WorldWideScience

Sample records for vsa heli meripld

  1. Heli Laaksonen ja Jan Rahman

    Index Scriptorium Estoniae

    2006-01-01

    Rahman, Jan ; Heli Laaksonen. Maapuupäiv : [luulõtuisi : runoi]. Võru : Võro Selts VKKF : Sammakko, 2000. Kohtumine väljaande tutvustamiseks Tartu Kirjanduse Majas 13. jaan. Vt. ka Eesti Päevaleht : Arkaadia, 13. jaan., lk. 16

  2. The effect of virtual sales agent (VSA) gender – product gender congruence on product advice credibility, trust in VSA and online vendor, and purchase intention

    NARCIS (Netherlands)

    Beldad, Ardion Daroca; Hegner, Sabrina; Hegner, Sabrina; Hoppen, Jip

    2016-01-01

    Online vendors are increasingly using virtual sales assistants (VSA), either in the form of an animated picture or a photograph of a real person, to help customers with their product-related information needs. Currently, what is known is that the use of a VSA in an online web shop results in

  3. The Variable Stiffness Actuator vsaUT-II: Mechanical Design, Modeling, and Identification

    NARCIS (Netherlands)

    Groothuis, Stefan; Rusticelli, Giacomo; Zucchelli, Andrea; Stramigioli, Stefano; Carloni, Raffaella

    In this paper, the rotational variable stiffness actuator vsaUT-II is presented. This actuation system is characterized by the property that the apparent stiffness at the actuator output can be varied independently from its position. This behavior is realized by implementing a variable transmission

  4. Epidemiology of volatile substance abuse (VSA) cases reported to US poison centers.

    Science.gov (United States)

    Spiller, Henry A

    2004-01-01

    Volatile substance abuse (VSA) is believed to be widespread. The Toxic Exposure Surveillance System (TESS) of the American Association of Poison Control Systems offers an opportunity to evaluate the epidemiology of volatile substance abuse using a data set that captures data from a large geographic area covering a wide-ranging group of socioeconomic strata, ethnic groups, and demographics. To utilize this potential we analyzed a data set of TESS for the 6-year period of 1996 through 2001 involving all cases of intentional inhalational abuse of nonpharmaceutical substances. Over the study period there was a mean annual decline of 9% of reported VSA with an overall decline of 37% from 1996 to 2001. Volatile substance abuse was reported primarily in children, with 6358 cases (54%) in children 13-19 yr and 1803 (15%) cases in children 6-12 yr. Fifty-two cases were reported in children air fresheners (6%), and formalin (5%). Three categories were responsible for the majority of deaths: gasoline (45%), air fresheners (26%), and propane/butane (11%). While there was a decline in reported cases, there was no decline in major outcomes or fatalities. Volatile substance abuse was reported in all 50 states, with case distribution similar to population distribution. However, seven states had > 2 times the expected rate based on their population; three western states, two midwestern states, and two Appalachian states. The role of urban vs. rural population may possibly explain the difference in numbers, with a greater incidence of VSA cases reported in states with large rural populations. The mean monthly occurrence rate was 162 VSA cases/month (S.D. +/- 10.85). There were 4 months that were > 2 standard deviations from the mean, with two peak months (May, 192/month and March, 187/month) and two trough months (December, 126/month and January, 137/month). This report presents a broad picture of VSA in the United States. Volatile substance abuse, as reported to U.S. poison centers

  5. Next Generation HeliMag UXO Mapping Technology

    Science.gov (United States)

    2010-01-01

    Ancillary instrumentation records aircraft height above ground and attitude. A fluxgate magnetometer is used to allow for aeromagnetic compensation of... Magnetometer System WWII World War II WAA wide area assessment ACKNOWLEDGEMENTS This Next Generation HeliMag Unexploded Ordnance (UXO) Mapping...for deployment of seven total-field magnetometers on a Kevlar reinforced boom mounted on a Bell 206L helicopter. The objectives of this

  6. Loomulik ja loominguline koostööprojekt "Ruhrpott" : Ruhri katel / Heli Meisterson ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Meisterson, Heli

    2007-01-01

    Goethe Instituudi kultuuriprogrammide referent Heli Meisterson Nordrhein-Westfaleni Liidumaa kultuurifestifalist "Ruhrpott" Eestis, programmist. 2006. a. eelnenud Baltimaade kultuurifestivali "scene nrw" kava koostamisest

  7. cgHeliParm : analysis of dsDNA helical parameters for coarse-grained MARTINI molecular dynamics simulations

    NARCIS (Netherlands)

    Faustino, Ignacio; Marrink, S. J.

    2017-01-01

    Summary: We introduce cgHeliParm, a python program that provides the conformational analysis of Martini-based coarse-grained double strand DNA molecules. The software calculates the helical parameters such as base, base pair and base pair step parameters. cgHeliParm can be used for the analysis of

  8. Investigating potential effects of heli-skiing on golden eagles in the Wasatch Mountains, Utah

    Science.gov (United States)

    Teryl G. Grubb; David K. Delaney; William W. Bowerman

    2007-01-01

    Implementing further research was beyond the scope of the U.S. Forest Service's 2004 Final Environmental Impact Statement (FEIS) and 2005 Wasatch Powderbird Guides (WPG) Special Use Permit Renewal process for heli-skiing in the Tri-Canyon Area in the Wasatch Mountains, just east of Salt Lake City, Utah. However, in their Record of Decision the Wasaatch-Cache (WCNF...

  9. Siim Nestor soovitab : Hea Uus Heli. Vibe 5. sünnipäev / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2003-01-01

    Üritustest "Võlu Music" Mustpeade Majas 9. okt., "1ÖÖ%" Von Krahlis 10. okt., "Kontsert" Tartu Peetri kirikus 10. okt ja Tallinna Niguliste kirikus 11. okt., "Valge Laigu Klubi" Hobuveskis 11. okt. popmuusikafestivali "Hea Uus Heli" raames. Üritusest "Vibe" Liiva keskuses 11. oktoobril

  10. The Health Equity Leadership Institute (HELI): Developing workforce capacity for health disparities research.

    Science.gov (United States)

    Butler, James; Fryer, Craig S; Ward, Earlise; Westaby, Katelyn; Adams, Alexandra; Esmond, Sarah L; Garza, Mary A; Hogle, Janice A; Scholl, Linda M; Quinn, Sandra C; Thomas, Stephen B; Sorkness, Christine A

    2017-06-01

    Efforts to address health disparities and achieve health equity are critically dependent on the development of a diverse research workforce. However, many researchers from underrepresented backgrounds face challenges in advancing their careers, securing independent funding, and finding the mentorship needed to expand their research. Faculty from the University of Maryland at College Park and the University of Wisconsin-Madison developed and evaluated an intensive week-long research and career-development institute-the Health Equity Leadership Institute (HELI)-with the goal of increasing the number of underrepresented scholars who can sustain their ongoing commitment to health equity research. In 2010-2016, HELI brought 145 diverse scholars (78% from an underrepresented background; 81% female) together to engage with each other and learn from supportive faculty. Overall, scholar feedback was highly positive on all survey items, with average agreement ratings of 4.45-4.84 based on a 5-point Likert scale. Eighty-five percent of scholars remain in academic positions. In the first three cohorts, 73% of HELI participants have been promoted and 23% have secured independent federal funding. HELI includes an evidence-based curriculum to develop a diverse workforce for health equity research. For those institutions interested in implementing such an institute to develop and support underrepresented early stage investigators, a resource toolbox is provided.

  11. 76 FR 16462 - In the Matter of Heli Electronics Corp., Order of Suspension of Trading

    Science.gov (United States)

    2011-03-23

    .... (``HELI''), a Nevada corporation with headquarters and operations in the People's Republic of China, which..., among other things, the company's cash balances and accounts receivable. The company has failed to disclose that the company's independent auditor has resigned due to accounting irregularities involving (a...

  12. Nende kõrgeaususte kirjad on avaldatud : [intervjuu] / Eva Aaver, Heli Laanekask ; üles kirjut. Juhani Püttsepp

    Index Scriptorium Estoniae

    Aaver, Eva, 1925-2008

    1998-01-01

    Riigi teaduspreemia humanitaarteaduste vallas said Eva Aaver, Heli Laanekask, Abel Nagelmaa ja Leo Anvelt (postuumselt) publikatsiooni 'Otto Wilhelm Masingu kirjad Johann Heinrich Rosenplänterile. 1814-1832'

  13. Modeling, Control, and Numerical Simulations of a Novel Binary-Controlled Variable Stiffness Actuator (BcVSA

    Directory of Open Access Journals (Sweden)

    Irfan Hussain

    2018-06-01

    Full Text Available This research work aims at realizing a new compliant robotic actuator for safe human-robotic interaction. In this paper, we present the modeling, control, and numerical simulations of a novel Binary-Controlled Variable Stiffness Actuator (BcVSA aiming to be used for the development of a novel compliant robotic manipulator. BcVSA is the proof of concept of the active revolute joint with the variable recruitment of series-parallel elastic elements. We briefly recall the basic design principle which is based on a stiffness varying mechanism consisting of a motor, three inline clutches, and three torsional springs with stiffness values (K0, 2K0, 4K0 connected to the load shaft and the motor shaft through two planetary sun gear trains with ratios (4:1, 4:1 respectively. We present the design concept, stiffness and dynamic modeling, and control of our BcVSA. We implemented three kinds of Multiple Model Predictive Control (MPC to control our actuator. The main motivation of choosing this controller lies in the fact that working principle of multiple MPC and multiple states space representation (stiffness level of our actuator share similar interests. In particular, we implemented Multiple MPC, Multiple Explicit MPC, and Approximated Multiple Explicit MPC. Numerical simulations are performed in order to evaluate their effectiveness for the future experiments on the prototype of our actuator. The simulation results showed that the Multiple MPC, and the Multiple Explicit MPC have similar results from the robustness point of view. On the other hand, the robustness performance of Approximated Multiple Explicit MPC is not good as compared to other controllers but it works in the offline framework while having the capability to compute the sub-optimal results. We also performed the comparison of MPC based controllers with the Computed Torque Control (CTC, and Linear Quadratic Regulator (LQR. In future, we are planning to test the presented approach on the

  14. Constraining the Distribution of Vertical Slip on the South Heli Shan Fault (Northeastern Tibet) From High-Resolution Topographic Data

    Science.gov (United States)

    Bi, Haiyun; Zheng, Wenjun; Ge, Weipeng; Zhang, Peizhen; Zeng, Jiangyuan; Yu, Jingxing

    2018-03-01

    Reconstruction of the along-fault slip distribution provides an insight into the long-term rupture patterns of a fault, thereby enabling more accurate assessment of its future behavior. The increasing wealth of high-resolution topographic data, such as Light Detection and Ranging and photogrammetric digital elevation models, allows us to better constrain the slip distribution, thus greatly improving our understanding of fault behavior. The South Heli Shan Fault is a major active fault on the northeastern margin of the Tibetan Plateau. In this study, we built a 2 m resolution digital elevation model of the South Heli Shan Fault based on high-resolution GeoEye-1 stereo satellite imagery and then measured 302 vertical displacements along the fault, which increased the measurement density of previous field surveys by a factor of nearly 5. The cumulative displacements show an asymmetric distribution along the fault, comprising three major segments. An increasing trend from west to east indicates that the fault has likely propagated westward over its lifetime. The topographic relief of Heli Shan shows an asymmetry similar to the measured cumulative slip distribution, suggesting that the uplift of Heli Shan may result mainly from the long-term activity of the South Heli Shan Fault. Furthermore, the cumulative displacements divide into discrete clusters along the fault, indicating that the fault has ruptured in several large earthquakes. By constraining the slip-length distribution of each rupture, we found that the events do not support a characteristic recurrence model for the fault.

  15. Gümnasistid kipuvad kooli kõrvalt tööle / Kaarel Kotkas, Mariliis Kaul, Helis Toiger, Elar Toomsalu ; küsitlenud Madde Rebane

    Index Scriptorium Estoniae

    2007-01-01

    Intervjuu Pärnu gümnaasiumiõpilaste Kaarel Kotkasega Hansagümnaasiumist, Mariliis Kauliga Koidula Gümnaasiumist, Helis Toigeriga Ülejõe Gümnaasiumist ja Elar Toomsaluga Sütevaka Humanitaargümnaasiumist

  16. CREATION OF A MULTIRESOLUTION AND MULTIACCURACY DTM: PROBLEMS AND SOLUTIONS FOR HELI-DEM CASE STUDY

    Directory of Open Access Journals (Sweden)

    L. Biagi

    2014-01-01

    Full Text Available The work is part of "HELI-DEM" (HELvetia-Italy Digital Elevation Model project, funded by the European Regional Development Fund within the Italy-Switzerland cooperation program. The aim of the project is the creation of a unique DTM for the alpine and subalpine area between Italy (Piedmont, Lombardy and Switzerland (Ticino and Grisons Cantons; at present, different DTMs, that are in different reference frames and have been obtained with different technologies, accuracies, and resolutions, have been acquired. The final DTM should be correctly georeferenced and produced validating and integrating the data that are available for the project. DTMs are fundamental in hydrogeological studies, especially in alpine areas where hydrogeological risks may exist. Moreover, when an event, like for example a landslide, happens at the border between countries, a unique and integrated DTM which covers the interest area is useful to analyze the scenario. In this sense, HELI-DEM project is helpful. To perform analyses along the borders between countries, transnational geographic information is needed: a transnational DTM can be obtained by merging regional low resolution DTMs. Moreover high resolution local DTMs should be used where they are available. To be merged, low and high resolution DTMs should be in the same three dimensional reference frame, should not present biases and should be consistent in the overlapping areas. Cross-validation between the different DTMs is therefore needed. Two different problems should be solved: the merging of regional, partly overlapping low and medium resolution DTMs into a unique low/medium resolution DTM and the merging with other local high resolution/high accuracy height data. This paper discusses the preliminary processing of the data for the fusion of low and high resolution DTMs in a study-case area within the Lombardy region: Valtellina valley. In this region the Lombardy regional low resolution DTM is available, with

  17. Katkenud õpingute teise kõrgkooli "kolimine" nõuab visadust / Agne Narusk, Ene Küüner, Heli Mattisen, Kadri Osula

    Index Scriptorium Estoniae

    Narusk, Agne

    2007-01-01

    Pooleli jäänud ülikooliõpingute lõpetamisest. Varasemate õpingute ja töökogemuse arvestamise tingimusi õpingute jätkamisel selgitavad Tartu Ülikooli avatud ülikooli tasemeõppe koordinaator Ene Küüner, Tallinna Ülikooli akadeemiline prorektor Heli Mattisen ja Estonian Business Schoolì õppeosakonna juhataja Kadri Osula

  18. Mycobacterium smegmatis HelY Is an RNA-Activated ATPase/dATPase and 3'-to-5' Helicase That Unwinds 3'-Tailed RNA Duplexes and RNA:DNA Hybrids.

