diminished over time (168h), even at an effective medium concentration of 226.37mg BL(-1) (the concentration of boron applied per liter of culture medium). A similar trend was observed for chlorophyll content (chlorophyll a and b) and indicated that the photosynthesis of C. vulgaris was not affected and that high levels of SPP may even promote chlorophyll synthesis. Superoxide dismutase and catalase activities of C. vulgaris increased during 24-120h exposure to SPP, but these activities gradually decreased as culture time progressed. In other words, the initial detrimental effects of synthetic SPP on C. vulgaris were temporary and reversible. This research provides a scientific basis for applications of SPP in the environment. Copyright © 2016 Elsevier Inc. All rights reserved.

  5. Inhibitory effect of Thymus vulgaris extract on memory impairment induced by scopolamine in rat简

    Institute of Scientific and Technical Information of China (English)

    Zahra; Rabiei; Shiva; Mokhtari; Samira; Asgharzade; Mostafa; Gholami; Samira; Rahnama; Mahmoud; Rafieian-kopaei

    2015-01-01

    Objective: To investigate the effect of Thymus vulgaris(T. vulgaris) on learning and memory functions in scopolamine-induced memory deficit in rats. Memory enhancing activity in scopolamine-induced amnesic rats was investigated by assessing the Morris water maze and passive avoidance paradigm.Methods: A total of 42 male Wistar rats were divided into 6 equal groups as follow:control group: received water, scopolamine treated group: received scopolamine 1 mg/kg for 15 days, two scopolamine + T. vulgaris treated groups: received scopolamine and T. vulgaris extract 50 and 100 mg/kg body weight per day for 15 days, two intact groups:received T. vulgaris extract 50 and 100 mg/kg body weight per day for 15 days.Results: Administration of T. vulgaris extract significantly restored memory and learning impairments induced by scopolamine in the passive avoidance test and Morris water maze test.Conclusions: T. vulgaris extract has repairing effects on memory and behavioral disorders produced by scopolamine and may have beneficial effects in the treatment of Alzheimer’s disease.

  6. Efficacy and safety of superficial chemical peeling in treatment of active acne vulgaris.

    Science.gov (United States)

    Al-Talib, Hassanain; Al-Khateeb, Alyaa; Hameed, Ayad; Murugaiah, Chandrika

    2017-01-01

    Acne vulgaris is an extremely common condition affecting the pilosebaceous unit of the skin and characterized by presence of comedones, papules, pustules, nodules, cysts, which might result in permanent scars. Acne vulgaris commonly involve adolescents and young age groups. Active acne vulgaris is usually associated with several complications like hyper or hypopigmentation, scar formation and skin disfigurement. Previous studies have targeted the efficiency and safety of local and systemic agents in the treatment of active acne vulgaris. Superficial chemical peeling is a skin-wounding procedure which might cause some potentially undesirable adverse events. This study was conducted to review the efficacy and safety of superficial chemical peeling in the treatment of active acne vulgaris. It is a structured review of an earlier seven articles meeting the inclusion and exclusion criteria. The clinical assessments were based on pretreatment and post-treatment comparisons and the role of superficial chemical peeling in reduction of papules, pustules and comedones in active acne vulgaris. This study showed that almost all patients tolerated well the chemical peeling procedures despite a mild discomfort, burning, irritation and erythema have been reported; also the incidence of major adverse events was very low and easily manageable. In conclusion, chemical peeling with glycolic acid is a well-tolerated and safe treatment modality in active acne vulgaris while salicylic acid peels is a more convenient for treatment of darker skin patients and it showed significant and earlier improvement than glycolic acid.

  7. Modeling of sulfation of potassium chloride by ferric sulfate addition during grate-firing of biomass

    DEFF Research Database (Denmark)

    Wu, Hao; Jespersen, Jacob Boll; Aho, Martti

    2013-01-01

    Potassium chloride, KCl, formed from critical ash-forming elements released during combustion may lead to severe ash deposition and corrosion problems in biomass-fired boilers. Ferric sulfate, Fe2(SO4)3 is an effective additive, which produces sulfur oxides (SO2 and SO3) to convert KCl to the less...... harmful K2SO4. In the present study the decomposition of ferric sulfate is studied in a fast-heating rate thermogravimetric analyzer (TGA), and a kinetic model is proposed to describe the decomposition process. The yields of SO2 and SO3 from ferric sulfate decomposition are investigated in a laboratory......-scale tube reactor. It is revealed that approximately 40% of the sulfur is released as SO3, the remaining fraction being released as SO2. The proposed decomposition model of ferric sulfate is combined with a detailed gas phase kinetic model of KCl sulfation, and a simplified model of K2SO4 condensation...

  8. The electrical and thermal properties of sodium sulfate mixed with lithium sulfate, yttrium sulfate, and silicon dioxide

    International Nuclear Information System (INIS)

    Imanaka, N.; Yamaguchi, Y.; Adachi, G.; Shiokawa, J.

    1986-01-01

    Sodium sulfate mixed with lithium sulfate, yttrium sulfate, and silicon dioxide was prepared. The thermal and electrical properties of its phases were investigated. The Na 2 SO 4 -Li 2 SO 4 -Y 2 (SO 4 ) 3 SiO 2 samples are similar to the Na 2 SO 4 -I phase (a high temperature phase), which is appreciably effective for Na + ionic conduction. Phase transformation was considerably suppressed by mixing. Electromotive force (EMF) was measured, using Na 2 SO 4 -Li 2 SO 4 -Y 2 (SO 4 ) 3 -SiO 2 as a solid electrolyte, by constructing an SO 2 gas concentration cell. The measured EMF's at 823 and 773 K were in fairly good accordance with the calculated EMF's for inlet SO 2 gas concentration between 30 ppm and 1%, and 500 ppm and 0.5% respectively

  9. Heparan sulfate-chondroitin sulfate hybrid proteoglycan of the cell surface and basement membrane of mouse mammary epithelial cells

    International Nuclear Information System (INIS)

    David, G.; Van den Berghe, H.

    1985-01-01

    Chondroitin sulfate represents approximately 15% of the 35 SO 4 -labeled glycosaminoglycans carried by the proteoglycans of the cell surface and of the basolateral secretions of normal mouse mammary epithelial cells in culture. Evidence is provided that these chondroitin sulfate-carrying proteoglycans are hybrid proteoglycans, carrying both chondroitin sulfate and heparan sulfate chains. Complete N-desulfation but limited O-desulfation, by treatment with dimethyl sulfoxide, of the proteoglycans decreased the anionic charge of the chondroitin sulfate-carrying proteoglycans to a greater extent than it decreased the charge of their constituent chondroitin sulfate chains. Partial depolymerization of the heparan sulfate residues of the proteoglycans with nitrous acid or with heparin lyase also reduced the effective molecular radius of the chondroitin sulfate-carrying proteoglycans. The effect of heparin lyase on the chondroitin sulfate-carrying proteoglycans was prevented by treating the proteoglycan fractions with dimethyl sulfoxide, while the effect of nitrous acid on the dimethyl sulfoxide-treated proteoglycans was prevented by acetylation. This occurrence of heparan sulfate-chondroitin sulfate hybrid proteoglycans suggests that the substitution of core proteins by heparan sulfate or chondroitin sulfate chains may not solely be determined by the specific routing of these proteins through distinct chondroitin sulfate and heparan sulfate synthesizing mechanisms. Moreover, regional and temporal changes in pericellular glycosaminoglycan compositions might be due to variable postsynthetic modification of a single gene product

  10. Co-existence of Methanogenesis and Sulfate Reduction with Common Substrates in Sulfate-Rich Estuarine Sediments

    Directory of Open Access Journals (Sweden)

    Michal Sela-Adler

    2017-05-01

    Full Text Available The competition between sulfate reducing bacteria and methanogens over common substrates has been proposed as a critical control for methane production. In this study, we examined the co-existence of methanogenesis and sulfate reduction with shared substrates over a large range of sulfate concentrations and rates of sulfate reduction in estuarine systems, where these processes are the key terminal sink for organic carbon. Incubation experiments were carried out with sediment samples from the sulfate-methane transition zone of the Yarqon (Israel estuary with different substrates and inhibitors along a sulfate concentrations gradient from 1 to 10 mM. The results show that methanogenesis and sulfate reduction can co-exist while the microbes share substrates over the tested range of sulfate concentrations and at sulfate reduction rates up to 680 μmol L-1 day-1. Rates of methanogenesis were two orders of magnitude lower than rates of sulfate reduction in incubations with acetate and lactate, suggesting a higher affinity of sulfate reducing bacteria for the available substrates. The co-existence of both processes was also confirmed by the isotopic signatures of δ34S in the residual sulfate and that of δ13C of methane and dissolved inorganic carbon. Copy numbers of dsrA and mcrA genes supported the dominance of sulfate reduction over methanogenesis, while showing also the ability of methanogens to grow under high sulfate concentration and in the presence of active sulfate reduction.

  11. Quality of life, self-esteem and psychosocial factors in adolescents with acne vulgaris.

    Science.gov (United States)

    Vilar, Gustavo Nunes; Santos, Laís Araújo dos; Sobral Filho, Jader Freire

    2015-01-01

    Dermatological diseases, among which acne vulgaris, have psychological impact on the affected generating feelings of guilt, shame and social isolation. To compare quality of life, self-esteem and other psychosocial variables amongst adolescents with and without acne vulgaris, and between levels of severity. Cross-sectional observational study in a sample of 355 high school students from the city of João Pessoa. Data collection was performed with questionnaires and clinical-dermatological evaluation. The primary variables were the incidence of AV; quality of life, set by the Children's Dermatology Quality of Life Index and Dermatology Quality of Life Index; and self-esteem, measured by the Rosenberg Self-Esteem Scale. For calculation of statistical tests, we used the SPSS 20.0 software, considering p=0.05. The sample, with an average age of 16, showed 89.3% prevalence of acne vulgaris. The most prevalent psychosocial issue was "afraid that acne will never cease", present in 58% of affected youth. The median score of Quality of Life in Children's Dermatology Index was different amongst students with and without acne vulgaris (p=0.003), as well as the Quality of Life in Dermatology (p=0.038) scores, so that students with acne vulgaris have worse QoL. There was a correlation between the severity of acne vulgaris and worse quality of life. Self-esteem was not significantly associated with the occurrence or severity of acne vulgaris. acne vulgaris assumes significance in view of its high prevalence and the effect on quality of life of adolescents, more severe at the more pronounced stages of disease (pacne vulgaris should be valued in the management of patients with this condition.

  12. Protection of yearling ponies against Strongylus vulgaris by foalhood vaccination.

    Science.gov (United States)

    Klei, T R; French, D D; Chapman, M R; McClure, J R; Dennis, V A; Taylor, H W; Hutchinson, G W

    1989-06-01

    The long-term efficacy of an irradiation attenuated larval (L3) vaccine against Strongylus vulgaris was tested in ponies which were reared on pasture. Prior to foaling, mares were divided into two groups. One group of mares and foals received regular (eight weekly) treatment with ivermectin and the second group remained untreated. Half the foals in each pasture group were vaccinated at eight to ten weeks of age. Foals were weaned at three to four months of age and maintained on separate pastures. At eight to ten months of age, ponies were placed in box stalls and half of each treatment group were challenged with S. vulgaris (5 x 1000 L3). Clinical signs and lesions typical of acute verminous arteritis were found at necropsy in the ivermectin treated non-vaccinated challenged yearlings. Ivermectin treated vaccinated challenged yearlings did not show these clinical signs, had markedly reduced to absent arterial lesions and showed an 89 per cent reduction in arterial larval burdens post mortem. Significant differences in clinical signs, arterial lesions or arterial larval burdens were not seen between vaccinated and non-vaccinated foals reared without benefit of ivermectin treatment.

  13. Effect of the hydrocarbon phenanthrene on Chlorella vulgaris (Chlorellaceae) growth

    International Nuclear Information System (INIS)

    Otero Paternina, Angelica; Cruz Casallas, Pablo E; Velasco Santamaria, Yohana M

    2013-01-01

    The effects of the polycyclic aromatic hydrocarbon phenanthrene on the growth of chlorella vulgaris alga were evaluated under laboratory conditions. The algae were exposed during 72 h to different concentrations of phenanthrene (0, 1, 10, 100, 1000 and 10000 μg/l). The alga density was daily determined by a neubauer chamber. The average growth average, total biomass and inhibition percentage of the biomass were also determined. In addition, the content of chlorophyll a was determined at the beginning and the end of the experiment. the assays were carried out in glass bottles of 0,4 l using the complex NPK (remital m 17-6-18) at 1 g/l as an organic fertilizing. The results showed that phenanthrene inhibited progressively the alga growth being the lowest cellular growth observed in the medium with the highest phenanthrene concentration, reaching an inhibition percentage of 59 %. In the other treatments, the daily growth rate was relatively constant. The chlorophyll a concentration evaluated by spectrophotometry was not affected by the phenanthrene concentration. in conclusion, the growth of the alga c. vulgaris was affected negatively by the exposure to nominal concentrations of the polycyclic aromatic hydrocarbon phenanthrene higher than 1 μg/l.

  14. Treatment of acne vulgaris with fractional radiofrequency microneedling.

    Science.gov (United States)

    Kim, Sang Tae; Lee, Kang Hoon; Sim, Hyung Jun; Suh, Kee Suck; Jang, Min Soo

    2014-07-01

    Fractional radiofrequency microneedling is a novel radiofrequency technique that uses insulated microneedles to deliver energy to the deep dermis at the point of penetration without destruction of the epidermis. It has been used for the treatment of various dermatological conditions including wrinkles, atrophic scars and hypertrophic scars. There have been few studies evaluating the efficacy of fractional radiofrequency microneedling in the treatment of acne, and none measuring objective parameters like the number of inflammatory and non-inflammatory acne lesions or sebum excretion levels. The safety and efficacy of fractional radiofrequency microneedling in the treatment of acne vulgaris was investigated. In a prospective clinical trial, 25 patients with moderate to severe acne were treated with fractional radiofrequency microneedling. The procedure was carried out three times at 1-month intervals. Acne lesion count, subjective satisfaction score, sebum excretion level and adverse effects were assessed at baseline and at 4, 8 and 12 weeks after the first treatment as well as 4, 8 and 12 weeks after the last treatment. Number of acne lesions (inflammatory and non-inflammatory) decreased. Sebum excretion and subjective satisfaction were more favorable at every time point compared with the baseline values (P acne vulgaris. © 2014 Japanese Dermatological Association.

  15. Enhanced Harvesting of Chlorella vulgaris Using Combined Flocculants.

    Science.gov (United States)

    Ma, Xiaochen; Zheng, Hongli; Zhou, Wenguang; Liu, Yuhuan; Chen, Paul; Ruan, Roger

    2016-10-01

    In this study, a novel flocculation strategy for harvesting Chlorella vulgaris with combined flocculants, poly (γ-glutamic acid) (γ-PGA) and calcium oxide (CaO), has been developed. The effect of flocculant dosage, the order of flocculant addition, mixing speed, and growth stage on the harvesting efficiency was evaluated. Results showed that the flocculation using combined flocculants significantly decreases the flocculant dosage and settling time compared with control. It was also found that CaO and γ-PGA influenced microalgal flocculation by changing the zeta potential of cells and pH of microalgal suspension. The most suitable order of flocculant addition was CaO first and then γ-PGA. The optimal mixing speed was 200 rpm for 0.5 min, followed by 50 rpm for another 4.5 min for CaO and γ-PGA with the highest flocculation efficiency of 95 % and a concentration factor of 35.5. The biomass concentration and lipid yield of the culture reusing the flocculated medium were similar to those when a fresh medium was used. Overall, the proposed method requires low energy input, alleviates biomass and water contamination, and reduces utilization of water resources and is feasible for harvesting C. vulgaris for biofuel and other bio-based chemical production.

  16. Stability and loading properties of curcumin encapsulated in Chlorella vulgaris.

    Science.gov (United States)

    Jafari, Yaser; Sabahi, Hossein; Rahaie, Mahdi

    2016-11-15

    Curcumin (Cur), a polyphenols with pharmacological function, was successfully encapsulated in algae (Alg) cell (Chlorella vulgaris) as confirmed by fluorescence microscopy, thermogravimetric analysis (TGA), differential scanning calorimetry (DSC) and Fourier transform-infrared spectroscopy (FT-IR). Fluorescence micrographs, TGA, DSC and FTIR spectra suggested the hypothesis inclusion Cur in Nano-empty spaces inside cell wall of Alg. The TGA analysis showed that the thermal stability of Alg and Cur at algae/curcumin complex was 3.8% and 33% higher than their free forms at 0-300°C and 300-600°C ranges, respectively. After encapsulation in Alg cells, the photostability of Cur was enhanced by about 2.5-fold. Adsorption isotherm of Cur into Alg was fitted with the Freundlich isotherm. The microcapsules were loaded with Cur up to about 55% w/w which is much higher than other reported bio-carriers. In conclusion, the data proved that Chlorella vulgaris cell can be used as a new stable carrier for Cur. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Sulfation in lead-acid batteries

    Science.gov (United States)

    Catherino, Henry A.; Feres, Fred F.; Trinidad, Francisco

    Virtually, all military land vehicle systems use a lead-acid battery to initiate an engine start. The maintainability of these batteries and as a consequence, system readiness, has suffered from a lack of understanding of the reasons for battery failure. Often, the term most commonly heard for explaining the performance degradation of lead-acid batteries is the word, sulfation. Sulfation is a residual term that came into existence during the early days of lead-acid battery development. The usage is part of the legend that persists as a means for interpreting and justifying the eventual performance deterioration and failure of lead-acid batteries. The usage of this term is confined to the greater user community and, over time, has encouraged a myriad of remedies for solving sulfation problems. One can avoid the connotations associated with the all-inclusive word, sulfation by visualizing the general "sulfation" effect in terms of specific mechanistic models. Also, the mechanistic models are essential for properly understanding the operation and making proper use this battery system. It is evident that the better the model, the better the level of understanding.

  18. Assessing the Role of Iron Sulfides in the Long Term Sequestration of Uranium by Sulfate-Reducing Bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, Kim F. [Univ. of Michigan, Ann Arbor, MI (United States); Bi, Yuqiang [Univ. of Michigan, Ann Arbor, MI (United States); Carpenter, Julian [Univ. of Michigan, Ann Arbor, MI (United States); Hyng, Sung Pil [Univ. of Michigan, Ann Arbor, MI (United States); Rittmann, Bruce E. [Arizona State Univ., Tempe, AZ (United States); Zhou, Chen [Arizona State Univ., Tempe, AZ (United States); Vannela, Raveender [Arizona State Univ., Tempe, AZ (United States); Davis, James A. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2013-12-31

    This overarching aim of this project was to identify the role of biogenic and synthetic iron-sulfide minerals in the long-term sequestration of reduced U(IV) formed under sulfate-reducing conditions when subjected to re-oxidizing conditions. The work reported herein was achieved through the collaborative research effort conducted at Arizona State University (ASU) and the University of Michigan (UM). Research at ASU, focused on the biogenesis aspects, examined the biogeochemical bases for iron-sulfide production by Desulfovibrio vulgaris, a Gram-negative bacterium that is one of the most-studied strains of sulfate-reducing bacteria. A series of experimental studies were performed to investigate comprehensively important metabolic and environmental factors that affect the rates of sulfate reduction and iron-sulfide precipitation, the mineralogical characteristics of the iron sulfides, and how uranium is reduced or co-reduced by D. vulagaris. FeS production studies revealed that controlling the pH affected the growth of D. vulgaris and strongly influenced the formation and growth of FeS solids. In particular, lower pH produced larger-sized mackinawite (Fe1+xS). Greater accumulation of free sulfide, from more sulfate reduction by D. vulgaris, also led to larger-sized mackinawite and stimulated mackinawite transformation to greigite (Fe3S4) when the free sulfide concentration was 29.3 mM. On the other hand, using solid Fe(III) (hydr)oxides as the iron source led to less productivity of FeS due to their slow and incomplete dissolution and scavenging of sulfide. Furthermore, sufficient free Fe2+, particularly during Fe(III) (hydr)oxide reductions, led to the additional formation of vivianite [Fe3(PO4)2•8(H2O)]. The U(VI) reduction studies revealed that D. vulgaris reduced U(VI) fastest when accumulating sulfide from concomitant sulfate reduction, since direct enzymatic and sulfide

  19. Immunohistochemical localization of chondroitin sulfate, chondroitin sulfate proteoglycan, heparan sulfate proteoglycan, entactin, and laminin in basement membranes of postnatal developing and adult rat lungs

    DEFF Research Database (Denmark)

    Sannes, P L; Burch, K K; Khosla, J

    1993-01-01

    Histologic preparations of lungs from 1-, 5-, 10-, 18-, and 25-day-old postnatal and adult rats were examined immunohistochemically with antibodies specific against chondroitin sulfate (CS), basement membrane chondroitin sulfate proteoglycan (BM-CSPG), heparan sulfate proteoglycan (HSPG), entactin...

  20. Precipitin response of the mitogen produced by Strongylus vulgaris arterial larvae.

    Science.gov (United States)

    Adeyefa, C A

    1992-07-01

    The precipitin response of the mitogen produced by Strongylus vulgaris arterial larvae was investigated. IgG (T) from the sera of horses naturally infected with S. vulgaris adults and arterial larvae recognised the presence of two antigenic components of the mitogenic fractions. The results obtained seem to confirm that these antigens are immunogenic in stimulating the production of increased levels of IgG(T) in infected animals, and showed that the procedures could be used as immunological tools in the diagnosis of S. vulgaris infection.

  1. SvSXP: a Strongylus vulgaris antigen with potential for prepatent diagnosis.

    Science.gov (United States)

    Andersen, Ulla V; Howe, Daniel K; Dangoudoubiyam, Sriveny; Toft, Nils; Reinemeyer, Craig R; Lyons, Eugene T; Olsen, Susanne N; Monrad, Jesper; Nejsum, Peter; Nielsen, Martin K

    2013-04-04

    Strongyle parasites are ubiquitous in grazing horses. Strongylus vulgaris, the most pathogenic of the large strongyles, is known for its extensive migration in the mesenteric arterial system. The lifecycle of S. vulgaris is characterised by a long prepatent period where the migrating larvae are virtually undetectable as there currently is no test available for diagnosing prepatent S. vulgaris infection. Presence of S. vulgaris larvae in the arterial system causes endarteritis and thrombosis with a risk of non-strangulating intestinal infarctions. Emergence of anthelmintic resistance among cyathostomins has led to recommendations of reduced treatment intensity by targeting horses that exceed a predetermined strongyle faecal egg count threshold. One study suggests an apparent increase in prevalence of S. vulgaris on farms where reduced anthelmintic treatment intensity has been implemented. These issues highlight the need for an accurate and reliable assay for diagnosing prepatent S. vulgaris infection. Immunoscreening of a larval S. vulgaris cDNA library using hyperimmune serum raised against S. vulgaris excretory/secretory antigens was performed to identify potential diagnostic antigens. Immunoreactive clones were sequenced, one potential antigen was characterised, expressed as a recombinant protein, initially evaluated by western blot (WB) analysis, the diagnostic potential of the IgG subclasses was evaluated by ELISA, and the diagnostic accuracy evaluated using serum from 102 horses with known S. vulgaris infection status. The clone expressing the potential antigen encoded a S. vulgaris SXP/RAL2 homologue. The recombinant protein, rSvSXP, was shown to be a potential diagnostic antigen by WB analysis, and a target of serum IgGa, IgG(T) and total IgG in naturally infected horses, with IgG(T) antibodies being the most reliable indicator of S. vulgaris infection in horses. Evaluation of diagnostic accuracy of the ELISA resulted in a sensitivity of 73.3%, a specificity

  2. Two endornaviruses show differential infection patterns between gene pools of Phaseolus vulgaris.

    Science.gov (United States)

    Khankhum, Surasak; Valverde, Rodrigo A; Pastor-Corrales, Marcial A; Osorno, Juan M; Sabanadzovic, Sead

    2015-04-01

    We investigated the occurrence of two plant endornaviruses, Phaseolus vulgaris endornavirus 1 and Phaseolus vulgaris endornavirus 2, in breeding lines, cultivars, landraces, and wild genotypes of common bean (Phaseolus vulgaris) collected from the two centers of common bean domestication: Mesoamerica and the Andes. The two endornaviruses were detected in many genotypes of Mesoamerican origin but rarely in genotypes of Andean origin. The results suggest that these two endornaviruses were introduced into the Mesoamerican modern genotypes during common bean domestication and provide more evidence for the existence of two divergent gene pools of common bean.

  3. A pediatric case of disseminated mutilating lupus vulgaris: A disgrace for society

    Directory of Open Access Journals (Sweden)

    Suresh Kumar Jain

    2016-01-01

    Full Text Available Lupus vulgaris (LV is a chronic and progressive form of cutaneous tuberculosis. The lesions may sometimes be associated with extensive destruction of tissue resulting in marked disfigurement and morbidity. A high index of suspicion is crucial for early diagnosis and treatment and thereby prevention of cosmetic deformity. Lupus vulgaris presenting as disseminated mutilating lesions in a child is uncommon, especially in today's era. Herein, we report an unusual case of lupus vulgaris with coexistence of multiple ulcerative mutilating lesions over face and classical plaque over distant site (right thigh in a 9 year old girl.

  4. p-Cresyl sulfate and indoxyl sulfate in pediatric patients on chronic dialysis

    Directory of Open Access Journals (Sweden)

    Hye Sun Hyun

    2013-04-01

    Full Text Available &lt;b&gt;Purpose:&lt;/b&gt; Indoxyl sulfate and p- cresyl sulfate are important protein-bound uremic retention solutes whose levels can be partially reduced by renal replacement therapy. These solutes originate from intestinal bacterial protein fermentation and are associated with cardiovascular outcomes and chronic kidney disease progression. The aims of this study were to investigate the levels of indoxyl sulfate and p- cresyl sulfate as well as the effect of probiotics on reducing the levels of uremic toxins in pediatric patients on dialysis. &lt;b&gt;Methods:&lt;/b&gt; We enrolled 20 pediatric patients undergoing chronic dialysis; 16 patients completed the study. The patients underwent a 12-week regimen of VSL#3, a high-concentration probiotic preparation, and the serum levels of indoxyl sulfate and p- cresyl sulfate were measured before treatment and at 4, 8, and 12 weeks after the regimen by using fluorescence liquid chromatography. To assess the normal range of indoxyl sulfate and p- cresyl sulfate we enrolled the 16 children with normal glomerular filtration rate who had visited an outpatient clinic for asymptomatic microscopic hematuria that had been detected by a school screening in August 2011. &lt;b&gt;Results:&lt;/b&gt; The baseline serum levels of indoxyl sulfate and p- cresyl sulfate in the patients on chronic dialysis were significantly higher than those in the children with microscopic hematuria. The baseline serum levels of p- cresyl sulfate in the peritoneal dialysis group were significantly higher than those in the hemodialysis group. There were no significant changes in the levels of these uremic solutes after 12-week VSL#3 treatment in the patients on chronic dialysis. &lt;b&gt;Conclusion:&lt;/b&gt; The levels of the uremic toxins p- cresyl sulfate and indoxyl sulfate are highly elevated in pediatric patients on dialysis, but there was no significant effect by

  5. Sulfated glycopeptide nanostructures for multipotent protein activation

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Sungsoo S.; Fyrner, Timmy; Chen, Feng; Álvarez, Zaida; Sleep, Eduard; Chun, Danielle S.; Weiner, Joseph A.; Cook, Ralph W.; Freshman, Ryan D.; Schallmo, Michael S.; Katchko, Karina M.; Schneider, Andrew D.; Smith, Justin T.; Yun, Chawon; Singh, Gurmit; Hashmi, Sohaib Z.; McClendon, Mark T.; Yu, Zhilin; Stock, Stuart R.; Hsu, Wellington K.; Hsu, Erin L.; Stupp , Samuel I. (NWU)

    2017-06-19

    Biological systems have evolved to utilize numerous proteins with capacity to bind polysaccharides for the purpose of optimizing their function. A well-known subset of these proteins with binding domains for the highly diverse sulfated polysaccharides are important growth factors involved in biological development and tissue repair. We report here on supramolecular sulfated glycopeptide nanostructures, which display a trisulfated monosaccharide on their surfaces and bind five critical proteins with different polysaccharide-binding domains. Binding does not disrupt the filamentous shape of the nanostructures or their internal β-sheet backbone, but must involve accessible adaptive configurations to interact with such different proteins. The glycopeptide nanostructures amplified signalling of bone morphogenetic protein 2 significantly more than the natural sulfated polysaccharide heparin, and promoted regeneration of bone in the spine with a protein dose that is 100-fold lower than that required in the animal model. These highly bioactive nanostructures may enable many therapies in the future involving proteins.

  6. Primer registro de Vespula vulgaris (Hymenoptera: Vespidae en la Argentina First record of Vespula vulgaris (Hymenoptera: Vespidae in Argentina

    Directory of Open Access Journals (Sweden)

    Maité Masciocchi

    2010-12-01

    Full Text Available Vespula vulgaris (Linnaeus es un véspido social nativo de la región Holártica. En este trabajo reportamos la primera detección de esta especie en Argentina. Obreras de esta avispa fueron capturadas cerca de la ciudad de San Carlos de Bariloche (Argentina en Febrero de 2010, mientras se tomaban muestras de otra avispa invasora, Vespula germanica (Fabricius o chaqueta amarilla, de morfología externa y hábitos similares a la anteriormente mencionada. Además, detallamos algunos caracteres de identificación y características biológicas.Vespula vulgaris (Linnaeus is a social vespid native to the Holarctic region. The first detection of this species in Argentina is here reported. Workers were captured close to San Carlos de Bariloche (Argentina during February 2010, while sampling for another successful invader, the German wasp or Yellowjacket, Vespula germanica (Fabricius. Both these wasp species are very similar morphologically and share a number of common habits. Also, some identification features and biological characters are here explained.