    Science.gov (United States)

    Uson, Maria Loressa; Ordonez, Heather; Shuman, Stewart

    2015-10-01

    Mycobacteria have a large and distinctive ensemble of DNA helicases that function in DNA replication, repair, and recombination. Little is known about the roster of RNA helicases in mycobacteria or their roles in RNA transactions. The 912-amino-acid Mycobacterium smegmatis HelY (MSMEG_3885) protein is a bacterial homolog of the Mtr4 and Ski2 helicases that regulate RNA 3' processing and turnover by the eukaryal exosome. Here we characterize HelY as an RNA-stimulated ATPase/dATPase and an ATP/dATP-dependent 3'-to-5' helicase. HelY requires a 3' single-strand RNA tail (a loading RNA strand) to displace the complementary strand of a tailed RNA:RNA or RNA:DNA duplex. The findings that HelY ATPase is unresponsive to a DNA polynucleotide cofactor and that HelY is unable to unwind a 3'-tailed duplex in which the loading strand is DNA distinguish HelY from other mycobacterial nucleoside triphosphatases/helicases characterized previously. The biochemical properties of HelY, which resemble those of Mtr4/Ski2, hint at a role for HelY in mycobacterial RNA catabolism. RNA helicases play crucial roles in transcription, RNA processing, and translation by virtue of their ability to alter RNA secondary structure or remodel RNA-protein interactions. In eukarya, the RNA helicases Mtr4 and Ski2 regulate RNA 3' resection by the exosome. Mycobacterium smegmatis HelY, a bacterial homolog of Mtr4/Ski2, is characterized here as a unidirectional helicase, powered by RNA-dependent ATP/dATP hydrolysis, that tracks 3' to 5' along a loading RNA strand to displace the complementary strand of a tailed RNA:RNA or RNA:DNA duplex. The biochemical properties of HelY suggest a role in bacterial RNA transactions. HelY homologs are present in pathogenic mycobacteria (e.g., M. tuberculosis and M. leprae) and are widely prevalent in Actinobacteria and Cyanobacteria but occur sporadically elsewhere in the bacterial domain. Copyright © 2015, American Society for Microbiology. All Rights Reserved.

  19. Qualidade de vida no trabalho: um estudo de caso das enfermeiras do Hospital Heliópolis Life quality at work: a study of case of the nurses of Heliópolis Hospital

    Directory of Open Access Journals (Sweden)

    Lourdes Margareth Leite Pizzoli

    2005-12-01

    Full Text Available O artigo apresenta um estudo de caso referente à Qualidade de Vida no Trabalho (QVT da população de enfermeiras do Hospital Heliópolis, mediante indicadores baseados nas dimensões do modelo de Richard Walton. Suas dimensões apresentam indicadores amplos que melhor se adaptam à cultura socioeconômica brasileira, adequando-se à condição organizacional da comunidade onde se situa a população-alvo. A instituição é pública, caracterizada por especialidades de alta complexidade, predominância cirúrgica, hospital de referência, em São Paulo. A pesquisa fez parte da dissertação aprovada para mestrado em Ciências da Administração e Valores Humanos no Centro Universitário Capital, em 2002. Pesquisa exploratória, de campo, qualitativa na elaboração fundamental de conceitos para confecção do questionário, e quantitativa nos procedimentos de mensuração das respostas fechadas, com tratamento estatístico por meio de análise descritiva e distribuição das freqüências das variáveis abordadas. Os resultados apresentaram-se positivos quanto à integração, relevância social, oportunidade de uso e ao desenvolvimento das capacidades; e negativos quanto à ausência de reconhecimento pelo trabalho, ausência de plano de carreira, comunicação deficiente e remuneração incompatível com a função.The article presents a study of case referring the verification of Life Quality at Work (LQW of the nurses’ population of Heliópolis Hospital, by means of indicators based on dimensions of the Richard Walton’ model. These dimensions propound wide indicators which better adapt to the Brazilian socioeconomic culture, adapting to the community’s organization structure where situates the target population. The institution is public, characterized by high complexity specialties, with predominance in surgical activity, considered reference hospital, located in São Paulo State, Brazil. The research made part of the dissertation

  20. Etteheited räsivad pidu / Henri Reeder, Ly Rääsk, Heli Jürgenson ... [jt.] ; intervjueerinud Anneli Aasmäe

    Index Scriptorium Estoniae

    2009-01-01

    Küsimustele tänavusele üldlaulu- ja üldtantsupeole minekust ja peo repertuaari raskusest vastavad Aruküla noortekoori laulja Henri Reeder, Äksi segakoori dirigent Ly Rääsk, üldlaulupeo segakooride liigijuht Heli Jürgenson, Laulu- ja Tantsupeo SA muusikatoimetaja Ave Sopp, Laulu- ja Tantsupeo SA tantsutoimetaja Kadri Tiis , Lüganuse segakoori dirigent Priit-Andres Pärtna ja kolme tantsurühma juhendaja Vändrast Kädi Pärnoja

  1. Intervjuu American Wind Symphony Orchestra dirigendi Robert Austin Boudreau'ga = Interview with Mr. Robert Austin Boudreau, director of the American Wind Symphony Orchestra / Robert Austin Boudreau ; interv. Heli Ojamaa

    Index Scriptorium Estoniae

    Boudreau, Robert Austin

    2007-01-01

    11. IV 2007. a. tehtud telefoniintervjuu Robert A. Boudreau'ga, kellele arhitekt Louis I. Kahn disainis kontserdilaevad Point Counterpoint I (valmis 1961) ja Point Counterppoint II (kavandamist alustati 1966, valmis 1975). Louis I. Kahnist, koostööst arhitektiga ja laevadest. Selgitav kaaskiri arhitekt Heli Ojamaalt. Ill.: I laeva makett, II laeva joonised ja 4 värv. fotot

  2. Muudatustest hooldusravis / Heli Paluste

    Index Scriptorium Estoniae

    Paluste, Heli

    2010-01-01

    Alates 1. jaanuarist 2010. a. moodustab hooldusravi voodipäevade hinnast isiku omaosalus 15 % (VV määrusest nr. 49 (19. veebruarist 2009. a.), mis jõustus 1. jaanuaril 2010. a. ja millega hooldusravi rahastamine muutus)

  3. Kevadtiivul Eestisse / Heli Silma

    Index Scriptorium Estoniae

    Silma, Heli

    2000-01-01

    Kathleen Caillier'i (s. 1967) näitus "Kevadtiivul" La Galerie Passage'is. Eksponeeritud õrnades toonides lillemaalid, natüürmordid ja maastikud aastatest 1994-2000. Kunstnik on täiendanud töid luuleridadega.

  4. Esiplaanil heli / Harri Slip

    Index Scriptorium Estoniae

    Slip, Harri

    2015-01-01

    Kõrvaklapid hinnaga alla 200 €: AKG Y50BT, Audio-Technica, Beyerdynamic Custom Street, Bose SoundTrue around-ear II, Creative Aurvana Gold, Denon AH-MM200, Focal Spirit One S, Grado SR 80e, JBL Everest V300, Klipsch Reference On Ear, Panasonic RP-HD10, Philips SHB8850NC, Sennheiser HD 25, SMS Audio On-Ear Wired Sport, Sony MDR-100AAP

  5. Filmile tardunud heli / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2001-01-01

    Kinomajas esitleti Lepo Sumera filmimuusika plaati "Film music by Lepo Sumera" ("Muusikat "Tallinnfilmi" filmidest") firmalt Antes CD. Ka teistest eesti filmiheliloojatest, lähemalt Sumera õpilasest Jüri Reinverest

  6. Suveetendus eksootilises paigas / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2004-01-01

    Eeloleval suvel on teatrihuvilistel võimalik näha vabaõhuetendust väga erilises kohas - Pöide vallas asuval Udriku laiul, kus etendatakse P. Vallaku "Relvad vastamisi", lavastaja E. Klemets. Korraldajateks on MTÜ Lihtsad Lahendused koostöös AS Fix Ideed Estonia ja Ugala teatriga

  7. Study of collective flows of protons and π{sup -}-mesons in p+C, Ta and He+Li, C collisions at momenta of 4.2, 4.5 and 10 AGeV/c

    Energy Technology Data Exchange (ETDEWEB)

    Chkhaidze, L.; Djobava, T.; Kharkhelauri, L. [High Energy Physics Institute of Tbilisi State University, Tbilisi (Georgia); Chlachidze, G. [Fermi National Accelerator Laboratory, Batavia, IL (United States); Galoyan, A. [Joint Institute for Nuclear Research, Veksler and Baldin Laboratory of High Energy Physics, Dubna (Russian Federation); Togoo, R. [Institute of Physics and Technology of the Mongolian Academy of Sciences, Ulan Bator (Mongolia); Uzhinsky, V. [Joint Institute for Nuclear Research, Laboratory of Information Technologies, Dubna (Russian Federation)

    2016-11-15

    Collective flows of protons and π{sup -}-mesons are studied at the momenta of 4.2, 4.5 and 10 AGeV/c for p+C, Ta and He+Li, C interactions. The data were obtained from the streamer chamber (SKM-200-GIBS) and from the Propane Bubble Chamber (PBC-500) systems utilized at JINR. A method of Danielewicz and Odyniec has been employed in determining a directed transverse flow of particles. The values of the transverse flow parameter and the strength of the anisotropic emission were defined for each interacting nuclear pair. It is found that the directed flows of protons and pions decrease with increasing the energy and the mass numbers of colliding nucleus pairs. The π{sup -}-meson and proton flows exhibit opposite directions in all studied interactions, and the flows of protons are directed in the reaction plane. The Ultra-relativistic Quantum Molecular Dynamical Model (UrQMD) coupled with the Statistical Multi-fragmentation Model (SMM), satisfactorily describes the obtained experimental results. (orig.)

  8. Dicty_cDB: VSA784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrh... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62...13 |AL382813.1 Medicago truncatula EST MtBC10B03R1 : T7 end of clone MtBC10B03 of

  9. Dicty_cDB: VSA387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---HLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVFNQTQKNHLRAVYSKK SSSKIPTDLRYKKTRAIRRRLTNKQXKVVTLRVSKTATNFPQRVFAVKA*ici*milk...QVKSPNPSKLAKIGTVRKAIARVLTVFNQTQKNHLRAVYSKK SSSKIPTDLRYKKTRAIRRRLTNKQXKVVTLRVSKTATNFPQRVFAVKA*ici*milknk iy*k

  10. Dicty_cDB: VSA209 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ed Amino Acid sequence ---GDDKWEDYPQDDNVEGNEANLKVGEAIKNIGNDYFKQGKSLEAIAKYNKALRYLDCC SNIDGLKNVQTICYNNMSQCYLKEKKVPMLWWLQKKH*nyhqmilk...IAKYNKALRYLDCC SNIDGLKNVQTICYNNMSQCYLKEKKVPMLWWLQKKH*nyhqmilkhsleklklyl*wrn mmklskiskkslkpiprikmqnln*kelklqk

  11. Dicty_cDB: VSA330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Translated Am...TRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Frame C: kklkllnsepktrlnylntsrnselssqv

  12. Dicty_cDB: VSA850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IRRRLTNKQSKVVTLRVSKTATN FPQRVFAVKA*ici*milknkiy*k Translated Amino Acid sequence (All Frames) Frame A: QNFNM...RVSKTATN FPQRVFAVKA*ici*milknkiy*k Frame B: kistwpkklkllnsepktrlnylntsrnselssqv*e...AEKTKAFELRTKNKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIA RVLTVFNQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTL

  13. 33 CFR 104.305 - Vessel Security Assessment (VSA) requirements.

    Science.gov (United States)

    2010-07-01

    ... baggage; and (vi) Vessel stores; (2) Threat assessments, including the purpose and methodology of the assessment, for the area or areas in which the vessel operates or at which passengers embark or disembark; (3... and control procedures; (ii) Identification systems; (iii) Surveillance and monitoring equipment; (iv...

  14. Aardejahil Luke mõisapargis / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Lühidalt Luke mõisa ajaloost, omanikest ja mõisaansamblist. Terrasside ja taastatud tiikidesüsteemiga pargist. Külastuskeskusest arhitekt Eva Laarmanni projekti järgi rekonstrueeritud puitpitsiga kärnerimajas. Veenuse kuju taastas firmas Kar-Grupp Tallinnas. SA Luke Mõis juhatuse liige Gea Järvela Luke tulevikuplaanidest. Mõisasüdame makett, 12 värv. vaadet

  15. Eristumine on edu pant / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2013-01-01

    Turustamine on raskem kui tootmine, kuid selle juures on abiks eristumine - nii väidab Taarapõllu talu peremees Edgar Kolts. Väikeettevõtja valmistab kohapeal mahedalt kasvatatud aia- ja metsasaadustest moose, mahlu, marjakrõpse, marjajahusid, mahlajooke jne

  16. Uus isikuandmete kaitse seadus / Heli Naeris

    Index Scriptorium Estoniae

    Naeris, Heli

    2008-01-01

    1. jaan. 2008 jõustunud isikuandmete kaitse seadusest, mis sätestab isikuandmete töötlemise tingimused ja korra, riikliku järelevalve teostamise korra isikuandmete töötlemisel ja vastutuse isikuandmete töötlemise nõuete rikkumise eest

  17. Prantslastelt õppimas / Marve Koppel, Heli Leppik

    Index Scriptorium Estoniae

    Koppel, Marve

    2005-01-01

    Kuressaare ametikoolis järgmisel õppeaastal rakenduvast majutuskorralduse eriala õppekavast, mille koostamisel on eeskujuks võetud Prantsuse hotellikooli Lycee d'Hotellerie et de Tourisme Saint-Quentin-en-Yvelines õppekava

  18. Sotsiaalteenuste kvaliteedi hindamine ja kontroll / Heli Tooman

    Index Scriptorium Estoniae

    Tooman, Heli, 1949-

    2002-01-01

    Uurimisprojekti "Sotsiaalteenuste vajadus ja kasutamine - territoriaalsed, sotsiaalsed ja kultuurilised erinevused" raames katsetati SERVQUAL meetodit sotsiaalteenuste kvaliteedi mõõtmiseks Pärnu ja Narva sotsiaalasutustes. Tabelid. Bibliogr.

  19. Kohtumine minevikus pilguga tulevikku / Heli Susi

    Index Scriptorium Estoniae

    Susi, Heli, 1929-

    2009-01-01

    Reisist Moskvasse detsembris 2008 A. Solženitsõni 90. sünniaastapäevale pühendatud näituse avamisele. Näituse "Eesti saar Gulagi arhipelaagis" koostas ajakirja Вышгород peatoimetaja Ljudmila Gluškovskaja koostöös fondiraamatukoguga Русское Зарубежье. 25. märtsil 2009 avati sama näitus Eesti Rahvusraamatukogus

  20. Ene Sepp esitles esikteost "Medaljon" / Heli Talinurm

    Index Scriptorium Estoniae

    Talinurm, Heli

    2009-01-01

    Ene Sepp esitles 19. veebruaril Rapla Keskraamatukogus oma raamatut, mis pälvis kolmanda koha Eesti Lastekirjanduse Teabekeskuse ja kirjastuse Tänapäev 2008. aasta noorsooromaani võistlusel. Ly Ehini mõtteid, mida Ene Sepa raamat temas tekitas

  1. ECM. Kauneim heli pärast vaikust / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2007-01-01

    Uutest Saksa plaadifirma ECM heliplaatidest Frode Haltli "Passing Images", Roscoe Mitchell "The Transatlantic Art Ensemble Composition", Chritian Wallumrod "TRhe Zoo Is Far", Valentin Silvestrov "Symphony No. 6"

  2. Kõrgharidus on loomult ebavõrdne / Heli Aru

    Index Scriptorium Estoniae

    Aru, Heli

    2007-01-01

    OECD ekspertide hinnangust, mille kohaselt pööratakse Eestis õppurite võimaluste võrdsusele ebaproportsionaalselt vähe tähelepanu, ning ekspertide soovitustest. Autor, OECD projekti Eesti koordinaator leiab, et üldise osalise õppemaksu kehtestamine on väga pragmaatiline. Vt. samas: Rein Raud. Võrdselt haritud või võrdselt võlgu? Küsitlus: kuidas vähendada ebavõrdsust kõrghariduses? Vastavad Maris Mälzer, Madis Habakuk ja Tõnis Lukas

  3. 99% maaelu arengukavast võib saada heakskiidu / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2007-01-01

    Maaelu arengukava (MAK), mille alusel jagataks Eestile 14,5 miljardit krooni, ootab novembris Euroopa Liidu heakskiitu. Vt. samas: Euroopa Liidu maaelu arengukavadest; Kommenteerivad: Kalev Kreegipuu, Kaul Nurm, Silvia Lotman, Margus Timmo

  4. Pindalatoetusi saab tänavu taotleda maikuus / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2005-01-01

    Sama ka Vali Uudised 27. aprill 2005, lk. 7 ; Vooremaa : Palamuse Valla Teataja 30. aprill 2005, lk. 3 ; Vooremaa : Pala Teataja 3. mai 2005, lk. 2 artiklis pealkiri kujul: Pindalatoetuse taotlusi ootab PRIA mais ; Vooremaa : Jõgeva Valla Teataja 7. mai 2005, lk. 3 ; Vooremaa : Saare Valla Teataja 14. mai 2005, lk. 2 artiklis pealkiri kujul: PRIA ootab pindalatoetuse taotlusi

  5. Juhtimiskriis kirikus / Frederick W Gluck ; tõlk. Heli Leek

    Index Scriptorium Estoniae

    Gluck, Frederick W

    2005-01-01

    USA Kiriku Juhtimise Riikliku Ümarlaua asutajaliige haldus- ja juhtimisprobleemidest ning kaasaegse juhtimissüsteemi rakendamise vajalikkusest katolikus kirikus, paavsti osast kiriku tegevuse ja mõju tõhustamisel. Kommenteerib Eesti Metodisti Kiriku pastor Üllas Tankler

  6. Mis on looming.org? : elektrooniline heli / Andres Lõo

    Index Scriptorium Estoniae

    Lõo, Andres

    2004-01-01

    Võrguajakirjast www.looming.org, kuhu kogutakse infot põhiliselt kahe jaotuse põhjal: muusika ja helieksperimentalism ning kaasaegne kunst, kunsti ja meediaga seonduv. Idee autorid: Hanno Soans ja Andres Lõo. Ilmunud on looming.orgi esimene muusikakogumik "Lilled algebrale"

  7. Riik toetab 50 miljoniga rikkamaid suurperesid / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Lasterikastele peredele kodu ehitamiseks või remondiks mõeldud toetuse tahab majandusministeerium jagada ainult pangalaenu võtnud perede vahel, mis jätab paljud suurpered abi saamise võimalusest ilma. Vt. samas: Suure pere maja jaoks on annetatud 77 360 krooni; Lasterikaste perede liidu ettepanekud

  8. Trigon Farming ehitab Kaiu moodsa eurolauda / Heli Talinur

    Index Scriptorium Estoniae

    Talinur, Heli

    2007-01-01

    Trigon Farming tegutseb Eestis aastast 2003 ning firmal on laudad peale Kaiu veel Saaremaal Kärlas, lisaks tegutseb firma ka Venemaal ja Ukrainas. Farmingu emafirma on Trigon Agri, mis on noteeritud Stockholmi börsil

  9. Lauluväljaku uus skulptuur visualiseerib heli / Andreas Sepp

    Index Scriptorium Estoniae

    Sepp, Andreas

    2011-01-01

    14. mail Tallinna lauluväljakul Euroopa kultuuripealinna segakoori kontserdiga avatavast saksa skulptori Lukas Kühne loodud akustilisest skulptuurist "Chromatico". Teose arhitekt on Rosario Nuin (Uruguay), ehitas Nordecon Betoon

  10. Valjala kiriku orel kõlab / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2004-01-01

    Valjala Püha Martini kiriku Gustav Normanni valmistatud ja Ago Tindi põhjalikult remonditud oreli taaspühitsemisest piduliku kontsert-jumalateenistusega 10. nov., külalisesinejaks saksa organist ja orelimeister Martin ter Haseborg

  11. Siim Nestor soovitab : Hea Uus Heli / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2007-01-01

    Üritustest Tallinnas muusikafestivalist HUH raames: "Odessa Pop" 4. okt., Pedigree remix-albumi "Ghosts and Corpses" esitlusest 5. okt. Kultuurikatlas, "Krill" 5. okt. Von Krahlis, Cluster ja Analogue Birds 6. okt. Glehni lossis

  12. Vana mõisahoone ärkas elule / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2008-01-01

    Muhus asuva Pädaste mõisa peahoone avamist tähistati kultuuriprogrammiga. Kohal viibisid ka president Toomas Hendrik Ilves ja proua Evelin Ilves. Juuresoleval fotol Muhu kooliõpetaja Tiina Saar, mõisaomanikud Martin Breuer ja Imre Sooäär ning proua Evelin Ilves härrastemaja linti läbi lõikamas

  13. Inga Kuusik vallutas tippe Kõrgõzstanis / Heli Talinurm

    Index Scriptorium Estoniae

    Talinurm, Heli

    2007-01-01

    Saku Õlletehase uus finantsdirektor tööst tubakatootja Imperial Tobacco Grupi Kesk-Aasia regiooni finantsdirektorina Kõrgõzstanis, kohalikest inimestest ja töökultuurist. Lisa: Fakte Kõrgõzstani kohta

  14. Alma mater sõnas, pildis ja helis / Varje Sootak

    Index Scriptorium Estoniae

    Sootak, Varje, 1946-

    2007-01-01

    Tartu Ülikooli 375. aastapäeva puhul esitleti ülikooli kohvikus albumit "Universitas Tartuensis 375" ja samanimelise dokumentaalfilmi DVD-d. Viimase stsenaristideks on Jaak Lõhmus ja Lauri Vahtre, režissöörideks Rene Vilbre ja Märten Vaher

  15. Täiskasvanute kursusi saadab suur menu / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Euroopa Sotsiaalfondi projekti "Täiskasvanute tööalane koolitus kutseõppeasutustes" raames toimuvad tasuta kursused 37 kutseõppeasutuses ja rakenduskõrgkoolis üle Eesti. Tasuta koolitusi pakuvad ka vabahariduskeskused maakondades

  16. Mannide dünastia teleekraanil / Heli Mägar

    Index Scriptorium Estoniae

    Mägar, Heli

    2005-01-01

    Lühiseriaal Mannide kirjanikedünastia saatusest 1930-1940-ndail aastail "Mannide perekond" ("Die Manns") : stsenaristid Heinrich Breloer ja Horst Königstein : režissöör Heinrich Breloer : Saksamaa 2001

  17. From Viability to Sustainability: The Contribution of the Viable Systems Approach (VSA

    Directory of Open Access Journals (Sweden)

    Vincenzo Formisano

    2018-03-01

    Full Text Available The current dynamics of business systems require new ways of conceiving the role of single entities. On this basis, a complex of interactions between the company and the reference context must be activated to guarantee survival dynamics. From these considerations re-emerge the ideas of Peccei (2013 and King (2013 that recognise in the systemic thought the foundations for a sustainable society. The present study derives from these considerations, and aims at contributing to the advancement of the knowledge necessary to overcome the challenges in the sustainability field. The methodological approach, albeit heuristic, can be traced back to the positive scientific and constructivist method. The results of the study showed the prevalence of qualitative and subjective techniques, accompanied by the so-called inductive method, testifying to the intense interaction between the scholar and the object investigated. With regard to future research, it would be interesting to construct a flexible, scalable and extensible model to recover both a database and an ontology for the theoretical framework.

  18. Lessons from the Voluntary System of Accountability (VSA): The Intersection of Collective Action & Public Policy

    Science.gov (United States)

    Keller, Christine M.

    2014-01-01

    Over the past decade, the federal investment in higher education has grown, the public demand for a postsecondary degree has risen, and skepticism about the value and meaning of the degree has increased. This confluence has prompted a more intense federal interest in having clear and comparable information about colleges and universities available…

  19. Teravili - kütuseks või söödaks? / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2007-01-01

    Tartus toimus rahvusvahelise biotehnoloogia firma Alltech Euroopa loengusari, kus käsitleti teraviljast kütuse tootmisega, viljaturu muutustega, liha- ja söödatootmisega seonduvaid probleeme. Vt. samas: Kas teadsid?

  20. VocMat projekt - uudsed e-õppe võimalused turismiasjalistele / Heli Tooman

    Index Scriptorium Estoniae

    Tooman, Heli, 1949-

    2008-01-01

    Turismivaldkonna spetsialistidele mõeldud koolitusprojektist VocMat (Vocational Management Training for the Tourism Industry). Projekti partneriteks Eestis on Ettevõtluse Arendamise Sihtasutuse Turismiarenduskeskus ja Tartu Ülikooli Pärnu kolledzh. Lisa: Kokkuvõte

  1. PRIA ja MES teevad koostööd maaelu edendamiseks / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2004-01-01

    Ilmunud ka: Nädaline : Maakonna Talu Leht, 16. okt. 2004, lk. 1. Põllumajanduse Registrite ja Informatsiooni Amet (PRIA) ning Maaelu Edendamise Sihtasutus (MES) sõlmisid kokkuleppe, mille alusel külaelu arendajatel, kellele PRIA määras või määrab investeeringutoetuse, on võimalik saada omaosaluse rahastamiseks MES-ist laenu või tagatist pangalaenu jaoks

  2. Uurida või mitte uurida, selles on küsimus ... / Heli Müristaja

    Index Scriptorium Estoniae

    Müristaja, Heli

    2011-01-01

    MTÜ Eesti Turismihariduse Liidu 25.-26. mail toimunud turismiettevõtjate, -õpetajate ja -õppurite ühisseminarist, kus arutati , millist rolli kannavad uuringud kvaliteetsete ja jätkusuutlike turismitoodete ja -teenuste arendamisel. Välisesinejateks olid Tony Harrison Glasgow Caledonia Ülikooli Moffat Centre for Travel & Tourism Business Development vanemkonsultant Šotimaalt ja Soomest Eva Holmberg ning Kaija Lindroth Haaga-Kelia Porvoo üksusest

  3. Kaali kraatritest tehtav film jõuab Discovery ekraanile / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2002-01-01

    Urma E. Liiv režissöörina, Riho Västrik Eesti-poolse produtsendina on Saaremaal filmimas populaarteaduslikku filmi "Päikese kodu", mis käsitleb Kaali meteoriidikraatriga seonduvat. Film valmib koostöös lätlastega ning tehakse eesti, läti ja inglise keeles.

  4. Film Kaali meteoriidiplahvatusest võib jõuda teaduskanalile Discovery / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2002-01-01

    Urmas E. Liiv režissöörina, Riho Västrik Eesti-poolse produtsendina on Saaremaal filmimas populaarteaduslikku filmi "Päikese kodu", mis käsitleb Kaali meteoriidikraatriga seonduvat. Film valmib koostöös lätlastega ning tehakse eesti, läti ja inglise keeles

  5. Hans Teiv : mina sellel kohal igavuse üle ei kurda / Hans Teiv ; interv. Heli Salong

    Index Scriptorium Estoniae

    Teiv, Hans

    2004-01-01

    Saare maavanema kohusetäitja ja kandidaat Hans Teiv hindab oma võimalusi saada ametisse kinnitatud, räägib oma tegevusest maavalitsuse osakonnajuhataja ja maakonna juhina ning tutvustab Saaremaa arenguvisioone

  6. Viron kieli toisena kielenä - opetuksesta Tarton yliopistossa 1820-luvun lopulla / Heli Laanekask

    Index Scriptorium Estoniae

    Laanekask, Heli, 1950-

    2013-01-01

    Artiklis analüüsitakse Tartu Ülikooli eesti keele lektori Johann Samuel Friedrich Boubrigi õpetamise metoodikat, kasutatud allikaid ja loengute sisu. Puudutatakse ka sugulaskeelte - soome ja ungari keele õpetust

  7. Strateegiat juba realiseeritakse / Inge Timoštšuk, Heli Mattisen

    Index Scriptorium Estoniae

    Timoštšuk, Inge, 1970-

    2002-01-01

    26.11.2002 kinnitas TPÜ nõukogu TPÜ õpetajakoolituse strateegia 2001-2005; kommentaarid strateegia koostajate töörühma kuulunud TPÜ akadeemiliselt prorektorilt H. Mattisenilt ja õpetajakoolituse osakonna juhatajalt I. Timoštšukilt, vahendas Anu Mõttus

  8. Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

    Index Scriptorium Estoniae

    Lehtsaar, Heli, 1976-

    2008-01-01

    Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

  9. Berliini kunstielu : aktuaalne, sõltumatu, internatsionaalne... ja vastuoluline / Heli Meisterson

    Index Scriptorium Estoniae

    Meisterson, Heli

    2004-01-01

    IX rahvusvahelisest kaasaegse kunsti messist "Art Forum Berlin", selle raames toimunud Zdenek Felixi kureeritud erinäitusest "Made in Berlin". Eesti kunstnikest olid messil esindatud Ene-Liis Semper ("Oasis", "Uks", esindas Hamburgi galerii Art Agents) ja Jaan Toomik (esindas IBID Projects). New Yorgi moodsa kunsti muuseumi väljapanekust Berliini uues rahvusgaleriis. Friedrich Christian Flicki kollektsiooni väljapanekust Hamburger Bahnhofis

  10. Alguses oli HELI ja PÄRT, siis Jalaka LAVASTUS / Riina Luik

    Index Scriptorium Estoniae

    Luik, Riina, 1962-

    2010-01-01

    Tõnu Kaljuste ja Peeter Jalaka lavastusest "Alguses oli", lavastuse aluseks Arvo Pärdi teosed "In Principio" ja "Miserere", 17. augustil Noblesse valukojas toimunud etendusest, muusikaline juht Tõnu Kaljuste. Arvo Pärdi pidunädalate ürituste loetelu

  11. Eelmine aasta andis palju häid uusehitisi / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2003-01-01

    Analüüsitakse Kuressaares aasta jooksul valminud ehitusi, sisekujundust ja reklaamisilte. Parimateks tunnistas žürii koosseisus Lilian Hansar, Urmas Sepp, Endla Tuutma, Vello Liiv, Ainar Viires, Tuuli Org, Terje Truumaa, Sulev Vahtre, Urmas Arike ja Rita Tamm ärihoone Ferrumi (Arhitektuuribüroo Alver Trummal Arhitektid), Kohvik-Veski laienduse (projekt Tuuli Org), eramu Tulika 5 (projekt Kiira Soosaar), pansionaadi Uus-Roomassaare 5 ruumikujunduse (kujundaja Vello Liiv) ja raamatukogu infokeskuse reklaamisildi (kujundaja AB Studio 3)

  12. Talutoidu tootjad tahavad varjusurmas "Eesti toidu" programmi ellu äratada / Heli Raamets ; kommenteerinud Karina Loi

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2011-01-01

    Talutootjad leidsid seminaril "Kohalik toit tarbijani 2020 - kuidas?", et nende toodangu paremaks tarbijani jõudmiseks on vaja teha koostööd ning kohaliku toidu strateegia ja tegevuskava oleks vaja kajastada uues maaelu arengukavas

  13. 14 CFR 77.29 - Airport imaginary surfaces for heli-ports.