  7. Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Minhee, E-mail: heelee@pknu.ac.kr [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of); Yang, Minjune [Department of Environmental Geosciences, Pukyong National University, 599-1 Daeyondong, Namgu, Busan 608-737 (Korea, Republic of)

    2010-01-15

    The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 {mu}g/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

  8. Shelf-life extension of minimally processed and gamma irradiated red beet (Beta vulgaris ssp. vulgaris L.), Cv. early wonder

    International Nuclear Information System (INIS)

    Hernandes, Nilber Kenup; Vital, Helio de Carvalho; Coneglian, Regina Celi Cavestre

    2007-01-01

    This work investigated the effects of gamma irradiation on the shelf-life extension and safety of minimally processed red beet (Beta vulgaris ssp. vulgaris L.) by performing microbiological, chemical and sensory analyses. Red beets were harvested 73 days after transplanting and their tuberous parts were minimally processed and separated in two groups: control (non-irradiated) and irradiated (0.5, 1.0 and 1.5 kGy). Tests for Salmonella sp., total and fecal coliforms, total count of aerobic mesophilic and lactic-acid bacteria were performed during the 21-day storage at 8 deg C. They indicated that the samples irradiated with 1.0 and 1.5 kGy remained in good conditions throughout storage while the unirradiated samples did not last 7 days. Chemical analyses indicated that the concentrations of vitamins B1 and B2 were not affected by irradiation. In contrast the amounts of fructose and glucose increased during storage while the one for sucrose decreased. In addition four series of sensory evaluations including appearance and aroma indicated that the samples irradiated with 1.0 and 1.5 kGy remained good for consumption for 20 days. Therefore it was concluded that the use of the doses of 1.0 and 1.5 kGy produced the best effects on the conservation of the samples without harming the sensory characteristics and nutritional constituents tested. (author)

  9. Rhizofiltration using sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) to remediate uranium contaminated groundwater

    International Nuclear Information System (INIS)

    Lee, Minhee; Yang, Minjune

    2010-01-01

    The uranium removal efficiencies of rhizofiltration in the remediation of groundwater were investigated in lab-scale experiments. Sunflower (Helianthus annuus L.) and bean (Phaseolus vulgaris L. var. vulgaris) were cultivated and an artificially uranium contaminated solution and three genuine groundwater samples were used in the experiments. More than 80% of the initial uranium in solution and genuine groundwater, respectively, was removed within 24 h by using sunflower and the residual uranium concentration of the treated water was lower than 30 μg/L (USEPA drinking water limit). For bean, the uranium removal efficiency of the rhizofiltration was roughly 60-80%. The maximum uranium removal via rhizofiltration for the two plant cultivars occurred at pH 3-5 of solution and their uranium removal efficiencies exceeded 90%. The lab-scale continuous rhizofiltration clean-up system delivered over 99% uranium removal efficiency, and the results of SEM and EDS analyses indicated that most uranium accumulated in the roots of plants. The present results suggested that the uranium removal capacity of two plants evaluated in the clean-up system was about 25 mg/kg of wet plant mass. Notably, the removal capacity of the root parts only was more than 500 mg/kg.

  10. Formation of the natural sulfate aerosol

    Energy Technology Data Exchange (ETDEWEB)

    Kerminen, V.M.; Hillamo, R.; Maekinen, M.; Virkkula, A.; Maekelae, T.; Pakkanen, T. [Helsinki Univ. (Finland). Dept. of Physics

    1996-12-31

    Anthropogenic sulfate aerosol, together with particles from biomass burning, may significantly reduce the climatic warming due to man-made greenhouse gases. The radiative forcing of aerosol particles is based on their ability to scatter and absorb solar radiation (direct effect), and on their influences on cloud albedos and lifetimes (indirect effect). The direct aerosol effect depends strongly on the size, number and chemical composition of particles, being greatest for particles of 0.1-1 {mu}m in diameter. The indirect aerosol effect is dictated by the number of particles being able to act as cloud condensation nuclei (CCN). For sulfate particles, the minimum CCN size in tropospheric clouds is of the order of 0.05-0.2 {mu}m. To improve aerosol parameterizations in future climate models, it is required that (1) both primary and secondary sources of various particle types will be characterized at a greater accuracy, and (2) the influences of various atmospheric processes on the spatial and temporal distribution of these particles and their physico-chemical properties are known much better than at the present. In estimating the climatic forcing due to the sulfate particles, one of the major problems is to distinguish between sulfur from anthropogenic sources and that of natural origin. Global emissions of biogenic and anthropogenic sulfate pre-cursors are comparable in magnitude, but over regional scales either of these two source types may dominate. The current presentation is devoted to discussing the natural sulfate aerosol, including the formation of sulfur-derived particles in the marine environment, and the use of particulate methanesulfonic acid (MSA) as a tracer for the natural sulfate

  11. Formation of the natural sulfate aerosol

    Energy Technology Data Exchange (ETDEWEB)

    Kerminen, V M; Hillamo, R; Maekinen, M; Virkkula, A; Maekelae, T; Pakkanen, T [Helsinki Univ. (Finland). Dept. of Physics

    1997-12-31

    Anthropogenic sulfate aerosol, together with particles from biomass burning, may significantly reduce the climatic warming due to man-made greenhouse gases. The radiative forcing of aerosol particles is based on their ability to scatter and absorb solar radiation (direct effect), and on their influences on cloud albedos and lifetimes (indirect effect). The direct aerosol effect depends strongly on the size, number and chemical composition of particles, being greatest for particles of 0.1-1 {mu}m in diameter. The indirect aerosol effect is dictated by the number of particles being able to act as cloud condensation nuclei (CCN). For sulfate particles, the minimum CCN size in tropospheric clouds is of the order of 0.05-0.2 {mu}m. To improve aerosol parameterizations in future climate models, it is required that (1) both primary and secondary sources of various particle types will be characterized at a greater accuracy, and (2) the influences of various atmospheric processes on the spatial and temporal distribution of these particles and their physico-chemical properties are known much better than at the present. In estimating the climatic forcing due to the sulfate particles, one of the major problems is to distinguish between sulfur from anthropogenic sources and that of natural origin. Global emissions of biogenic and anthropogenic sulfate pre-cursors are comparable in magnitude, but over regional scales either of these two source types may dominate. The current presentation is devoted to discussing the natural sulfate aerosol, including the formation of sulfur-derived particles in the marine environment, and the use of particulate methanesulfonic acid (MSA) as a tracer for the natural sulfate

  12. Inhibition of sulfate reduction in paddy soils

    Energy Technology Data Exchange (ETDEWEB)

    Vamos, R

    1958-12-13

    The hydrogen sulfide formed in waterlogged soils is a serious problem in rice cultivation. It inhibits the uptake of water and nutrients and may even cause root-rot. Results can best be obtained by preventing the formation of hydrogen sulfide. It is formed mainly by reduction of sulfate for which the cellulose-butyric acid fermentation provides the hydrogen source. Addition of ammonium or potassium nitrate prevents the formation of H/sub 2/S. The hydrogen produced by butyric acid fermentation is used to reduce nitrate and consequently cannot be utilized by the sulfate-reducing bacteria as a source of energy. 6 references.

  13. Measurement of chemical leaching potential of sulfate from landfill disposed sulfate containing wastes.

    Science.gov (United States)

    Sun, Wenjie; Barlaz, Morton A

    2015-02-01

    A number of sulfate-containing wastes are disposed in municipal solid wastes (MSW) landfills including residues from coal, wood, and MSW combustion, and construction and demolition (C&D) waste. Under anaerobic conditions that dominate landfills, the sulfate can be reduced to hydrogen sulfide which is problematic for several reasons including its low odor threshold, toxicity, and corrosive nature. The overall objective of this study was to evaluate existing protocols for the quantification of total leachable sulfate from solid samples and to compare their effectiveness and efficiency with a new protocol described in this study. Methods compared include two existing acid extraction protocols commonly used in the U.S., a pH neutral protocol that requires multiple changes of the leaching solution, and a new acid extraction method. The new acid extraction method was shown to be simple and effective to measure the leaching potential of sulfate from a range of landfill disposed sulfate-containing wastes. However, the acid extraction methods do not distinguish between sulfate and other forms of sulfur and are thus most useful when sulfate is the only form of sulfur present. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Sulfates on Mars: A systematic Raman spectroscopic study of hydration states of magnesium sulfates

    Science.gov (United States)

    Wang, A.; Freeman, J.J.; Jolliff, B.L.; Chou, I.-Ming

    2006-01-01

    The martian orbital and landed surface missions, OMEGA on Mar Express and the two Mars Explorations Rovers, respectively, have yielded evidence pointing to the presence of magnesium sulfates on the martian surface. In situ identification of the hydration states of magnesium sulfates, as well as the hydration states of other Ca- and Fe- sulfates, will be crucial in future landed missions on Mars in order to advance our knowledge of the hydrologic history of Mars as well as the potential for hosting life on Mars. Raman spectroscopy is a technique well-suited for landed missions on the martian surface. In this paper, we report a systematic study of the Raman spectra of the hydrates of magnesium sulfate. Characteristic and distinct Raman spectral patterns were observed for each of the 11 distinct hydrates of magnesium sulfates, crystalline and non-crystalline. The unique Raman spectral features along with the general tendency of the shift of the position of the sulfate ??1 band towards higher wavenumbers with a decrease in the degree of hydration allow in situ identification of these hydrated magnesium sulfates from the raw Raman spectra of mixtures. Using these Raman spectral features, we have started the study of the stability field of hydrated magnesium sulfates and the pathways of their transformations at various temperature and relative humidity conditions. In particular we report on the Raman spectrum of an amorphous hydrate of magnesium sulfate (MgSO4??2H2O) that may have specific relevance for the martian surface. ?? 2006 Elsevier Inc. All rights reserved.

  15. Novel processes for anaerobic sulfate production from elemental sulfur by sulfate-reducing bacteria

    Science.gov (United States)

    Lovley, D.R.; Phillips, E.J.P.

    1994-01-01

    Sulfate reducers and related organisms which had previously been found to reduce Fe(III) with H2 or organic electron donors oxidized S0 to sulfate when Mn(IV) was provided as an electron acceptor. Organisms catalyzing this reaction in washed cell suspensions included Desulfovibrio desulfuricans, Desulfomicrobium baculatum. Desulfobacterium autotrophicum, Desulfuromonas acetoxidans, and Geobacter metallireducens. These organisms produced little or no sulfate from S0 with Fe(III) as a potential electron acceptor or in the absence of an electron acceptor. In detailed studies with Desulfovibrio desulfuricans, the stoichiometry of sulfate and Mn(II) production was consistent with the reaction S0 + 3 MnO2 + 4H+ ???SO42- + 3Mn(II) + 2H2O. None of the organisms evaluated could be grown with S0 as the sole electron donor and Mn(IV) as the electron acceptor. In contrast to the other sulfate reducers evaluated, Desulfobulbus propionicus produced sulfate from S0 in the absence of an electron acceptor and Fe(III) oxide stimulated sulfate production. Sulfide also accumulated in the absence of Mn(IV) or Fe(III). The stoichiometry of sulfate and sulfide production indicated that Desulfobulbus propionicus disproportionates S0 as follows: 4S0 + 4H2O???SO42- + 3HS- + 5 H+. Growth of Desulfobulbus propionicus with S0 as the electron donor and Fe(III) as a sulfide sink and/or electron acceptor was very slow. The S0 oxidation coupled to Mn(IV) reduction described here provides a potential explanation for the Mn(IV)-dependent sulfate production that previous studies have observed in anoxic marine sediments. Desulfobulbus propionicus is the first example of a pure culture known to disproportionate S0.

  16. Activation and transfer of sulfate in biological systems (1960); Activation biologique du sulfate et son transfert (1960)

    Energy Technology Data Exchange (ETDEWEB)

    Chapeville, F [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires

    1960-07-01

    It examines in this review the successive stages of active sulfate formation and its role in biological synthesis of sulfuric esters. The possible role of active sulfate as intermediary in sulfate reduction is also discussed. (author) [French] On examine dans cette etude les stades successifs de la mise en evidence du sulfate actif, son role dans la formation des esters sulfuriques de natures diverses, ainsi que sa participation eventuelle comme intermediaire au cours de la reduction du sulfate. On decrit aussi un procede de preparation du systeme biologique, generateur du sulfate actif et une methode de synthese chimique. (auteur)

  17. Adapalene gel 0.1% for topical treatment of acne vulgaris in African patients.

    Science.gov (United States)

    Jacyk, W K; Mpofu, P

    2001-10-01

    Acne vulgaris is a common dermatologic disease in African patients, as well as in Caucasians. Our report evaluates the safety and efficacy of adapalene gel 0.1% in African patients with acne vulgaris. We used a 12-week, 2-center, open-label, noncomparative study of adapalene gel 0.1% in 65 African patients with acne vulgaris to assess the drug's effect on hyperpigmented lesions in people with dark skin. The study demonstrated that the progressive and significant improvements in lesion counts and global acne grades produced by adapalene in African patients were paralleled by significant improvements in the degree of hyperpigmentation of acne lesions. During treatment with adapalene, less than 5% of patients reported moderate or severe skin irritation at any time during the study, and the incidence of skin oiliness decreased markedly. We conclude that adapalene gel 0.1% was well tolerated and highly effective in African patients with acne vulgaris and was found to reduce hyperpigmentation.

  18. Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus).

    Science.gov (United States)

    Borji, Hassan; Moosavi, Zahra; Ahmadi, Fatemeh

    2014-09-01

    Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors' knowledge, a complete cranial mesenteric arterial obstruction due to verminous arteritis has rarely been described in horses and donkeys. Based on recent reports of fatal arterial obstruction due to S. vulgaris infection in donkeys, it may be evident to consider acute colic caused by this pathogenic parasite a re-emerging disease in donkeys and horses.

  19. Cranial Mesenteric Arterial Obstruction Due To Strongylus vulgaris Larvae in a Donkey (Equus asinus.

    Directory of Open Access Journals (Sweden)

    Hassan Borji

    2014-09-01

    Full Text Available Arteritis due to Strongylus vulgaris is a well-known cause of colic in horses and donkeys. The current report describes a fatal incidence of arterial obstruction in cranial mesenteric artery caused by S. vulgaris infection in an adult donkey in which anthelmintic treatment was not regularly administered. Necropsy findings of the abdominal cavity revealed a complete cranial mesenteric arterial obstruction due to larvae of S. vulgaris, causing severe colic. To the authors' knowledge, a complete cranial mesenteric arterial obstruction due to verminous arteritis has rarely been described in horses and donkeys. Based on recent reports of fatal arterial obstruction due to S. vulgaris infection in donkeys, it may be evident to consider acute colic caused by this pathogenic parasite a re-emerging disease in donkeys and horses.

  20. Development of 12 Chloroplast Microsatellite Markers in Vigna unguiculata (Fabaceae and Amplification in Phaseolus vulgaris

    Directory of Open Access Journals (Sweden)

    Lei Pan

    2014-03-01

    Full Text Available Premise of the study: Vigna unguiculata is an economically important legume, and the complexity of its variability and evolution needs to be further understood. Based on publicly available databases, we developed chloroplast microsatellite primers to investigate genetic diversity within V. unguiculata and its related species Phaseolus vulgaris. Methods and Results: Twelve polymorphic chloroplast microsatellite markers were developed and characterized in 62 V. unguiculata individuals. The number of alleles per locus varied between two and four, the unbiased haploid diversity per locus ranged from 0.123 to 0.497, and the polymorphism information content varied from 0.114 to 0.369. In cross-species amplifications, nine of these markers showed polymorphism in 29 P. vulgaris individuals. Conclusions: The newly developed chloroplast microsatellite markers exhibit variation in V. unguiculata as well as their transferability in P. vulgaris. These markers can be used to investigate genetic diversity and evolution in V. unguiculata and P. vulgaris.

  1. Cheilitis in acne vulgaris patients with no previous use of systemic retinoid products.

    Science.gov (United States)

    Balighi, Kamran; Daneshpazhooh, Maryam; Lajevardi, Vahideh; Talebi, Shahin; Azizpour, Arghavan

    2017-08-01

    Isotretinoin is commonly used in the treatment of acne vulgaris. While one of the more common side-effects is cheilitis, we have observed an increased incidence of cheilitis prior to the commencement of systemic isotretinoin. The aim of this study was to assess the prevalence of cheilitis among acne vulgaris patients. A non-interventional cross-sectional study of patients with acne vulgaris. Patients with previous use of systemic retinoids were excluded. The patients were examined for signs and symptoms of cheilitis. Of a total of 400 patients, 134 (34%) had evidence of cheilitis at initial presentation. Two-thirds (63%) were female (P acne excorie, compared with only 8% of patients with no signs of cheilitis. Our findings suggest that cheilitis is quite common among acne vulgaris patients even before treatment with isotretinoin. © 2016 The Australasian College of Dermatologists.

  2. Kinetic studies on the inhibition of Proteus vulgaris beta-lactamase by imipenem.

    OpenAIRE

    Hashizume, T; Yamaguchi, A; Hirata, T; Sawai, T

    1984-01-01

    Imipenem was found to inhibit Proteus vulgaris beta-lactamase in a progressive manner. Kinetic experiments confirmed that the inactivated enzyme was not completely recovered after intact imipenem had been exhausted.

  3. Crop physiological analysis of seed quality variation in common bean (Phaseolus vulgaris L.)

    NARCIS (Netherlands)

    Muasya, R.M.

    2001-01-01

    Keywords : Physiological maturity, harvest maturity, earliness, common bean, Phaseolus vulgaris L., morphological markers, variation, moisture content, dry weight, viability, vigour, electrical conductivity, tetrazolium, seed lot, seed

  4. [Effects of different trophic modes on growth characteristics, metabolism and cellular components of Chlorella vulgaris].

    Science.gov (United States)

    Kong, Weibao; Wang, Yang; Yang, Hong; Xi, Yuqin; Han, Rui; Niu, Shiquan

    2015-03-04

    We studied the effects of trophic modes related to glucose and light (photoautotrophy, mixotrophy and heterotrophy) on growth, cellular components and carbon metabolic pathway of Chlorella vulgaris. The parameters about growth of algal cells were investigated by using spectroscopy and chromatography techniques. When trophic mode changed from photoautotrophy to mixotrophy and to heterotrophy successively, the concentrations of soluble sugar, lipid and saturated C16/C18 fatty acids in C. vulgaris increased, whereas the concentrations of unsaturated C16, C18 fatty acids, proteins, photosynthetic pigments and 18 relative amino acids decreased. Light and glucose affect the growth, metabolism and the biochemical components biosynthesis of C. vulgaris. Addition of glucose can promote algal biomass accumulation, stimulate the synthesis of carbonaceous components, but inhibit nitrogenous components. Under illumination cultivation, concentration and consumption level of glucose decided the main trophic modes of C. vulgaris. Mixotrophic and heterotrophic cultivation could promote the growth of algal cells.

  5. Bioelectrogenesis with microbial fuel cells (MFCs using the microalga Chlorella vulgaris and bacterial communities

    Directory of Open Access Journals (Sweden)

    Ronald Huarachi-Olivera

    2018-01-01

    Conclusions: These findings suggest that MFCs with C. vulgaris and bacterial community have a simultaneous efficiency in the production of bioelectricity and bioremediation processes, becoming an important source of bioenergy in the future.

  6. Comparing Nutrient Removal from Membrane Filtered and Unfiltered Domestic Wastewater Using Chlorella vulgaris

    Science.gov (United States)

    Mayhead, Elyssia; Llewellyn, Carole A.; Fuentes-Grünewald, Claudio

    2018-01-01

    The nutrient removal efficiency of Chlorella vulgaris cultivated in domestic wastewater was investigated, along with the potential to use membrane filtration as a pre-treatment tool during the wastewater treatment process. Chlorella vulgaris was batch cultivated for 12 days in a bubble column system with two different wastewater treatments. Maximum uptake of 94.18% ammonium (NH4-N) and 97.69% ortho-phosphate (PO4-P) occurred in 0.2 μm membrane filtered primary wastewater. Membrane filtration enhanced the nutrient uptake performance of C. vulgaris by removing bacteria, protozoa, colloidal particles and suspended solids, thereby improving light availability for photosynthesis. The results of this study suggest that growing C. vulgaris in nutrient rich membrane filtered wastewater provides an option for domestic wastewater treatment to improve the quality of the final effluent. PMID:29351200

  7. Performance of conventional pcr for screening for strongylus vulgaris on horse farms

    OpenAIRE

    Nielsen, Marianne K.; Wøhlk, Chamilla B.M.; Petersen, Stig L.; Nielsen, Martin Krarup

    2010-01-01

      Strongyle parasites are ubiquitous in grazing horses. Of these, the bloodworm Strongylus vulgaris is regarded most pathogenic. Increasing levels of anthelmintic resistance in strongyle parasites has lead to recommendations of decreased treatment intensities, and there is now a pronounced need for reliable tools for detection of parasite burdens in general and S. vulgaris in particular. The only method currently available is the larval culture, which is laborious and time-consuming, so veter...

  8. Potential Of Microalgae Chlorella vulgaris As Bioremediation Agents of Heavy Metal Pb (Lead On Culture Media

    Directory of Open Access Journals (Sweden)

    Rita Sulistya Dewi Endah

    2018-01-01

    Full Text Available The purpose of this study to determine the ability of Chlorella vulgaris in absorbing Pb (lead and the effect of the variation of Pb metal concentration on the growth of Chlorella vulgaris.This study using an experimental study with complete random design with 4 treatments, namely control (without the addition of metal, Pb1 (addition of metal 1 mg / l, Pb3 (3 mg / l and Pb5 (5 mg / l, respectively 3 replications. Exposure Pb ion in Chlorella vulgaris for 7 days. Analysis of the metal content of Pb concentration performed on culture media after exposure it at 3 hours after dispersion Chlorella vulgaris and on day 7 of culture using the AAS method. Do also counting the growth of cells each day. The results of the analysis of the average metal content of Pb in the culture medium at the end of the study was the control (0.1980, Pb1 (0.1453, Pb3 (0.4144 and Pb5 (0.5305. While the average growth of Chlorella vulgaris at the end of the study were control (630.1116 x 104, Pb1 (829.0012 x 104, Pb3 (1069.9446 x 104 and Pb 5 (808.94450 x 104. The results of the analysis of the content of Pb in the F test shown that the difference in concentration of water Pb given real influence on the ability of Chlorella vulgaris in absorbing Pb and growth. The conclusion of this study was Chlorella vulgaris has the ability to absorb metals in the waters, and the provision of various concentrations of Pb can affect the growth of Chlorella vulgaris.

  9. The genome sequence of Barbarea vulgaris facilitates the study of ecological biochemistry

    DEFF Research Database (Denmark)

    Byrne, Stephen L.; Erthmann, Pernille Østerbye; Agerbirk, Niels

    2017-01-01

    The genus Barbarea has emerged as a model for evolution and ecology of plant defense compounds, due to its unusual glucosinolate profile and production of saponins, unique to the Brassicaceae. One species, B. vulgaris, includes two ‘types’, G-type and P-type that differ in trichome density, and t...... deter larvae to the extent that they die. The B. vulgaris genome will promote the study of mechanisms in ecological biochemistry to benefit crop resistance breeding....

  10. Influence of beetroot (Beta vulgaris var. cruenta) on mice leukocytes increase

    OpenAIRE

    Amaro, Jony

    2014-01-01

    Background: Beetroot is a flavonoid-containing Mediterranean plant used for food and medicinal purposes. Objectives: To determine the influence of Beta vulgaris var. cruenta extract consumption in increasing albino mice leukocytes. Design: Experimental study. Setting: School N° 1182 bioterium. Biologic material: Twenty male Balb/c albino mice weighing 24 g average. Interventions: Two groups of ten mice each were formed; the experimental group received Beta vulgaris var. cruenta extract at 250...

  11. Identification of an Alternative to Proteus vulgaris as a Laboratory Standard for Hydrogen Sulfide Production

    Directory of Open Access Journals (Sweden)

    Nar'Asha Randall

    2017-05-01

    Full Text Available This project involved the evaluation of a biosafety level 1 alternative to Proteus vulgaris as a positive control for the production of hydrogen sulfide. We determined that Citrobacter freundii could serve as an excellent substitute for P. vulgaris, and that lead acetate strips used in conjunction with triple sugar iron media allows for consistent results following evaluation after up to one week.

  12. Potential Of Microalgae Chlorella vulgaris As Bioremediation Agents of Heavy Metal Pb (Lead) On Culture Media

    Science.gov (United States)

    Dewi, Endah Rita Sulistya; Nuravivah, Riza

    2018-02-01

    The purpose of this study to determine the ability of Chlorella vulgaris in absorbing Pb (lead) and the effect of the variation of Pb metal concentration on the growth of Chlorella vulgaris.This study using an experimental study with complete random design with 4 treatments, namely control (without the addition of metal), Pb1 (addition of metal 1 mg / l), Pb3 (3 mg / l) and Pb5 (5 mg / l), respectively 3 replications. Exposure Pb ion in Chlorella vulgaris for 7 days. Analysis of the metal content of Pb concentration performed on culture media after exposure it at 3 hours after dispersion Chlorella vulgaris and on day 7 of culture using the AAS method. Do also counting the growth of cells each day. The results of the analysis of the average metal content of Pb in the culture medium at the end of the study was the control (0.1980), Pb1 (0.1453), Pb3 (0.4144) and Pb5 (0.5305). While the average growth of Chlorella vulgaris at the end of the study were control (630.1116 x 104), Pb1 (829.0012 x 104), Pb3 (1069.9446 x 104) and Pb 5 (808.94450 x 104). The results of the analysis of the content of Pb in the F test shown that the difference in concentration of water Pb given real influence on the ability of Chlorella vulgaris in absorbing Pb and growth. The conclusion of this study was Chlorella vulgaris has the ability to absorb metals in the waters, and the provision of various concentrations of Pb can affect the growth of Chlorella vulgaris.

  13. Sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS ...

    African Journals Online (AJOL)

    Four strains of eri, Samia cynthia ricini Lepidoptera: Saturniidae that can be identified morphologically and maintained at North East Institute of Science and Technology, Jorhat were characterized based on their protein profile by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and DNA by random ...

  14. Determination of boron spectrophotometry in thorium sulfate

    International Nuclear Information System (INIS)

    Federgrun, L.; Abrao, A.

    1976-01-01

    A procedure for the determination of microquantities of boron in nuclear grade thorium sulfate is described. The method is based on the extraction of BF - 4 ion associated to monomethylthionine (MMT) in 1,2 - dichloroethane. The extraction of the colored BF - 4 -MMT complex does not allow the presence of sulfuric and phosphoric acids; other anions interfere seriously. This fact makes the dissolution of the thorium sulfate impracticable, since it is insoluble in both acids. On the other hand, the quantitative separation of thorium is mandatory, to avoid the precipitation of ThF 4 . To overcome this difficulty, the thorium sulfate is dissolved using a strong cationic ion exchanger, Th 4+ being totally retained into the resin. Boron is then analysed in the effluent. The procedure allows the determination of 0.2 to 10.0 microgramas of B, with a maximum error of 10%. Thorium sulfate samples with contents of 0.2 to 2.0μg B/gTh have being analysed [pt

  15. Sulfate reducing potential in an estuarine beach

    Digital Repository Service at National Institute of Oceanography (India)

    LokaBharathi, P.A.; Chandramohan, D.

    Sulfate reducing bacteria (SRB) and their activity (SRA) together with total anaerobic and aerobic bacterial flora were estimated during July 1982-April 1983 and July-August 1984 from 1, 3 and 5 cm depths using core samples. The average number (no...

  16. Sulfate-reducing bacteria in anaerobic bioreactors

    NARCIS (Netherlands)

    Oude Elferink, S.J.W.H.

    1998-01-01

    The treatment of industrial wastewaters containing high amounts of easily degradable organic compounds in anaerobic bioreactors is a well-established process. Similarly, wastewaters which in addition to organic compounds also contain sulfate can be treated in this way. For a long time, the

  17. Mechanisms and Effectivity of Sulfate Reducing Bioreactors ...

    Science.gov (United States)

    Mining-influenced water (MIW) is the main environmental challenges associated with the mining industry. Passive MIW remediation can be achieved through microbial activity in sulfate-reducing bioreactors (SRBRs), but their actual removal rates depend on different factors, one of which is the substrate composition. Chitinous materials have demonstrated high metal removal rates, particularly for the two recalcitrant MIW contaminants Zn and Mn, but their removal mechanisms need further study. We studied Cd, Fe, Zn, and Mn removal in bioactive and abiotic SRBRs to elucidate the metal removal mechanisms and the differences in metal and sulfate removal rates using a chitinous material as substrate. We found that sulfate-reducing bacteria are effective in increasing metal and sulfate removal rates and duration of operation in SRBRs, and that the main mechanism involved was metal precipitation as sulfides. The solid residues provided evidence of the presence of sulfides in the bioactive column, more specifically ZnS, according to XPS analysis. The feasibility of passive treatments with a chitinous substrate could be an important option for MIW remediation. Mining influenced water (MIW) remediation is still one of the top priorities for the agency because it addresses the most important environmental problem associated with the mining industry and that affects thousands of communities in the U.S. and worldwide. In this paper, the MIW bioremediation mechanisms are studied

  18. Controlling sulfate attack in Mississippi Department of Transportation structures.

    Science.gov (United States)

    2010-08-01

    At some construction sites in Mississippi, deterioration of concrete in contact with the surrounding soil could be related to the high sulfate content of the adjacent soils. Studies dating to 1966 have documented sulfate attack associated with specif...