    Science.gov (United States)

    2010-01-01

    ... in size and shape with the designated take-off and landing area of a heliport. This surface is a... surface, and extends outward and upward for a horizontal distance of 4,000 feet where its width is 500 feet. The slope of the approach surface is 8 to 1 for civil heliports and 10 to 1 for military...

  14. Kui hästi või halvasti ... / Jaak Aaviksoo, Piret Hartman, Heli Aru

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2003-01-01

    TÜ rektor J. Aaviksoo, Üliõpilaskondade Liidu juhatuse esimees P. Hartman ja Haridus- ja Teadusministeeriumi kõrghariduse talituse juhataja H. Aru vastavad küsimusele, kui hästi või halvasti on end õigustanud kõrghariduses aasta toiminud 3+2 süsteem

  15. Holocene coastal dune development and environmental changes in Helis area (NW Peloponnese, Greece

    Directory of Open Access Journals (Sweden)

    L. STAMATOPOULOS

    2017-12-01

    Full Text Available The coastal area of western Peloponnese is characterized by Pleistocene and Holocene marine deposits. The study area shows the effects of different phases of coastal morphology evolution and is located along a wave-dominated and microtidal coast in the northwestern Peloponnese, 40 km southwest of Patras city. Three significant morphogenetic phases occurred during the Holocene. The first was radiometrically aged from 7000 to 3810 years BP, marking the end of the rapid postglacial transgression. The second, between 3810 and 1400 years BP, was characterized by high rates of sedimentation, possibly because of the proximity of the mouth of the Peneus River, and resulted in the accumulation of predominantly fluvial sediments. During the third and younger phase, from 1400 years BP to the present, landward migration of the coast and deposition of aeolian sands occurred. Archaeological and morphological evidences suggest that this last phase should be related to a low sea-level stand followed by a slow sea-level rise, up to the present-day position and by humid-temperate climate. The collected data concerning the Holocene coastal dune belts, suggest that main phases of dune development could be related to the effects of sea-level changes, climatic conditions, and in a subordinate way, to human activity.

  16. Euroopa parim film näitab punase võimu olemust / Heli Meisterson

    Index Scriptorium Estoniae

    Meisterson, Heli

    2006-01-01

    Euroopa Filmiakadeemia andis Euroopa 2006.a. parima filmi auhinna sakslase Florian Henckel von Donnersmarcki filmile "Teiste elu" ("Das Leben der Anderen"), mille peaosaline Ulrich Mühe sai parima meesnäitleja auhinna. F. Henckel von Donnersmarck sai ka stsenaristi auhinna

  17. Lutshshi film Jevropõ raskrõvajet sut Shtazi / Heli Meisterson

    Index Scriptorium Estoniae

    Meisterson, Heli

    2006-01-01

    Euroopa Filmiakadeemia andis Euroopa 2006.a. parima filmi auhinna sakslase Florian Henckel von Donnersmarcki filmile "Teiste elu" ("Das Leben der Anderen"), mille peaosaline Ulrich Mühe sai parima meesnäitleja auhinna. F. Henckel von Donnersmarck sai ka stsenaristi auhinna. Lisatud Euroopa 2006.a. filmiauhinna saajate nimekiri

  18. Eesti kõrgharidus institutsionaalse akrediteerimise tulemuste taustal ehk Mida juhid peaksid teadma / Maiki Udam, Riin Seema, Heli Mattisen

    Index Scriptorium Estoniae

    Udam, Maiki

    2015-01-01

    2014. aastal Eesti Kõrghariduse Kvaliteediagentuuris tehtud kõrghariduse institutsionaalse akrediteerimise hindamisaruannete kvalitatiivsest analüüsist, millega selgitati välja kõrgkoolide peamised tugevad ja nõrgad küljed

  19. Koos tööstusega tagame ohutuma elu- ja töökeskkonna / Kitty Kislenko, Heli Laarmann

    Index Scriptorium Estoniae

    Kislenko, Kitty

    2006-01-01

    Euroopa Liidus on käsil senise kemikaaliohutuse poliitika reform, mille eesmärgiks on paremini kaitsta inimese tervist ja keskkonda, säilitades samal ajal ELi tööstuse konkurentsivõime ja innovatsioon. Selleks on välja töötatud uus kemikaaliohutuse määruse eelnõu (REACH määrus). Sama ka Linnaleht : Tartu 18. aug. 2006, lk. 6; Põhjarannik 12. aug. 2006, lk. 2; Nädaline 22. aug. 2006, lk. 10 ; Pärnu Postimees 21. sep. 2006, lk. 11

  20. Tõlkemeistrite 141 selli / Triinu Tamm ; intervjueerinud Pille-Riin Larm ; kommenteerinud Heli Allik, Doris Kareva, Aare Pilv, Alari Allik

    Index Scriptorium Estoniae

    Tamm, Triinu

    2017-01-01

    Eesti Kirjanike Liidu tõlkijate sektsiooni noortele, gümnasistidele ja tudengitele suunatud ilukirjanduse tõlkevõistlusest ja koolitusest. Koos Tallinna ülikooli ja Postimehega käima lükatud uuel tõlkevõistlusel tõlgiti proosatekste vene, prantsuse, inglise ja jaapani keelest. Kommenteerivad tõlkevõistluse žüriide esindajad. Kõige rohkem töid oli Tartu ülikooli üliõpilastelt - 50, Tallinna ülikooli tudengeilt 25, gümnasistide töid oli 59

  1. Pilt ja heli koos räägivad artisti kohta palju / Ove Musting ; intervjueerinud Margus Haav

    Index Scriptorium Estoniae

    Musting, Ove

    2010-01-01

    Intervjuu režissööri ja produtsendi Ove Mustinguga, kelle uut lühimängufilmi "Kallis sõber, Sind austan" näidatakse 4. veebruaril 2010 Viljandi klubis Puhas Kuld. Räägitakse ka filmis üht peaosa kehastavast Jaan Pehkist alias Orelipoisist, kelle uue albumi "Õnn" esitluskontsert samas toimub

  2. 27. XI esitles Kanuti gildi saalis Mooste avatud ateljee MOKS video-, heli- ja tegevuskunstiprogrammi "Põhi silmab kagu"...

    Index Scriptorium Estoniae

    2003-01-01

    Esinesid MOKSiga seotud kunstnikud ja rühmitused: John Grzinich, OPA: Slobodanka Stevceska, Denis Saraginovski (Obsessive Possessive Aggression, Makedoonia), Kaarel Vulla, Irene Roos, Jane Remm, OMP: maalikunstnikud Maris Palgi, Eva Orav ja ajakirjanik Maia Möller, Pink Punk: Kristin Kalamees, Margus Tamm, Sandra Jõgeva

  3. Tan Silliksaar, Tõnu Ling : meie piltides ei ole mingit trikitamist ega skandaali / Tõnu Ling, Tan Silliksaar ; interv. Heli Salong

    Index Scriptorium Estoniae

    Ling, Tõnu

    2005-01-01

    Kuressaare kultuurikeskuses ja Saaremaa kunstistuudios avati Tõnu Lingi ja Tan Silliksaare fotonäitus-müük "Maameeste maastikud". Fotod on prinditud spetsiaalsele, kunsti reprodutseerimiseks mõeldud lõuendile. Autorid oma koostööst, fotodest, lõuenditehnikast

  4. Effects of pregnancy and intensity of Plasmodium falciparum transmission on immunoglobulin G subclass responses to variant surface antigens

    DEFF Research Database (Denmark)

    Megnekou, Rosette; Staalsoe, Trine; Taylor, Diane W

    2005-01-01

    Placenta-sequestering Plasmodium falciparum involved in the pathogenesis of pregnancy-associated malaria (PAM) in otherwise clinically immune women expresses particular variant surface antigens (VSA(PAM)) on the surface of infected erythrocytes that differ from VSA found in parasitized nonpregnant...... individuals (non-PAM type VSA). We studied levels of immunoglobulin G (IgG) and IgG subclasses with specificity for VSA(PAM) and for non-PAM type VSA in pregnant and nonpregnant women from two sites with different endemicities in Cameroon. We found that VSA(PAM)-specific responses depended on the pregnancy......(PAM)-specific immunity to pregnancy-associated malaria....

  5. Rasked vestlused. Kuidas ma talle seda ütlen / Irene Metsis, Sami Seppänen, Peep Sooman ; intervjueerinud Heli Lehtsaar

    Index Scriptorium Estoniae

    Metsis, Irene

    2009-01-01

    Skanska EMV administratsioonijuhi Irene Metsise, AS-i Elisa Eesti tegevdirektori Sami Seppäneni ja Pindi Kinnisvara juhatuse liikme Peep Soomani soovitused negatiivse sõnumi edastamiseks töötajale. Vt. samas: 4 nõuannet juhile, kuidas end keeruliseks vestluseks ette valmistada

  6. Ilona Lott: kui oled proff, võetakse sind kõikjal avasüli vastu / Ilona Lott ; intervjueerinud Heli Lehtmets

    Index Scriptorium Estoniae

    Lott, Ilona

    2009-01-01

    Suurkorporatsiooni Schneider Electricu Balti riikide personalijuht vastab küsimustele, mis puudutavad tema karjääri, tööd personalijuhina, Schneider Electronicusse tööle asumist, töötamist rahvusvahelises organisatsioonis ning tööülesandeid

  7. Kogu elu tööliste keskel / Aarne Ruben

    Index Scriptorium Estoniae

    Ruben, Aarne, 1971-

    2003-01-01

    Portreefilm filmimees Semjon Shkolnikovist "Igaviku seisukohalt" : stsenarist Igor Ruus : režissöörid Igor Ruus ja Heli Speek : produtsent Igor Ruus : Estonia Film 2002. Lisatud andmed Igor Ruusi, Heli Speegi ja Aarne Rubeni kohta, lk. 114

  8. Tarvo Hanno Varres, Mari-Leen Kiipli / Merilin Talumaa, Hanno Soans, Tatjana Kozlova-Johannes

    Index Scriptorium Estoniae

    Talumaa, Merilin, 1986-

    2015-01-01

    Vaatluse alla on võetud Tarvo Hanno Varrese heli- ja videoinstallatsioon "Lindistav põrand" (2015) ja heli- ja videoteos "Betweenland" (2014) ning Mari-Leen Kiipli fotoseeria "The school of dreams" (2012-2015)

  9. Long-term stand growth after helicopter and ground-based skidding in a tupelo-cypress wetland: 21-year results

    Science.gov (United States)

    D.E. Evans; W.M. Aust; J.A. Peterson

    2013-01-01

    Three disturbance treatments were implemented on a tupelo-cypress forested wetland in southwestern Alabama on the Tensaw River in 1986: (1) clearcutting with helicopter log removal (HELI), (2) HELI followed by rubber-tired skidder traffic simulation (SKID), and (3) HELI followed by removal of all vegetation during the first two growing seasons via glyphosate herbicide...

  10. Plasmodium falciparum parasites expressing pregnancy-specific variant surface antigens adhere strongly to the choriocarcinoma cell line BeWo

    DEFF Research Database (Denmark)

    Haase, Rikke N; Megnekou, Rosette; Lundquist, Maja

    2006-01-01

    Placenta-sequestering Plasmodium falciparum parasites causing pregnancy-associated malaria express pregnancy-specific variant surface antigens (VSA(PAM)). We report here that VSA(PAM)-expressing patient isolates adhere strongly to the choriocarcinoma cell line BeWo and that the BeWo line can...... be used to efficiently select for VSA(PAM) expression in vitro....

  11. Rapid acquisition of isolate-specific antibodies to chondroitin sulfate A-adherent Plasmodium falciparum isolates in Ghanaian primigravidae

    DEFF Research Database (Denmark)

    Cox, Sharon E; Staalsoe, Trine; Arthur, Paul

    2005-01-01

    RBC to chondroitin sulfate A (CSA). The VSA mediating CSA binding (VSA(CSA)) and thus sequestration of pRBC in the placenta are antigenically distinct from those that mediate pRBC sequestration elsewhere in the body, and it has been suggested that VSA(CSA) are relatively conserved and may thus constitute...

  12. Dicty_cDB: Contig-U12422-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 3 ( EL513628 ) CHUY396.b1_G03.ab1 CHU(XYZ) puzzle sunflower Heli... 42 1e-06 4 (... EL513966 ) CHUY737.b1_B18.ab1 CHU(XYZ) puzzle sunflower Heli... 42 1e-06 4 ( DH772441 ) Rattus norvegicus D...03, 5' ... 48 1e-05 3 ( EL513533 ) CHUX637.b1_I16.ab1 CHU(XYZ) puzzle sunflower Heli... 42 1e-05 3 ( AC10558

  13. Expression of variant surface antigens by Plasmodium falciparum parasites in the peripheral blood of clinically immune pregnant women indicates ongoing placental infection

    DEFF Research Database (Denmark)

    Ofori, Michael F; Staalsoe, Trine; Bam, Victoria

    2003-01-01

    Placenta-sequestered Plasmodium falciparum parasites that cause pregnancy-associated malaria (PAM) in otherwise clinically immune women express distinct variant surface antigens (VSA(PAM)) not expressed by parasites in nonpregnant individuals. We report here that parasites from the peripheral blood...... of clinically immune pregnant women also express VSA(PAM), making them a convenient source of VSA(PAM) expressors for PAM vaccine research....

  14. How Spatial is a Whale? Places and Processes in Zoomusicology / Dario Martinelli

    Index Scriptorium Estoniae

    Martinelli, Dario

    2008-01-01

    Zoomusikoloogiast, mis uurib loomade muusikalist tegevust. Loomade muusikataoliste häälitsuste uurimisest. Heli kasutamisest loomadevahelises kommunikatsioonis, muusikast kui imitatsiooni vormist. Muusikast kui sotsiaalsest faktist

  15. Näitused / Katrin Kurik

    Index Scriptorium Estoniae

    Kurik, Katrin

    1998-01-01

    Linnagalerii Tallinnas: Anna Pauli tekstiilid ja Andras Huberi skulptuurid (Ungari); Kullo lastegalerii: Heli Männi ja Tondiraba keskkooli kunstiklasside õpilaste "Veneetsia maskid"; Tammsaare majamuuseum: Kersti Karu keraamika

  16. Kilplased saavad eesti filmi juubeliaastaks kilbi läikima / Erik Müürsepp

    Index Scriptorium Estoniae

    Müürsepp, Erik

    2010-01-01

    Tallinnfilm plaanib 2010. aasta jooksul juubeliprogrammi "Eesti film 100" raames digiteerida ning taastada pildi ja heli kolmel Rein Raamatu joonisfilmil: "Kilplased" (1974), "Suur Tõll" (1980) ja "Põrgu" (1983)

  17. Dicty_cDB: CFI277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nslated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxnxxxxxxkgxxxxxkxxxxkxyxxxxqxkx*cnxknrixtfn...NKTPVKPKLGEYG QKSIKTK Frame C: ---xxxxxxxxxxxxqxxxxxxxrxxxxxkxlxxqxixxxsxxqtxmq*xk*nxhfqslq ingsspxq*nis*vsa

  18. "Kohtuniku amet on liiga raske neile": Eesti naisjuristide pürgimisest kohtunikuks kahe maailmasõja vahelisel perioodil / Merike Ristikivi, Marju Luts-Sootak, Heli-Triin Räis

    Index Scriptorium Estoniae

    Ristikivi, Merike, 1973-

    2017-01-01

    Kohtukorraldusest 1918-1941, kohtunikele esitatavatest nõuetest, kohtuameti kandidaadiks saamisest, Auguste Susi-Tannebaumi ja Olli Oleski taotlustest kohtuameti kandidaadiks saamiseks, Tartu vaeslastekohtu esimehest Ljubov Hütsist, esimestest naiskohtunikest nõukogude perioodil

  19. Individuaalsete töövaidluste lahendamine töövaidluskomisjonis ja selle õigusliku regulatsiooni vastavus Eesti Vabariigi põhiseadusele : [bakalaureusetöö] / Heli Raidve ; Õigusinstituut ; juhendaja: Heino Siigur

    Index Scriptorium Estoniae

    Raidve, Heli

    2002-01-01

    Individuaalse töövaidluse lahendamise korra õiguslik regulatsioon, töövaidluskomisjoni õiguslik seisund ja sõltumatus, individuaalse töövaidluse lahendamise seaduse kohaldamisest töövaidluskomisjonis tekkivad probleemid

  20. Dicty_cDB: Contig-U04139-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Drosophila melanogaster cDNA clone 15... 30 3.6 3 ( EL513628 ) CHUY396.b1_G03.ab1 CHU(XYZ) puzzle sunflower ...Heli... 42 3.7 2 ( EL513966 ) CHUY737.b1_B18.ab1 CHU(XYZ) puzzle sunflower Heli... 42 3.7 2 ( CZ282611 ) cp2

  1. The Way It Was Montrealis / Ralf Kall ; fotod: Tõnu Sultson

    Index Scriptorium Estoniae

    Kall, Ralf

    2009-01-01

    dr. prof. Heli-Kristy Kultas-Ilinsky ja dr. prof. Igor Ilinsky külaskäigust Montreali Eesti Pensionäride Klubisse ja mälestusteose Kultas-Ilinsky, Heli-Kristy. The Way It Was: Trafford Publishing, 2008 esitlusest

  2. Expressed var gene repertoire and variant surface antigen diversity in a shrinking Plasmodium falciparum population.

    Science.gov (United States)

    Carlos, Bianca C; Fotoran, Wesley L; Menezes, Maria J; Cabral, Fernanda J; Bastos, Marcele F; Costa, Fabio T M; Sousa-Neto, Jayme A; Ribolla, Paulo E M; Wunderlich, Gerhard; Ferreira, Marcelo U

    2016-11-01

    The var gene-encoded erythrocyte membrane protein-1 of Plasmodium falciparum (PfEMP-1) is the main variant surface antigen (VSA) expressed on infected erythrocytes. The rate at which antibody responses to VSA expressed by circulating parasites are acquired depends on the size of the local VSA repertoire and the frequency of exposure to new VSA. Because parasites from areas with declining malaria endemicity, such as the Amazon, typically express a restricted PfEMP-1 repertoire, we hypothesized that Amazonians would rapidly acquire antibodies to most locally circulating VSA. Consistent with our expectations, the analysis of 5878 sequence tags expressed by 10 local P. falciparum samples revealed little PfEMP-1 DBL1α domain diversity. Among the most commonly expressed DBL1α types, 45% were shared by two or more independent parasite lines. Nevertheless, Amazonians displayed major gaps in their repertoire of anti-VSA antibodies, although the breadth of anti-VSA antibody responses correlated positively with their cumulative exposure to malaria. We found little antibody cross-reactivity even when testing VSA from related parasites expressing the same dominant DBL1α types. We conclude that variant-specific immunity to P. falciparum VSAs develops slowly despite the relatively restricted PfEMP-1 repertoire found in low-endemicity settings. Copyright © 2016 Elsevier Inc. All rights reserved.

  3. Differential induction of immunoglobulin G to Plasmodium falciparum variant surface antigens during the transmission season in Daraweesh, Sudan

    DEFF Research Database (Denmark)

    Nielsen, Morten A; Grevstad, Berit; A-Elgadir, Thoraya M E

    2005-01-01

    with severe malaria (VSA(SM)) are frequently recognized by IgG. METHODS: We analyzed levels of anti-VSA IgG in 57 individuals in Daraweesh, Sudan, before and after the transmission season. IgG responses to 79 Plasmodium falciparum isolates from children with defined malaria syndromes and exposed to high...

  4. Variable stiffness actuators: the user’s point of view

    NARCIS (Netherlands)

    Grioli, Giorgio; Wolf, Sebastian; Garabini, Manolo; Catalano, Manuel; Burdet, Etienne; Caldwell, Darwin; Carloni, Raffaella; Friedl, Werner; Grebenstein, Markus; Laffranchi, Matteo; Lefeber, Dirk; Stramigioli, Stefano; Tsagarakis, Nikos; van Damme, Michael; Vanderborght, Bram; Albu-Shaeffer, Alin; Bicchi, Antonio

    Since their introduction in the early years of this century, variable stiffness actuators (VSA) witnessed a sustained growth of interest in the research community, as shown by the growing number of publications. While many consider VSA very interesting for applications, one of the factors hindering

  5. Determinants of variant surface antigen antibody response in severe Plasmodium falciparum malaria in an area of low and unstable malaria transmission

    DEFF Research Database (Denmark)

    A-Elgadir, T M E; Theander, T G; Elghazali, G

    2006-01-01

    The variant surface antigens (VSA) of infected erythrocytes are important pathogenic markers, a set of variants (VSA(SM)), were assumed to be associated with severe malaria (SM), while SM constitutes clinically diverse forms, such as, severe malarial anemia (SMA) and cerebral malaria (CM). This s...

  6. Reducing door-to-needle times using Toyota's lean manufacturing principles and value stream analysis.

    Science.gov (United States)

    Ford, Andria L; Williams, Jennifer A; Spencer, Mary; McCammon, Craig; Khoury, Naim; Sampson, Tomoko R; Panagos, Peter; Lee, Jin-Moo

    2012-12-01

    Earlier tissue-type plasminogen activator (tPA) treatment for acute ischemic stroke increases efficacy, prompting national efforts to reduce door-to-needle times. We used lean process improvement methodology to develop a streamlined intravenous tPA protocol. In early 2011, a multidisciplinary team analyzed the steps required to treat patients with acute ischemic stroke with intravenous tPA using value stream analysis (VSA). We directly compared the tPA-treated patients in the "pre-VSA" epoch with the "post-VSA" epoch with regard to baseline characteristics, protocol metrics, and clinical outcomes. The VSA revealed several tPA protocol inefficiencies: routing of patients to room, then to CT, then back to the room; serial processing of workflow; and delays in waiting for laboratory results. On March 1, 2011, a new protocol incorporated changes to minimize delays: routing patients directly to head CT before the patient room, using parallel process workflow, and implementing point-of-care laboratories. In the pre and post-VSA epochs, 132 and 87 patients were treated with intravenous tPA, respectively. Compared with pre-VSA, door-to-needle times and percent of patients treated ≤60 minutes from hospital arrival were improved in the post-VSA epoch: 60 minutes versus 39 minutes (PLean process improvement methodology can expedite time-dependent stroke care without compromising safety.

  7. Geographical and temporal conservation of antibody recognition of Plasmodium falciparum variant surface antigens

    DEFF Research Database (Denmark)

    Nielsen, Morten A; Vestergaard, Lasse S; Lusingu, John

    2004-01-01

    The slow acquisition of protection against Plasmodium falciparum malaria probably reflects the extensive diversity of important antigens. The variant surface antigens (VSA) that mediate parasite adhesion to a range of host molecules are regarded as important targets of acquired protective immunity......, but their diversity makes them questionable vaccine candidates. We determined levels of VSA-specific immunoglobulin G (IgG) in human plasma collected at four geographically distant and epidemiologically distinct localities with specificity for VSA expressed by P. falciparum isolates from three African countries...

  8. Research of Video Steganalysis Algorithm Based on H265 Protocol

    Directory of Open Access Journals (Sweden)

    Wu Kaicheng

    2015-01-01

    This paper researches LSB matching VSA based on H265 protocol with the research background of 26 original Video sequences, it firstly extracts classification features out from training samples as input of SVM, and trains in SVM to obtain high-quality category classification model, and then tests whether there is suspicious information in the video sample. The experimental results show that VSA algorithm based on LSB matching can be more practical to obtain all frame embedded secret information and carrier and video of local frame embedded. In addition, VSA adopts the method of frame by frame with a strong robustness in resisting attack in the corresponding time domain.

  9. Siim Nestor soovitab : DJ Muggs. Odessa Pop : HUHi soojendus / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2007-01-01

    Üritusest "HipHop Café" 27. sept. Tallinnas Club Hollywoodis, heliplaadi "The Legend of the Mask and the Assassin" esitlusest. Üritusest "Odessa Pop" festivali "Hea Uus Heli" raames 29. sept. Tallinnas Von Krahlis

  10. Eredamaid helielamusi Helsingi "Avanto'lt" / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    Helsingi meediakunsti festival 21.-24. 2002. Põhitähelepanu oli koondunud helile. Franz Pomassli heliinstallatsioonist, Briti loomingulise kollektiivi Semiconductor heli- ja pildiperformance'itest, inglise kunstniku Lis Rhodesi videotest jm.

  11. EPL-i ümarlaud : kõige olulisem on vähi varajane avastamine / Ille Grün-Ots

    Index Scriptorium Estoniae

    Grün-Ots, Ille, 1960-2016

    2007-01-01

    Ümarlaual osalesid TÜ kliinikumi hematoloogia-onkoloogiakliiniku professor Hele Everaus, ravimifirma Roche Eesti OÜ tegevjuht Kadri Mägi, ravifirma GlaxoSmithKline Eesti filiaali juhataja Akshay Mody ja PERH-i keemiaravispetsialist Helis Pokker

  12. Valitsus peaks noortebändi Bedwetters autasustama

    Index Scriptorium Estoniae

    2007-01-01

    Rahvaliidu noored peavad vajalikuks, et valitsus autasustaks esimese Eesti bändina MTV Europe Music Awards 2007 galal Saksamaal Münchenis auhinnakategoorias "Euroopa uue heli" tiitli võitnud pop-punkansamblit Bedwetters

  13. Siim Nestor soovitab : HUH : energiaöö. Bad Apples / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2006-01-01

    Festivali "Hea Uus Heli" hooaja lõpetamisest 15. dets. Von Krahlis Tallinnas. Ansambli Bad Apples heliplaadi "When Colours Become Day and Night" esitlusest 19. dets. Tallinnas teatri NO99 majas Jazziklubis

  14. Uuring : 3G vajab läbilöögiks televisiooni / Askur Alas

    Index Scriptorium Estoniae

    Alas, Askur, 1973-

    2004-01-01

    Analysys'i uuringu kohaselt võivad need mobiilsideoperaatorid, kes pakuvad 3G võrgus televisiooni või filmide vaatamise võimalust, olla edukamad kui need, kes piirduvad ainult heli ja tavalise andmeside võimalustega

  15. Killustatud toetusvõimalused panevad ettevõtja eri asutuste vahet jooksma / Merike Lees

    Index Scriptorium Estoniae

    Lees, Merike, 1976-

    2004-01-01

    Ettevõtluse Arendamise Sihtasutus, Põllumajanduse Registrite ja Informatsiooni Amet, konsultatsioonifirma BDA Estonia ning maakondlikud arenduskeskused jagavad toetusvõimaluste kohta erinevat informatsiooni. Kommenteerivad Kadri Ugand, Piret Arusaar, Heli Raamets ja Tiina Tarma

  16. Very Complicated, indeed! / Jürgen Rooste

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2005-01-01

    Marco Laimre ja Killu Sukmiti näitus "Very Complicated Rock'n'Roll" Kunstihoone galeriis kuni 22. V. Heli: Indrek Pinsel, Andres Lõo, Riho Sibul, Erkki-Sven Tüür, Rainer Jancis (heliinstallatsiooni seadmine)

  17. Panustamine töötaja teadmiste testimisse tasub ära / Maio Rannamägi, Kreet Aun, Mari Krumm

    Index Scriptorium Estoniae

    Rannamägi, Maio

    2006-01-01

    If Eesti Kindlustus lõi töötajate teadmiste testimise süsteemi, et omada parimate kindlustusalaste teadmistega personali Eestis. Vt. samas: Teste täiustati pidevalt. Kommenteerivad Heli Kauber ja Annika Jung

  18. Kunstnikud käivad katuseid mööda / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2010-01-01

    Näitus "Linna kohal" Tallinna Linnagaleriis 19. septembrini 2010. Osalevad Anu Vahtra, Johnson & Johnson, Timo Toots, Claudia Doms, Mikk Heinsoo, Urmo Mets, Marit Ilison. Kuraatorid Kadri Klementi ja Helis Teiter. Näituse teemaks on linnamajade kasutamata katusepinnad

  19. Eramu Viimsis : Mäekünka 8, Harjumaa = Private home in Viimsi : Mäekünka 8, Harju County / Liina Jänes

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2008-01-01

    Hoone on suures osas valatud monoliitbetoonist ning puhas betoonpind kujundab maja väljast ja seest. Arhitekt Eero Palm. Sisearhitektid: Kadi Kõpper, Heli Aade. I ja II korruse plaan, värv. välisvaade, sisevaade

  20. Mitmekesine, mitmel viisil kesine / Ly Lestberg

    Index Scriptorium Estoniae

    Lestberg, Ly, 1965-

    2004-01-01

    Arvustus: Robbe-Grillet, Alain. Džinn : punane auk ebaühtlaste sillutuskivide vahel : moodsa aja lugemik = Djinn : un trou rouge entre les pavés disjoints / Heli Alliku tõlge. [Tallinn] : Valgus, 2004. (Homo ludens)

  1. [Raamat] / Tarmo Rajamets

    Index Scriptorium Estoniae

    Rajamets, Tarmo, 1969-

    2004-01-01

    Tutvustus: Robbe-Grillet, Alain. Džinn : punane auk ebaühtlaste sillutuskivide vahel : moodsa aja lugemik = Djinn : un trou rouge entre les pavés disjoints / Heli Alliku tõlge. [Tallinn] : Valgus, 2004. (Homo ludens)

  2. Lähiminevik Kinomajas

    Index Scriptorium Estoniae

    2003-01-01

    Homme näidatakse Kinomajas portreefilmi filmimees Semjon Shkolnikovist "Igaviku seisukohalt" : stsenarist Igor Ruus : režissöörid Igor Ruus ja Heli Speek : produtsent Igor Ruus : Estonia Film 2002

  3. Lasva veetorn-galerii = Lasva water tower-gallery / Veronika Valk

    Index Scriptorium Estoniae

    Valk, Veronika, 1976-

    2010-01-01

    Lasva veetorni rekonstrueerimisest klavertrepiga kunstigaleriiks-vaatetorniks. Projekteerija: Zizi & Yoyo. Autorid: arhitekt Veronika Valk, arhitekti abiline Kadri Klementi, kunstnik Peeter Laurits, skulptor Kalle-Priit Pruuden, Kalle Tikas (heli elektroonika). Projekt: 2006-2008, valmis: 2009

  4. 76 FR 5467 - Airworthiness Directives; Pilatus Aircraft Ltd. Models PC-6, PC-6-H1, PC-6-H2, PC-6/350, PC-6/350...