  19. Transmission spectra study of sulfate substituted potassium dihydrogen phosphate

    KAUST Repository

    LI, LIANG; Zhang, Jianqin; Sun, Xun; Zhang, Qiang; Zhao, Xian; Zhang, Xixiang

    2013-01-01

    Potassium dihydrogen phosphate (KDP) crystals with different amounts of sulfate concentration were grown and the transmittance spectrum was studied. A crystal with high sulfate replacement density exhibits heavy absorption property

  20. Controlling sulfate attack in Mississippi Department of Transportation structures

    Science.gov (United States)

    2010-08-01

    At some construction sites in Mississippi, deterioration of concrete in contact with the surrounding soil could be related to the high sulfate content of the adjacent soils. Studies dating to 1966 have documented sulfate attack associated with sp...

  1. Bone sialoprotein II synthesized by cultured osteoblasts contains tyrosine sulfate

    International Nuclear Information System (INIS)

    Ecarot-Charrier, B.; Bouchard, F.; Delloye, C.

    1989-01-01

    Isolated mouse osteoblasts that retain their osteogenic activity in culture were incubated with [35S] sulfate. Two radiolabeled proteins, in addition to proteoglycans, were extracted from the calcified matrix of osteoblast cultures. All the sulfate label in both proteins was in the form of tyrosine sulfate as assessed by amino acid analysis and thin layer chromatography following alkaline hydrolysis. The elution behavior on DEAE-Sephacel of the major sulfated protein and the apparent Mr on sodium dodecyl sulfate gels were characteristic of bone sialoprotein II extracted from rat. This protein was shown to cross-react with an antiserum raised against bovine bone sialoprotein II, indicating that bone sialoprotein II synthesized by cultured mouse osteoblasts is a tyrosine-sulfated protein. The minor sulfated protein was tentatively identified as bone sialoprotein I or osteopontin based on its elution properties on DEAE-Sephacel and anomalous behavior on sodium dodecyl sulfate gels similar to those reported for rat bone sialoprotein I

  2. Galactose 6-sulfate sulfatase activity in Morquio syndrome

    International Nuclear Information System (INIS)

    Yutaka, T.; Okada, S.; Kato, T.; Inui, K.; Yabuuhi, H.

    1982-01-01

    The authors have prepared a new substrate, o-β-D-sulfo-galactosyl-(1-4)-β-D-6-sulfo-2-acetamido-2-deoxyglucosyl-(1-4)-D-[1- 3 H]galactitol, from shark cartilage keratan sulfate, for the assay of galactose 6-sulfate sulfatase activity. Using this substrate, they found there was a striking deficiency of galactose 6-sulfate sulfatase activity, in addition to the known deficiency of N-acetylgalactosamine 6-sulfate sulfatase, in the cultured skin fibroblasts of patients with Morquio syndrome. Their results could be explained by the hypothesis that accumulation of keratan sulfate and chondroitin 6-sulfate in Morquio syndrome is due to a deficiency of galactose 6-sulfate sulfatase and N-acetylgalactosamine 6-sulfate sulfatase activity, which are necessary for the degradation of these two mucopolysaccharides. (Auth.)

  3. Galactose 6-sulfate sulfatase activity in Morquio syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Yutaka, T.; Okada, S.; Kato, T.; Inui, K.; Yabuuhi, H. (Osaka Univ. (Japan). Faculty of Medicine)

    1982-07-01

    The authors have prepared a new substrate, o-..beta..-D-sulfo-galactosyl-(1-4)-..beta..-D-6-sulfo-2-acetamido-2-deoxyglucosyl-(1-4)-D-(1-/sup 3/H)galactitol, from shark cartilage keratan sulfate, for the assay of galactose 6-sulfate sulfatase activity. Using this substrate, they found there was a striking deficiency of galactose 6-sulfate sulfatase activity, in addition to the known deficiency of N-acetylgalactosamine 6-sulfate sulfatase, in the cultured skin fibroblasts of patients with Morquio syndrome. Their results could be explained by the hypothesis that accumulation of keratan sulfate and chondroitin 6-sulfate in Morquio syndrome is due to a deficiency of galactose 6-sulfate sulfatase and N-acetylgalactosamine 6-sulfate sulfatase activity, which are necessary for the degradation of these two mucopolysaccharides.

  4. PRODUCTIVITY OF MICROALGAE CHLORELLA VULGARIS IN LABORATORY CONDITION

    Directory of Open Access Journals (Sweden)

    Agnieszka Patyna

    2017-06-01

    Full Text Available Algae biomass is increasingly regarded as a potential resource that could be used to produce biofuels, electricity and heat. Algae contain a lot of nutrients, so they can be used as food for humans and livestock. Because of their valuable composition (many nutrients they are used as supplements of balanced diet, in turn taking into account their biosorption abbility they are used to detoxification of human body. Algae cultivation does not demand large areas of land to expose cells to sunlight, so their production rate is higher than vascular plants. Moreover algae cultivation lets to achieve high biomass concentration. Important cultivation factors are: illumination (light intensity is an important factor because it drives photosynthesis, CO2 supply, culture medium and mixing. The experimental research was conducted using Chlorella vulgaris BA 002 strain. The aim of this study was to determine the effectiveness of biomass growth in laboratory condition.

  5. Transfer of adult Strongylus vulgaris via stomach tube.

    Science.gov (United States)

    Hofing, G L; Bennett, D G

    1983-10-01

    Patent infections with Strongylus vulgaris were established in 6 of 8 helminth-free ponies given 41 to 101 adult worms via nasogastric tube. The parasites were removed from the cecum and ventral colon and transferred within 1 to 2 hours of the death of the donor horses. Eggs were found in the feces of the recipients in 2 or 3 days; egg counts reached maximum, 28 eggs per gram of feces, at 4 weeks after ponies were inoculated. In 6 ponies euthanatized 3 to 7 weeks after parasitic transfers were done, 28% of the inoculated worms were found alive at necropsy. A 7th pony was maintained as a donor for establishing infections for chemotherapy trials and, although never passing more than 6 eggs per gram of feces, shed infective larvae over a period of 2 years.

  6. Effect of diethylcarbamazine on Strongylus vulgaris infection in ponies.

    Science.gov (United States)

    Hofing, G L; Bennett, D G

    1982-02-01

    Shetland ponies (n = 4) were given diethylcarbamazine orally at a dose level of 22 mg/kg/day for 1 week before they were inoculated with 800 third-stage larvae of Strongylus vulgaris. Treatment was continued for 86 (1 pony) or 200 days (3 ponies) after the inoculation. As compared with the changes seen in a similarly inoculated group of ponies (group 2) which were not treated, diethylcarbamazine did not prevent the clinical or pathologic changes due to the migrating larvae. Fewer adult parasites were recovered at necropsy from treated ponies than from nontreated (group 2) ponies, even when treatment was discontinued 86 days after inoculation. Treatment appeared to have a detrimental effect on 4th-stage larvae either in the arteries or their intestinal wall, but not until after arterial lesions resulted.

  7. Nootropic Effects of Filipendula Vulgaris Moench Water Extract Fractions.

    Science.gov (United States)

    Shilova, I V; Suslov, N I; Amelchenko, V P

    2015-07-01

    Nootropic activity of water extract fractions from aerial parts of Filipendula vulgaris Moench was demonstrated on the models of hermetic volume hypoxia, conditioned passive avoidance response, open field test, and forced swimming with a load. The fractions stimulated hypoxic resistance, normalized orientation and exploratory behavior, improved conditioned response reproduction during testing after hypoxic injury, and increased exercise tolerance. Fractionation of the extract led to dissociation of the effect components, which suggests that individual constituents have specific characteristics. Ethylacetate fraction exhibited most pronounced nootropic activity and was superior to plant extract by some characteristics. The detected effects seemed to be caused by modulation of the hippocampus activity the under the effects of phenol and triterpene compounds.

  8. Anisotropic transport of microalgae Chlorella vulgaris in microfluidic channel

    International Nuclear Information System (INIS)

    Ishak, Nur Izzati; Muniandy, S V; Periasamy, Vengadesh; Ng, Fong-Lee; Phang, Siew-Moi

    2017-01-01

    In this work, we study the regional dependence of transport behavior of microalgae Chlorella vulgaris inside microfluidic channel on applied fluid flow rate. The microalgae are treated as spherical naturally buoyant particles. Deviation from the normal diffusion or Brownian transport is characterized based on the scaling behavior of the mean square displacement (MSD) of the particle trajectories by resolving the displacements in the streamwise (flow) and perpendicular directions. The channel is divided into three different flow regions, namely center region of the channel and two near-wall boundaries and the particle motions are analyzed at different flow rates. We use the scaled Brownian motion to model the transitional characteristics in the scaling behavior of the MSDs. We find that there exist anisotropic anomalous transports in all the three flow regions with mixed sub-diffusive, normal and super-diffusive behavior in both longitudinal and transverse directions. (paper)

  9. Four cases of recalcitrant pemphigus vulgaris salvaged with rituximab

    Directory of Open Access Journals (Sweden)

    Samyak Ganjre

    2017-01-01

    Full Text Available Although the long-term use of immunosuppressives – supplemented with more aggressive treatments such as immunoadsorption, intravenous immunoglobulins, or plasmapheresis in recalcitrant cases has dramatically improved the prognosis of pemphigus vulgaris, opportunistic infections secondary to immunosuppression continue to cause significant mortality. We report four cases– three old ones, who had accumulated significant morbidities over their disease duration ranging from 5 to 10 years, and the fourth, a teenage female intolerant to corticosteroids and idiosyncratic to methotrexate– who achieved complete remission on administration of rituximab by the lymphoma protocol. One of the old cases who had recalcitrant mucositis experienced its complete subsidence without any adjuvant whatsoever. All continue to remain asymptomatic for 11–20 months. None had infusion reactions or any delayed side effects.

  10. Cannibalistic behavior of octopus (Octopus vulgaris) in the wild.

    Science.gov (United States)

    Hernández-Urcera, Jorge; Garci, Manuel E; Roura, Alvaro; González, Angel F; Cabanellas-Reboredo, Miguel; Morales-Nin, Beatriz; Guerra, Angel

    2014-11-01

    The first description of cannibalism in wild adult Octopus vulgaris is presented from 3 observations made in the Ría de Vigo (NW Spain), which were filmed by scuba divers. These records document common traits in cannibalistic behavior: (a) it was intercohort cannibalism; (b) attacks were made by both males and females; (c) in 2 of the records, the prey were transported to the den, which was covered with stones of different sizes; (d) the predator started to eat the tip of the arms of its prey; (e) predation on conspecifics occurred even if there were other abundant prey available (i.e., mussels); and (f) the prey/predator weight ratio in the 3 cases ranged from 20% to 25% body weight. The relationships between this behavior and sex, defense of territory, energy balance, food shortage, competition and predation, as well as how the attacker kills its victim are discussed. (PsycINFO Database Record (c) 2014 APA, all rights reserved).

  11. Thermogravimetric analysis of the gasification of microalgae Chlorella vulgaris.

    Science.gov (United States)

    Figueira, Camila Emilia; Moreira, Paulo Firmino; Giudici, Reinaldo

    2015-12-01

    The gasification of microalgae Chlorella vulgaris under an atmosphere of argon and water vapor was investigated by thermogravimetric analysis. The data were interpreted by using conventional isoconversional methods and also by the independent parallel reaction (IPR) model, in which the degradation is considered to happen individually to each pseudo-component of biomass (lipid, carbohydrate and protein). The IPR model allows obtaining the kinetic parameters of the degradation reaction of each component. Three main stages were observed during the gasification process and the differential thermogravimetric curve was satisfactorily fitted by the IPR model considering three pseudocomponents. The comparison of the activation energy values obtained by the methods and those found in the literature for other microalgae was satisfactory. Quantification of reaction products was performed using online gas chromatography. The major products detected were H2, CO and CH4, indicating the potential for producing fuel gas and syngas from microalgae. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Oral Lesions: The Clue to Diagnosis of Pemphigus Vulgaris

    Directory of Open Access Journals (Sweden)

    Diana Kuriachan

    2015-01-01

    Full Text Available Pemphigus is a group of potentially fatal dermatoses with both cutaneous and oral manifestations. Characterized by the appearance of vesicle or bullae, their manifestations in the oral cavity often precede those on the skin by many months or may remain as the only symptoms of the disease. It is therefore important that the oral manifestations of the disease are recognized on time, to make a proper diagnosis and initiate timely treatment. Here we present a case of Pemphigus Vulgaris (PV that presented with oral lesions at multiple sites including tongue, to highlight the importance of timely recognition of the oral lesions during routine dental practice for the diagnosis and management of this disease.

  13. Study of artemisinin and sugar accumulation in Artemisia vulgaris and Artemisia dracunculus "hairy" root cultures.

    Science.gov (United States)

    Drobot, Kateryna O; Matvieieva, Nadiia A; Ostapchuk, Andriy M; Kharkhota, Maxim A; Duplij, Volodymyr P

    2017-09-14

    We studied the effect of genetic transformation on biologically active compound (artemisinin and its co-products (ART) as well as sugars) accumulation in Artemisia vulgaris and Artemisia dracunculus "hairy" root cultures. Glucose, fructose, sucrose, and mannitol were accumulated in A. vulgaris and A. dracunculus "hairy" root lines. Genetic transformation has led in some cases to the sugar content increasing or appearing of nonrelevant for the control plant carbohydrates. Sucrose content was 1.6 times higher in A. vulgaris "hairy" root lines. Fructose content was found to be 3.4 times higher in A. dracunculus "hairy" root cultures than in the control roots. The accumulation of mannitol was a special feature of the leaves of A. vulgaris and A. dracunculus control roots. A. vulgaris "hairy" root lines differed also in ART accumulation level. The increase of ART content up to 1.02 mg/g DW in comparison with the nontransformed roots (up to 0.687 mg/g DW) was observed. Thus, Agrobacterium rhizogenes-mediated genetic transformation can be used for obtaining of A. vulgaris and A. dracunculus "hairy" root culture produced ART and sugars in a higher amount than mother plants.

  14. Ghrelin in the pilosebaceous unit: alteration of ghrelin in patients with acne vulgaris.

    Science.gov (United States)

    Cicek, Demet; Demir, Betul; Erder, Ilker; Kuloglu, Tuncay; Ucer, Ozlem; Aydin, Suleyman; Ucak, Haydar; Dertlioglu, Selma; Kalayci, Mehmet

    2015-01-01

    Ghrelin in the pilosebaceous tissues of human skin and ghrelin levels in patients with acne vulgaris have not yet been investigated. The purpose of this study was to screen ghrelin immunoreactivity by immunohistochemistry in human pilosebaceous tissues of human skin and also to determine the quantities of ghrelin in the serum of the patients with acne vulgaris. 30 patients presenting with acne vulgaris and 30 control subjects participated in this study. Ghrelin levels were determined by enzyme linked immunosorbent assay (ELISA). Human hair follicles and sebaceous glands were immunohistochemically examined. Immunohistochemistry results showed that there is a strong ghrelin immunoreactivity in the hair follicles and sebaceous glands in sections of human skin. The mean serum ghrelin levels (27.58 ・} 15.44 pg/mL) in patients with acne vulgaris was significantly lower than those of controls (35.62・}20.46 pg/mL). Ghrelin produced in hair follicles and sebaceous glands of the skin might participate in the pathogenesis of acne vulgaris and also acne vulgaris in humans might be associated with decreased serum ghrelin.

  15. Chlorella vulgaris vs cyanobacterial biomasses: Comparison in terms of biomass productivity and biogas yield

    International Nuclear Information System (INIS)

    Mendez, Lara; Mahdy, Ahmed; Ballesteros, Mercedes; González-Fernández, Cristina

    2015-01-01

    Highlights: • Cyanobacteria and C. vulgaris were compared in terms of growth and methane production. • Biomasses were subjected to anaerobic digestion without applying any disruption method. • Cyanobacteria showed an increased methane yield in comparison with C. vulgaris. - Abstract: The aim of the present study was to compare cyanobacteria strains (Aphanizomenon ovalisporum, Anabaena planctonica, Borzia trilocularis and Synechocystis sp.) and microalgae (Chlorella vulgaris) in terms of growth rate, biochemical profile and methane production. Cyanobacteria growth rate ranged 0.5–0.6 day −1 for A. planctonica, A. ovalisporum and Synecochystis sp. and 0.4 day −1 for B. tricularis. Opposite, C. vulgaris maximum growth rate was double (1.2 day −1 ) than that of cyanobacteria. Regarding the methane yield, microalgae C. vulgaris averaged 120 mL CH 4 g COD in −1 due to the presence of a strong cell wall. On the other hand, anaerobic digestion of cyanobacteria supported higher methane yields. B. trilocularis and A. planctonica presented 1.42-fold higher methane yield than microalgae while this value was raised to approximately 1.85-fold for A. ovalisporum and Synechochystis sp. In the biogas production context, this study showed that the low growth rates of cyanobacteria can be overcome by their increased anaerobic digestibility when compared to their microalgae counterpartners, such is the case of C. vulgaris

  16. Light/laser therapy in the treatment of acne vulgaris.

    Science.gov (United States)

    Nouri, Keyvan; Villafradez-Diaz, L Magaly

    2005-12-01

    Acne vulgaris is one of the most prevalent skin diseases known. As common as this condition is, the social and psychological consequences are limitless. Although current treatments are available and include topical or oral antibiotics, it is crucial to develop a less risky and more effective therapy such as light/laser therapy. This article focuses specifically on the benefits of the light/laser treatment on acne vulgaris. Porphyrins accumulated in the bacteria, Propionibacterium acnes, one of the etiologic factors involved in the pathogenesis, allows phototherapy to be a successful modality. They have specific absorption peaks at which lasers have optimal effects. The longer the wavelength of the light is, the deeper its penetration and thus the greater its damage to the sebaceous glands. Although blue light is best for the activation of porphyrins, red light is best for deeper penetration and an anti-inflammatory effect. Ultraviolet (UV) light, although it may have initial an anti-inflammatory effects, has been proven to be potentially carcinogenic and have adverse effects such as aging (by UV-A) and burning (by UV-B). Previous studies indicate successful long-term intervention and selective damage of the sebaceous glands by using a diode laser with indocyanine green (ICG) dye. Mid-infrared lasers have been found to decrease lesion counts while also reducing the oiliness of skin and the scarring process. Nonablative laser treatment of acne scars using the Er:YAG laser with a short-pulsed mode has been successful in reducing the appearance of scars by stimulating neocollagenesis. The light/laser therapy has started to be explored with promising results in highly selected patients that require further investigation in greater populations and well-designed protocols.

  17. Isolation of a sulfate reducing bacterium and its application in sulfate ...

    African Journals Online (AJOL)

    The results show that the effect of C. freundii in removing sulfate was best when the temperature was 32°C, pH was 7.0, COD/SO42- was 5.0 and the initial SO42- concentration was 1500 mg/L. Also, the SRB was inoculated onto an up-flow anaerobic sludge bed (UASB) to remove sulfate in actual tannery wastewater.

  18. Comparison of magnesium sulfate and sodium sulfate for removal of water from pesticide extracts of foods.

    Science.gov (United States)

    Schenck, Frank J; Callery, Patrick; Gannett, Peter M; Daft, Jonathan R; Lehotay, Steven J

    2002-01-01

    Water-miscible solvents, such as acetone and acetonitrile, effectively extract both polar and nonpolar pesticide residues from nonfatty foods. The addition of sodium chloride to the resulting acetonitrile-water or acetone-water extract (salting out) results in the separation of the water from the organic solvent. However, the organic solvent layer (pesticide extract) still contains some residual water, which can adversely affect separation procedures that follow, such as solid-phase extraction and/or gas chromatography. Drying agents, such as sodium sulfate or magnesium sulfate, are used to remove the water from the organic extracts. In the present study, we used nuclear magnetic resonance spectroscopy to study the composition of the phases resulting from salting out and to compare the effectiveness of sodium sulfate and magnesium sulfate as drying agents. The study showed that considerable amounts of water remained in the organic phase after phase separation. Sodium sulfate was a relatively ineffective drying agent, removing little or no residual water from the organic solvent. Magnesium sulfate proved to be a much more effective drying agent.

  19. In Vitro Inhibitory Effect of Berberis vulgaris (Berberidaceae) and Its Main Component, Berberine against Different Leishmania Species.

    Science.gov (United States)

    Mahmoudvand, Hossein; Sharififar, Fariba; Sharifi, Iraj; Ezatpour, Behrouz; Fasihi Harandi, Majid; Makki, Mahsa Sadat; Zia-Ali, Naser; Jahanbakhsh, Sareh

    2014-03-01

    Leishmaniasis has been identified as a major public health problem in tropical and sub-tropical countries. The present study was aimed to investigate antileishmanial effects of various extracts of Berberis vulgaris also its active compoenent, berberine against Leishmania tropica and L. infantum species on in vitro experiments. In this study in vitro antileishmanial activity of various extracts of B. vulgaris also its active compoenent, berberine against promastigote and amastigote stages of L. tropica and L. infantum was evaluated, using MTT assay and in a macrophage model, respectively. Furthermore, infectivity rate and cytotoxicity effects of B. vulgaris and berberine in murine macrophage cells were investigated. The findings of optical density (OD) and IC50 indicated that B. vulgaris particulary berberine significantly (P<0.05) inhibited the growth rate of promastigote stage of L.tropica and L.infantum in comparison to meglumine antimoniate (MA). In addition, B. vulgaris and berberine significantly (P<0.05) decreased the mean number of amastigotes in each macrophage as compared with positive control. In the evaluation of cytotoxicity effects, it could be observed that berberine as compared with B. vulgaris exhibited more cytotoxicity against murine macrophages. Results also showed that when parasites were pre-incubated with B. vulgaris their ability to infect murine macrophages was significantly decreased. B.vulgaris particularly berberine exhibited potent in vitro leishmanicidal effects against L. tropica and L.infantum. Further works are required to evaluate the antileishmanial effects of B.vulgaris on Leishmania species using clinical settings.

  20. Estudio de la fitohemaglutinina proveniente del frijol colorado (Phaseolus Vulgaris Study of phytohemagglutinin from red bean (Phaseolus vulgaris

    Directory of Open Access Journals (Sweden)

    Patricia Hernández Díaz

    1999-12-01

    Full Text Available Se obtuvieron preparaciones crudas de fitohemaglutinina (PHA a partir de frijol colorado (Phaseolus vulgaris por 2 métodos: extracción acuosa y extracción ácida. Por el método ácido se obtuvieron mejores resultados en cuanto a concentración de proteínas y pureza de la misma. Se empleó la cromatografía en hidroxiapatita para separar las isoformas que forman la PHA y se obtuvieron 5 fraccciones proteicas que se evaluaron funcionalmente junto con las preparaciones crudas, a través de sus propiedades eritroaglutinantes y leucoaglutinantes. A medida que se aumentó la fuerza iónica del medio se observó que las fracciones obtenidas presentaban una disminución relativa de la actividad leucoaglutinante, así como un incremento relativo de la actividad eritroaglutinante. Las preparaciones crudas y las fracciones se evaluaron electroforéticamente y se obtuvieron bandas muy similares a la de la PHA patrón utilizadaRaw preparations of phytohemagglutinin (PHA were obtained from red bean (Phaseolus vulgaris by 2 methods: aqueous extraction and acid extraction. Better results were obtained with the acid methods as regards the protein concentration and its purity. Hydroxyapatite chromatography was used to separate the isoforms forming the phytohemagglutinin. 5 protein fractions were obtained and functionally evaluated together with the raw preparations through their erythroagglutinating and leukoagglutinating properties. As the ionic force of the medium increased it was observed that the fractions obtained presented a relative decrease of the leukoagglutinating activity as well as a relative rise of the crythroagglutinating activity. The raw preparations and the fractions were electrophoretically evaluated and bands very similar to that of the PHA used as a pattern were obtained

  1. Acid Sulfate Alteration in Gusev Crater, Mars

    Science.gov (United States)

    Morris, R. V.; Ming, D. W.; Catalano, J. G.

    2016-01-01

    The Mars Exploration Rover (MER) Spirit landed on the Gusev Crater plains west of the Columbia Hills in January, 2004, during the Martian summer (sol 0; sol = 1 Martian day = 24 hr 40 min). Spirit explored the Columbia Hills of Gusev Crater in the vicinity of Home Plate at the onset on its second winter (sol approximately 900) until the onset of its fourth winter (sol approximately 2170). At that time, Spirit became mired in a deposit of fined-grained and sulfate-rich soil with dust-covered solar panels and unfavorable pointing of the solar arrays toward the sun. Spirit has not communicated with the Earth since sol 2210 (January, 2011). Like its twin rover Opportunity, which landed on the opposite side of Mars at Meridiani Planum, Spirit has an Alpha Particle X-Ray Spectrometer (APXS) instrument for chemical analyses and a Moessbauer spectrometer (MB) for measurement of iron redox state, mineralogical speciation, and quantitative distribution among oxidation (Fe(3+)/sigma Fe) and coordination (octahedral versus tetrahedral) states and mineralogical speciation (e.g., olivine, pyroxene, ilmenite, carbonate, and sulfate). The concentration of SO3 in Gusev rocks and soils varies from approximately 1 to approximately 34 wt%. Because the APXS instrument does not detect low atomic number elements (e.g., H and C), major-element oxide concentrations are normalized to sum to 100 wt%, i.e., contributions of H2O, CO2, NO2, etc. to the bulk composition care not considered. The majority of Gusev samples have approximately 6 plus or minus 5 wt% SO3, but there is a group of samples with high SO3 concentrations (approximately 30 wt%) and high total iron concentrations (approximately 20 wt%). There is also a group with low total Fe and SO3 concentrations that is also characterized by high SiO2 concentrations (greater than 70 wt%). The trend labeled "Basaltic Soil" is interpreted as mixtures in variable proportions between unaltered igneous material and oxidized and SO3-rich basaltic

  2. In vitro antioxidant and anticancer effects of solvent fractions from Prunella vulgaris var. lilacina.

    Science.gov (United States)

    Hwang, Yu-Jin; Lee, Eun-Ju; Kim, Haeng-Ran; Hwang, Kyung-A

    2013-11-09

    Recently, considerable attention has been focused on exploring the potential antioxidant properties of plant extracts or isolated products of plant origin. Prunella vulgaris var. lilacina is widely distributed in Korea, Japan, China, and Europe, and it continues to be used to treat inflammation, eye pain, headache, and dizziness. However, reports on the antioxidant activities of P. vulgaris var. lilacina are limited, particularly concerning the relationship between its phenolic content and antioxidant capacity. In this study, we investigated the antioxidant and anticancer activities of an ethanol extract from P. vulgaris var. lilacina and its fractions. Dried powder of P. vulgaris var. lilacina was extracted with ethanol, and the extract was fractionated to produce the hexane fraction, butanol fraction, chloroform fraction and residual water fraction. The phenolic content was assayed using the Folin-Ciocalteu colorimetric method. Subsequently, the antioxidant activities of the ethanol extract and its fractions were analyzed employing various antioxidant assay methods including DPPH, FRAP, ABTS, SOD activity and production of reactive oxygen species. Additionally, the extract and fractions were assayed for their ability to exert cytotoxic activities on various cancer cells using the MTT assay. We also investigated the expression of genes associated with apoptotic cell death by RT-PCR. The total phenolic contents of the ethanol extract and water fraction of P. vulgaris var. lilacina were 303.66 and 322.80 mg GAE/g dry weight (or fractions), respectively. The results showed that the ethanol extract and the water fraction of P. vulgaris var. lilacina had higher antioxidant content than other solvent fractions, similar to their total phenolic content. Anticancer activity was also tested using the HepG2, HT29, A549, MKN45 and HeLa cancer cell lines. The results clearly demonstrated that the P. vulgaris var. lilacina ethanol extract induced significant cytotoxic effects

  3. Constraining Δ33S signatures of Archean seawater sulfate with carbonate-associated sulfate

    Science.gov (United States)

    Peng, Y.; Bao, H.; Bekker, A.; Hofmann, A.

    2017-12-01

    Non-mass dependent sulfur isotope deviation of S-bearing phases in Archean sedimentary strata, and expressed as Δ33S, has a consistent pattern, i.e., sulfide (pyrite) predominantly bear positive Δ33S values, while Paleoarchean sulfate (barite) has negative Δ33S values. This pattern was later corroborated by observations of negative Δ33S values in Archean volcanogenic massive sulfide deposits and negative Δ33S values in early diagenetic nodular pyrite with a wide range of δ34S values, which is thought to be due to microbial sulfate reduction. These signatures have provided a set of initial conditions for a mechanistic interpretation at physical chemistry level. Unlike the younger geological times when large bodies of seawater evaporite deposits are common, to expand seawater sulfate records, carbonate-associated sulfate (CAS) was utilized as a proxy for ancient seawater sulfate. CAS extracted from the Archean carbonates carries positive Δ33S values. However, CAS could be derived from pyrite oxidation following exposure to modern oxidizing conditions and/or during laboratory extraction procedures. It is, therefore, important for us understanding context of the overall early earth atmospheric condition to empirically confirm whether Archean seawater sulfate was generally characterized by negative Δ33S signatures. Combined δ18O, Δ17O, δ34S, and Δ33S analyses of sequentially extracted water-leachable sulfate (WLS) and acid-leachable sulfate (ALS = CAS) and δ34S and Δ33S analyses of pyrite can help to identify the source of extracted sulfate. We studied drill-core samples of Archean carbonates from the 2.55 Ga Malmani and Campell Rand supgroups, South Africa. Our preliminary results show that 1) neither WLS nor ALS were extracted from samples with extremely low pyrite contents (less than 0.05 wt.%); 2) extractable WLS and ALS is present in samples with relatively high pyrite contents (more than 1 wt.%), and that δ34S and Δ33S values of WLS, ALS, and

  4. High rates of sulfate reduction in a low-sulfate hot spring microbial mat are driven by a low level of diversity of sulfate-respiring microorganisms

    DEFF Research Database (Denmark)

    Dillon, Jesse G; Fishbain, Susan; Miller, Scott R

    2007-01-01

    The importance of sulfate respiration in the microbial mat found in the low-sulfate thermal outflow of Mushroom Spring in Yellowstone National Park was evaluated using a combination of molecular, microelectrode, and radiotracer studies. Despite very low sulfate concentrations, this mat community...... was shown to sustain a highly active sulfur cycle. The highest rates of sulfate respiration were measured close to the surface of the mat late in the day when photosynthetic oxygen production ceased and were associated with a Thermodesulfovibrio-like population. Reduced activity at greater depths...... was correlated with novel populations of sulfate-reducing microorganisms, unrelated to characterized species, and most likely due to both sulfate and carbon limitation....

  5. Assessing the effect of leachate of copper slag from the ISASMELT process on cell growth and proximate components in microalgae, Chlorella vulgaris (Beijerinck)

    Digital Repository Service at National Institute of Oceanography (India)

    Harish, V.; Sreepada, R.A.; Suryavanshi, U.; Shanmuganathan, P.; Sumathy, A.

    -exposed cultures were significantly higher than the controls. Although the cells of C. vulgaris exposed to CSL accumulated numerically elevated levels of total lipid (TL) compared to control, exposure of C. vulgaris to 100% CSL did not induce stress proteins...

  6. Effects of sulfate chitosan derivatives on nonalcoholic fatty liver disease

    Science.gov (United States)

    Yu, Mingming; Wang, Yuanhong; Jiang, Tingfu; Lv, Zhihua

    2014-06-01

    Sulfate chitosan derivatives have good solubility and therapeutic effect on the cell model of NAFLD. The aim of this study was to examine the therapeutic effect of sulfate chitosan derivatives on NAFLD. The male Wistar rats were orally fed high fat emulsion and received sulfate chitosan derivatives for 5 weeks to determine the pre-treatment effect of sulfate chitosan derivatives on NAFLD. To evaluate the therapeutic effect of sulfate chitosan derivatives on NAFLD, the rats were orally fed with high concentration emulsion for 5 weeks, followed by sulfate chitosan derivatives for 3 weeks. Histological analysis and biomedical assays showed that sulfate chitosan derivatives can dramatically prevent the development of hepatic steatosis in hepatocyte cells. In animal studies, pre-treatment and treatment with sulfate chitosan derivatives significantly protected against hepatic steatohepatitis induced by high fat diet according to histological analysis. Furthermore, increased TC, ALT, MDA, and LEP in NAFLD were significantly ameliorated by pre-treatment and treatment with sulfate chitosan derivatives. Furthermore, increased TG, AST, and TNF-α in NAFLD were significantly ameliorated by treatment with sulfate chitosan derivatives. Sulfate chitosan derivatives have good pre-treatment and therapeutic effect on NAFLD.

  7. Chinese hamster ovary cell mutants defective in heparan sulfate biosynthesis

    International Nuclear Information System (INIS)

    Bame, K.J.; Kiser, C.S.; Esko, J.D.

    1987-01-01

    The authors have isolated Chinese hamster ovary cell mutants defective in proteoglycan synthesis by radiographic screening for cells unable to incorporate 35 SO 4 into acid-precipitable material. Some mutants did not incorporate 35 SO 4 into acid-precipitable material, whereas others incorporated about 3-fold less radioactivity. HPLC anion exchange chromatographic analysis of radiolabelled glycosaminoglycans isolated from these mutants revealed many are defective in heparan sulfate biosynthesis. Mutants 803 and 677 do not synthesize heparan sulfate, although they produce chondroitin sulfate: strain 803 makes chondroitin sulfate normally, whereas 677 overaccumulates chondroitin sulfate by a factor of three. These mutants fall into the same complementation group, suggesting that the mutations are allelic. A second group of heparan sulfate biosynthetic mutants, consisting of cell lines 625, 668 and 679, produce undersulfated heparan sulfate and normal chondroitin sulfate. Treatment of the chains with nitrous acid should determine the position of the sulfate groups along the chain. These mutants may define a complementation group that is defective in the enzymes which modify the heparan sulfate chain. To increase the authors repertoire of heparan sulfate mutants, they are presently developing an in situ enzyme assay to screen colonies replica plated on filter discs for sulfotransferase defects

  8. Competition between Catolaccus grandis (Hymenoptera: Pteromalidae and Bracon vulgaris (Hymenoptera: Braconidae, parasitoids of the Boll Weevil

    Directory of Open Access Journals (Sweden)

    Francisco de Sousa Ramalho

    2007-05-01

    Full Text Available The competition between populations of the parasitoids C. grandis and B. vulgaris was studied using larvae of Euscepes postfasciatus (Fairmaire as an alternative host. A series of biological parameters was observed and related to the competitive abilities of both parasitoid species. They were capable of colonizing and maintaining their populations regardless of host location. The population growth of C. grandis and B. vulgaris, based on fecundity was not affected by the competition. The parasitism and survivorship to the adult stage were affected by competition, except when the host was located at the bottom of the rearing cage. C. grandis performed better than B. vulgaris independently of the competition and host location, but it did not exclude the other species.Catolaccus grandis (Burks e Bracon vulgaris Ashmead são os principais parasitóides do bicudo-do-algodoeiro Anthonomus grandis Boheman no Nordeste do Brasil. É importante que se determinem as interações entre esses parasitóides e o seu efeito em programas de controle biológico dessa praga com os mesmos. A competição entre os parasitóides C. grandis e B. vulgaris foi estudada, utilizando-se larvas de Euscepes postfasciatus Fairmaire como hospedeiro alternativo. A fecundidade de C. grandis e B. vulgaris baseada na produção de ovos, não foi afetada pela competição, mas o parasitismo e a produção de adultos desses parasitóides foram afetados pela competição, exceto quando o hospedeiro se encontrava na base da caixa de criação. Independentemente da competição e da localização do hospedeiro, C. grandis apresentou melhor desempenho que B. vulgaris, mas não excluiu as populações da outra espécie de parasitóide.

  9. Hot water extract of Chlorella vulgaris induced DNA damage and apoptosis

    Science.gov (United States)

    Yusof, Yasmin Anum Mohd; Md. Saad, Suhana; Makpol, Suzana; Shamaan, Nor Aripin; Ngah, Wan Zurinah Wan

    2010-01-01

    OBJECTIVES: The aim of this study was to determine the antiproliferative and apoptotic effects of hot water extracts of Chlorella vulgaris on hepatoma cell line HepG2. INTRODUCTION: The search for food and spices that can induce apoptosis in cancer cells has been a major study interest in the last decade. Chlorella vulgaris, a unicellular green algae, has been reported to have antioxidant and anti‐cancer properties. However, its chemopreventive effects in inhibiting the growth of cancer cells have not been studied in great detail. METHODS: HepG2 liver cancer cells and WRL68 normal liver cells were treated with various concentrations (0‐4 mg/ml) of hot water extract of C. vulgaris after 24 hours incubation. Apoptosis rate was evaluated by TUNEL assay while DNA damage was assessed by Comet assay. Apoptosis proteins were evaluated by Western blot analysis. RESULTS: Chlorella vulgaris decreased the number of viable HepG2 cells in a dose dependent manner (p Chlorella vulgaris tested. Evaluation of apoptosis by TUNEL assay showed that Chlorella vulgaris induced a higher apoptotic rate (70%) in HepG2 cells compared to normal liver cells, WRL68 (15%). Western blot analysis showed increased expression of pro‐ apoptotic proteins P53, Bax and caspase‐3 in the HepG2 cells compared to normal liver cells WRL68, and decreased expression of the anti‐apoptotic protein Bcl‐2. CONCLUSIONS: Chlorella vulgaris may have anti‐cancer effects by inducing apoptosis signaling cascades via an increased expression of P53, Bax and caspase‐3 proteins and through a reduction of Bcl‐2 protein, which subsequently lead to increased DNA damage and apoptosis. PMID:21340229

  10. The culture of Chlorella vulgaris with human urine in multibiological life support system experiments

    Science.gov (United States)

    Li, Ming; Liu, Hong; Tong, Ling; Fu, Yuming; He, Wenting; Hu, Enzhu; Hu, Dawei

    The Integrative Experimental System (IES) was established as a tool to evaluate the rela-tionship of the subsystems in Bioregenerative Life Support System, and Multibiological Life Support System Experiments (MLSSE) have been conducted in the IES. The IES consists of a higher plant chamber, an animal chamber and a plate photo bioreactor (PPB) which cultivated lettuce (Lactuca sativa L.), silkworm (Bombyx Mori L.) and microalgae (Chlorella vulgaris), respectively. In MLSSE, four volunteers took turns breathing the system air through a tube connected with the animal chamber periodically. According to the CO2 concentration in the IES, the automotive control system of the PPB changed the light intensity regulating the photosynthesis of Chlorella vulgaris to make CO2 /O2 in the system maintain at stable levels. Chlorella vulgaris grew with human urine by carrying certain amount of alga liquid out of the bioreactor every day with synthetic urine replenished into the system, and O2 was regenerated, at the same time human urine was purified. Results showed that this IES worked stably and Chlorella vulgaris grew well; The culture of Chlorella vulgaris could be used to keep the balance of CO2 and O2 , and the change of light intensity could control the gas composition in the IES; Microalgae culture could be used in emergency in the system, the culture of Chlorella vulgaris could recover to original state in 5 days; 15.6 ml of condensation water was obtained every day by the culture of Chlorella vulgaris; The removal efficiencies of N, P in human urine could reach to 98.2% and 99.5%.

  11. Thermophilic Sulfate-Reducing Bacteria in Cold Marine Sediment

    DEFF Research Database (Denmark)

    ISAKSEN, MF; BAK, F.; JØRGENSEN, BB

    1994-01-01

    sulfate-reducing bacteria was detected. Time course experiments showed constant sulfate reduction rates at 4 degrees C and 30 degrees C, whereas the activity at 60 degrees C increased exponentially after a lag period of one day. Thermophilic, endospore-forming sulfate-reducing bacteria, designated strain...... C to search for presence of psychrophilic, mesophilic and thermophilic sulfate-reducing bacteria. Detectable activity was initially only in the mesophilic range, but after a lag phase sulfate reduction by thermophilic sulfate-reducing bacteria were observed. No distinct activity of psychrophilic...... P60, were isolated and characterized as Desulfotomaculum kuznetsovii. The temperature response of growth and respiration of strain P60 agreed well with the measured sulfate reduction at 50 degrees-70 degrees C. Bacteria similar to strain P60 could thus be responsible for the measured thermophilic...

  12. DEPENDENCY OF SULFATE SOLUBILITY ON MELT COMPOSITION AND MELT POLYMERIZATION

    International Nuclear Information System (INIS)

    JANTZEN, CAROL M.

    2004-01-01

    Sulfate and sulfate salts are not very soluble in borosilicate waste glass. When sulfate is present in excess it can form water soluble secondary phases and/or a molten salt layer (gall) on the melt pool surface which is purported to cause steam explosions in slurry fed melters. Therefore, sulfate can impact glass durability while formation of a molten salt layer on the melt pool can impact processing. Sulfate solubility has been shown to be compositionally dependent in various studies, (e.g. , B2O3, Li2O, CaO, MgO, Na2O, and Fe2O3 were shown to increase sulfate solubility while Al2O3 and SiO2 decreased sulfate solubility). This compositional dependency is shown to be related to the calculated melt viscosity at various temperatures and hence the melt polymerization

  13. Chondroitin-4-sulfation negatively regulates axonal guidance and growth

    Science.gov (United States)

    Wang, Hang; Katagiri, Yasuhiro; McCann, Thomas E.; Unsworth, Edward; Goldsmith, Paul; Yu, Zu-Xi; Tan, Fei; Santiago, Lizzie; Mills, Edward M.; Wang, Yu; Symes, Aviva J.; Geller, Herbert M.

    2008-01-01

    Summary Glycosaminoglycan (GAG) side chains endow extracellular matrix proteoglycans with diversity and complexity based upon the length, composition, and charge distribution of the polysaccharide chain. Using cultured primary neurons, we show that specific sulfation in the GAG chains of chondroitin sulfate (CS) mediates neuronal guidance cues and axonal growth inhibition. Chondroitin-4-sulfate (CS-A), but not chondroitin-6-sulfate (CS-C), exhibits a strong negative guidance cue to mouse cerebellar granule neurons. Enzymatic and gene-based manipulations of 4-sulfation in the GAG side chains alter their ability to direct growing axons. Furthermore, 4-sulfated CS GAG chains are rapidly and significantly increased in regions that do not support axonal regeneration proximal to spinal cord lesions in mice. Thus, our findings provide the evidence showing that specific sulfation along the carbohydrate backbone carries instructions to regulate neuronal function. PMID:18768934

  14. Thermophilic Sulfate-Reducing Bacteria in Cold Marine Sediment

    DEFF Research Database (Denmark)

    ISAKSEN, MF; BAK, F.; JØRGENSEN, BB

    1994-01-01

    C to search for presence of psychrophilic, mesophilic and thermophilic sulfate-reducing bacteria. Detectable activity was initially only in the mesophilic range, but after a lag phase sulfate reduction by thermophilic sulfate-reducing bacteria were observed. No distinct activity of psychrophilic...... sulfate-reducing bacteria was detected. Time course experiments showed constant sulfate reduction rates at 4 degrees C and 30 degrees C, whereas the activity at 60 degrees C increased exponentially after a lag period of one day. Thermophilic, endospore-forming sulfate-reducing bacteria, designated strain...... P60, were isolated and characterized as Desulfotomaculum kuznetsovii. The temperature response of growth and respiration of strain P60 agreed well with the measured sulfate reduction at 50 degrees-70 degrees C. Bacteria similar to strain P60 could thus be responsible for the measured thermophilic...

  15. Sulfate and acid resistant concrete and mortar

    Science.gov (United States)

    Liskowitz, John W.; Wecharatana, Methi; Jaturapitakkul, Chai; Cerkanowicz, deceased, Anthony E.

    1998-01-01

    The present invention relates to concrete, mortar and other hardenable mixtures comprising cement and fly ash for use in construction and other applications, which hardenable mixtures demonstrate significant levels of acid and sulfate resistance while maintaining acceptable compressive strength properties. The acid and sulfate hardenable mixtures of the invention containing fly ash comprise cementitious materials and a fine aggregate. The cementitous materials may comprise fly ash as well as cement. The fine aggregate may comprise fly ash as well as sand. The total amount of fly ash in the hardenable mixture ranges from about 60% to about 120% of the total amount of cement, by weight, whether the fly ash is included as a cementious material, fine aggregate, or an additive, or any combination of the foregoing. In specific examples, mortar containing 50% fly ash and 50% cement in cementitious materials demonstrated superior properties of corrosion resistance.

  16. Biosynthesis and function of chondroitin sulfate.

    Science.gov (United States)

    Mikami, Tadahisa; Kitagawa, Hiroshi

    2013-10-01

    Chondroitin sulfate proteoglycans (CSPGs) are principal pericellular and extracellular components that form regulatory milieu involving numerous biological and pathophysiological phenomena. Diverse functions of CSPGs can be mainly attributed to structural variability of their polysaccharide moieties, chondroitin sulfate glycosaminoglycans (CS-GAG). Comprehensive understanding of the regulatory mechanisms for CS biosynthesis and its catabolic processes is required in order to understand those functions. Here, we focus on recent advances in the study of enzymatic regulatory pathways for CS biosynthesis including successive modification/degradation, distinct CS functions, and disease phenotypes that have been revealed by perturbation of the respective enzymes in vitro and in vivo. Fine-tuned machineries for CS production/degradation are crucial for the functional expression of CS chains in developmental and pathophysiological processes. Control of enzymes responsible for CS biosynthesis/catabolism is a potential target for therapeutic intervention for the CS-associated disorders. Copyright © 2013 Elsevier B.V. All rights reserved.

  17. Inhibiting mild steel corrosion from sulfate-reducing bacteria using antimicrobial-producing biofilms in Three-Mile-Island process water.

    Science.gov (United States)

    Zuo, R; Ornek, D; Syrett, B C; Green, R M; Hsu, C-H; Mansfeld, F B; Wood, T K

    2004-04-01

    Biofilms were used to produce gramicidin S (a cyclic decapeptide) to inhibit corrosion-causing, sulfate-reducing bacteria (SRB). In laboratory studies these biofilms protected mild steel 1010 continuously from corrosion in the aggressive, cooling service water of the AmerGen Three-Mile-Island (TMI) nuclear plant, which was augmented with reference SRB. The growth of both reference SRB (Gram-positive Desulfosporosinus orientis and Gram-negative Desulfovibrio vulgaris) was shown to be inhibited by supernatants of the gramicidin-S-producing bacteria as well as by purified gramicidin S. Electrochemical impedance spectroscopy and mass loss measurements showed that the protective biofilms decreased the corrosion rate of mild steel by 2- to 10-fold when challenged with the natural SRB of the TMI process water supplemented with D. orientis or D. vulgaris. The relative corrosion inhibition efficiency was 50-90% in continuous reactors, compared to a biofilm control which did not produce the antimicrobial gramicidin S. Scanning electron microscope and reactor images also revealed that SRB attack was thwarted by protective biofilms that secrete gramicidin S. A consortium of beneficial bacteria (GGPST consortium, producing gramicidin S and other antimicrobials) also protected the mild steel.

  18. Regional transport model of atmospheric sulfates

    International Nuclear Information System (INIS)

    Rao, K.S.; Thomson, I.; Egan, B.A.

    1977-01-01

    As part of the Sulfate Regional Experiment (SURE) Design Project, a regional transport model of atmospheric sulfates has been developed. This quasi-Lagrangian three-dimensional grid numerical model uses a detailed SO 2 emission inventory of major anthropogenic sources in the Eastern U.S. region, and observed meteorological data during an episode as inputs. The model accounts for advective transport and turbulent diffusion of the pollutants. The chemical transformation of SO 2 and SO 4 /sup =/ and the deposition of the species at the earth's surface are assumed to be linear processes at specified constant rates. The numerical model can predict the daily average concentrations of SO 2 and SO 4 /sup =/ at all receptor locations in the grid region during the episode. Because of the spatial resolution of the grid, this model is particularly suited to investigate the effect of tall stacks in reducing the ambient concentration levels of sulfur pollutants. This paper presents the formulations and assumptions of the regional sulfate transport model. The model inputs and results are discussed. Isopleths of predicted SO 2 and SO 4 /sup =/ concentrations are compared with the observed ground level values. The bulk of the information in this paper is directed to air pollution meteorologists and environmental engineers interested in the atmospheric transport modeling studies of sulfur oxide pollutants

  19. The roles of the micro-organisms and chromium content in the corrosion of iron-chromium steels in the presence of sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Ferrante, V.

    1991-09-01

    If it is widely accepted that the presence of sulfate-reducing bacteria can increase the aqueous corrosion of steels, the induced mechanisms are still not definitively established. The aim of this work is to specify the roles, for corrosion, of the presence of bacteria (D. Vulgaris) in one part and of chemical parameters as the composition of the material and the accumulation of sulfides in another part. The use of experimental techniques coming from microbiology, electrochemistry or chemical analysis has revealed the interdependence which exists between the bacteria and the material, and the importance of the steel composition towards the adhesion of microorganisms and the generalized corrosion. The bacteria and the dissolved sulfides do not seem to influence remarkably the generalized corrosion. Nevertheless, the alterations of the surface state they induce could be the cause of localized corrosion phenomena. (O.M.)

  20. The roles of the micro-organisms and chromium content in the corrosion of iron-chromium steels in the presence of sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Ferrante, V.

    1991-12-01

    Although the ability of sulfate-reducing bacteria to enhance the corrosion of steel is now widely accepted, the actual processes involved in such phenomena are still discussed. This work is dedicated to the study of the exact roles played in corrosion processes firstly, by the presence of D. vulgaris cells and, secondly, by chemical factors such as the material composition and the accumulation of sulfide ions in the solution. The use of microbiological, electrochemical and analytical experimental techniques lead to results that show the interdependence of the bacteria and the material as well as the importance of the steel composition in the adhesion of the micro-organisms and the general corrosion rates. The bacteria cells and dissolved sulfide ions do not markedly influence the general corrosion rates. They however induce surface state modifications that can result in localized corrosion phenomena

  1. Sulfation and cation effects on the conformational properties of the glycan backbone of chondroitin sulfate disaccharides.

    Science.gov (United States)

    Faller, Christina E; Guvench, Olgun

    2015-05-21

    Chondroitin sulfate (CS) is one of several glycosaminoglycans that are major components of proteoglycans. A linear polymer consisting of repeats of the disaccharide -4GlcAβ1-3GalNAcβ1-, CS undergoes differential sulfation resulting in five unique sulfation patterns. Because of the dimer repeat, the CS glycosidic "backbone" has two distinct sets of conformational degrees of freedom defined by pairs of dihedral angles: (ϕ1, ψ1) about the β1-3 glycosidic linkage and (ϕ2, ψ2) about the β1-4 glycosidic linkage. Differential sulfation and the possibility of cation binding, combined with the conformational flexibility and biological diversity of CS, complicate experimental efforts to understand CS three-dimensional structures at atomic resolution. Therefore, all-atom explicit-solvent molecular dynamics simulations with Adaptive Biasing Force sampling of the CS backbone were applied to obtain high-resolution, high-precision free energies of CS disaccharides as a function of all possible backbone geometries. All 10 disaccharides (β1-3 vs β1-4 linkage × five different sulfation patterns) were studied; additionally, ion effects were investigated by considering each disaccharide in the presence of either neutralizing sodium or calcium cations. GlcAβ1-3GalNAc disaccharides have a single, broad, thermodynamically important free-energy minimum, whereas GalNAcβ1-4GlcA disaccharides have two such minima. Calcium cations but not sodium cations bind to the disaccharides, and binding is primarily to the GlcA -COO(-) moiety as opposed to sulfate groups. This binding alters the glycan backbone thermodynamics in instances where a calcium cation bound to -COO(-) can act to bridge and stabilize an interaction with an adjacent sulfate group, whereas, in the absence of this cation, the proximity of a sulfate group to -COO(-) results in two like charges being both desolvated and placed adjacent to each other and is found to be destabilizing. In addition to providing information

  2. Purification and sequence characterization of chondroitin sulfate and dermatan sulfate from fishes.

    Science.gov (United States)

    Lin, Na; Mo, Xiaoli; Yang, Yang; Zhang, Hong

    2017-04-01

    Chondroitin sulfate (CS) and dermatan sulfate (DS) were extracted and purified from skins or bones of salmon (Salmo salar), snakehead (Channa argus), monkfish (Lophius litulon) and skipjack tuna (Katsuwonus pelamis). Size, structural sequences and sulfate groups of oligosaccharides in the purified CS and DS could be characterized and identified using high performance liquid chromatography (HPLC) combined with Orbitrap mass spectrometry. CS and DS chain structure varies depending on origin, but motif structure appears consistent. Structures of CS and DS oligosaccharides with different size and sulfate groups were compared between fishes and other animals, and results showed that some minor differences of special structures could be identified by hydrophilic interaction chromatography-liquid chromatography-fourier transform-mass/mass spectrometry (HILIC-LC-FT-MS/MS). For example, data showed that salmon and skipjack CS had a higher percentage content of high-level sulfated oligosaccharides than that porcine CS. In addition, structural information of different origins of CS and DS was analyzed by principal component analysis (PCA) and results showed that CS and DS samples could be differentiated according to their molecular conformation and oligosaccharide fragments information. Understanding CS and DS structure derived from different origins may lead to the production of CS or DS with unique disaccharides or oligosaccharides sequence composition and biological functions.

  3. Treatment of Active Acne Vulgaris by Chemical Peeling Using 88% Lactic Acid

    Directory of Open Access Journals (Sweden)

    Khalifa E. Sharquie

    2014-10-01

    Full Text Available Introduction: The etiopathogenesis of acne vulgaris is multifactorial, and its therapy is prolonged course that might be not accepted by many patients. Most recently TCA 35% one session peeling gave complete clearance and full remission for active acne vulgaris. Lactic acid has been used effectively as therapeutic topical agents for many skin diseases. Aim: To evaluate the efficacy and safety of chemical peeling using 88% lactic acid solution in the treatment of active acne vulgaris. Material and Methods: This clinical, interventional, therapeutic study was done at the Department of Dermatology, Baghdad Teaching Hospital, during the period from October 2012 to October 2013. Twenty five patients with active acne vulgaris were included, 15 (60% females and 10 (40% males and their ages ranged from 16-36 (21.5000± 5.46279 years. Fifteen patients were associated with acne scars. Three chemical peels using 88% lactic acid solution was carried out two weeks apart for patients with active acne vulgaris with or without scarring. Scoring for active acne vulgaris and acne scar was done for each case before and after operation to evaluate the severity of acne and the degree of scar before and after treatment. All patients were with Fitzpatrick’s skin types III and IV. Patients were followed up every two weeks during period of therapy and monthly for 3 months after stopping the treatment. Results: Twenty five patients with active acne vulgaris were treated with 3 sessions of lactic acid, fifteen patients had associated acne scar. Scoring for active acne vulgaris including papules and pustules showed highly statistically significant reduction after 2 weeks of therapy (p=0.0001, after 4 weeks (p=0.0001and after 6 weeks (p=0.0001, with percent reduction 87.2% for papules and 94% for pustules after end of sessions while after 3 months follow up the reduction rate for papules 93.8% and p-value (p=0.001 and for pustules 97.6% and (p=0.0001. While the scarring

  4. Heritability and clinical determinants of serum indoxyl sulfate and p-cresyl sulfate, candidate biomarkers of the human microbiome enterotype.

    Directory of Open Access Journals (Sweden)

    Liesbeth Viaene

    Full Text Available BACKGROUND: Indoxyl sulfate and p-cresyl sulfate are unique microbial co-metabolites. Both co-metabolites have been involved in the pathogenesis of accelerated cardiovascular disease and renal disease progression. Available evidence suggests that indoxyl sulfate and p-cresyl sulfate may be considered candidate biomarkers of the human enterotype and may help to explain the link between diet and cardiovascular disease burden. OBJECTIVE AND DESIGN: Information on clinical determinants and heritability of indoxyl sulfate and p-cresyl sulfate serum is non-existing. To clarify this issue, the authors determined serum levels of indoxyl sulfate and p-cresyl sulfate in 773 individuals, recruited in the frame of the Flemish Study on Environment, Genes and Health Outcomes (FLEMENGHO study. RESULTS: Serum levels of indoxyl sulfate and p-cresyl sulfate amounted to 3.1 (2.4-4.3 and 13.0 (7.4-21.5 μM, respectively. Regression analysis identified renal function, age and sex as independent determinants of both co-metabolites. Both serum indoxyl sulfate (h2 = 0.17 and p-cresyl sulfate (h2 = 0.18 concentrations showed moderate but significant heritability after adjustment for covariables, with significant genetic and environmental correlations for both co-metabolites. LIMITATIONS: Family studies cannot provide conclusive evidence for a genetic contribution, as confounding by shared environmental effects can never be excluded. CONCLUSIONS: The heritability of indoxyl sulfate and p-cresyl sulfate is moderate. Besides genetic host factors and environmental factors, also renal function, sex and age influence the serum levels of these co-metabolites.

  5. Evaluating of Life Quality in Patients with Acne Vulgaris Using Generic and Specific Questionnaires

    Directory of Open Access Journals (Sweden)

    Reza Ghaderi

    2013-01-01

    Full Text Available Background. Acne vulgaris is a common skin disease that can adversely affect the quality of life of patients. Objective. The aim of this study was to determine the quality of life in patients with acne vulgaris. Methods. This study was carried out on 70 patients with acne vulgaris (28 males, 42 females. All the patients filled out two Persian versions of questionnaires: short form 36 (SF-36 and Dermatology Life Quality Index (DLQI. The obtained data were analyzed by using SPSS software (version 17. Results. The scores for physical functioning, social functioning, and bodily pain domains in patients were over 70%, but the scores for role physical, general health, vitality, role emotional, and mental health in patients were under 70%. Scores on the DLQI in patients with acne vulgaris ranged from 0 to 22 (mean ± SD, 8.18 ± 4.83. After comparing mean score of DLQI with respect to gender and age, it was found that the difference between the two groups was not statistically significant. Conclusion. Acne vulgaris has a significant effect on the quality of life. There was not any significant gender or age related difference in QOL.

  6. Antibody responses of ponies to initial and challenge infections of Strongylus vulgaris.

    Science.gov (United States)

    Klei, T R; Chapman, M R; Torbert, B J; McClure, J R

    1983-05-01

    An indirect fluorescent antibody assay (IFA) was developed using Strongylus vulgaris third stage larvae (L3) as antigens. Observations using the IFA indicate that a species-specific antibody response to S. vulgaris L3 develops in S. vulgaris-infected ponies and that some surface L3 antigens are shared by adult worms. Sequential antibody levels against S. vulgaris were measured in strongyle-naive and in immune ponies following initial and challenge infections using the IFA and an indirect hemagglutination assay (IHA). Antibody levels measured by IFA increased faster following initial infections than did levels measured by IHA. Antibody levels appear to increase following challenge infections of immune ponies when measured with the IFA, but not with the IHA. Significant differences in antibody titers were not seen between ponies which developed colic following challenge infections and those that did not develop colic. Antibodies were not detectable in ponies unexposed to larval migrations, but which received surgical implantation of S. vulgaris adults into the cecum.