    Science.gov (United States)

    2011-02-01

    ...;Prices of new books are listed in the first FEDERAL REGISTER issue of each #0;week. #0; #0; #0; #0;#0..., Fairchild Heli Porter PC-6 airplanes, or Fairchild-Hiller Corporation PC-6 airplanes. Discussion Section... [[Page 5469

  5. Kõlakoda - muusika tundeline vägi / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2008-01-01

    Teaduslikust muusikast - muusika seostest matemaatikaga, süsteemsest lähenemisest muusikale. Heli salvestamisest ja heliteadusest. Leiutajate Thomas Alva Edisoni ja Edouard-Leon Scott de Martinville'i loodud maailma esimestest helitaasesitusseadmetest ja helisalvestustest

  6. Hamletid Krahli proovisaalis - remixed and revisited / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2006-01-01

    "Hamletid" William Shakespeare'i ainetel Von Krahli Teatri väikeses saalis. Kontseptsioon, lavastus, koreograafia, kujundus, valgus Sasha Pepeljajev, video, heli, elektroonika Taavet Jansen. Esitaja Juhan Ulfsak. Esietendus 3. okt

  7. Yeast Interacting Proteins Database: YER081W, YDR105C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YDR105C TMS1 Vacuolar membrane protein of unknown function that is conserved in mammals; predicted to contai...tion that is conserved in mammals; predicted to contain eleven transmembrane heli

  8. Inimesed ostavad kinnisvara asemel üha rohkem teemante / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Eesti gemmoloogid Karin Eensaar ja Heli Kuulmann teemantidest kui investeeringust. Kommenteerib Karin Eensaar. Lisad: Maapõu peidab ülivanu kivikesi. Kultusehe number kaks: pärlikee; De Beers. Alrosa. BHP Billiton, Rio Tinto

  9. Raznõje, no ravnõje / Jevgenija Zelenskaja

    Index Scriptorium Estoniae

    Zelenskaja, Jevgenija

    2007-01-01

    Jõhvis toimus seminar "Tolerantsus rahvusvahelistes suhetes", kus esinesid USA teadlane Jeremy Gunn, rahvastikuministri nõunik Eva-Maria Asari, Viru kolledzhi esindaja Sergei Tshekrõzhov, Ida-Viru integratsioonikeskuse esindaja Heli Fershel

  10. Lack of gender-specific antibody recognition of products from domains of a var gene implicated in pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Jensen, Anja T R; Zornig, Hanne D; Buhmann, Caecilie

    2003-01-01

    Gender-specific and parity-dependent acquired antibody recognition is characteristic of variant surface antigens (VSA) expressed by chondroitin sulfate A (CSA)-adherent Plasmodium falciparum involved in pregnancy-associated malaria (PAM). However, antibody recognition of recombinant products...

  11. Variant surface antigen-specific IgG and protection against clinical consequences of pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Shulman, Caroline E; Bulmer, Judith N

    2004-01-01

    BACKGROUND: Pregnancy-associated malaria caused by Plasmodium falciparum adherence to chondroitin sulfate A in the placental intervillous space is a major cause of low birthweight and maternal anaemia in areas of endemic P falciparum transmission. Adhesion-blocking antibodies that specifically...... recognise parasite-encoded variant surface antigens (VSA) are associated with resistance to pregnancy-associated malaria. We looked for a possible relation between VSA-specific antibody concentrations, placental infection, and protection from low birthweight and maternal anaemia. METHODS: We used flow...... cytometry to measure VSA-specific IgG concentrations in plasma samples taken during child birth from 477 Kenyan women selected from a cohort of 910 women on the basis of HIV-1 status, gravidity, and placental histology. We measured VSA expressed by one placental P falciparum isolate and two isolates...

  12. Linhagens de Lentinula edodes inibem fungos fitopatogênicos e o vírus da estomatite vesicular, sorotipo Alagoas

    OpenAIRE

    Sasaki, Selma H.; Linhares, Rosa E.C.; Nozawa, Carlos M.; Montalván, Ricardo; Paccola-Meirelles, Luzia D.

    2001-01-01

    Four Lentinula edodes strains (Le10, 46, K2, Assai) were assessed for their antagonistic effect on four filamentous fungus species of agricultural importance (Helminthosporium euphorbiae, Helminthosporium sp, Fusarium solani and Phomopsis sojae) and on Alagoas serotype of Vesicular Stomatitis Virus (VSA). The L. edodes strains studied had variable effects on the filamentous fungi and on VSA. The K2 and Le10 strains were antagonistic on the fungi assessed and the 46 and K2 strains were efficie...

  13. In Touch with Industry. ICAF Industry Studies 1999

    Science.gov (United States)

    1999-01-01

    construction management, construction, maintenance, repair, renovation , demolition, removal, and disposal. The infrastructure of the United States...allows the DOD, in some cases, to work with the private sector to build or renovate military housing. A key advantage of the law is that it permits...de Janeiro, Brazil Petroleos de Venezuela S.A. (PdVSA), Lake Maracaibo, Venezuela PdVSA INTEVEP, Caracas, Venezuela Secretaria de Energia , Buenos

  14. Using a topographic index to distribute variable source area runoff predicted with the SCS curve-number equation

    Science.gov (United States)

    Lyon, Steve W.; Walter, M. Todd; Gérard-Marchant, Pierre; Steenhuis, Tammo S.

    2004-10-01

    Because the traditional Soil Conservation Service curve-number (SCS-CN) approach continues to be used ubiquitously in water quality models, new application methods are needed that are consistent with variable source area (VSA) hydrological processes in the landscape. We developed and tested a distributed approach for applying the traditional SCS-CN equation to watersheds where VSA hydrology is a dominant process. Predicting the location of source areas is important for watershed planning because restricting potentially polluting activities from runoff source areas is fundamental to controlling non-point-source pollution. The method presented here used the traditional SCS-CN approach to predict runoff volume and spatial extent of saturated areas and a topographic index, like that used in TOPMODEL, to distribute runoff source areas through watersheds. The resulting distributed CN-VSA method was applied to two subwatersheds of the Delaware basin in the Catskill Mountains region of New York State and one watershed in south-eastern Australia to produce runoff-probability maps. Observed saturated area locations in the watersheds agreed with the distributed CN-VSA method. Results showed good agreement with those obtained from the previously validated soil moisture routing (SMR) model. When compared with the traditional SCS-CN method, the distributed CN-VSA method predicted a similar total volume of runoff, but vastly different locations of runoff generation. Thus, the distributed CN-VSA approach provides a physically based method that is simple enough to be incorporated into water quality models, and other tools that currently use the traditional SCS-CN method, while still adhering to the principles of VSA hydrology.

  15. Predicting Phosphorus Dynamics Across Physiographic Regions Using a Mixed Hortonian Non-Hortonian Hydrology Model

    Science.gov (United States)

    Collick, A.; Easton, Z. M.; Auerbach, D.; Buchanan, B.; Kleinman, P. J. A.; Fuka, D.

    2017-12-01

    Predicting phosphorus (P) loss from agricultural watersheds depends on accurate representation of the hydrological and chemical processes governing P mobility and transport. In complex landscapes, P predictions are complicated by a broad range of soils with and without restrictive layers, a wide variety of agricultural management, and variable hydrological drivers. The Soil and Water Assessment Tool (SWAT) is a watershed model commonly used to predict runoff and non-point source pollution transport, but is commonly only used with Hortonian (traditional SWAT) or non-Hortonian (SWAT-VSA) initializations. Many shallow soils underlain by a restricting layer commonly generate saturation excess runoff from variable source areas (VSA), which is well represented in a re-conceptualized version, SWAT-VSA. However, many watersheds exhibit traits of both infiltration excess and saturation excess hydrology internally, based on the hydrologic distance from the stream, distribution of soils across the landscape, and characteristics of restricting layers. The objective of this research is to provide an initial look at integrating distributed predictive capabilities that consider both Hortonian and Non-Hortonian solutions simultaneously within a single SWAT-VSA initialization. We compare results from all three conceptual watershed initializations against measured surface runoff and stream P loads and to highlight the model's ability to drive sub-field management of P. All three initializations predict discharge similarly well (daily Nash-Sutcliffe Efficiencies above 0.5), but the new conceptual SWAT-VSA initialization performed best in predicting P export from the watershed, while also identifying critical source areas - those areas generating large runoff and P losses at the sub field level. These results support the use of mixed Hortonian non-Hortonian SWAT-VSA initializations in predicting watershed-scale P losses and identifying critical source areas of P loss in landscapes

  16. Reducing Door-to-Needle Times using Toyota’s Lean Manufacturing Principles and Value Stream Analysis

    Science.gov (United States)

    Ford, Andria L.; Williams, Jennifer A.; Spencer, Mary; McCammon, Craig; Khoury, Naim; Sampson, Tomoko; Panagos, Peter; Lee, Jin-Moo

    2012-01-01

    Background Earlier tPA treatment for acute ischemic stroke increases efficacy, prompting national efforts to reduce door-to-needle times (DNTs). We utilized lean process improvement methodology to develop a streamlined IV tPA protocol. Methods In early 2011, a multi-disciplinary team analyzed the steps required to treat acute ischemic stroke patients with IV tPA, utilizing value stream analysis (VSA). We directly compared the tPA-treated patients in the “pre-VSA” epoch to the “post-VSA” epoch with regard to baseline characteristics, protocol metrics, and clinical outcomes. Results The VSA revealed several tPA protocol inefficiencies: routing of patients to room, then to CT, then back to room; serial processing of work flow; and delays in waiting for lab results. On 3/1/2011, a new protocol incorporated changes to minimize delays: routing patients directly to head CT prior to patient room, utilizing parallel process work-flow, and implementing point-of-care labs. In the pre-and post-VSA epochs, 132 and 87 patients were treated with IV tPA, respectively. Compared to pre-VSA, DNTs and percent of patients treated ≤60 minutes from hospital arrival were improved in the post-VSA epoch: 60 min vs. 39 min (pLean process improvement methodology can expedite time-dependent stroke care, without compromising safety. PMID:23138440

  17. GIS Based Distributed Runoff Predictions in Variable Source Area Watersheds Employing the SCS-Curve Number

    Science.gov (United States)

    Steenhuis, T. S.; Mendoza, G.; Lyon, S. W.; Gerard Marchant, P.; Walter, M. T.; Schneiderman, E.

    2003-04-01

    Because the traditional Soil Conservation Service Curve Number (SCS-CN) approach continues to be ubiquitously used in GIS-BASED water quality models, new application methods are needed that are consistent with variable source area (VSA) hydrological processes in the landscape. We developed within an integrated GIS modeling environment a distributed approach for applying the traditional SCS-CN equation to watersheds where VSA hydrology is a dominant process. Spatial representation of hydrologic processes is important for watershed planning because restricting potentially polluting activities from runoff source areas is fundamental to controlling non-point source pollution. The methodology presented here uses the traditional SCS-CN method to predict runoff volume and spatial extent of saturated areas and uses a topographic index to distribute runoff source areas through watersheds. The resulting distributed CN-VSA method was incorporated in an existing GWLF water quality model and applied to sub-watersheds of the Delaware basin in the Catskill Mountains region of New York State. We found that the distributed CN-VSA approach provided a physically-based method that gives realistic results for watersheds with VSA hydrology.

  18. Rapid Improvement in Visual Selective Attention Related to Action Video Gaming Experience

    Directory of Open Access Journals (Sweden)

    Nan Qiu

    2018-02-01

    Full Text Available A central issue in cognitive science is understanding how learning induces cognitive and neural plasticity, which helps illuminate the biological basis of learning. Research in the past few decades showed that action video gaming (AVG offered new, important perspectives on learning-related cognitive and neural plasticity. However, it is still unclear whether cognitive and neural plasticity is observable after a brief AVG session. Using behavioral and electrophysiological measures, this study examined the plasticity of visual selective attention (VSA associated with a 1 h AVG session. Both AVG experts and non-experts participated in this study. Their VSA was assessed prior to and after the AVG session. Within-group comparisons on the participants' performance before and after the AVG session showed improvements in response time in both groups and modulations of electrophysiological measures in the non-experts. Furthermore, between-group comparisons showed that the experts had superior VSA, relative to the non-experts, prior to the AVG session. These findings suggested an association between the plasticity of VSA and AVG. Most importantly, this study showed that the plasticity of VSA was observable after even a 1 h AVG session.

  19. Rapid Improvement in Visual Selective Attention Related to Action Video Gaming Experience.

    Science.gov (United States)

    Qiu, Nan; Ma, Weiyi; Fan, Xin; Zhang, Youjin; Li, Yi; Yan, Yuening; Zhou, Zhongliang; Li, Fali; Gong, Diankun; Yao, Dezhong

    2018-01-01

    A central issue in cognitive science is understanding how learning induces cognitive and neural plasticity, which helps illuminate the biological basis of learning. Research in the past few decades showed that action video gaming (AVG) offered new, important perspectives on learning-related cognitive and neural plasticity. However, it is still unclear whether cognitive and neural plasticity is observable after a brief AVG session. Using behavioral and electrophysiological measures, this study examined the plasticity of visual selective attention (VSA) associated with a 1 h AVG session. Both AVG experts and non-experts participated in this study. Their VSA was assessed prior to and after the AVG session. Within-group comparisons on the participants' performance before and after the AVG session showed improvements in response time in both groups and modulations of electrophysiological measures in the non-experts. Furthermore, between-group comparisons showed that the experts had superior VSA, relative to the non-experts, prior to the AVG session. These findings suggested an association between the plasticity of VSA and AVG. Most importantly, this study showed that the plasticity of VSA was observable after even a 1 h AVG session.