  7. Quality of life in acne vulgaris: Relationship to clinical severity and demographic data.

    Science.gov (United States)

    Gupta, Aayush; Sharma, Yugal Kishor; Dash, Kedar Nath; Chaudhari, Nitin Dinkar; Jethani, Sumit

    2016-01-01

    Acne vulgaris is known to impair many aspects of quality of life. However, the correlation of this impairment with clinical severity remains equivocal despite various school, community and hospital-based studies. A hospital-based study was undertaken to measure the impairment of quality of life of patients of acne vulgaris and correlate it with the severity of lesions. This was a cross-sectional, questionnaire-based study in a cohort of 100 patients of acne vulgaris attending the outpatient department of our referral hospital. A physician measured the severity of lesions using the global acne grading system, and patients assessed quality of life by completing a questionnaire (Cardiff acne disability index). A correlation of these two was done; some additional correlations were brought out through demographic data collected from the patients. There was no correlation between the severity of acne vulgaris and an impaired quality of life. Patients who consumed alcohol and/or smoked cigarettes were found to have an impaired quality of life. While the severity of acne progressively lessened in older patients, the impact on quality of life increased. The sample size was small and there was a lack of guaranteed reliability on the self-reported quality of life. The severity of acne vulgaris does not correlate with impairment in quality of life.

  8. Enhanced methane production of Chlorella vulgaris and Chlamydomonas reinhardtii by hydrolytic enzymes addition

    International Nuclear Information System (INIS)

    Mahdy, Ahmed; Mendez, Lara; Ballesteros, Mercedes; González-Fernández, Cristina

    2014-01-01

    Highlights: • Methane production of microalgae biomass is hampered by their cell wall. • Pretreatment should be designed in accordance to the microalgae specie. • Fresh Chlamydomonas reinhardtii exhibited high anaerobic biodegradability. • Chlorella vulgaris anaerobic biodegradability was enhanced by 50% using protease pretreatment. - Abstract: The effect of enzymatic hydrolysis on microalgae organic matter solubilisation and methane production was investigated in this study. Even though both biomasses, Chlamydomonas reinhardtii and Chlorella vulgaris, exhibited similar macromolecular distribution, their cell wall composition provided different behaviors. The addition of carbohydrolase (Viscozyme) and protease (Alcalase) resulted in high carbohydrates and protein solubilisation on both biomasses (86–96%). Despite the high carbohydrate solubilisation with the carbohydrolase, methane production was enhanced by 14% for C. vulgaris, while hydrolyzed C. reinhardtii did not show any improvement. The addition of protease to C. reinhardtii increased methane production by 1.17-fold. The low enhancement achieved together with the inherent high biodegradability of this biomass would not justify the cost associated to the enzyme addition. On the other hand, C. vulgaris hydrolyzed with the protease resulted in 86% anaerobic biodegradability compared to 54% of the raw biomass. Therefore, the application of protease prior anaerobic digestion of C. vulgaris could be a promising approach to decrease the energetic input required for cell wall disruption

  9. Efficacy of Essential Oils of Thymus vulgaris and Origanum vulgare on Echinococcus granulosus

    Directory of Open Access Journals (Sweden)

    P. E. Pensel

    2014-01-01

    Full Text Available The aim of the present work was to determine the in vitro effect of T. vulgaris and O. vulgare essential oils against E. granulosus protoscoleces and cysts. Essential oils were added to the medium resulting in thymol final concentrations of 10 μg/mL. The essential oils had a time-dependent effect provoking the complete loss of protoscolex viability after 72 days of postincubation. The results were confirmed at the ultrastructure level. Loss of infectivity in protoscoleces incubated with O. vulgare after 60 days was observed. On the other hand, the weight of cysts recorded in mice inoculated with T. vulgaris treated protoscoleces was significantly lower than that obtained in control group. Gamma-glutamyl-transpeptidase activity was readily detected in the culture supernatant of protoscoleces treated either with the essential oils or thymol. T. vulgaris and O. vulgare essential oils and thymol can induce cell apoptosis of protoscoleces after short incubation times. The efficacy of T. vulgaris and O. vulgare essential oils was also demonstrated in vitro on E. granulosus murine cysts. Our data suggest that essential oils of T. vulgaris and O. vulgare have anthelmintic effect against protoscoleces and cysts of E. granulosus.

  10. Chlorella vulgaris Induces Apoptosis of Human Non-Small Cell Lung Carcinoma (NSCLC) Cells.

    Science.gov (United States)

    Zhang, Zhi-Dong; Liang, Kai; Li, Kun; Wang, Guo-Quan; Zhang, Ke-Wei; Cai, Lei; Zhai, Shui-Ting; Chou, Kuo-Chen

    2017-01-01

    Chlorella vulgaris (C. vulgaris), a unicellular green microalga, has been widely used as a food supplement and reported to have antioxidant and anticancer properties. The current study was designed to assess the cytotoxic, apoptotic, and DNA-damaging effects of C. vulgaris growth factor (CGF), hot water C. vulgaris extracts, inlung tumor A549 and NCI-H460 cell lines. A549 cells, NCI-H460 cells, and normal human fibroblasts were treated with CGF at various concentrations (0-300 μg/ml) for 24 hr. The comet assay and γH2AX assay showed DNA damage in A549 and NCI-H460 cells upon CGF exposure. Evaluation of apoptosis by the TUNEL assay and DNA fragmentation analysis by agarose gel electrophoresis showed that CGF induced apoptosis in A549 and NCI-H460 cells. Chlorella vulgaris hot water extract induced apoptosis and DNA damage in human lung carcinoma cells. CGF can thus be considered a potential cytotoxic or genotoxic drug for treatment of lung carcinoma. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  11. Magnesium Uptake by the Green Microalga Chlorella vulgaris in Batch Cultures.

    Science.gov (United States)

    Ben Amor-Ben Ayed, Hela; Taidi, Behnam; Ayadi, Habib; Pareau, Dominique; Stambouli, Moncef

    2016-03-01

    The accumulation (internal and superficial distribution) of magnesium ions (Mg(2+)) by the green freshwater microalga Chlorella vulgaris (C. vulgaris) was investigated under autotrophic culture in a stirred photobioreactor. The concentrations of the three forms of Mg(2+) (dissolved, extracellular, and intracellular) were determined with atomic absorption spectroscopy during the course of C. vulgaris growth. The proportions of adsorbed (extracellular) and absorbed (intracellular) Mg(2+) were quantified. The concentration of the most important pigment in algal cells, chlorophyll a, increased over time in proportion to the increase in the biomass concentration, indicating a constant chlorophyll/biomass ratio during the linear growth phase. The mean-average rate of Mg(2+) uptake by C. vulgaris grown in a culture medium starting with 16 mg/l of Mg(2+) concentration was measured. A clear relationship between the biomass concentration and the proportion of the Mg(2+) removal from the medium was observed. Of the total Mg(2+) present in the culture medium, 18% was adsorbed on the cell wall and 51% was absorbed by the biomass by the end of the experiment (765 h). Overall, 69% of the initial Mg(2+) were found to be removed from the medium. This study supported the kinetic model based on a reversible first-order reaction for Mg(2+) bioaccumulation in C. vulgaris, which was consistent with the experimental data.

  12. An Automatic Diagnosis Method of Facial Acne Vulgaris Based on Convolutional Neural Network.

    Science.gov (United States)

    Shen, Xiaolei; Zhang, Jiachi; Yan, Chenjun; Zhou, Hong

    2018-04-11

    In this paper, we present a new automatic diagnosis method for facial acne vulgaris which is based on convolutional neural networks (CNNs). To overcome the shortcomings of previous methods which were the inability to classify enough types of acne vulgaris. The core of our method is to extract features of images based on CNNs and achieve classification by classifier. A binary-classifier of skin-and-non-skin is used to detect skin area and a seven-classifier is used to achieve the classification task of facial acne vulgaris and healthy skin. In the experiments, we compare the effectiveness of our CNN and the VGG16 neural network which is pre-trained on the ImageNet data set. We use a ROC curve to evaluate the performance of binary-classifier and use a normalized confusion matrix to evaluate the performance of seven-classifier. The results of our experiments show that the pre-trained VGG16 neural network is effective in extracting features from facial acne vulgaris images. And the features are very useful for the follow-up classifiers. Finally, we try applying the classifiers both based on the pre-trained VGG16 neural network to assist doctors in facial acne vulgaris diagnosis.

  13. Effect of polyacetylenic acids from Prunella vulgaris on various plant pathogens.

    Science.gov (United States)

    Yoon, M-Y; Choi, G J; Choi, Y H; Jang, K S; Park, M S; Cha, B; Kim, J-C

    2010-11-01

    This study is aiming at characterizing antifungal substances from the methanol extract of Prunella vulgaris and at investigating those substances' antifungal and antioomycete activities against various plant pathogens. Two polyacetylenic acids were isolated from P. vulgaris as active principles and identified as octadeca-9,11,13-triynoic acid and trans-octadec-13-ene-9,11-diynoic acid. These two compounds inhibited the growth of Magnaporthe oryzae, Rhizoctonia solani, Phytophthora infestans, Sclerotinia sclerotiorum, Fusarium oxysporum f. sp. raphani, and Phytophthora capsici. In addition, these two compounds and the wettable powder-type formulation of an n-hexane fraction of P. vulgaris significantly suppressed the development of rice blast, tomato late blight, wheat leaf rust, and red pepper anthracnose. These data show that the extract of P. vulgaris and two polyacetylenic acids possess antifungal and antioomycete activities against a broad spectrum of tested plant pathogens. This is the first report on the occurrence of octadeca-9,11,13-triynoic acid and trans-octadec-13-ene-9,11-diynoic acid in P. vulgaris and their efficacy against plant diseases. The crude extract containing the two polyacetylenic acids can be used as a natural fungicide for the control of various plant diseases. © 2010 The Authors. © 2010 The Society for Applied Microbiology.

  14. Evidence for the endophytic colonization of Phaseolus vulgaris (common bean) roots by the diazotroph Herbaspirillum seropedicae.

    Science.gov (United States)

    Schmidt, M A; Souza, E M; Baura, V; Wassem, R; Yates, M G; Pedrosa, F O; Monteiro, R A

    2011-03-01

    Herbaspirillum seropedicae is an endophytic diazotrophic bacterium, which associates with important agricultural plants. In the present study, we have investigated the attachment to and internal colonization of Phaseolus vulgaris roots by the H. seropedicae wild-type strain SMR1 and by a strain of H. seropedicae expressing a red fluorescent protein (DsRed) to track the bacterium in the plant tissues. Two-day-old P. vulgaris roots were incubated at 30°C for 15 min with 6 x 10(8) CFU/mL H. seropedicae SMR1 or RAM4. Three days after inoculation, 4 x 10(4) cells of endophytic H. seropedicae SMR1 were recovered per gram of fresh root, and 9 days after inoculation the number of endophytes increased to 4 x 10(6) CFU/g. The identity of the recovered bacteria was confirmed by amplification and sequencing of the 16SrRNA gene. Furthermore, confocal microscopy of P. vulgaris roots inoculated with H. seropedicae RAM4 showed that the bacterial cells were attached to the root surface 15 min after inoculation; fluorescent bacteria were visible in the internal tissues after 24 h and were found in the central cylinder after 72 h, showing that H. seropedicae RAM4 is capable of colonizing the roots of the dicotyledon P. vulgaris. Determination of dry weight of common bean inoculated with H. seropedicae SMR1 suggested that this bacterium has a negative effect on the growth of P. vulgaris.

  15. Detection and semi-quantification of Strongylus vulgaris DNA in equine faeces by real-time quantitative PCR

    DEFF Research Database (Denmark)

    Nielsen, Martin Krarup; Peterson, David S.; Monrad, Jesper

    2008-01-01

    Strongylus vulgaris is an important strongyle nematode with high pathogenic potential infecting horses world-wide. Several decades of intensive anthelminitic use has virtually eliminated clinical disease caused by S. vulgaris, but has also causes high levels of anthelmintic resistance in equine...

  16. Gas chromatography-mass spectrometry analysis of different organic crude extracts from the local medicinal plant of Thymus vulgaris L

    Institute of Scientific and Technical Information of China (English)

    Laila Salim Al Hashmi; Mohammad Amzad Hossain; Afaf Mohammed Weli; Qasim Al-Riyami; Jamal Nasser Al-Sabahi

    2013-01-01

    Objective: To isolate and analyze the chemical composition in different crude extracts of from the leaves of locally grown of Thymus vulgaris L (T. vulgaris) by gas chromatography-mass spectrometry (GC-MS). Methods: The shade dried leaves powder was extracted with methanol by using Soxhlet extractor. Methanol crude extracts of T. vulgaris and the derived fractions of hexane, chloroform, ethyl acetate and butanol were obtained. Results: Qualitative analyses of various organic crude extracts of T. vulgaris by using GC-MS showed that there were different types of high and low molecular weight compounds. Most of the isolated and identified compounds by GC-MS in the crude extracts are basically biologically important. Further, the T. vulgaris leaf possessed certain characteristics that can be ascribed to cultivation on a domestic plantation. The crude extracts were prepared from the powder leaves of T. vulgaris for respective compounds can be chosen on the basis of above GC-MS analysis. Conclusions: All the major compounds were identified and characterized by spectroscopic method in different organic crude extracts of T. vulgaris are biologically active molecules. Thus the identification of a good number of compounds in various crude extracts of T. vulgaris might have some ecological role.

  17. Gas chromatography-mass spectrometry analysis of different organic crude extracts from the local medicinal plant of Thymus vulgaris L

    Institute of Scientific and Technical Information of China (English)

    Laila; Salim; Al; Hashmi; Mohammad; Amzad; Hossain; Afaf; Mohammed; Weli; Qasim; Al-Riyami; Jamal; Nasser; Al-Sabahi

    2013-01-01

    Objective:To isolate and analyze the chemical composition in different crude extracts of from the leaves of locally grown of Thymus vulgaris L(T.vulgaris)by gas chromatography-mass spectrometry(GC-MS).Methods:The shade dried leaves powder was extracted with methanol by using Soxhlet extractor.Methanol crude extracts of T.vulgaris and the derived fractions of hexane,chloroform,ethyl acetate and butanol were obtained.Results:Qualitative analyses of various organic crude extracts of T.vulgaris by using GC-MS showed that there were different types of high and low molecular weight compounds.Most of the isolated and identified compounds by GC-MS in the crude extracts are basically biologically important.Further,the T.vulgaris leaf possessed certain characteristics that can be ascribed to cultivation on a domestic plantation.The crude extracts were prepared from the powder leaves of T.vulgaris for respective compounds can be chosen on the basis of above GC-MS analysis.Conclusions:All the major compounds were identified and characterized by spectroscopic method in different organic crude extracts of T.vulgaris are biologically active molecules.Thus the identification of a good number of compounds in various crude extracts of T.vulgaris might have some ecological role.

  18. Genetic basis for nitrate resistance in Desulfovibrio strains

    Directory of Open Access Journals (Sweden)

    Hannah eKorte

    2014-04-01

    Full Text Available Nitrate is an inhibitor of sulfate-reducing bacteria (SRB. In petroleum production sites, amendments of nitrate and nitrite are used to prevent SRB production of sulfide that causes souring of oil wells. A better understanding of nitrate stress responses in the model SRB, Desulfovibrio vulgaris Hildenborough and Desulfovibrio alaskensis G20, will strengthen predictions of environmental outcomes. Nitrate inhibition of SRB has historically been considered to result from the generation of small amounts of nitrite, to which SRB are quite sensitive. Here we explored the possibility that nitrate might inhibit SRB by a mechanism other than through nitrite inhibition. We found that nitrate-stressed D. vulgaris cultures grown in lactate-sulfate conditions eventually grew in the presence of high concentrations of nitrate, and their resistance continued through several subcultures. Nitrate consumption was not detected over the course of the experiment, suggesting adaptation to nitrate. With high-throughput genetic approaches employing TnLE-seq for D. vulgaris and a pooled mutant library of D. alaskensis, we determined the fitness of many transposon mutants of both organisms in nitrate stress conditions. We found that several mutants, including homologs present in both strains, had a greatly increased ability to grow in the presence of nitrate but not nitrite. The mutated genes conferring nitrate resistance included the gene encoding the putative Rex transcriptional regulator (DVU0916/Dde_2702, as well as a cluster of genes (DVU0251-DVU0245/Dde_0597-Dde_0605 that is poorly annotated. Follow-up studies with individual D. vulgaris transposon and deletion mutants confirmed high-throughput results. We conclude that, in D. vulgaris and D. alaskensis, nitrate resistance in wild-type cultures is likely conferred by spontaneous mutations. Furthermore, the mechanisms that confer nitrate resistance may be different from those that confer nitrite resistance.

  19. Sulfation pattern of fucose branches affects the anti-hyperlipidemic activities of fucosylated chondroitin sulfate.

    Science.gov (United States)

    Wu, Nian; Zhang, Yu; Ye, Xingqian; Hu, Yaqin; Ding, Tian; Chen, Shiguo

    2016-08-20

    Fucosylated chondroitin sulfates (fCSs) are glycosaminoglycans extracted from sea cucumbers, consisting of chondroitin sulfate E (CSE) backbones and sulfated fucose branches. The biological properties of fCSs could be affected by the sulfation pattern of their fucose branches. In the present study, two fCSs were isolated from sea cucumbers Isostichopus badionotus (fCS-Ib) and Pearsonothuria graeffei (fCS-Pg). Their monosaccharide compositions of glucuronic acid (GlcA), N-acetylgalactosamine (GalNAc), fucose (Fuc) and sulfate were at similar molar ratio with 1.0/0.7/0.9/3.1 for fCS-Ib and 1.0/0.8/1.5/2.6 for fCS-Pg. The two fCSs have different sulfation patterns on their fucose branches, fCS-Pg with 3,4-O-disulfation while fCS-Ib with 2,4-O-disulfation. Their antihyperlipidemic effects were compared using a high-fat high-fructose diet (HFFD)-fed C57BL/6J mice model. Both fCS-Ib and fCS-Pg had significant effects on lipid profile improvement, liver protection, blood glucose diminution and hepatic glycogen synthesis. Specifically, fCS-Pg with 3,4-O-disulfation fucose branches was more effective in reduction of blood cholesterol (TC), low density lipoprotein (LDL) and atherogenic index (AI). Our results indicate that both fCSs, especially fCS-Pg, could be used as a potential anti-hyperlipidemic drug. Copyright © 2016. Published by Elsevier Ltd.

  20. A potential role for chondroitin sulfate/dermatan sulfate in arm regeneration in Amphiura filiformis.

    Science.gov (United States)

    Ramachandra, Rashmi; Namburi, Ramesh B; Dupont, Sam T; Ortega-Martinez, Olga; van Kuppevelt, Toin H; Lindahl, Ulf; Spillmann, Dorothe

    2017-05-01

    Glycosaminoglycans (GAGs), such as chondroitin sulfate (CS) and dermatan sulfate (DS) from various vertebrate and invertebrate sources are known to be involved in diverse cellular mechanisms during repair and regenerative processes. Recently, we have identified CS/DS as the major GAG in the brittlestar Amphiura filiformis, with high proportions of di- and tri-O-sulfated disaccharide units. As this echinoderm is known for its exceptional regeneration capacity, we aimed to explore the role of these GAG chains during A. filiformis arm regeneration. Analysis of CS/DS chains during the regeneration process revealed an increase in the proportion of the tri-O-sulfated disaccharides. Conversely, treatment of A. filiformis with sodium chlorate, a potent inhibitor of sulfation reactions in GAG biosynthesis, resulted in a significant reduction in arm growth rates with total inhibition at concentrations higher than 5 mM. Differentiation was less impacted by sodium chlorate exposure or even slightly increased at 1-2 mM. Based on the structural changes observed during arm regeneration we identified chondroitin synthase, chondroitin-4-O-sulfotransferase 2 and dermatan-4-O-sulfotransferase as candidate genes and sought to correlate their expression with the expression of the A. filiformis orthologue of bone morphogenetic factors, AfBMP2/4. Quantitative amplification by real-time PCR indicated increased expression of chondroitin synthase and chondroitin-4-O-sulfotransferase 2, with a corresponding increase in AfBMP2/4 during regeneration relative to nonregenerating controls. Our findings suggest that proper sulfation of GAGs is important for A. filiformis arm regeneration and that these molecules may participate in mechanisms controlling cell proliferation. © The Author 2017. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  1. Atividade antimicrobiana de Struthanthus vulgaris (erva-de-passarinho

    Directory of Open Access Journals (Sweden)

    O.M.C. Vieira

    Full Text Available As plantas do gênero Struthanthus são conhecidas como ervas-de-passarinho e parasitam pomares no Brasil, principalmente os de laranjeiras e goiabeiras. Na medicina popular são usadas nas afecções das vias respiratórias. O extrato hidroetanólico a 70% de folhas frescas de Struthanthus vulgaris apresentou atividade antimicrobiana contra amostras bacterianas Gram positiva e Gram negativa. Este extrato não apresentou, nas condições testadas, atividade contra fungos. As amostras bacterianas mais sensíveis ao extrato foram Bacillus cereus (ATCC 11778, Micrococcus luteus (ATCC 9341, Staphylococcus aureus (ATCC 6538, S. epidermidis (ATCC 12228 e P. aeruginosa (ATCC 27853, usando o método de difusão em agar. As frações obtidas, pela partição líquido-líquido do extrato hidroetanólico a 70%, com solventes de polaridades crescentes (clorofórmio, acetato de etila, n-butanol e água, apresentaram diferentes atividades inibitórias. A fração que apresentou a maior atividade contra bactéria Gram positiva (B. cereus e Gram negativa (P. aeruginosa foi aquela obtida com n-butanol. Nessa fração foram detectados flavonóides, taninos condensados (proantocianidinas e saponinas.

  2. Loss of normal anagen hair in pemphigus vulgaris.

    Science.gov (United States)

    Daneshpazhooh, M; Mahmoudi, H R; Rezakhani, S; Valikhani, M; Naraghi, Z S; Mohammadi, Y; Habibi, A; Chams-Davatchi, C

    2015-07-01

    Pemphigus vulgaris (PV) is a known cause of loss of 'normal' anagen hair; that is, shedding of intact anagen hairs covered by root sheaths. However, studies on this subject are limited. To investigate anagen hair shedding in patients with PV, and ascertain its association with disease severity. In total, 96 consecutive patients with PV (new patients or patients in relapse) who were admitted to the dermatology wards of a tertiary hospital were enrolled in this study. Demographic data, PV phenotype, disease severity and presence of scalp lesions were recorded. A group of 10-20 hairs were pulled gently from different areas of the scalp (lesional and nonlesional skin) in all patients, and anagen hairs were counted. Disease severity was graded according to Harman score. Anagen hair was obtained by pull test in 59 of the 96 patients (61.5%), of whom 2 had normal scalp. The mean ± SD anagen hair count was 5.9 ± 7.6 (range 0-31). In univariate analysis, anagen hair loss (P hair count was significantly higher in the severe (mean 6.83 ± 7.89) than the moderate (mean 1.06 ± 1.94) subgroup (P hair loss (OR = 1.16, 95% CI = 1.05-1.28, P hair loss was an independent predictor of the disease severity. © 2015 British Association of Dermatologists.

  3. Vanadium, rubidium and potassium in Octopus vulgaris (Mollusca: Cephalopoda

    Directory of Open Access Journals (Sweden)

    Sónia Seixas

    2005-06-01

    Full Text Available The levels of vanadium, rubidium and potassium were determined in Octopus vulgaris caught during commercial fishing activities at three locations (Cascais, Santa Luzia and Viana do Castelo in Portugal in autumn and spring. We determined the concentration of these elements in digestive gland, branchial heart, gills, mantle and arms in males and females. At least five males and five females were assessed for each season/location combination. Elemental concentrations were determined by Particle Induced X-ray Emission (PIXE. Vanadium was detectable only in digestive gland and branchial heart samples. Its concentration was not correlated with total weight, total length or mantle length. There were no differences in concentrations of V, Rb and K between sexes. There were significant differences in vanadium concentrations in branchial hearts in autumn between samples from Viana do Castelo and those from the other two sites. We found a significant positive relationship between the concentration of vanadium and those of potassium and rubidium in branchial hearts. Branchial hearts appear to play an important role in decontamination of V.

  4. Accumulation of 65Zn by octopus Octopus vulgaris

    International Nuclear Information System (INIS)

    Ueda, Taiji; Nakahara, Motokazu; Nakamura, Ryoichi; Suzuki, Yuzuru; Shimizu, Chiaki.

    1985-01-01

    In order to aim the prevention of the radiation hazard to human beings through sea food, the accumulation and excretion of 65 Zn by octopus Octopus vulgaris was examined by the radioisotope tracer experiment. The concentration factor of 65 Zn for whole body of the octopus that take up the nuclide from sea water and food was estimated as 9,900, by assuming that the octopus feeds on clams alone. In that case the contribution of food was about twenty times greater than that of sea water on the accumulation of the nuclide. The biological half-life of 65 Zn accumulated through sea water was 74 days. High accumulation of 65 Zn in the branchial heart of the octopus, as in the case of Co, was not observed. In the liver, 65 Zn combined with three constituents which have a molecular weight of more than 80,000, 7,000 - 8,000 and less than 5,000. In the kidney, 65 Zn combined with three constituents of a molecular weight of more than 80,000, 10,000 - 20,000 and less than 5,000. (author)

  5. Chlorella vulgaris triggers apoptosis in hepatocarcinogenesis-induced rats*

    Science.gov (United States)

    Mohd Azamai, Emey Suhana; Sulaiman, Suhaniza; Mohd Habib, Shafina Hanim; Looi, Mee Lee; Das, Srijit; Abdul Hamid, Nor Aini; Wan Ngah, Wan Zurinah; Mohd Yusof, Yasmin Anum

    2009-01-01

    Chlorella vulgaris (CV) has been reported to have antioxidant and anticancer properties. We evaluated the effect of CV on apoptotic regulator protein expression in liver cancer-induced rats. Male Wistar rats (200~250 g) were divided into eight groups: control group (normal diet), CDE group (choline deficient diet supplemented with ethionine in drinking water to induce hepatocarcinogenesis), CV groups with three different doses of CV (50, 150, and 300 mg/kg body weight), and CDE groups treated with different doses of CV (50, 150, and 300 mg/kg body weight). Rats were sacrificed at various weeks and liver tissues were embedded in paraffin blocks for immunohistochemistry studies. CV, at increasing doses, decreased the expression of anti-apoptotic protein, Bcl-2, but increased the expression of pro-apoptotic protein, caspase 8, in CDE rats, which was correlated with decreased hepatoctyes proliferation and increased apoptosis as determined by bromodeoxy-uridine (BrdU) labeling and terminal deoxynucleotidyl transferase mediated dUTP nick-end labeling (TUNEL) assay, respectively. Our study shows that CV has definite chemopreventive effect by inducing apoptosis via decreasing the expression of Bcl-2 and increasing the expression of caspase 8 in hepatocarcinogenesis-induced rats. PMID:19198018

  6. Use of diluted urine for cultivation of Chlorella vulgaris.

    Science.gov (United States)

    Jaatinen, Sanna; Lakaniemi, Aino-Maija; Rintala, Jukka

    2016-01-01

    Our aim was to study the biomass growth of microalga Chlorella vulgaris using diluted human urine as a sole nutrient source. Batch cultivations (21 days) were conducted in five different urine dilutions (1:25-1:300), in 1:100-diluted urine as such and with added trace elements, and as a reference, in artificial growth medium. The highest biomass density was obtained in 1:100-diluted urine with and without additional trace elements (0.73 and 0.60 g L(-1), respectively). Similar biomass growth trends and densities were obtained with 1:25- and 1:300-diluted urine (0.52 vs. 0.48 gVSS L(-1)) indicating that urine at dilution 1:25 can be used to cultivate microalgal based biomass. Interestingly, even 1:300-diluted urine contained sufficiently nutrients and trace elements to support biomass growth. Biomass production was similar despite pH-variation from < 5 to 9 in different incubations indicating robustness of the biomass growth. Ammonium formation did not inhibit overall biomass growth. At the beginning of cultivation, the majority of the biomass consisted of living algal cells, while towards the end, their share decreased and the estimated share of bacteria and cell debris increased.

  7. Physiological and biochemical responses of Chlorella vulgaris to Congo red.

    Science.gov (United States)

    Hernández-Zamora, Miriam; Perales-Vela, Hugo Virgilio; Flores-Ortíz, César Mateo; Cañizares-Villanueva, Rosa Olivia

    2014-10-01

    Extensive use of synthetic dyes in many industrial applications releases large volumes of wastewater. Wastewaters from dying industries are considered hazardous and require careful treatment prior to discharge into receiving water bodies. Dyes can affect photosynthetic activities of aquatic flora and decrease dissolved oxygen in water. The aim of this study was to evaluate the effect of Congo red on growth and metabolic activity of Chlorella vulgaris after 96h exposure. Exposure of the microalga to Congo red reduced growth rate, photosynthesis and respiration. Analysis of chlorophyll a fluorescence emission showed that the donor side of photosystem II was affected at high concentrations of Congo red. The quantum yield for electron transport (φEo), the electron transport rate (ETR) and the performance index (PI) also decreased. The reduction in the ability to absorb and use the quantum energy increased non-photochemical (NPQ) mechanisms for thermal dissipation. Overall, Congo red affects growth and metabolic activity in photosynthetic organisms in aquatic environments. Copyright © 2014 Elsevier Inc. All rights reserved.

  8. Structure and mechanical properties of Octopus vulgaris suckers.

    Science.gov (United States)

    Tramacere, Francesca; Kovalev, Alexander; Kleinteich, Thomas; Gorb, Stanislav N; Mazzolai, Barbara

    2014-02-06

    In this study, we investigate the morphology and mechanical features of Octopus vulgaris suckers, which may serve as a model for the creation of a new generation of attachment devices. Octopus suckers attach to a wide range of substrates in wet conditions, including rough surfaces. This amazing feature is made possible by the sucker's tissues, which are pliable to the substrate profile. Previous studies have described a peculiar internal structure that plays a fundamental role in the attachment and detachment processes of the sucker. In this work, we present a mechanical characterization of the tissues involved in the attachment process, which was performed using microindentation tests. We evaluated the elasticity modulus and viscoelastic parameters of the natural tissues (E ∼ 10 kPa) and measured the mechanical properties of some artificial materials that have previously been used in soft robotics. Such a comparison of biological prototypes and artificial material that mimics octopus-sucker tissue is crucial for the design of innovative artificial suction cups for use in wet environments. We conclude that the properties of the common elastomers that are generally used in soft robotics are quite dissimilar to the properties of biological suckers.