  20. Effect of process parameters on power requirements of vacuum swing adsorption technology for CO2 capture from flue gas

    International Nuclear Information System (INIS)

    Zhang, Jun; Webley, Paul A.; Xiao, Penny

    2008-01-01

    This study focuses on the effects of process and operating parameters - feed gas temperature, evacuation pressure and feed concentration - on the performance of carbon dioxide vacuum swing adsorption (CO 2 VSA) processes for CO 2 capture from gas, especially as it affects power consumption. To obtain reliable data on the VSA process, experimental work was conducted on a purposely built three bed CO 2 VSA pilot plant using commercial 13X zeolite. Both 6 step and 9 step cycles were used to determine the influences of temperature, evacuation pressure and feed concentration on process performance (recovery, purity, power and corresponding capture cost). A simple economic model for CO 2 capture was developed and employed herein. Through experiments and analysis, it is found that the feed gas temperature, evacuation pressure and feed concentration have significant effects on power consumption and CO 2 capture cost. Our data demonstrate that the CO 2 VSA process has good recovery (>70%), purity (>90%) and low power cost (4-10 kW/TPDc) when operating with 40 C feed gas provided relatively deep vacuum is used. Enhanced performance is obtained when higher feed gas concentration is fed to the plant, as expected. Our data indicates large potential for application of CO 2 VSA to CO 2 capture from flue gas. (author)

  1. Intermittent preventive sulfadoxine-pyrimethamine treatment of primigravidae reduces levels of plasma immunoglobulin G, which protects against pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Shulman, Caroline E; Dorman, Edgar K

    2004-01-01

    Pregnancy-associated malaria (PAM) is an important cause of maternal and neonatal suffering. It is caused by Plasmodium falciparum capable of inhabiting the placenta through expression of particular variant surface antigens (VSA) with affinity for proteoglycans such as chondroitin sulfate A....... Protective immunity to PAM develops following exposure to parasites inhabiting the placenta, and primigravidae are therefore particularly susceptible to PAM. The adverse consequences of PAM in primigravidae are preventable by intermittent preventive treatment (IPTp), where women are given antimalarials...... at specified intervals during pregnancy, but this may interfere with acquisition of protective PAM immunity. We found that Kenyan primigravidae receiving sulfadoxine-pyrimethamine IPTp had significantly lower levels of immunoglobulin G (IgG) with specificity for the type of parasite-encoded VSA-called VSA(PAM...

  2. Effects of electrical stimulation of ventral septal area on firing rates of pyrogen-treated thermosensitive neurons in preoptic anterior hypothalamus from rabbits.

    Science.gov (United States)

    Dong, Jun; Xie, Xin-Hua; Lu, Da-Xiang; Fu, Yong-Mei

    2007-01-09

    Although there is considerable evidence supporting that fever evolved as a host defense response, it is important that the rise in body temperature would not be too high. Many endogenous cryogens or antipyretics that limit the rise in body temperature have been identified. Endogenous antipyretics attenuate fever by influencing the thermoregulatory neurons in the preoptic anterior hypothalamus (POAH) and in adjacent septal areas including ventral septal area (VSA). Our previous study showed that intracerebroventricular (I.C.V.) injection of interleukin-1beta (IL-1beta) affected electrophysiological activities of thermosensitive neurons in VSA regions, and electrical stimulation of POAH reversed the effect of IL-1beta. To further investigate the functional electrophysiological connection between POAH and VSA and its mechanisms in thermoregulation, the firing rates of thermosensitive neurons in POAH of forty-seven unit discharge were recorded by using extracellular microelectrode technique in New Zealand white rabbits. Our results show that the firing rates of the warm-sensitive neurons decreased significantly and those of the cold-sensitive neurons increased in POAH when the pyrogen (IL-1beta) was injected I.C.V. The effects of IL-1beta on firing rates in thermosensitive neurons of POAH were reversed by electrical stimulation of VSA. An arginine vasopressin (AVP) V1 antagonist abolished the regulatory effects of VSA on the firing rates in thermosensitive neurons of POAH evoked by IL-1beta. However, an AVP V2 antagonist had no effects. These data indicated that VSA regulates the activities of the thermosensitive neurons of POAH through AVP V1 but not AVP V2 receptor.

  3. Diffraction imaging study of the phase coexistence around the triple point in MnP

    International Nuclear Information System (INIS)

    Medrano, C.; Pernot, E.; Espeso, J.I.; Boller, E.; Lorut, F.; Baruchel, J.

    2001-01-01

    The coexistence of the helimagnetic, ferromagnetic and fan phases in the neighborhood of the triple point is investigated by real-time Bragg diffraction imaging in a (0 0 1) MnP crystal. When increasing the field while retaining the heli-ferromagnetic coexistence, the nucleation of the fan phase occurs inside the present interface. The shapes and orientations of the heli-ferromagnetic and fan-helimagnetic interfaces can be understood by considering the corresponding elastic and/or magnetostatic energy. The ferromagnetic-fan thick interface, on the contrary, suggests the existence of intermediate states

  4. Impairment of Vowel Articulation as a Possible Marker of Disease Progression in Parkinson's Disease

    OpenAIRE

    Skodda, Sabine; Grönheit, Wenke; Schlegel, Uwe

    2012-01-01

    PURPOSE: The aim of the current study was to survey if vowel articulation in speakers with Parkinson's disease (PD) shows specific changes in the course of the disease. METHOD: 67 patients with PD (42 male) and 40 healthy speakers (20 male) were tested and retested after an average time interval of 34 months. Participants had to read a given text as source for subsequent calculation of the triangular vowel space area (tVSA) and vowel articulation index (VAI). Measurement of tVSA and VAI were ...

  5. Insecticide-treated bed nets reduce plasma antibody levels and limit the repertoire of antibodies to Plasmodium falciparum variant surface antigens

    DEFF Research Database (Denmark)

    Askjaer, N; Maxwell, C; Chambo, W

    2001-01-01

    The use of insecticide-treated bed nets (ITN) has been documented to reduce malaria morbidity and mortality in areas with endemic malaria, but concerns have been raised that ITN usage could affect the acquisition of malaria immunity. Several lines of evidence have indicated that antibodies against...... variant surface antigens (VSA) are important in the development of naturally acquired immunity to Plasmodium falciparum malaria and may thus be good indicators of immune status. We have compared the levels of VSA antibodies in plasma from children who have used ITN for 4 years to levels in plasma from...

  6. Evidence for the involvement of VAR2CSA in pregnancy-associated malaria

    DEFF Research Database (Denmark)

    Salanti, Ali; Dahlbäck, Madeleine; Turner, Louise

    2004-01-01

    In Plasmodium falciparum-endemic areas, pregnancy-associated malaria (PAM) is an important health problem. The condition is precipitated by accumulation of parasite-infected erythrocytes (IEs) in the placenta, and this process is mediated by parasite-encoded variant surface antigens (VSA) binding...... to chondroitin sulfate A (CSA). Parasites causing PAM express unique VSA types, VSAPAM, which can be serologically classified as sex specific and parity dependent. It is sex specific because men from malaria-endemic areas do not develop VSAPAM antibodies; it is parity dependent because women acquire anti...

  7. Voice stress analysis and evaluation

    Science.gov (United States)

    Haddad, Darren M.; Ratley, Roy J.

    2001-02-01

    Voice Stress Analysis (VSA) systems are marketed as computer-based systems capable of measuring stress in a person's voice as an indicator of deception. They are advertised as being less expensive, easier to use, less invasive in use, and less constrained in their operation then polygraph technology. The National Institute of Justice have asked the Air Force Research Laboratory for assistance in evaluating voice stress analysis technology. Law enforcement officials have also been asking questions about this technology. If VSA technology proves to be effective, its value for military and law enforcement application is tremendous.

  8. Noor Eesti muusika plahvatab! / Andres Lõo

    Index Scriptorium Estoniae

    Lõo, Andres

    2004-01-01

    Popmuusikaüritustest muusikafestivali Hea Uus Heli raames: "1öö%" Von Krahlis ja "Viva la HUH!" kultuuritehases Polymer 8. ja 9. okt.. Jaapanlase Emi Maeda kontserdist Kanuti Gildi saalis 8. okt.ja elektroonilise muusika esitajatest Von Krahlis

  9. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  10. THE MILITARY GLIDER REVISITED

    African Journals Online (AJOL)

    briefest life span of any major military equipment type - spanning not ... that country. The disadvantages of this to PLAN ... increasingly hamper the employment of heli- .... time, both attack and medium helicopters could .... balance out his armoured superiority and to im- ... derable flexibility to our operations and enhance.

  11. Deceptive pictures and revealing sounds / Anu Allas

    Index Scriptorium Estoniae

    Allas, Anu, 1977-

    2009-01-01

    2009. aasta Ars Fennica kunstipreemia pälvinud eesti kunstniku ja fotograafi Mark Raidpere videokunstist, muusika ja heli tähtsast rollist tema videotes (videod "Pühendus/Dedication" (2008), "5 Guards" (2006), "Wailing Woman" (2007), "Majestoso Mystico" (2007), "Vekovka" (2008) jt.)

  12. Ülevaade tolli ja käibemaksu teabepäevast / Rait Kaarma, Mariliis Kannukene, Hiie Õunpuu

    Index Scriptorium Estoniae

    Kaarma, Rait

    2004-01-01

    30. märtsil toimunud teabepäevast tolli ja käibemaksu teemal. Ülevaade Heli Tariku, Ruth Paade, Lembar Kivistiku, Martin Hubergi ja Kaia Loobi sõnavõttudest. Lisad: kirjalik tollideklaratsioon (SAD) esitatakse, kui ; tollimaksumäärade, keeldude ja piirangutega saab tutvuda

  13. Stuart Brisley etendused inimliku ja kunstipärase piiril / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2009-01-01

    Stuart Brisley näitus "Crossings" ("Ületamised") Tallinna Linnagaleriis 19- sept. - 4. oktoobrini. Heli- ja valgusinstallatsioonist "Touching Black Ice" Titanicu hukkumisest 1912. a. 15. aprillil. Videoinstallatsioonist "Blackout" Estonia hukkumisest 1994. a. 28. septembril. Näitusega kaasnevast kataloogist. Stuart Brisley loomingust

  14. Kurtna keskusehoone renoveerimine = Renovation of the Kurtna center building / Epp Lankots

    Index Scriptorium Estoniae

    Lankots, Epp, 1976-

    2005-01-01

    Saku vallas Kurtna külas asuva Kurtna Linnukasvatuse Katsejaama peahoone (arhitekt Valve Pormeister, sisearhitektid Vello Asi ja Väino Tamm, 1965-66) pieteeditundelisest renoveerimisest hotelliks. Arhitektid: Heli Ernesaks, Katrin Rannik. Halvast ja odavast interjöörikujundusest. Ill.: 3 värv. välis- ja 3 sisevaadet

  15. Priit Pärna vanad hitid jõuavad taastatuna kinno / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2008-01-01

    Priit Pärna kuus joonisfilmi on digitaalselt taastatud Nkufilmi stuudios Saksa TrickWILK tehnikaga (restauraator Tõnu Talivee) ja heli osas Ants Andrease juhtimisel firmas Film Audio. Sõpruse kinos toimub eriseanss "Priit Pärn revisited" lühifilmide festivali raames 29. augustil

  16. Tartu linnaraamatukogu ja kunstikuu peakorraldaja Tartu kõrgema kunstikooli koostöös jõuab 27. ja 28. I vanasse kaubamajja kirjandus

    Index Scriptorium Estoniae

    2006-01-01

    Tartu vanas kaubamajas kohtuvad 27. I lastega raamatu "Seitse mütsikest" autorid kirjanik Lehte Hainsalu ja illustraator Lea Malin. 28. I astuvad kavaga "Kahjulik õhtu" publiku ette fs ja Asko Künnap, heli Heikki Kallelt. Esilinastub Jaan-Jürgen Klausi portreefilm "Erakpoeet Marko Kompus"

  17. Koolitusfirmade TOP aastal 2007

    Index Scriptorium Estoniae

    2008-01-01

    Koolitusfirmade TOP. Vt. samas: Käibe TOP 10; Käibekasvu TOP 10; Kasumi TOP 10; Kasumi kasvu TOP 10; Rentaabluse TOP 10; Omakapitali tootlikkuse TOP 10; Signe Sillasoo. Invicta tahab lähiaastail laieneda Eestis ja mujalgi; Ketlin Priilinn. Addenda kasutas ära majanduse soodsa seisu. Kommenteerib Heli Sõmer. Juhtide hoiakute muutmisega tõus esikolmikusse

  18. Kiberataki pridjotsja otrazhat samostojatelno / Roman Starapopov

    Index Scriptorium Estoniae

    Starapopov, Roman

    2008-01-01

    Valitsuse kinnitatud Eesti küberjulgeoleku strateegia üks olulisi põhimõtteid on igaühe vastutus kasutuses oleva süsteemi julgeoleku eest. Kaitseministeeriumi töötaja Heli Tiirmaa-Klaari selgitusi strateegia kohta

  19. Workshop Polli Talu Loomingulises Keskuses

    Index Scriptorium Estoniae

    2004-01-01

    MAP Intermedia Performance Collaboration'i (USA) workshop. Brendan McCall (liikumine), N. B. Aldrich (heli) ja Zach Poff (video) workshop tutvustab kolme kunstniku koostööd. Näidatakse ka multimeedia etendust, mis on külaliskunstnikel valminud Polli talus

  20. Sünnitades "Ema ja tütart" / Anna Hints

    Index Scriptorium Estoniae

    Hints, Anna, 1982-

    2010-01-01

    Tartu sünnitusmajale Toomemäel, naise eluringile ja põlvkondade järjepidevusele pühendatud "Ema ja tütar" kui koha, heli, foto ja rituaalse tegevuse koostoimel sündinud autori tajuvõrgustikku dekodeeriv pärimusliku ja isikliku taustaga kunstitöö

  1. Tarmeko on Olev Niguli elutöö / Annely Allik

    Index Scriptorium Estoniae

    Allik, Annely

    2005-01-01

    Olev Nigul on 40 aastat juhtinud Tartus tegutsevat mööblitööstusettevõtet Tarmeko. Kommenteerivad: Heli Lutsar, Triinu Lööve ja Lea Koorits. Vt. samas: Akordion ja spinning aitavad töömõtted unustada

  2. Художники ходят по крышам домов / Ханно Соанс

    Index Scriptorium Estoniae

    Соанс, Ханно, 1974-

    2010-01-01

    Näitusest "Linna kohal" Tallinna Linnagaleriis. Teemaks on linnamajade katusepindade kasutuselevõtt. Kuraatorid Kadri Klementi ja Helis Heiter. Töödest näitusel. Osalevad: Anu Vahtra — Tallinna Kunstihoone, Claudia Doms ja Mikk Heinsoo — Saku Suurhall, Timo Toots — Lennujaam, Marit Ilison — Telliskivi Loomelinnak, Johnson & Johnson — Postimaja

  3. Moodsad ajad vanas majas : Raekoja 1975. aasta sisekujundus = Modern Times at an Old Building : 1975 Interior Design of Tallinn Town Hall / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2004-01-01

    1973. a. Tallinna Raekojale uue sisekujunduslahenduse saamiseks korraldatud kutsutud konkursi võitis töö Annunciation, mille põhiautoriks oli Leila Pärtelpoeg, kaasautoriteks Aate-Heli Õun, Anu Raud, Ilme-Anu Neemre. Tööd jätkas Leila Pärtelpoeg koos Udo Umbergiga. Rippvaipade galerii autor Valve Ilveste

  4. Lühifilmide lühifestivalil Sõpruses uued tudengifilmid

    Index Scriptorium Estoniae

    2008-01-01

    Sõpruse kinos toimuvast lühifilmide festivalist 29. augustil, kus eriprogrammis "Tuliuued tudengifilmid" näeb Margus Paju ("Hargnevate teede aed"), Age Viksi ("Pealpool pilvi"), Mart Rauna ("Mehele parim"), Martin Ruusi ("Heli Mäeorg"), Joosep Matjuse ("Uuestisünd") ja Tanno Mee ("Mälestuste maja") lühifilme