  9. Molecular Characterization of a Catalase from Hydra vulgaris

    Science.gov (United States)

    Dash, Bhagirathi; Phillips, Timothy D.

    2012-01-01

    Catalase, an antioxidant and hydroperoxidase enzyme protects the cellular environment from harmful effects of hydrogen peroxide by facilitating its degradation to oxygen and water. Molecular information on a cnidarian catalase and/or peroxidase is, however, limited. In this work an apparent full length cDNA sequence coding for a catalase (HvCatalase) was isolated from Hydra vulgaris using 3’- and 5’- (RLM) RACE approaches. The 1859 bp HvCatalase cDNA included an open reading frame of 1518 bp encoding a putative protein of 505 amino acids with a predicted molecular mass of 57.44 kDa. The deduced amino acid sequence of HvCatalase contained several highly conserved motifs including the heme-ligand signature sequence RLFSYGDTH and the active site signature FXRERIPERVVHAKGXGA. A comparative analysis showed the presence of conserved catalytic amino acids [His(71), Asn(145), and Tyr(354)] in HvCatalase as well. Homology modeling indicated the presence of the conserved features of mammalian catalase fold. Hydrae exposed to thermal, starvation, metal and oxidative stress responded by regulating its catalase mRNA transcription. These results indicated that the HvCatalase gene is involved in the cellular stress response and (anti)oxidative processes triggered by stressor and contaminant exposure. PMID:22521743

  10. A Rare Case of Cranial Osteomyelitis Caused by Proteus Vulgaris

    Directory of Open Access Journals (Sweden)

    Hakan Uslu

    2011-03-01

    Full Text Available Osteomyelitis of the calvarial bones can cause serious complications such as brain abscess, due to the close proximity to adjacent brain structures. Development of the purulent secretion in surgery and traumatic scalp injuries must be considered as a possibility of osteomyelitis possibility. Generally gram positive, rarely gram negative bacteria and mix agents, can be isolated in infection. Especially chronic pyogenic osteomyelitis agents can be isolated from chronic infections such as tuberculosis. In cranial osteomyelitis diagnosis, radiological diagnosis has a very important place together with the clinical diagnosis. However, infection can usually show late findings radiologically. In treatment, antibiotic treatment is absolutely essential as well as removal of the infected part of the bone. Due to antibiotic treatment lasting between 6-12 weeks, organizing the antibiotic protocols according to the results of culture-antibiograms, which were provided from purulent secretions, has the most important role in the success of surgical treatment. In Proteus sp. infections, for choice of suitable treatment, determination of the type of bacteria is important. For exact diagnosis, histopathological examination of the bone tissue must be carried out. In this report, a case with cranial osteomyelitis caused by Proteus vulgaris which is a gram negative bacteria causing anaerobic infections and classified in the Enterobacteriaceae family is presented. The patient was treated with surgery and appropriate antibiotics. Early recognition of this condition, planning the best treatment strategy and taking precautions to prevent complications, is mandatory for a better outcome.

  11. Diversity of Rhizobium-Phaseolus vulgaris symbiosis: Overview and perspectives

    International Nuclear Information System (INIS)

    Martinez-Romero, Esperanza

    2001-01-01

    Common bean (Phaseolus vulgaris) has become a cosmopolitan crop, but was originally domesticated in the Americas and has been grown in Latin America for several thousand years. Consequently an enormous diversity of bean nodulating bacteria have developed and in the centers of origin the predominant species in bean nodules is R. etli. In some areas of Latin America, inoculation, which normally promotes nodulation and nitrogen fixation is hampered by the prevalence of native strains. Many other species in addition to R. etli have been found in bean nodules in regions where bean has been introduced. Some of these species such as R. leguminosarum bv. phaseoli, R. gallicum bv. phaseoli and R. giardinii bv. phaseoli might have arisen by acquiring the phaseoli plasmid from R. etli. Others, like R. trap id, are well adapted to acid soils and high temperatures and are good inoculants for bean under these conditions. The large number of rhizobia species capable of nodulating bean supports that bean is a promiscuous host and a diversity of bean-rhizobia interactions exists. Large ranges of dinitrogen fixing capabilities have been documented among bean cultivars and commercial beans have the lowest values among legume crops. Knowledge on bean symbiosis is still incipient but could help to improve bean biological nitrogen fixation. (author)

  12. On the roles and regulation of chondroitin sulfate and heparan sulfate in zebrafish pharyngeal cartilage morphogenesis

    DEFF Research Database (Denmark)

    Holmborn, Katarina; Habicher, Judith; Kasza, Zsolt

    2012-01-01

    The present study addresses the roles of heparan sulfate (HS) proteoglycans and chondroitin sulfate (CS) proteoglycans in the development of zebrafish pharyngeal cartilage structures. uxs1 and b3gat3 mutants, predicted to have impaired biosynthesis of both HS and CS because of defective formation...... levels of CS than control larvae, whereas morpholino-mediated suppression of csgalnact1/csgalnact2 resulted in increased HS biosynthesis. Thus, the balance of the Extl3 and Csgalnact1/Csgalnact2 proteins influences the HS/CS ratio. A characterization of the pharyngeal cartilage element morphologies...

  13. Effects of sulfate deprivation on the production of chondroitin/dermatan sulfate by cultures of skin fibroblasts from normal and diabetic individuals

    International Nuclear Information System (INIS)

    Silbert, C.K.; Humphries, D.E.; Palmer, M.E.; Silbert, J.E.

    1991-01-01

    Human skin fibroblast monolayer cultures from two normal men, three Type I diabetic men, and one Type I diabetic woman were incubated with [3H]glucosamine in the presence of diminished concentrations of sulfate. Although total synthesis of [3H]chondroitin/dermatan glycosaminoglycans varied somewhat between cell lines, glycosaminoglycan production was not affected within any line when sulfate levels were decreased from 0.3 mM to 0.06 mM to 0.01 mM to 0 added sulfate. Lowering of sulfate concentrations resulted in diminished sulfation of chondroitin/dermatan in a progressive manner, so that overall sulfation dropped to as low as 19% for one of the lines. Sulfation of chondroitin to form chondroitin 4-sulfate and chondroitin 6-sulfate was progressively and equally affected by decreasing the sulfate concentration in the culture medium. However, sulfation to form dermatan sulfate was preserved to a greater degree, so that the relative proportion of dermatan sulfate to chondroitin sulfate increased. Essentially all the nonsulfated residues were susceptible to chondroitin AC lyase, indicating that little epimerization of glucuronic acid residues to iduronic acid had occurred in the absence of sulfation. These results confirm the previously described dependency of glucuronic/iduronic epimerization on sulfation, and indicate that sulfation of the iduronic acid-containing disaccharide residues of dermatan can take place with sulfate concentrations lower than those needed for 6-sulfation and 4-sulfation of the glucuronic acid-containing disaccharide residues of chondroitin. There were considerable differences among the six fibroblast lines in susceptibility to low sulfate medium and in the proportion of chondroitin 6-sulfate, chondroitin 4-sulfate, and dermatan sulfate. However, there was no pattern of differences between normals and diabetics

  14. Effects of hydrolyzed Chlorella vulgaris by malted barley on the immunomodulatory response in ICR mice and in Molt-4 cells.

    Science.gov (United States)

    Kim, Na-Hyung; Kim, Kyu-Yeob; Jeong, Hyun-Ja; Kim, Hyung-Min; Hong, Seung-Heon; Um, Jae-Young

    2010-07-01

    Chlorella vulgaris is a unicellular and microscopic algae that is currently used in a variety of forms of tablets, capsules and liquid as a biological response modifier. The aim of this study was to investigate the effects of hydrolyzed Chlorella vulgaris by malted barley for its potential reduction of the immobility time in ICR mice and on the cytokine regulation in human T cell line, Molt-4. After a forced swimming test, the changes in aspects of blood biochemical parameters due to the administration of hydrolyzed Chlorella vulgaris by malted barley were examined. The effect of hydrolyzed Chlorella vulgaris by the malted barley-treated group for 14 days on the immobility time was significantly reduced in comparison with that of the control group (P cells. These results indicate that hydrolyzed Chlorella vulgaris by malted barley is useful for immune function improvements, enhanced physical stamina, and as a candidate for an anti-fatigue or antidepressant agent.

  15. Global source attribution of sulfate aerosol and its radiative forcing

    Science.gov (United States)

    Yang, Y.; Wang, H.; Smith, S.; Easter, R. C.; Ma, P. L.; Qian, Y.; Li, C.; Yu, H.; Rasch, P. J.

    2017-12-01

    Sulfate is an important aerosol that poses health risks and influences climate. Due to long-range atmospheric transport, local sulfate pollution could result from intercontinental influences, making domestic efforts of improving air quality inefficient. Accurate understanding of source attribution of sulfate and its radiative forcing is important for both regional air quality improvement and global climate mitigation. In this study, for the first time, a sulfur source-tagging capability is implemented in the Community Atmosphere Model (CAM5) to quantify the global source-receptor relationships of sulfate and its direct and indirect radiative forcing (DRF and IRF). Near-surface sulfate concentrations are mostly contributed by local emissions in regions with high emissions, while over regions with relatively low SO2 emissions, the near-surface sulfate is primarily attributed to non-local sources from long-range transport. The export of SO2 and sulfate from Europe contributes 20% of sulfate concentrations over North Africa, Russia and Central Asia. Sources from the Middle East account for 20% of sulfate over North Africa, Southern Africa and Central Asia in winter and autumn, and 20% over South Asia in spring. East Asia accounts for about 50% of sulfate over Southeast Asia in winter and autumn, 15% over Russia in summer, and 10% over North America in spring. South Asia contributes to 25% of sulfate over Southeast Asia in spring. Lifetime of aerosols, together with regional export, is found to determine regional air quality. The simulated global total sulfate DRF is -0.42 W m-2, with 75% contributed by anthropogenic sulfate and 25% contributed by natural sulfate. In the Southern Hemisphere tropics, dimethyl sulfide (DMS) contributes the most to the total DRF. East Asia has the largest contribution of 20-30% over the Northern Hemisphere mid- and high-latitudes. A 20% perturbation of sulfate and its precursor emissions gives a sulfate IRF of -0.44 W m-2. DMS has the

  16. Topical, Biological and Clinical Challenges in the Management of Patients with Acne Vulgaris

    Directory of Open Access Journals (Sweden)

    Anwar Al-Hammadi

    2016-05-01

    Full Text Available Acne vulgaris is one of the most common chronic inflammatory skin disorders among adolescents and young adults. It is associated with substantial morbidity and, rarely, with mortality. The exact worldwide incidence and prevalence are currently unknown. Current challenges involve improving understanding of the underlying pathophysiology of acne vulgaris and developing a practical treatment consensus. Expert panel discussions were held in 2013 and 2014 among a group of scientists and clinicians from the Omani and United Arab Emirate Dermatology Societies to ascertain the current optimal management of acne vulgaris, identify clinically relevant end-points and construct suitable methodology for future clinical trial designs. This article reviews the discussions of these sessions and recent literature on this topic.

  17. Nonstrangulating intestinal infarction associated with Strongylus vulgaris in referred Danish equine cases

    DEFF Research Database (Denmark)

    Nielsen, M. K.; Jacobsen, Stine; Olsen, Susanne Nautrup

    2016-01-01

    Reasons for performing study: Strongylus vulgaris is a pathogenic helminth parasite infecting horses and was once considered to be the primary cause of colic. Migrating larvae cause ischaemia and infarction of intestinal segments. This knowledge is derived from case reports and experimental...... (n = 48), strangulating obstructions (n = 76) and nonstrangulating infarctions (n = 20). Results: Strongylus vulgaris antibody levels were similar to control values in colics sensu lato and horses with undiagnosed colic. In contrast, nonstrangulating intestinal infarctions were significantly...... inoculations of parasite-naïve foals, and it remains unknown to what extent the parasite is associated with different types of colic. Objectives: To evaluate the role of S. vulgaris as a risk factor for different types of colic in horses. Study design: A retrospective case–control study among horses referred...

  18. Performance of conventional pcr for screening for strongylus vulgaris on horse farms

    DEFF Research Database (Denmark)

    Nielsen, Marianne K.; Wøhlk, Chamilla B.M.; Petersen, Stig L.

      Strongyle parasites are ubiquitous in grazing horses. Of these, the bloodworm Strongylus vulgaris is regarded most pathogenic. Increasing levels of anthelmintic resistance in strongyle parasites has lead to recommendations of decreased treatment intensities, and there is now a pronounced need...... for reliable tools for detection of parasite burdens in general and S. vulgaris in particular. The only method currently available is the larval culture, which is laborious and time-consuming, so veterinary practitioners most often pool samples from several horses together in one culture to save time....... This raises doubts about the reliability of the method. Recently, molecular tools have been developed to detect S. vulgaris in fecal samples. The aim of this study was to compare the performance of a conventional polymerase chain reaction (PCR) assay with the traditional larval culture and furthermore test...

  19. Prevalence of Strongylus vulgaris and Parascaris equorum in Kentucky thoroughbreds at necropsy.

    Science.gov (United States)

    Lyons, E T; Drudge, J H; Swerczek, T W; Crowe, M W; Tolliver, S C

    1981-10-15

    At necropsy of 49 Thoroughbreds from farms with generally good parasite control programs in central Kentucky, examination was specifically made for presence of Strongylus vulgaris in all of the horses and of Parascaris equorum in 21 of them. None of the deaths of the horses was caused by infections of internal parasites. Visceral arteries were examined for specimens of S vulgaris and lesions related to migrating stages of this parasite. Contents of the small intestines were examined for P equorum. Specimens of S vulgaris were recovered from 19 (39%) horses, and arterial lesions were observed in 24 (49%) of them. Parascaris equorum was found in 9 (43%) horses. Both parasites were found to persist in generally low numbers on farms in spite of their parasite control programs applied in recent years.

  20. Metformin as an adjunct therapy for the treatment of moderate to severe acne vulgaris.

    Science.gov (United States)

    Lee, John K; Smith, Andrew D

    2017-11-15

    The purpose of this literature review is to evaluate the use of metformin as an adjunct therapy in the treatment of moderate-to-severe acne in those not diagnosed with polycystic ovary syndrome (PCOS) or androgen excess. The authors conducted independent literature searches. Results were limited to clinical trials and randomized controlled trials. Studies with participants diagnosed with moderateto-severe acne vulgaris taking metformin versus placebo or other active treatment were included;studies with participants diagnosed with PCOS or androgen excess were excluded. The authors found three studies consistent with the search guidelines that evaluated the effects of metformin as adjunct therapy in moderate to severe acne vulgaris. In eachstudy, metformin was an effective adjunct therapy in the treatment of moderate-to-severe acne vulgaris.

  1. Topical, Biological and Clinical Challenges in the Management of Patients with Acne Vulgaris

    Science.gov (United States)

    Al-Hammadi, Anwar; Al-Ismaily, Abla; Al-Ali, Sameer; Ramadurai, Rajesh; Jain, Rishi; McKinley-Grant, Lynn; Mughal, Tariq I.

    2016-01-01

    Acne vulgaris is one of the most common chronic inflammatory skin disorders among adolescents and young adults. It is associated with substantial morbidity and, rarely, with mortality. The exact worldwide incidence and prevalence are currently unknown. Current challenges involve improving understanding of the underlying pathophysiology of acne vulgaris and developing a practical treatment consensus. Expert panel discussions were held in 2013 and 2014 among a group of scientists and clinicians from the Omani and United Arab Emirate Dermatology Societies to ascertain the current optimal management of acne vulgaris, identify clinically relevant end-points and construct suitable methodology for future clinical trial designs. This article reviews the discussions of these sessions and recent literature on this topic. PMID:27226905

  2. Caleosin from Chlorella vulgaris TISTR 8580 is salt-induced and heme-containing protein.

    Science.gov (United States)

    Charuchinda, Pairpilin; Waditee-Sirisattha, Rungaroon; Kageyama, Hakuto; Yamada, Daisuke; Sirisattha, Sophon; Tanaka, Yoshito; Mahakhant, Aparat; Takabe, Teruhiro

    2015-01-01

    Physiological and functional properties of lipid droplet-associated proteins in algae remain scarce. We report here the caleosin gene from Chlorella vulgaris encodes a protein of 279 amino acid residues. Amino acid sequence alignment showed high similarity to the putative caleosins from fungi, but less to plant caleosins. When the C. vulgaris TISTR 8580 cells were treated with salt stress (0.3 M NaCl), the level of triacylglycerol increased significantly. The mRNA contents for caleosin in Chlorella cells significantly increased under salt stress condition. Caleosin gene was expressed in E. coli. Crude extract of E. coli cells exhibited the cumene hydroperoxide-dependent oxidation of aniline. Absorption spectroscopy showed a peak around 415 nm which was decreased upon addition of cumene hydroperoxide. Native polyacrylamide gel electrophoresis suggests caleosin existed as the oligomer. These data indicate that a fresh water C. vulgaris TISTR 8580 contains a salt-induced heme-protein caleosin.

  3. Influence of cysteine and selenodicysteine on the uptake of zinc by Chlorella vulgaris Beijerinck

    International Nuclear Information System (INIS)

    Czauderna, M.; Samochocka, K.

    1982-01-01

    The uptake of zinc labelled with radioactive 65 Zn in the presence of cysteine and selenodicysteine by Chlorella vulgaris was examined. The concentration of zinc ions in the medium was 20 mg per 1. The uptake yield was found to be enhanced by selenodicysteine. At concentration of 10 - 7 -10 - 6 M the growth rate of Chlorella vulgaris was accelerated by the latter, provided that the specific activity of 65 Zn was 3.7 MBq/1. At this specific zinc activity cysteine increased the uptake yield during the initial 50 h of the incubation process. At specific 65 Zn-activity of 55.5 MBq/1 selenodicysteine and cysteine only slightly influenced the zinc uptake by Chlorella vulgaris. No increment in the biomass was observed at this specific zinc radioactivity. (author)

  4. Lipid accumulation from pinewood pyrolysates by Rhodosporidium diobovatum and Chlorella vulgaris for biodiesel production.

    Science.gov (United States)

    Luque, Luis; Orr, Valerie C A; Chen, Sean; Westerhof, Roel; Oudenhoven, Stijn; Rossum, Guus van; Kersten, Sascha; Berruti, Franco; Rehmann, Lars

    2016-08-01

    This study evaluated the suitability of pinewood pyrolysates as a carbon source for lipid production and cultivation of the oleaginous yeast Rhodosporidium diobovatum and the microalgae Chlorella vulgaris. Thermal decomposition of pinewood and fractional condensation were used to obtain an oil rich in levoglucosan which was upgraded to glucose by acid hydrolysis. Blending of pyrolytic sugars with pure glucose in both nitrogen rich and nitrogen limited conditions was studied for R. diobovatum, and under nitrogen limited conditions for C. vulgaris. Glucose consumption rate decreased with increasing proportions of pyrolytic sugars increasing cultivation time. While R. diobovatum was capable of growth in 100% (v/v) pyrolytic sugars, C. vulgaris growth declined rapidly in blends greater than 20% (v/v) until no growth was detected in blends >40%. Finally, the effects of pyrolysis sugars on lipid composition was evaluated and biodiesel fuel properties were estimated based on the lipid profiles. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Biomarkers of physiological responses of Octopus vulgaris to different coastal environments in the western Mediterranean Sea.

    Science.gov (United States)

    Sillero-Ríos, J; Sureda, A; Capó, X; Oliver-Codorniú, M; Arechavala-Lopez, P

    2018-03-01

    The increase of pollutants in coastal seawater could produce several harmful biological effects on marine organisms related to the production of reactive oxygen species (ROS) causing cellular and tissue damages through oxidative stress mechanisms. Common octopuses (Octopus vulgaris) inhabiting coastal areas under high anthropogenic activity of Mallorca (W-Mediterranean Sea) have the ability to control oxidative damage by triggering antioxidant enzyme responses. Analyzing the digestive glands, octopuses from human-altered coastal areas showed higher activity of superoxide dismutase (SOD), catalase (CAT) and glutathione S-transferase (GST) compared to octopuses from non-influenced coastal waters (i.e. marine reserve area). Higher metallothionein (MT) concentrations and lack of malondialdehyde (MDA) variations also reflect adaptations of O. vulgaris to polluted areas. This is the first study assessing the levels of the oxidative stress biomarkers on O. vulgaris in the Mediterranean Sea, revealing their usefulness to assess diverse environmental pollution effects on this relevant ecological and commercial species.

  6. Removal of Sulfate Ion From AN-107 by Evaporation

    International Nuclear Information System (INIS)

    GJ Lumetta; GS Klinger; DE Kurath; RL Sell; LP Darnell; LR Greenwood; CZ Soderquist; MJ Steele; MW Urie; JJ Wagner

    2000-01-01

    Hanford low-activity waste solutions contain sulfate, which can cause accelerated corrosion of the vitrification melter and unacceptable operating conditions. A method is needed to selectively separate sulfate from the waste. An experiment was conducted to evaluate evaporation for removing sulfate ion from Tank AN-107 low-activity waste. Two evaporation steps were performed. In the first step, the volume was reduced by 55% while in the second step, the liquid volume was reduced another 22%. Analysis of the solids precipitated during these evaporations revealed that large amounts of sodium nitrate and nitrite co-precipitated with sodium sulfate. Many other waste components precipitated as well. It can be concluded that sulfate removal by precipitation is not selective, and thus, evaporation is not a viable option for removing sulfate from the AN-107 liquid

  7. Metabolic interactions in methanogenic and sulfate-reducing bioreactors.

    Science.gov (United States)

    Stams, A J M; Plugge, C M; de Bok, F A M; van Houten, B H G W; Lens, P; Dijkman, H; Weijma, J

    2005-01-01

    In environments where the amount of electron acceptors is insufficient for complete breakdown of organic matter, methane is formed as the major reduced end product. In such methanogenic environments organic acids are degraded by syntrophic consortia of acetogenic bacteria and methanogenic archaea. Hydrogen consumption by methanogens is essential for acetogenic bacteria to convert organic acids to acetate and hydrogen. Several syntrophic cocultures growing on propionate and butyrate have been described. These syntrophic fatty acid-degrading consortia are affected by the presence of sulfate. When sulfate is present sulfate-reducing bacteria compete with methanogenic archaea for hydrogen and acetate, and with acetogenic bacteria for propionate and butyrate. Sulfate-reducing bacteria easily outcompete methanogens for hydrogen, but the presence of acetate as carbon source may influence the outcome of the competition. By contrast, acetoclastic methanogens can compete reasonably well with acetate-degrading sulfate reducers. Sulfate-reducing bacteria grow much faster on propionate and butyrate than syntrophic consortia.

  8. Process for removing sulfate anions from waste water

    Science.gov (United States)

    Nilsen, David N.; Galvan, Gloria J.; Hundley, Gary L.; Wright, John B.

    1997-01-01

    A liquid emulsion membrane process for removing sulfate anions from waste water is disclosed. The liquid emulsion membrane process includes the steps of: (a) providing a liquid emulsion formed from an aqueous strip solution and an organic phase that contains an extractant capable of removing sulfate anions from waste water; (b) dispersing the liquid emulsion in globule form into a quantity of waste water containing sulfate anions to allow the organic phase in each globule of the emulsion to extract and absorb sulfate anions from the waste water and (c) separating the emulsion including its organic phase and absorbed sulfate anions from the waste water to provide waste water containing substantially no sulfate anions.

  9. Immobilization of calcium sulfate contained in demolition waste

    International Nuclear Information System (INIS)

    Ambroise, J.; Pera, J.

    2008-01-01

    This paper presents the results of a laboratory study undertaken to examine the treatment of demolition waste containing calcium sulfate by means of calcium sulfoaluminate clinker (CSA). The quantity of CSA necessary to entirely consume calcium sulfate was determined. Using infrared spectrometry analysis and X-ray diffraction, it was shown that calcium sulfate was entirely consumed when the ratio between CSA and calcium sulfate was 4. Standard sand was polluted by 4% calcium sulfate. Two solutions were investigated: ·either global treatment of sand by CSA, ·or immobilization of calcium sulfate by CSA, followed by the introduction of this milled mixture in standard sand. Regardless of the type of treatment, swelling was almost stabilized after 28 days of immersion in water

  10. A radioimmunoassay for measurement of thyroxine sulfate

    International Nuclear Information System (INIS)

    Chopra, I.J.; Santini, F.; Hurd, R.E.; Chua Teco, G.N.

    1993-01-01

    A highly sensitive, specific, and reproducible RIA has been developed to measure T 4 sulfate (T 4 S) in ethanol extracts of serum. rT 3 sulfate (rT 3 S) cross-reacted 7.1%, and T 3 S cross-reacted 0.59% in the RIA; T 4 , T 3 , rT 3 and 3,3'-diiodothyronine cross-reacted 0.004% or less. The recovery of nonradioactive T 4 S added to serum averaged 95%. The detection threshold of the RIA was 18 pmol/L. The coefficient of variation averaged 6.9% within an assay and 12% between assays. T 4 S was bound by T 4 -binding globulin and albumin in serum. The free fraction of T 4 S in four normal sera averaged 0.06% compared to a value of 0.03% for T 4 (P 4 S was (mean ± SE) 19 ± 1.2 pmol/L in normal subjects, 33 ± 10 in hyperthyroid patients with Graves disease, 42 ± 15 in hypothyroid patients, 34 ± 6.9 in patients with systematic nonthyroidal illnesses, 21 ± 4.3 in pregnant women at 15-40 weeks gestation, and 245 ± 26 in cord blood sera of newborns; the value in the newborn was significantly different from normal (P 4 S. The T 4 S content of the thyroid gland was less than 1/4000th that of T 4 . We conclude that (1) T 4 S is a normal component of human serum, and its levels are markedly increased in newborn serum and amniotic fluid; and (2) the sulfation pathway plays an important role in the metabolism of T 4 in man. 28 refs., 4 figs., 2 tabs

  11. Sequence determination of synthesized chondroitin sulfate dodecasaccharides.

    Science.gov (United States)

    Shioiri, Tatsumasa; Tsuchimoto, Jun; Watanabe, Hideto; Sugiura, Nobuo

    2016-06-01

    Chondroitin sulfate (CS) is a linear acidic polysaccharide composed of repeating disaccharide units of glucuronic acid and N-acetyl-d-galactosamine. The polysaccharide is modified with sulfate groups at different positions by a variety of sulfotransferases. CS chains exhibit various biological and pathological functions by interacting with cytokines and growth factors and regulating their signal transduction. The fine structure of the CS chain defines its specific biological roles. However, structural analysis of CS has been restricted to disaccharide analysis, hampering the understanding of the structure-function relationship of CS chains. Here, we chemo-enzymatically synthesized CS dodecasaccharides having various sulfate modifications using a bioreactor system of bacterial chondroitin polymerase mutants and various CS sulfotransferases. We developed a sequencing method for CS chains using the CS dodecasaccharides. The method consists of (i) labeling a reducing end with 2-aminopyridine (PA), (ii) partial digestion of CS with testicular hyaluronidase, followed by separation of PA-conjugated oligosaccharides with different chain lengths, (iii) limited digestion of these oligosaccharides with chondroitin lyase AC II into disaccharides, followed by labeling with 2-aminobenzamide, (iv) CS disaccharide analysis using a dual-fluorescence HPLC system (reversed-phase ion-pair and ion-exchange chromatography), and (v) estimation of the composition by calculating individual disaccharide ratios. This CS chain sequencing allows characterization of CS-modifying enzymes and provides a useful tool toward understanding the structure-function relationship of CS chains. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  12. Evaluation of conventional PCR for detection of Strongylus vulgaris on horse farms.

    Science.gov (United States)

    Bracken, M K; Wøhlk, C B M; Petersen, S L; Nielsen, M K

    2012-03-23

    Strongyle parasites are ubiquitous in grazing horses. Of these, the bloodworm Strongylus vulgaris is regarded as most pathogenic. Increasing levels of anthelmintic resistance in strongyle parasites has led to recommendations of decreased treatment intensities, and there is now a pronounced need for reliable tools for detection of parasite burdens in general and S. vulgaris in particular. The only method currently available for diagnosing S. vulgaris in practice is the larval culture, which is laborious and time-consuming, so veterinary practitioners most often pool samples from several horses together in one culture to save time. Recently, molecular tools have been developed to detect S. vulgaris in faecal samples. The aim of this study was to compare the performance of a conventional polymerase chain reaction (PCR) assay with the traditional larval culture and furthermore test the performance of pooled versus individual PCR for farm screening purposes. Faecal samples were obtained from 331 horses on 18 different farms. Farm size ranged from 6 to 56 horses, and horses aged between 2 months and 31 years. Larval cultures and PCR were performed individually on all horses. In addition, PCR was performed on 66 faecal pools consisting of 3-5 horses each. Species-specific PCR primers previously developed were used for the PCR. PCR and larval culture detected S. vulgaris in 12.1 and 4.5% of individual horses, respectively. On the farm level, eight farms tested positive with the larval culture, while 13 and 11 farms were positive with the individual and pooled PCRs, respectively. The individual PCR method was statistically superior to the larval culture, while no statistical difference could be detected between pooled and individual PCR for farm screening. In conclusion, pooled PCR appears to be a useful tool for farm screening for S. vulgaris. Copyright © 2011 Elsevier B.V. All rights reserved.

  13. Evaluation of leptin, adiponectin, and ghrelin levels in patients with acne vulgaris.

    Science.gov (United States)

    Ozuguz, P; Kacar, S D; Asik, G; Ozuguz, U; Karatas, S

    2016-02-09

    The research evaluating adipokines are very few in patients with acne vulgaris. The hypothesis that hyperinsulinemic and high glycemic index diet plays a role in the pathogenesis of acne is still controversial. In this study, we aimed to evaluate adipokines such as leptin (L), adiponectin (A), ghrelin and A levels, and A/L rates that indicate insulin resistance in nonobese patients with severe acne vulgaris. Thirty patients who are nonobese with moderate acne vulgaris, aged 18 to 25 years, and 15 age-sex compatible controls were included in our study. The acne lesions were assessed using the Global Acne Grading Scale (GAGS). All participants were evaluated for the parameters that may affect the metabolism of serum L, A, and ghrelin levels in blood, and their body mass index were calculated. The significance level was determined as p ≤ 0.05. Of the 30 patients, 17 were women and 13 were men. The mean age was 20.60 years and the mean duration of the disease were 2.8 years. All of patients had moderate acne vulgaris (GAGS 19-30). Of the 15 controls, 11 were women and 4 were men. The mean age was 21.20 years. There were not a statistically significant difference in L, ghrelin, A levels, and A/L ratio between the two groups. Adipokines may have a role in the pathogenesis of acne vulgaris. L, A, ghrelin, and insulin resistance may not participate in the responsible mechanisms in nonobese patients with moderate acne vulgaris. © The Author(s) 2016.

  14. Growth of Chlorella vulgaris and nutrient removal in the wastewater in response to intermittent carbon dioxide.

    Science.gov (United States)

    Liu, Xiaoning; Ying, Kezhen; Chen, Guangyao; Zhou, Canwei; Zhang, Wen; Zhang, Xihui; Cai, Zhonghua; Holmes, Thomas; Tao, Yi

    2017-11-01

    In this study, Chlorella vulgaris (C. vulgaris) were cultured in cell culture flask supplied with intermittent CO 2 enriched gas. The impact of CO 2 concentration (from 1% to 20% v/v) on the growth of C. vulgaris cultured in domestic wastewater was exploited in various perspectives which include biomass, specific growth rate, culture pH, carbon consumption, and the removal of nitrogen and phosphorus compounds. The results showed that the maximum microalgal biomass concentration, 1.12 g L -1 , was achieved with 10% CO 2 as a feed gas. At 20% CO 2 the growth of C. vulgaris suffered from inhibition during initial 1.5 d, but acclimated to low pH (6.3 in average) with relatively higher specific growth rate (0.3-0.5 d -1 ) during subsequent culture period. After the rapid consumption of ammonium in the wastewater, an obvious decline in the nitrate concentration was observed, indicating that C. vulgaris prefer ammonium as a primary nitrogen source. The total nitrogen and phosphorus decreased from 44.0 mg L -1 to 2.1-5.4 mg L -1 and from 5.2 mg L -1 to 0-0.6 mg L -1 within 6.5 d under the aeration of 1-20% CO 2 , respectively, but no significant difference in consumed nitrogen versus phosphorus ratio was observed among different CO 2 concentration. The kinetics of nutrients removal were also determined through the application of pseudo first order kinetic model. 5-10% CO 2 aeration was optimal for the growth of C. vulgaris in the domestic wastewater, based on the coupling of carbon consumption, microalgal biomass, the nutrients removal and kinetics constants. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Pyrrolizidine alkaloid variation in Senecio vulgaris populations from native and invasive ranges

    Science.gov (United States)

    Nguyen, Viet-Thang; Ndihokubwayo, Noel; Ge, Jiwen; Mulder, Patrick P.J.

    2017-01-01

    Biological invasion is regarded as one of the greatest environmental problems facilitated by globalization. Some hypotheses about the invasive mechanisms of alien invasive plants consider the plant–herbivore interaction and the role of plant defense in this interaction. For example, the “Shift Defense Hypothesis” (SDH) argues that introduced plants evolve higher levels of qualitative defense chemicals and decreased levels of quantitative defense, as they are released of the selective pressures from specialist herbivores but still face attack from generalists. Common groundsel (Senecio vulgaris), originating from Europe, is a cosmopolitan invasive plant in temperate regions. As in other Senecio species, S. vulgaris contains pyrrolizidine alkaloids (PAs) as characteristic qualitative defense compounds. In this study, S. vulgaris plants originating from native and invasive ranges (Europe and China, respectively) were grown under identical conditions and harvested upon flowering. PA composition and concentration in shoot and root samples were determined using Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS). We investigated the differences between native and invasive S. vulgaris populations with regard to quantitative and qualitative variation of PAs. We identified 20 PAs, among which senecionine, senecionine N-oxide, integerrimine N-oxide and seneciphylline N-oxide were dominant in the roots. In the shoots, in addition to the 4 PAs dominant in roots, retrorsine N-oxide, spartioidine N-oxide and 2 non-identified PAs were also prevalent. The roots possessed a lower PA diversity but a higher total PA concentration than the shoots. Most individual PAs as well as the total PA concentration were strongly positively correlated between the roots and shoots. Both native and invasive S. vulgaris populations shared the pattern described above. However, there was a slight trend indicating lower PA diversity and lower total PA concentration in invasive S. vulgaris

  16. Pyrrolizidine alkaloid variation in Senecio vulgaris populations from native and invasive ranges

    Directory of Open Access Journals (Sweden)

    Dandan Cheng

    2017-08-01

    Full Text Available Biological invasion is regarded as one of the greatest environmental problems facilitated by globalization. Some hypotheses about the invasive mechanisms of alien invasive plants consider the plant–herbivore interaction and the role of plant defense in this interaction. For example, the “Shift Defense Hypothesis” (SDH argues that introduced plants evolve higher levels of qualitative defense chemicals and decreased levels of quantitative defense, as they are released of the selective pressures from specialist herbivores but still face attack from generalists. Common groundsel (Senecio vulgaris, originating from Europe, is a cosmopolitan invasive plant in temperate regions. As in other Senecio species, S. vulgaris contains pyrrolizidine alkaloids (PAs as characteristic qualitative defense compounds. In this study, S. vulgaris plants originating from native and invasive ranges (Europe and China, respectively were grown under identical conditions and harvested upon flowering. PA composition and concentration in shoot and root samples were determined using Liquid Chromatography-Tandem Mass Spectrometry (LC-MS/MS. We investigated the differences between native and invasive S. vulgaris populations with regard to quantitative and qualitative variation of PAs. We identified 20 PAs, among which senecionine, senecionine N-oxide, integerrimine N-oxide and seneciphylline N-oxide were dominant in the roots. In the shoots, in addition to the 4 PAs dominant in roots, retrorsine N-oxide, spartioidine N-oxide and 2 non-identified PAs were also prevalent. The roots possessed a lower PA diversity but a higher total PA concentration than the shoots. Most individual PAs as well as the total PA concentration were strongly positively correlated between the roots and shoots. Both native and invasive S. vulgaris populations shared the pattern described above. However, there was a slight trend indicating lower PA diversity and lower total PA concentration in

  17. Sulfated oligosaccharide structures, as determined by NMR techniques

    International Nuclear Information System (INIS)

    Noseda, M.D.; Duarte, M.E.R.; Tischer, C.A.; Gorin, P.A.J.; Cerezo, A.S.

    1997-01-01

    Carrageenans are sulfated polysaccharides, produced by red seaweeds (Rhodophyta), that have important biological and physico-chemical properties. Using partial autohydrolysis, we obtained sulfated oligosaccharides from a λ-carrageenan (Noseda and Cerezo, 1993). These oligosaccharides are valuable not only for the study of the structures of the parent carrageenans but also for their possible biological activities. In this work we determined the chemical structure of one of the sulfated oligosaccharides using 1D and 2D NMR techniques. (author)

  18. Hydrometallurgical process for recovering iron sulfate and zinc sulfate from baghouse dust

    Science.gov (United States)

    Zaromb, Solomon; Lawson, Daniel B.

    1994-01-01

    A process for recovering zinc/rich and iron-rich fractions from the baghouse dust that is generated in various metallurgical operations, especially in steel-making and other iron-making plants, comprises the steps of leaching the dust by hot concentrated sulfuric acid so as to generate dissolved zinc sulfate and a precipitate of iron sulfate, separating the precipitate from the acid by filtration and washing with a volatile liquid, such as methanol or acetone, and collecting the filtered acid and the washings into a filtrate fraction. The volatile liquid may be recovered distillation, and the zinc may be removed from the filtrate by alternative methods, one of which involves addition of a sufficient amount of water to precipitate hydrated zinc sulfate at 10.degree. C., separation of the precipitate from sulfuric acid by filtration, and evaporation of water to regenerate concentrated sulfuric acid. The recovery of iron may also be effected in alternative ways, one of which involves roasting the ferric sulfate to yield ferric oxide and sulfur trioxide, which can be reconverted to concentrated sulfuric acid by hydration. The overall process should not generate any significant waste stream.

  19. Purification, structural characterization and antiproliferative properties of chondroitin sulfate/dermatan sulfate from tunisian fish skins.

    Science.gov (United States)

    Krichen, Fatma; Volpi, Nicola; Sila, Assaâd; Maccari, Francesca; Mantovani, Veronica; Galeotti, Fabio; Ellouz-Chaabouni, Semia; Bougatef, Ali

    2017-02-01

    Chondroitin sulfate/dermatan sulfate GAGs were extracted and purified from the skins of grey triggerfish (GTSG) and smooth hound (SHSG). The disaccharide composition produced by chondroitinase ABC treatment showed the presence of nonsulfated disaccharide, monosulfated disaccharides ΔDi6S and ΔDi4S, and disulfated disaccharides in different percentages. In particular, the nonsulfated disaccharide ΔDi0S of GTSG and SHSG were 3.5% and 5.5%, respectively, while monosulfated disaccharides ΔDi6S and ΔDi4S were evaluated to be 18.2%, 59% and 14.6%, 47.0%, respectively. Capillary elecrophoresis analysis of GTSG and SHSG contained 99.2% and 95.4% of chondroitin sulfate/dermatan sulfate, respectively. PAGE analysis showed a GTSG and SHSG having molecular masses with average values of 41.72KDa and 23.8KDa, respectively. HCT116 cell proliferation was inhibited (p<0.05) by 70.6% and 72.65% at 200μg/mL of GTSG and SHSG respectively. Both GTSG and SHSG demonstrated promising antiproliferative potential, which may be used as a novel, effective agent. Copyright © 2016 Elsevier B.V. All rights reserved.

  20. Inter vs. intraglycosidic acetal linkages control sulfation pattern in semi-synthetic chondroitin sulfate.

    Science.gov (United States)

    Laezza, Antonio; De Castro, Cristina; Parrilli, Michelangelo; Bedini, Emiliano

    2014-11-04

    Microbial-sourced unsulfated chondroitin could be converted into chondroitin sulfate (CS) polysaccharide by a multi-step strategy relying upon benzylidenation and acetylation reactions as key-steps for its regioselective protection. By conducting the two reactions one- or two-pots, CSs with different sulfation patterns could be obtained at the end of the semi-synthesis. In particular, a CS polysaccharide possessing sulfate groups randomly distributed between positions 4 and 6 of N-acetyl-galactosamine (GalNAc) units could be obtained through the two-pots route, whereas the one-pot pathway allowed an additional sulfation at position 3 of some glucuronic acid (GlcA) units. This difference was ascribed to the stabilization of a labile interglycosidic benzylidene acetal involving positions O-3 and O-6 of some GlcA and GalNAc, respectively, when the benzylidene-acetylation reactions were conducted in a one-pot fashion. Isolation and characterization of a polysaccharide intermediate showing interglycosidic acetal moieties was accomplished. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Production and characterization of monospecific adult worm infections of Strongylus vulgaris and Strongylus edentatus in ponies.

    Science.gov (United States)

    McClure, J R; Chapman, M R; Klei, T R

    1994-02-01

    Since 1978, 20 surgical implantations of either Strongylus vulgaris or Strongylus edentatus have been performed in our laboratory for the purpose of obtaining single species cultures of these parasites. Following surgical implantation peak EPG values of 13-327 (S. vulgaris) and 363-1284 (S. edentatus) generally occurred during the first 3 weeks post-implantation. Duration of infections was as long as 5 years. Successful outcome of such surgeries appears to be related to the total number of parasites used (> or = 38) and the ratio of female to male worms implanted (1:1 or 2:1).

  2. Radiation-induced pemphigus vulgaris of the breast; Pemphigus vulgaire radio-induit du sein

    Energy Technology Data Exchange (ETDEWEB)

    Vigna-Taglianti, R.; Russi, E.G. [Department of radiotherapy, Santa Croce e Carle general hospital, Via M. Coppino, 12100 Cuneo (Italy); Denaro, N. [Oncology department, university of Messina, Via consolare Valeria no 1, 98100 Messina (Italy); Numico, G. [Department of medical oncology, U. Parini hospital, 11100 Aosta (Italy); Brizio, R. [Department of histopathology, Santa Croce e Carle general hospital, Via M. Coppino, 12100 Cuneo (Italy)

    2011-07-15

    Pemphigus vulgaris is a rare autoimmune muco-cutaneous bullous disease. Patients with a history of pemphigus vulgaris - who need radiotherapy - may show a long lasting bullous cutaneous manifestation, typical of pemphigus, within radiation fields. The literature describes fewer than 20 radio-induced cases. While systematic corticosteroid therapy has proven to be useful, topical treatment used in association with corticosteroid therapy is rarely described. To our knowledge the use of modern dressing products has never been described. We report our experience in a case in which modern dressing products were usefully associated to systemic therapy. (authors)

  3. CO2 capture from air by Chlorella vulgaris microalgae in an airlift photobioreactor.

    Science.gov (United States)

    Sadeghizadeh, Aziz; Farhad Dad, Farid; Moghaddasi, Leila; Rahimi, Rahbar

    2017-11-01

    In this work, hydrodynamics and CO 2 biofixation study was conducted in an airlift bioreactor at the temperature of 30±2°C. The main objective of this work was to investigate the effect of high gas superficial velocity on CO 2 biofixation using Chlorella vulgaris microalgae and its growth. The study showed that Chlorella vulgaris in high input gas superficial velocity also had the ability to grow and remove the CO 2 by less than 80% efficiency. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Current Pathophysiological Aspects and Therapeutic Modalities for Pemphigus Vulgaris : A Review

    Directory of Open Access Journals (Sweden)

    J Raviraj

    2007-01-01

    Full Text Available Pemphigus vulgaris (PV is an autoimmune disorder manifesting primarily as blisters involving the mucocutaneous systems. The current medical literature indicates many breakthroughs in the research of pathophysiology and treatment aspects of PV. This article tries to describe some of the novel aspects briefing the role of nondesmoglein antibodies and the role of TNF-alpha in the etiopathogenesis of pemphigus vulgaris and the role of newer therapeutic modalities like Rituximab, Etanercept, intravenous Immunoglobulins, cholinergic drugs, arid the like in the treatment of PV.

  5. Sulfate Formation on Mars by Volcanic Aerosols: A New Look

    Science.gov (United States)

    Blaney, D. L.

    1996-03-01

    Sulfur was measured at both Viking Lander sites in abundances of 5-9 wt % SO3. Because the sulfur was more concentrated in clumps which disintegrated and the general oxidized nature of the Martian soil, these measurements led to the assumption that a sulfate duricrust existed. Two types of models for sulfate formation have been proposed. One is a formation by upwardly migrating ground water. The other is the formation of sulfates by the precipitation of volcanic aerosols. Most investigators have tended to favor the ground water origin of sulfates on Mars. However, evidence assemble since Viking may point to a volcanic aerosol origin.

  6. Bicarbonate sulfate exchange in canalicular rat liver plasma membrane vesicles

    International Nuclear Information System (INIS)

    Meier, P.J.; Valantinas, J.; Hugentobler, G.; Rahm, I.

    1987-01-01

    The mechanism(s) and driving forces for biliary excretion of sulfate were investigated in canalicular rat liver plasma membrane vesicles (cLPM). Incubation of cLPM vesicles in the presence of an inside-to-outside (in, out) bicarbonate gradient but not pH or out-to-in sodium gradients, stimulated sulfate uptake 10-fold compared with the absence of bicarbonate and approximately 2-fold above sulfate equilibrium (overshoot). Initial rates of this bicarbonate gradient-driven [ 35 S]-sulfate uptake were saturable with increasing concentrations of sulfate and could be inhibited by probenecid, N-(4-azido-2-nitrophenyl)-2-aminoethylsulfonate, acetazolamide, furosemide, 4-acetamideo-4'-isothiocyanostilbene-2,2'-disulfonic acid, and 4,4'-diisothiocyanostilbene-2,2'-disulfonic acid (IC 50 , ∼40 μM). Cisinhibition of initial bicarbonate gradient-stimulated sulfate uptake and transstimulation of sulfate uptake in the absence of bicarbonate were observed with sulfate, thiosulfate, and oxalate but not with chloride, nitrate, phosphate, acetate, lactate, glutamate, aspartate, cholate, taurocholate, dehydrocholate, taurodehydrocholate, and reduced or oxidized glutathione. These findings indicate the presence of a sulfate (oxalate)-bicarbonate anion exchange system in canalicular rat liver plasma membranes. These findings support the concept that bicarbonate-sensitive transport system might play an important role in bile acid-independent canalicular bile formation

  7. Mencegah Pembentukan Kalsium Sulfat pada Desalinasi Air Laut

    Directory of Open Access Journals (Sweden)

    Mirna Rahmah Lubis

    2007-06-01

    Full Text Available Resin penukar-anion, Relite MG 1/P, dapat digunakan untuk memisahkan sulfat dalam air laut guna mencegah pembentukan kerak kalsium sulfat pada heat exchanger. Resin tersebut menunjukkan selektivitas sulfat yang tinggi dalam air laut sintetis. Resin yang telah dipakai dapat diregenerasi menggunakan air asin yang dipekatkan dengan asam hingga mencapai pH 4. Untuk waktu pemakaian dan regenerasi yang sama, faktor konsentrasi desalinasi (misalnya 2 hingga 4 menaikkan konsentrasi klorida dalam air asin yang diblowdown. Dengan faktor konsentrasi yang tetap, kenaikan laju alir (pengurangan waktu pemakaian dan regenerasi memperendah efisiensi regenerasi dan menaikkan pemisahan sulfat. Akibat kelarutan kalsium sulfat yang bersifat terbalik tersebut, temperatur air asin yang tinggi memerlukan pemisahan sulfat yang lebih banyak, yang dapat dicapai dengan mengurangi laju alir air laut. Pengurangan laju alir tersebut membutuhkan peralatan yang lebih besar dan resin yang lebih banyak, sehingga biaya modal bertambah. Untuk pabrik desalinasi dengan kapasitas produksi 1 juta gallon per hari dan faktor konsentrasi sebesar 2, biaya pemisahan sulfat meliputi biaya resin dan biaya peralatan. Biaya tersebut bervariasi dari $0.246 hingga $0.356/kgalon (per ribu galon air yang diproduksi karena temperatur maksimum air asin berubah dari 140°C menjadi 180°C. Keywords: desalinasi air laut, ion exchange, kalsium sulfat, kerak; mechanical vapor compression (MVC, pemisahan sulfat, resin penukar-anion basa lemah

  8. Divergent Synthesis of Chondroitin Sulfate Disaccharides and Identification of Sulfate Motifs that Inhibit Triple Negative Breast Cancer

    Science.gov (United States)

    Wei Poh, Zhong; Heng Gan, Chin; Lee, Eric J.; Guo, Suxian; Yip, George W.; Lam, Yulin

    2015-09-01

    Glycosaminoglycans (GAGs) regulate many important physiological processes. A pertinent issue to address is whether GAGs encode important functional information via introduction of position specific sulfate groups in the GAG structure. However, procurement of pure, homogenous GAG motifs to probe the “sulfation code” is a challenging task due to isolation difficulty and structural complexity. To this end, we devised a versatile synthetic strategy to obtain all the 16 theoretically possible sulfation patterns in the chondroitin sulfate (CS) repeating unit; these include rare but potentially important sulfated motifs which have not been isolated earlier. Biological evaluation indicated that CS sulfation patterns had differing effects for different breast cancer cell types, and the greatest inhibitory effect was observed for the most aggressive, triple negative breast cancer cell line MDA-MB-231.

  9. Noncatalytic transformation of the crude lipid of ChlorellaI vulgaris into fatty acid methyl ester (FAME) with charcoal via a thermo-chemical process.

    Science.gov (United States)

    Kwon, Eilhann E; Jeon, Young Jae; Yi, Haakrho

    2013-02-01

    The noncatalytic transformation of the crude lipid of Chlorella vulgaris (C. vulgaris) into fatty acid methyl ester (FAME) via a thermo-chemical process was mainly investigated in this work. The crude lipid of C. vulgaris was recovered by means of solvent extraction from C. vulgaris cultivated in a raceway pond. The conventional catalyzed transesterification of crude lipid of C. vulgaris is notably inhibited by the impurities contained in the crude lipid of C. vulgaris. These impurities are inevitably derived from the solvent extraction process for C. vulgaris. However, this work presents the noncatalytic transesterification of microalgal lipid into FAME, which could be an alternative option. For example, the noncatalytic transformation of microalgal lipid into FAME provides evidence that the esterification of free fatty acids (FFAs) and the transesterification of triglycerides can be combined into a single step less susceptible to the impurities and with a high conversion efficiency (∼97%). Copyright © 2012 Elsevier Ltd. All rights reserved.

  10. Acute Exacerbations of COPD Are Associated With Increased Expression of Heparan Sulfate and Chondroitin Sulfate in BAL.

    Science.gov (United States)

    Papakonstantinou, Eleni; Klagas, Ioannis; Roth, Michael; Tamm, Michael; Stolz, Daiana

    2016-03-01

    Acute exacerbations of COPD (AECOPDs) are associated with accelerated aggravation of clinical symptoms and deterioration of pulmonary function. The mechanisms by which exacerbations may contribute to airway remodeling and declined lung function are poorly understood. We investigated whether AECOPDs are associated with differential expression of glycosaminoglycans in BAL in a cohort of 97 patients with COPD. Patients with COPD with either stable disease (n = 53) or AECOPD (n = 44) and undergoing diagnostic bronchoscopy were matched for demographics and lung function parameters. Levels of heparan sulfate, chondroitin sulfate, dermatan sulfate, and matrix metalloproteinases (MMPs) in BAL were measured by enzyme-linked immunosorbent assay. Heparan sulfate and chondroitin sulfate were significantly increased in BAL of patients during exacerbations. Levels of heparan sulfate were higher in the BAL of patients with microbial infections. Chondroitin sulfate was negatively correlated with FEV1 % predicted but not with diffusing capacity of lung for carbon monoxide % predicted, indicating that chondroitin sulfate is associated with airway remodeling, leading to obstruction rather than to emphysema. Furthermore, heparan sulfate and chondroitin sulfate were significantly correlated with MMP-9, MMP-2, and MMP-12 in BAL, indicating that they were cleaved from their respective proteoglycans by MMPs and subsequently washed out in BAL. During AECOPD, there is increased expression of heparan sulfate and chondroitin sulfate in BAL. These molecules are significantly correlated with MMPs in BAL, indicating that they may be associated with airway remodeling and may lead to lung function decline during exacerbations of COPD. Copyright © 2016 American College of Chest Physicians. Published by Elsevier Inc. All rights reserved.

  11. Medical Gains of Chondroitin Sulfate Upon Fucosylation.

    Science.gov (United States)

    Pomin, Vitor H

    2015-01-01

    Chondroitin sulfate (CS) is a glycosaminoglycan (GAG) composed of alternating N-acetyl galactosamine and glucuronic acid units within disaccharide building blocks. CS is a key functional component in proteoglycans of cartilaginous tissues. Owing to its numerous biological roles, CS is widely explored in the pharmaceutical market as nutraceutical ingredient commonly utilized against arthritis, osteoarthrosis, and sometimes osteoporosis. Tissues like shark cartilage and bovine trachea are common sources of CS. Nonetheless, a new CS type has been introduced and investigated in the last few decades in what regards its medical potentials. It is named fucosylated chondroitin sulfate (FucCS). This less common CS type is isolated exclusively from the body wall of sea cucumbers. The presence of fucosyl branching units in the holothurian FucCS gives to this unique GAG, therapeutic properties in various pathophysiological systems which are inexistent in the common CS explored in the market. Examples of these systems are coagulation, thrombosis, hemodialysis, atherosclerosis, cellular growth, angiogenesis, fibrosis, tumor growth, inflammation, viral and protozoan infections, hyperglycemia, diabetes-related pathological events and tissue damage. This report aims at describing the medical benefits gained upon fucosylation of CS. Clinical prospects of these medical benefits are also discussed herein.

  12. Optimizing substrate for sulfate-reducing bacteria

    International Nuclear Information System (INIS)

    Chang, L.K.; Updegraff, D.M.; Wildeman, T.R.

    1991-01-01

    Microbial sulfate reduction followed by sulfide precipitation effectively removes heavy metals from wastewaters. The substrate in the anaerobic zone in a constructed wetland can be designed to emphasize this removal process. This group of bacteria requires CH 2 O, P, N, and SO 4 =, reducing conditions, and pH range of 5-9 (pH=7 is optimum). The objective of this study was to find an inexpensive source of nutrients that would give the best initial production of sulfide and make a good wetland substrate. All tested materials contain sufficient P and N; mine drainage provides sulfate. Thus, tests focused on finding organic material that provides the proper nutrients and does not cause the culture to fall below pH of 5. Among chemical nutrients, sodium lactate combined with (NH 4 ) 2 HPO 4 were the only compounds that produced sulfide after 11 days. Among complex nutrients, only cow manure produced sulfide after 26 days. Among complex carbohydrates, cracked corn and raw rice produced sulfide after 10 days. Most substrates failed to produce sulfide because anaerobic fermentation reduced the pH below 5. Presently, cracked corn is the best candidate for a substrate. Five grams of cow manure produced 0.14 millimole of sulfide whereas 0.1 g of cracked corn produced 0.22 millimole

  13. Autoantibodies other than anti-desmogleins in pemphigus vulgaris patients

    Directory of Open Access Journals (Sweden)

    Marwah Adly Saleh

    2017-01-01

    Full Text Available Background: Pemphigus vulgaris (PV is an immunoglobulin G-mediated autoimmune bullous skin disease. Nonorgan-specific antibodies were detected in Tunisian and Brazilian pemphigus patients with different prevalence. Materials and Methods: Fifty PV patients and fifty controls were screened for antinuclear antibodies (ANAs, anti-smooth muscle antibodies (ASMAs, anti-parietal antibodies (APAs, anti-mitochondrial antibodies, and Anti-nuclear cytoplasmic antibodies (ANCA by indirect immunofluorescence. Results: Thirty-nine patients were female and 11 were male. Fifteen patients did not receive treatment before while 35 patients were on systemic steroid treatment ± azathioprine. Twenty (40% of the PV patients and 1 (2% control had positive ANA. ANA was significantly higher in PV patients than controls, P< 0.0001. ASMAs were detected in 20 (40% PV patients and none of the controls. ASMA was significantly higher in PV patients than controls, P< 0.0001. No significant difference was detected between treated and untreated regarding ANA, P - 0.11. However, there was a significant difference between treated and untreated regarding ASMA, P- 0.03. Six patients (12% and none of the controls had positive APA. There was a significant difference between the patients and the controls in APA. P- 0.027. Conclusion: Egyptian PV patients showed more prevalent ANA, ASMA, and APA than normal controls. Follow-up of those patients is essential to detect the early development of concomitant autoimmune disease. Environmental factors might account for the variability of the nonorgan-specific antibodies among different populations.

  14. Diversification and Population Structure in Common Beans (Phaseolus vulgaris L.)

    Science.gov (United States)

    Blair, Matthew W.; Soler, Alvaro; Cortés, Andrés J.

    2012-01-01

    Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13) for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican), Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru). The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of cultivated beans

  15. Importance of the dentist in early diagnosis of pemphigus vulgaris

    Directory of Open Access Journals (Sweden)

    Thiago de Santana Santos

    2009-10-01

    Full Text Available The vulgar pemphigus is a chronic, rare, vesicle-bubble disease of autoimmune origin and with a possibility of following a dangerous clinical course when it is not diagnosed and treated in its initial stage. It usually affects people from 40 to 60 years old, being rare in children. In the majority of cases, oral manifestations are the first signs of the disease, so that dentists play an important rol in its early diagnosis. The authors present a case report of vulgar pemphigus in a 17 year-old patient, attended by the Bucco-Maxillo-Facial Surgery Service of the “Fundação de Beneficência Hospital de Cirurgia” in Aracaju-SE, Brazil. The patient was admitted with a complaint of the presence of numerous scattered painful ulcers in the mouth that had developed in approximately two months, and reported that at first, blisters that broke quickly appeared, leading to extremely painful ulcerations. Incisional biopsies were performed in the jugal mucosa and retromolar regions, and also a complete hemogram to discard the hypothesis of leukemia. In view of the clinical and histopathological findings, the final diagnosis of pemphigus vulgaris was made. Before receiving specialized treatment, the patient presented marked worsening of the clinical condition, with exacerbation of intraoral signs and symptoms and development of skin lesions around the body surface. The patient was hospitalized in the “Hospital Universitário da Universidade Federal de Sergipe” and treated with prednisone, cimetidine and nystatin, showing significant improvement of symptoms in approximately two weeks. At present, the patient is under the care of an interdisciplinary team that includes dermatologists and dentists.

  16. The efficacy of acyclovir in treatment of the pemphigus vulgaris

    Directory of Open Access Journals (Sweden)

    Fariba Iraji

    2013-01-01

    Full Text Available Background: Pemphigus is a group of autoimmune blistering diseases of the skin and mucous membranes caused by the presence of antibodies against adhesion molecules on the cell surface of keratinocytes. The possible role of herpes simplex virus infection in the pathogenesis of pemphigus vulgaris (PV has been suggested. In this study, we evaluated the impact of a course of acyclovir in improvement of the pemphigus patients and reduction of the hospitalization duration. Materials and Methods: A total of 30 patients with definitive diagnosis of PV were recruited in study. They were randomized in two groups. One group received routine treatment and another received the routine plus 2 week course of oral acyclovir (1200 mg/day. The improvement was defined as a more than 50% change in baseline severity score of the disease. All data was registered at the checklists and after follow-up period, the statistical analyses were performed by aid of t-test and Fisher′s exact test. Results: There was no statistically significant difference in mean severity score and improvement rates between two groups at the end of study (P > 0.05. Meanwhile, there was no statistical difference in duration of hospitalization in two groups (P > 0.05 though the severity score and hospitalization duration were apparently less in acyclovir-group than control group. Neither of the patients (in acyclovir group showed any side effect. Conclusion: We did not observe any difference between response to treatment and hospitalization period in the group that was treated with acyclovir as compared with control group. However, the partial and complete remissions were higher in patients on acyclovir therapy compared to controls. In those pemphigus patients who do not respond to sufficient immunosuppressive regimen or show a sudden relapse after reaching partial or complete clinical remission, a trial of oral acyclovir therapy may have promising result.

  17. Characterization of iron uptake from hydroxamate siderophores by Chlorella vulgaris

    International Nuclear Information System (INIS)

    Allnutt, F.C.T.

    1985-01-01

    Iron uptake by Chlorella vulgaris from ferric-hydroxamate siderophores and the possible production of siderophores by these algae was investigated. No production of siderophores or organic acids was observed. Iron from the two hydroxamate siderophores tested, ferrioximine B (Fe 3+ -DFOB) and ferric-rhodotorulate (Fe 3+ -RA), was taken up at the same rate as iron chelated by citrate or caffeate. Two synthetic chelates, Fe 3+ -EDTA and Fe 3+ -EDDHA, provided iron at a slower rate. Iron uptake was inhibited by 50 μM CCCP or 1 mM vanadate. Cyanide (100 μM KCN) or 25 μM antimycin A failed to demonstrate a link between uptake and respiration. Labeled iron ( 55 Fe) was taken up while labeled ligands ([ 14 C] citrate or RA) were not accumulated. Cation competition from Ni 2+ and Co 2+ observed using Fe 3+ -DFOB and Fe 3+ -RA while iron uptake from Fe 3+ -citrate was stimulated. Iron-stress induced iron uptake from the hydroxamate siderophores. Ferric reduction from the ferric-siderophores was investigated with electron paramagnetic resonance (EPR) and bathophenathroline disulfonate (BPDS). Ferric reduction was induced by iron-stress and inhibited by CCCP. A close correlation between iron uptake and ferric reduction was measured by the EPR method. Ferric reduction measured by the BPDS method was greater than that measure by EPR. BPDS reduction was interpreted to indicate a potential for reduction while EPR measures the physiological rate of reduction. BPDS inhibition of iron uptake and ferricyanide interference with reduction indicate that reduction and uptake occur exposed to the external medium. Presumptive evidence using a binding dose response curve for Fe 3+ -DFOB indicated that a receptor may be involved in this mechanism

  18. Purification and partial characterization of Phaseolus vulgaris seed aminopeptidase

    Directory of Open Access Journals (Sweden)

    Abdala A.P.

    1999-01-01

    Full Text Available The aminopeptidase activity of Phaseolus vulgaris seeds was measured using L-Leu-p-nitroanilide and the L-aminoacyl-ß-naphthylamides of Leu, Ala, Arg and Met. A single peak of aminopeptidase activity on Leu-ß-naphthylamide was eluted at 750 µS after gradient elution chromatography on DEAE-cellulose of the supernatant of a crude seed extract. The effluent containing enzyme activity was applied to a Superdex 200 column and only one peak of aminopeptidase activity was obtained. SDS-polyacrylamide gel electrophoresis (10% presented only one protein band with molecular mass of 31 kDa under reducing and nonreducing conditions. The aminopeptidase has an optimum pH of 7.0 for activity on all substrates tested and the highest Vmax/KM ratio for L-Leu-ß-naphthylamide. The enzyme activity was increased 40% by 0.15 M NaCl, inhibited 94% by 2.0 mM Zn2+, inhibited 91% by sodium p-hydroxymercuribenzoate and inhibited 45% by 0.7 mM o-phenanthroline and 30 µM EDTA. Mercaptoethanol (3.3 mM, dithioerythritol (1.7 mM, Ala, Arg, Leu and Met (70 µM, p-nitroaniline (0.25 mM and ß-naphthylamine (0.53 mM had no effect on enzyme activity when assayed with 0.56 mM of substrate. Bestatin (20 µM inhibited 18% the enzyme activity. The aminopeptidase activity in the seeds decayed 50% after two months when stored at 4oC and room temperature. The enzyme is leucyl aminopeptidase metal- and thiol group-dependent.

  19. Diversification and population structure in common beans (Phaseolus vulgaris L..

    Directory of Open Access Journals (Sweden)

    Matthew W Blair

    Full Text Available Wild accessions of crops and landraces are valuable genetic resources for plant breeding and for conserving alleles and gene combinations in planta. The primary genepool of cultivated common beans includes wild accessions of Phaseolus vulgaris. These are of the same species as the domesticates and therefore are easily crossable with cultivated accessions. Molecular marker assessment of wild beans and landraces is important for the proper utilization and conservation of these important genetic resources. The goal of this research was to evaluate a collection of wild beans with fluorescent microsatellite or simple sequence repeat markers and to determine the population structure in combination with cultivated beans of all known races. Marker diversity in terms of average number of alleles per marker was high (13 for the combination of 36 markers and 104 wild genotypes that was similar to the average of 14 alleles per marker found for the 606 cultivated genotypes. Diversity in wild beans appears to be somewhat higher than in cultivated beans on a per genotype basis. Five populations or genepools were identified in structure analysis of the wild beans corresponding to segments of the geographical range, including Mesoamerican (Mexican, Guatemalan, Colombian, Ecuadorian-northern Peruvian and Andean (Argentina, Bolivia and Southern Peru. The combined analysis of wild and cultivated accessions showed that the first and last of these genepools were related to the cultivated genepools of the same names and the penultimate was found to be distinct but not ancestral to the others. The Guatemalan genepool was very novel and perhaps related to cultivars of race Guatemala, while the Colombian population was also distinct. Results suggest geographic isolation, founder effects or natural selection could have created the different semi-discrete populations of wild beans and that multiple domestications and introgression were involved in creating the diversity of

  20. I know my neighbour: individual recognition in Octopus vulgaris.

    Science.gov (United States)

    Tricarico, Elena; Borrelli, Luciana; Gherardi, Francesca; Fiorito, Graziano

    2011-04-13

    Little is known about individual recognition (IR) in octopuses, although they have been abundantly studied for their sophisticated behaviour and learning capacities. Indeed, the ability of octopuses to recognise conspecifics is suggested by a number of clues emerging from both laboratory studies (where they appear to form and maintain dominance hierarchies) and field observations (octopuses of neighbouring dens display little agonism between each other). To fill this gap in knowledge, we investigated the behaviour of 24 size-matched pairs of Octopus vulgaris in laboratory conditions. The experimental design was composed of 3 phases: Phase 1 (acclimatization): 12 "sight-allowed" (and 12 "isolated") pairs were maintained for 3 days in contiguous tanks separated by a transparent (and opaque) partition to allow (and block) the vision of the conspecific; Phase 2 (cohabitation): members of each pair (both sight-allowed and isolated) were transferred into an experimental tank and were allowed to interact for 15 min every day for 3 consecutive days; Phase 3 (test): each pair (both sight-allowed and isolated) was subject to a switch of an octopus to form pairs composed of either familiar ("sham switches") or unfamiliar conspecifics ("real switches"). Longer latencies (i.e. the time elapsed from the first interaction) and fewer physical contacts in the familiar pairs as opposed to the unfamiliar pairs were used as proxies for recognition. Octopuses appear able to recognise conspecifics and to remember the individual previously met for at least one day. To the best of our knowledge, this is the first experimental study showing the occurrence of a form of IR in cephalopods. Future studies should clarify whether this is a "true" IR.

  1. I know my neighbour: individual recognition in Octopus vulgaris.

    Directory of Open Access Journals (Sweden)

    Elena Tricarico

    2011-04-01

    Full Text Available Little is known about individual recognition (IR in octopuses, although they have been abundantly studied for their sophisticated behaviour and learning capacities. Indeed, the ability of octopuses to recognise conspecifics is suggested by a number of clues emerging from both laboratory studies (where they appear to form and maintain dominance hierarchies and field observations (octopuses of neighbouring dens display little agonism between each other. To fill this gap in knowledge, we investigated the behaviour of 24 size-matched pairs of Octopus vulgaris in laboratory conditions.The experimental design was composed of 3 phases: Phase 1 (acclimatization: 12 "sight-allowed" (and 12 "isolated" pairs were maintained for 3 days in contiguous tanks separated by a transparent (and opaque partition to allow (and block the vision of the conspecific; Phase 2 (cohabitation: members of each pair (both sight-allowed and isolated were transferred into an experimental tank and were allowed to interact for 15 min every day for 3 consecutive days; Phase 3 (test: each pair (both sight-allowed and isolated was subject to a switch of an octopus to form pairs composed of either familiar ("sham switches" or unfamiliar conspecifics ("real switches". Longer latencies (i.e. the time elapsed from the first interaction and fewer physical contacts in the familiar pairs as opposed to the unfamiliar pairs were used as proxies for recognition.Octopuses appear able to recognise conspecifics and to remember the individual previously met for at least one day. To the best of our knowledge, this is the first experimental study showing the occurrence of a form of IR in cephalopods. Future studies should clarify whether this is a "true" IR.

  2. I Know My Neighbour: Individual Recognition in Octopus vulgaris

    Science.gov (United States)

    Tricarico, Elena; Borrelli, Luciana; Gherardi, Francesca; Fiorito, Graziano

    2011-01-01

    Background Little is known about individual recognition (IR) in octopuses, although they have been abundantly studied for their sophisticated behaviour and learning capacities. Indeed, the ability of octopuses to recognise conspecifics is suggested by a number of clues emerging from both laboratory studies (where they appear to form and maintain dominance hierarchies) and field observations (octopuses of neighbouring dens display little agonism between each other). To fill this gap in knowledge, we investigated the behaviour of 24 size-matched pairs of Octopus vulgaris in laboratory conditions. Methodology/Principal Findings The experimental design was composed of 3 phases: Phase 1 (acclimatization): 12 “sight-allowed” (and 12 “isolated”) pairs were maintained for 3 days in contiguous tanks separated by a transparent (and opaque) partition to allow (and block) the vision of the conspecific; Phase 2 (cohabitation): members of each pair (both sight-allowed and isolated) were transferred into an experimental tank and were allowed to interact for 15 min every day for 3 consecutive days; Phase 3 (test): each pair (both sight-allowed and isolated) was subject to a switch of an octopus to form pairs composed of either familiar (“sham switches”) or unfamiliar conspecifics (“real switches”). Longer latencies (i.e. the time elapsed from the first interaction) and fewer physical contacts in the familiar pairs as opposed to the unfamiliar pairs were used as proxies for recognition. Conclusions Octopuses appear able to recognise conspecifics and to remember the individual previously met for at least one day. To the best of our knowledge, this is the first experimental study showing the occurrence of a form of IR in cephalopods. Future studies should clarify whether this is a “true” IR. PMID:21533257

  3. Dissecting Phaseolus vulgaris innate immune system against Colletotrichum lindemuthianum infection.

    Directory of Open Access Journals (Sweden)

    Paula Rodrigues Oblessuc

    Full Text Available BACKGROUND: The genus Colletotrichum is one of the most economically important plant pathogens, causing anthracnose on a wide range of crops including common beans (Phaseolus vulgaris L.. Crop yield can be dramatically decreased depending on the plant cultivar used and the environmental conditions. This study aimed to identify potential genetic components of the bean immune system to provide environmentally friendly control measures against this fungus. METHODOLOGY AND PRINCIPAL FINDINGS: As the common bean is not amenable to reverse genetics to explore functionality and its genome is not fully curated, we used putative Arabidopsis orthologs of bean expressed sequence tag (EST to perform bioinformatic analysis and experimental validation of gene expression to identify common bean genes regulated during the incompatible interaction with C. lindemuthianum. Similar to model pathosystems, Gene Ontology (GO analysis indicated that hormone biosynthesis and signaling in common beans seem to be modulated by fungus infection. For instance, cytokinin and ethylene responses were up-regulated and jasmonic acid, gibberellin, and abscisic acid responses were down-regulated, indicating that these hormones may play a central role in this pathosystem. Importantly, we have identified putative bean gene orthologs of Arabidopsis genes involved in the plant immune system. Based on experimental validation of gene expression, we propose that hypersensitive reaction as part of effector-triggered immunity may operate, at least in part, by down-regulating genes, such as FLS2-like and MKK5-like, putative orthologs of the Arabidopsis genes involved in pathogen perception and downstream signaling. CONCLUSIONS/SIGNIFICANCE: We have identified specific bean genes and uncovered metabolic processes and pathways that may be involved in the immune response against pathogens. Our transcriptome database is a rich resource for mining novel defense-related genes, which enabled us to

  4. Acne vulgaris: Perceptions and beliefs of Saudi adolescent males

    Science.gov (United States)

    Al-Natour, Sahar H.

    2017-01-01

    INTRODUCTION: Although acne vulgaris is common in adolescents, information on their understanding of acne is minimal. OBJECTIVES: To evaluate the perceptions and beliefs of Saudi youth on acne. MATERIALS AND METHODS: Three hundred twenty-nine male students (aged 13–22 years) from 6 secondary schools in the Eastern Saudi Arabia completed a self-reported questionnaire on knowledge, causation, exacerbating and relieving factors of acne. Data were analyzed by SPSS version 15.0. Results of subjects with acne, a family history of acne, and parents' educational levels were compared. Differences between the analyzed groups were assessed by a Chi-square test; p ≤ 0.05 was considered statistically significant. RESULTS: Over half (58.9%) of the participants considered acne a transient condition not requiring therapy. Only 13.1% knew that the proper treatment of acne could take a long time, even several years. Over half (52%) thought acne can be treated from the first or after few visits to the doctor. Popular sources of information were television/radio (47.7%), friends (45.6%), and the internet (38%). Only 23.4% indicated school as a source of knowledge. Reported causal factors included scratching (88.5%) and squeezing (82.1%) of pimples, poor hygiene (83.9%), poor dietary habits (71.5%), and stress (54.1%). Ameliorating factors included frequent washing of the face (52.9%), exercise (41.1%), sunbathing (24.1%), and drinking of mineral water (21%). The correlations of these facts are discussed. CONCLUSION: Results of this study point out that misconceptions of acne are widespread among Saudi youth. A health education program is needed to improve the understanding of the condition. PMID:28163574

  5. Growth and sedimentation of fine particles produced in aqueous solutions of palladium sulfate and palladium sulfate-silver sulfate induced by gamma-ray irradiation

    International Nuclear Information System (INIS)

    Hatada, Motoyoshi; Jonah, C.D.

    1994-10-01

    It is known that palladium and palladium-silver fine particles were formed from deaerated aqueous solutions of palladium sulfate and palladium sulfate-silver sulfate induced by gamma-ray irradiation. Changes in particle size and with amount of particles in the solution with time during and after irradiation were studied using dynamic light scattering technique and UV spectrophotometer. The particles formed from palladium sulfate solution are found to be water-filled bulky particles of diameter of 200 nm, which grow by mutual coagulation even after irradiation was terminated. Average density depends on concentration of palladium ion in the solution and dose, and the lowest density was about 2 g/cm 3 for particles of 200 nm obtained from 0.06 mM solution by 2.4 kGy irradiation. The average density of the particles obtained from palladium sulfate-silver sulfate solutions was smaller than those obtained for the corresponding palladium sulfate solutions. Supersonic agitation destroyed coagulated precipitates to form fine particles, but did not form clusters of a few atoms. (author)

  6. Sulfate-reducing bacteria slow intestinal transit in a bismuth-reversible fashion in mice.

    Science.gov (United States)

    Ritz, N L; Lin, D M; Wilson, M R; Barton, L L; Lin, H C

    2017-01-01

    Hydrogen sulfide (H 2 S) serves as a mammalian cell-derived gaseous neurotransmitter. The intestines are exposed to a second source of this gas by sulfate-reducing bacteria (SRB). Bismuth subsalicylate binds H 2 S rendering it insoluble. The aim of this study was to test the hypothesis that SRB may slow intestinal transit in a bismuth-reversible fashion. Eighty mice were randomized to five groups consisting of Live SRB, Killed SRB, SRB+Bismuth, Bismuth, and Saline. Desulfovibrio vulgaris, a common strain of SRB, was administered by gavage at the dose of 1.0 × 10 9 cells along with rhodamine, a fluorescent dye. Intestinal transit was measured 50 minutes after gavage by euthanizing the animals, removing the small intestine between the pyloric sphincter and the ileocecal valve and visualizing the distribution of rhodamine across the intestine using an imaging system (IVIS, Perkin-Elmer). Intestinal transit (n=50) was compared using geometric center (1=minimal movement, 100=maximal movement). H 2 S concentration (n=30) was also measured when small intestinal luminal content was allowed to generate this gas. The Live SRB group had slower intestinal transit as represented by a geometric center score of 40.2 ± 5.7 when compared to Saline: 73.6 ± 5.7, Killed SRB: 77.9 ± 6.9, SRB+Bismuth: 81.0 ± 2.0, and Bismuth: 73.3 ± 4.2 (Pfashion in mice. Our results demonstrate that intestinal transit is slowed by SRB and this effect could be abolished by H 2 S-binding bismuth. © 2016 John Wiley & Sons Ltd.

  7. The confused world of sulfate attack on concrete

    International Nuclear Information System (INIS)

    Neville, Adam

    2004-01-01

    External sulfate attack is not completely understood. Part I identifies the issues involved, pointing out disagreements, and distinguishes between the mere occurrence of chemical reactions of sulfates with hydrated cement paste and the damage or deterioration of concrete; only the latter are taken to represent sulfate attack. Furthermore, sulfate attack is defined as deleterious action involving sulfate ions; if the reaction is physical, then, it is physical sulfate attack that takes place. The discussion of the two forms of sulfate attack leads to a recommendation for distinct nomenclature. Sulfate attack on concrete structures in service is not widespread, and the amount of laboratory-based research seems to be disproportionately large. The mechanisms of attack by different sulfates--sodium, calcium, and magnesium--are discussed, including the issue of topochemical and through-solution reactions. The specific aspects of the action of magnesium sulfate are discussed, and the differences between laboratory conditions and field exposure are pointed out. Part II discusses the progress of sulfate attack and its manifestations. This is followed by a discussion of making sulfate-resisting concrete. One of the measures is to use Type V cement, and this topic is extensively discussed. Likewise, the influence of w/c on sulfate resistance is considered. The two parameters are not independent of one another. Moreover, the cation in the sulfate salt has a strong bearing on the efficiency of the Type V cement. Recent interpretations of the Bureau of Reclamation tests, both long term and accelerated, are evaluated, and it appears that they need reworking. Part III reviews the standards and guides for the classification of the severity of exposure of structures to sulfates and points out the lack of calibration of the various classes of exposure. A particular problem is the classification of soils because much depends on the extraction ratio of sulfate in the soil: there is a

  8. Contribution to the study of the role of sulfate-reducing bacteria in bio-corrosion phenomenon

    International Nuclear Information System (INIS)

    Chatelus, C.

    1987-11-01

    By their metabolic activities of hydrogen consumption and of sulfides production, the sulfate-reducing bacteria are the main bacteria responsible of the metallic corrosion phenomena in the absence of oxygen. A physiological and enzymatic study of some Desulfovibrio has contributed to the understanding of the role of these bacteria in the anaerobic bio-corrosion phenomena. Desulfovibrio (D.) vulgaris in organic medium, after having oxidized the lactate, consumes the hydrogen formed by the electrochemical reaction of iron dissolution. The Desulfovibrio can be responsible either of a corrosion by a direct contact with the metal in using the H 2 layer formed at its surface, (bacteria are then adsorbed at the surface because of an iron sulfide crystalline lattice), or of a distant corrosion in consuming the dissolved or gaseous hydrogen. As their hydrogenases can be stable in time independently of the cellular structure (D. vulparis) and active at high temperatures (to 70 C - 75 C) (D. baculatus), these bacteria can act in conditions incompatible with the viability of cells but compatible with the enzymatic expression. A study in terms of temperature has shown that inside the mesophilic group of the Desulfovibrio, the behaviour towards this parameter is specific to each bacteria, that accounts for the permanent presence of the representatives of this population in sites where the temperature variations are important. A change of some degrees Celsius can induce modifications in the yields of bacteria growth and by a consequence in variations in the corrosion intensity. Moreover, sulfate D. multispirans can reduce with specific velocities of different growth, the nitrate, the nitrite and the fumarate. Some sulfato-reducing could then adapt themselves to the variations of concentrations in electron acceptors and metabolize the oxidized substances used as biocides too. The choice of an electron acceptor rather than another do not depend uniquely of the specificity of the

  9. In Vitro Inhibitory Effect of Berberis vulgaris (Berberidaceae and Its Main Component, Berberine against Different Leishmania Species.

    Directory of Open Access Journals (Sweden)

    Hossein Mahmoudvand

    2014-03-01

    Full Text Available Leishmaniasis has been identified as a major public health problem in tropical and sub-tropical countries. The present study was aimed to investigate antileishmanial effects of various extracts of Berberis vulgaris also its active compoenent, berberine against Leishmania tropica and L. infantum species on in vitro experiments.In this study in vitro antileishmanial activity of various extracts of B. vulgaris also its active compoenent, berberine against promastigote and amastigote stages of L. tropica and L. infantum was evaluated, using MTT assay and in a macrophage model, respectively. Furthermore, infectivity rate and cytotoxicity effects of B. vulgaris and berberine in murine macrophage cells were investigated.The findings of optical density (OD and IC50 indicated that B. vulgaris particulary berberine significantly (P<0.05 inhibited the growth rate of promastigote stage of L.tropica and L.infantum in comparison to meglumine antimoniate (MA. In addition, B. vulgaris and berberine significantly (P<0.05 decreased the mean number of amastigotes in each macrophage as compared with positive control. In the evaluation of cytotoxicity effects, it could be observed that berberine as compared with B. vulgaris exhibited more cytotoxicity against murine macrophages. Results also showed that when parasites were pre-incubated with B. vulgaris their ability to infect murine macrophages was significantly decreased.B.vulgaris particularly berberine exhibited potent in vitro leishmanicidal effects against L. tropica and L.infantum. Further works are required to evaluate the antileishmanial effects of B.vulgaris on Leishmania species using clinical settings.

  10. A radioimmunoassay for measurement of thyroxine sulfate

    Energy Technology Data Exchange (ETDEWEB)

    Chopra, I.J.; Santini, F.; Hurd, R.E.; Chua Teco, G.N. (Univ. of California Center for the Health Sciences, Los Angeles (United States))

    1993-01-01

    A highly sensitive, specific, and reproducible RIA has been developed to measure T[sub 4] sulfate (T[sub 4]S) in ethanol extracts of serum. rT[sub 3] sulfate (rT[sub 3]S) cross-reacted 7.1%, and T[sub 3]S cross-reacted 0.59% in the RIA; T[sub 4], T[sub 3], rT[sub 3] and 3,3[prime]-diiodothyronine cross-reacted 0.004% or less. The recovery of nonradioactive T[sub 4]S added to serum averaged 95%. The detection threshold of the RIA was 18 pmol/L. The coefficient of variation averaged 6.9% within an assay and 12% between assays. T[sub 4]S was bound by T[sub 4]-binding globulin and albumin in serum. The free fraction of T[sub 4]S in four normal sera averaged 0.06% compared to a value of 0.03% for T[sub 4] (P < 0.001). The serum concentration of T[sub 4]S was (mean [+-] SE) 19 [+-] 1.2 pmol/L in normal subjects, 33 [+-] 10 in hyperthyroid patients with Graves disease, 42 [+-] 15 in hypothyroid patients, 34 [+-] 6.9 in patients with systematic nonthyroidal illnesses, 21 [+-] 4.3 in pregnant women at 15-40 weeks gestation, and 245 [+-] 26 in cord blood sera of newborns; the value in the newborn was significantly different from normal (P < 0.001). Administration of sodium ipodate (Oragrafin; 3 g, orally) to hyperthyroid patients was associated with a transient increase in serum T[sub 4]S. The T[sub 4]S content of the thyroid gland was less than 1/4000th that of T[sub 4]. We conclude that (1) T[sub 4]S is a normal component of human serum, and its levels are markedly increased in newborn serum and amniotic fluid; and (2) the sulfation pathway plays an important role in the metabolism of T[sub 4] in man. 28 refs., 4 figs., 2 tabs.

  11. Biological processes for the production of aryl sulfates

    DEFF Research Database (Denmark)

    2016-01-01

    The present invention generally relates to the field of biotechnology as it applies to the production of aryl sulfates using polypeptides or recombinant cells comprising said polypeptides. More particularly, the present invention pertains to polypeptides having aryl sulfotransferase activity......, recombinant host cells expressing same and processes for the production of aryl sulfates employing these polypeptides or recombinant host cells....

  12. Dietary reference intakes for water, potassium, sodium, chloride, and sulfate

    National Research Council Canada - National Science Library

    Institute of Medicine (U.S.). Panel on Dietary Reference Intakes for Electrolytes and Water

    2005-01-01

    ... intake to the risk of high blood pressure and hypertension as well as other diseases and the amounts of water from beverages and foods needed to maintain hydration. In addition, since requirements for sulfur can be met by inorganic sulfate in the diets of animals, a review of the role in inorganic sulfur in the form of sulfate is included. The gro...

  13. Effects of magnesium sulfate on the acquisition and reinstatement of ...

    African Journals Online (AJOL)

    In the current study, the effects of magnesium sulfate on the acquisition and reinstatement of morphine-induced conditioned place preference (CPP) in an animal model were investigated. The acquisition and extinction and reinstatement phases induced using morphine 40 and 10mg/kg. Magnesium sulfate 300 and 600 ...

  14. Sulfur accumulation and atmospherically deposited sulfate in the Lake States.

    Science.gov (United States)

    Mark B. David; George Z. Gernter; David F. Grigal; Lewis F. Ohmann

    1989-01-01

    Characterizes the mass of soil sulfur (adjusted for nitrogen), and atmospherically deposited sulfate along an acid precipitation gradient from Minnesota to Michigan. The relationship of these variables, presented graphically through contour mapping, suggests that patterns of atmospheric wet sulfate deposition are reflected in soil sulfur pools.

  15. Sulfated zirconia modified SBA-15 catalysts for cellobiose hydrolysis

    NARCIS (Netherlands)

    Degirmenci, V.; Uner, D.; Cinlar, B.; Shanks, B.H.; Yilmaz, A.; Santen, van R.A.; Hensen, E.J.M.

    2011-01-01

    Zirconia modified SBA-15 becomes a very active catalyst for the selective hydrolysis of cellobiose to glucose after sulfation. Spectroscopic investigations indicate the presence of Brønsted acid sites with similar properties to those present in conventional sulfated zirconia. Indications are found

  16. Reductive and sorptive properties of sulfate green rust (GRSO4)

    DEFF Research Database (Denmark)

    Nedel, Sorin

    The Fe(II), Fe(III) hydroxide containing sulfate in its structure, called sulfate green rust (GRSO4), can effectively reduce and convert contaminants to less mobile and less toxic forms. However, the ability of GRSO4 to remove positively charged species from solution, via sorption, is very limited...

  17. Sulfate was a trace constituent of Archean seawater

    DEFF Research Database (Denmark)

    Crowe, Sean Andrew; Paris, Guillaume; Katsev, Sergei

    2014-01-01

    In the low-oxygen Archean world (>2400 million years ago), seawater sulfate concentrations were much lower than today, yet open questions frustrate the translation of modern measurements of sulfur isotope fractionations into estimates of Archean seawater sulfate concentrations. In the water column...

  18. Extraction and determination of chondroitin sulfate from fish processing byproducts

    Science.gov (United States)

    Chondroitin sulfate (CS) refers to a group of sulfated glycosaminoglycan containing a chain of alternating N-acetylgalactosamine and glucuronic acid sugars. It is a major component of the extracellular matrix of cartilage and attached to proteins. CS is usually an over the counter dietary supplement...

  19. Annual sulfate budgets for Dutch lowland peat polders

    NARCIS (Netherlands)

    Vermaat, Jan E.; Harmsen, Joop; Hellmann, Fritz A.; Geest, van der Harm G.; Klein, de Jeroen J.M.; Kosten, Sarian; Smolders, Alfons J.P.; Verhoeven, Jos T.A.; Mes, Ron G.; Ouboter, Maarten

    2016-01-01

    Annual sulfate mass balances have been constructed for four low-lying peat polders in the Netherlands, to resolve the origin of high sulfate concentrations in surface water, which is considered a water quality problem, as indicated amongst others by the absence of sensitive water plant species.

  20. Transmission spectra study of sulfate substituted potassium dihydrogen phosphate

    KAUST Repository

    LI, LIANG

    2013-04-18

    Potassium dihydrogen phosphate (KDP) crystals with different amounts of sulfate concentration were grown and the transmittance spectrum was studied. A crystal with high sulfate replacement density exhibits heavy absorption property in the ultraviolet region which confirms and agrees well with former results. © 2013 Astro Ltd.