  5. Kontseptsioonid ja persoonid / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-

    2003-01-01

    Heli Sarapuu näitus "Isale" Hobusepea galeriis. Valeri Vinogradovi "Design Jet 5001" Viviann Napi Galeriis. Eve Kiileri "Progressi arhitektoonika" Tallinna Linnagaleriis. Jan Van Imschooti maalinäitus "Müstilised patud ja kaasaegsed värvid. Ümberhindamise asupaik"

  6. Tigutorn = The Snail Tower / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tartus Väike-Turu 5 asuva Tigutorni arhitektuursest lahendusest. Maja alumisel korrusel on äriruumid, ülemistel korrustel korterid. Arhitektid Vilen Künnapu, Ain Padrik, kaasautorid Kristiina Hussar, Kerli Koolma (AB Künnapu & Padrik). Üldruumide kujundus: Heli Eensalu, Sulev Vahtra. Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele

  7. Tänane Tartu - naerud, nutud ja hernetondid = Tartu today - laughter, tears and scarecrows / Berk Vaher

    Index Scriptorium Estoniae

    Vaher, Berk, 1975-

    2006-01-01

    Tartu linnaruumist, selle teisenemistest. Eduard Tubina mälestusmärgist (skulptor Aili Vahtrapuu, arhitekt Veronika Valk, heli: Louis Dandrel), Tartu Kaubamajast (arhitekt Raivo Puusepp), Rüütli tänava kujundusest (Rene Valner, Ott Kadarik), Ülikooli tänavast. 5 värv. ill

  8. Valik konkursi "Noored poeedid 2009" alapealkirjaga "See on rõõm elust endast" tunnustust pälvinud töödest : [luuletused

    Index Scriptorium Estoniae

    2009-01-01

    Vanem vanuseaste 1. koht Triin Sepp, 2. koht Triinu Ansper, 3.-4. koht Kairi Sepp ja Heli Armus. Keskmine vanuseaste 1. koht Annaliis Lehto, 2. koht Liina Salonen, 3. koht Gerda-Liis Palmiste. Noorem vanuseaste 1. koht Reet Rüütel, 2. koht Diana Kasesalu, 3. koht Eliis Mets

  9. Sille Pihlaku ja Siim Tuksami arhitektuuritegevus = Activities of Sille Pihlak and Siim Tuksam in the Field of Architecture / Sille Pihlak, Siim Tuksam

    Index Scriptorium Estoniae

    Pihlak, Sille

    2016-01-01

    Installatsioon "Keha ehitus" Rotermanni Soolalao ees (2015), Eleringi disainimast "Soorebane" (konkursi võidutöö, 2016), Tallinn Music Week installatsioonid "HeliLained" (2016), näituse "Keha ehitus" kureerimine Eesti Arhitektuurimuuseumis (2015). Kultuurkapitali Arhitektuuri sihtkapitali aastapreemia nominent 2016

  10. Understanding the effects of fire management practices on forest health: Implications for weeds and vegetation structure (Project INT-F-04-01) [Chapter 14

    Science.gov (United States)

    Anne E. Black; Peter Landres

    2011-01-01

    Current fire policy to restore ecosystem function and resiliency and reduce buildup of hazardous fuels implies a larger future role for fire (both natural and human ignitions) (USDA and USDOI 2000). Yet some fire management (such as building fire line, spike camps, or heli-spots) potentially causes both short- and long-term impacts to forest health. In the short run,...

  11. Sensible branding / Martin Lindström ; interv. Alina Lisina

    Index Scriptorium Estoniae

    Lindström, Martin

    2006-01-01

    Autori juhitud ühe tähtsaima tootearendusalase uurimuse järelduseks on, et tootearenduses on oluline kasutada kõiki viit meelt. See tähendab, et hea toode eristub teistest nii lõhna, heli, välimuse, maitse kui ka kombatavuse poolest

  12. Elada vabana või surra = To live free or to die / Raul Keller

    Index Scriptorium Estoniae

    Keller, Raul, 1973-

    2015-01-01

    Näitusest "Vaikus on kuldne. Ilmar Laaban ja eksperimendid helis ning keeles" Kumu kunstimuuseumis. Näitus annab ülevaate keelega ja heliga-häälega tehtud kunstilistest eksperimentidest 20. sajandi algusest tänapäevani. Esindatud on kõlaluule rahvusvahelised pioneerid (nende hulgas Ilmar Laaban) ning Eesti kaasaegsed kõlapoeedid Jaan Malin ja Roomet Jakapi

  13. Commando Raids: 1946-1983.

    Science.gov (United States)

    1985-10-01

    then released, allowing the "barrel bomb" to roll free of the truck, jump the barbed -wire fences surrounding the headquarters, and roll across the...approxi- mately 250 miles south of Teheran. Eight RH-53D "Sea Stallion " heli- copters simultaneously took off from the aircraft carrier Nimitz in the

  14. Lasva veetorn = Lasva Water Tower / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Lasva veetorni rekonstrueerimisest klavertrepiga kunstigaleriiks-vaatetorniks. Arhitekt, idee autor Veronika Valk, kaasautor Kadri Klementi, klavertrepi teostus: Kalle-Priit Pruuden, trepi elektrooniline heli: Kalle Tikas, infostendid: Peeter Laurits. Žürii liige Kalle Komissarov žürii hinnangust EK arhitektuuri sihtkapitali 2009. a. väikeobjekti preemia pälvinud hoonele

  15. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    EFK salvestab Pärdi "Miserere", "Salve Regina", Nunc dimittis" ja "Littlemore tractus". Georg Otsa nimelise fondi moodustamisest. Pärimusmuusika Lõikuspeost. 24. - 29. IX esineb Eestis Kieli poistekoor. 15. IX avas peadirigent Olari Elts oma Läti Rahvusliku Sümfooniaorkestri uue hooaja. Heli Veskus on kutsutud esinema Läti Rahvusooperi galakontserdile

  16. Ilo Pariisi varjus / Kaia Sisask

    Index Scriptorium Estoniae

    Sisask, Kaia

    2003-01-01

    Portreefilm Pariisis giidina töötavast kirjanik Juhan Jaigi tütrest Ilo Jaik-Riedbergist "Ilo Pariisis" : stsenarist ja režissöör Peep Puks : operaatorid Arvo Vilu, Ago Ruus, Heli Arvo Vilu, Henn Liiva, Jüri Vaher : teksti loeb Anu Lamp : muusikaline kujundus Merike Vaino : filmi direktor Maie Kerma : Pro-Film 2002

  17. Conformational Preferences of Amphibian Peptides Brevinin-Ya and ...

    African Journals Online (AJOL)

    NICO

    180 to 180) in its Phi angle (C-N-C~-C), while its Psi angle. (N-C~-C-N) remains relatively fixed (–100), adopting theД-sheet conformation. The transformation of initial right-handed~-heli- cal (~R) configuration of Asn11 into Д-sheet after ~20 ns of.

  18. Eesti luule Kajaani sõnakunsti päevadel / Endel Mallene

    Index Scriptorium Estoniae

    Mallene, Endel, 1933-2002

    1996-01-01

    Ülevaade Kajaani sõnakunsti päevadest 'Sõna ja heli' ('Sana ja sävel'), kus toimus ka eesti kirjanike luuleõhtu ja Sass Suumani valikkogu esitlus: Suuman, Sass. Viisaampaa ei ole / Tlk. Pirkko Huurto, Ritva Hyry, Hannu Oittinen. Saarijärvi : Pohjoinen, 1996

  19. Enhanced FAA-hybrid III numerical dummy model in Madymo for aircraft occupant safety assessment

    NARCIS (Netherlands)

    Boucher, H.; Waagmeester, C.D.

    2003-01-01

    To improve survivability and to minimize the risk of injury to occupants in helicopter crash events, a complete Cabin Safety System concept including safety features and an enhanced FAA-Hybrid III dummy were developed within the HeliSafe project. A numerical tool was also created and validated to

  20. Õpetatud Eesti Selts 1988-1991 : [Ülevaade koosolekutest] / Tiit Rosenberg, Maris Pruuli

    Index Scriptorium Estoniae

    Rosenberg, Tiit, 1946-

    1995-01-01

    Lisa: Õpetatud Eesti Seltsi taasasutamise ürik : [26 apr. 1988]. Allakirjutanute hulgas Paul Ariste, Eduard Laugaste, Leo Metsar, Aino Põldmäe, Harald Peep, Juhan Peegel, Imbi Pelkonen, Heno Sarv, Arne Merilai, Margus Kasterpalu, Heli Laanekask, Eva Aaver, Paul Hagu, Hando Runnel

  1. Ainult kaks küsimust / Aleksandr Žedeljov

    Index Scriptorium Estoniae

    Žedeljov, Aleksandr

    2010-01-01

    Vene Teatris juunis 2011 esietenduvast live performance'ist "Alice", mis koosneb kaasaegsest koreograafiast, originaalsest autorimuusikast. videost, animatsioonist ja varjuteatrist. Lewis Carroll'i teosel "Alice Imedemaal" põhineva lavastuse autorid on Olga Privis, Aleksandr Žedeljov, MTÜ Fat Snail, MTÜ Vastik Sipsik, MTÜ HeliTelg

  2. Алиса в Заэстонье / Николай Караев

    Index Scriptorium Estoniae

    Караев, Николай, 1978-

    2010-01-01

    „Alice" on omanäoline live perfomance, mis koosneb kaasaegsest koreograafiast, originaalsest autorimuusikast, kunstilisest videost, traditsioonilisest animatsioonist, VJ setist ja varjude teatrietendusest. Lavastuse autoriteks on MTÜ Fat Snail, MTÜ Vastik Sipsik, MTÜ HeliTelg, Olga Privis ja Aleksandr Žedeljov. Lavastus põhineb Lewis Carrolli teosel „Alice Imedemaal", kuid pole otseselt autori tekstide ümberjutustus

  3. Bedwetters esineb tänutuuri raames Rakveres

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontsert 30. nov. Rakveres, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  4. Ilves viskas koos Bedwettersiga näppu. President Ilves kohtus õpilaste ja kaitseliitlastega / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters ja president Toomas Hendrik Ilvese Pärnu Sütevaka humanitaargümnaasiumi ja Kaitseliidu Pärnumaa maleva külastusest 9. novembril

  5. Kuidas Adolf Hitler vahetult enne valimisi Püssirohukeldrisse jõuab / Agni Lass

    Index Scriptorium Estoniae

    Lass, Agni

    2005-01-01

    10. sept. esietendub Tartu Püssirohukeldris P. Uttoni "Adolf", mille M. Unt pidi lavastama. Kuid proovideni ta ei jõudnud. See etendub E. Õunapuu käe all, kes tegi M. Undi lavavariandi ümber. Heli- ja lavakujundus ning kostüümid on samuti E. Õunapuult

  6. Keeleinimesed muretsevad inglise keele sissetungi pärast / Kaarel Kressa

    Index Scriptorium Estoniae

    Kressa, Kaarel, 1983-

    2007-01-01

    Kumu auditooriumis toimunud keelefoorumil arutati eesti keele tulevikuväljavaateid. Tallinna Ülikooli õppejõud Heli Mattisen osutas faktile, et toimumas on inglise keele hiiliv sulandumine kõrgharidusse. Mati Hindile tegi muret eestikeelse muusika vähesus riigiraadios

  7. NEW BEDFORD, FINAL WETLAND STUDY REPORT (08/10/88 TRANSMITTAL LETTER IS ATTACHED), 06-01-1988, SDMS# 51717

    Science.gov (United States)

    2013-06-11

    ... U 4 i' Hilli,i! J4 . Diu'it.i: nJl:iut..i.on Heli-sri Waldorf ... 'I . i 1! . i! li;i:iv I nciiiiiniiji t iil^Ji::'!! ii.iii:| nia I ILIIIII; Fn-'/ i ciiiiii I ii\\ re ;; i: i (! ii t I ciiin.!! ...

  8. Tunnuslause on leitud

    Index Scriptorium Estoniae

    2008-01-01

    2010 aasta kirikupäeva ja vaimuliku laulupeo sihtasutuse nõukogu kinnitas moto, milleks valiti murdekeelne kutse: "Mu mano tulge, latse". Moto konkursist (EELK kirikupäev ja vaimulik laulupidu toimuvad 11.-13. juunil 2010 Tartus, kunstiliseks juhiks Heli Jürgenson)

  9. Skaalanihe : kunstnikud räägivad / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2006-01-01

    Kunstnikud tutvustavad Kumus avanäitusel eksponeeritud kunstiteoseid: Anssi Kasitonni "Jah-monstrum", Chris Evans "Radikaalne lojaalsus", Neeme Külm "Betooni valatud lehm", Cevdet Erek "Teine sild", Heli Ryhänen "Ootus", Hans Hammert "Õhupallikabel", Veronica Brovall "Lahutus", Karsten Konrad "Supersuziseacat", Anders Krüger "Mis silma alt ära, see unustatud", Tommy Stockel "Tulevaste asjade kuju"

  10. Eesti Raamatukoguhoidjate Ühing tähistas 90 aasta möödumist asutamisest / Reet Olevsoo

    Index Scriptorium Estoniae

    Olevsoo, Reet, 1956-

    2013-01-01

    Ülevaade aasta- ja kõnekoosolekust ning 2012. a preemiate võitjatest. Teadusraamatukogude aasta teona tunnustati uudsel RFID-tehnoloogial põhineva teavikute laenutamis- ja tagastamissüsteemi rakendamist TLÜ Akadeemilises Raamatukogus. Süsteemi rakendamist koordineerisid IT-teenistuse juhataja Peeter Kondratjev ja teenindusosakonna juhataja Heli Sirotkin

  11. Küla arengukava on külaarengu toetuse saamiseks vajalik / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Liikumine Kodukant kavatseb esitada põllumajandusministeeriumile protestikirja, kuna ei nõustu ministeeriumi infopäevadel levitatava tõlgendusega nagu võiks külade taastamise ja arendamise meetme toetust taotleda ka ilma küla arengukavata. Arvamust avaldavad: Maris Ode, Lemmi Maasik, Heli Raamets, Marek Raud ja Sille Rähn

  12. True single-molecule DNA sequencing of a pleistocene horse bone

    DEFF Research Database (Denmark)

    Orlando, Ludovic Antoine Alexandre; Ginolhac, Aurélien; Raghavan, Maanasa

    2011-01-01

    -preserved Pleistocene horse bone using the Helicos HeliScope and Illumina GAIIx platforms, respectively. We find that the percentage of endogenous DNA sequences derived from the horse is higher among the Helicos data than Illumina data. This result indicates that the molecular biology tools used to generate sequencing...

  13. The (un)usefulness of interactive exploration in building 3D- mental representations.

    NARCIS (Netherlands)

    Meijer, F.; van den Broek, Egon

    The generation of mental representations from visual images is crucial in 3-D object recognition. In two experiments, thirty-six participants were divided into a low, middle, and high visuospatial ability (VSA) group, which was determined by Vandenberg and Kuse's MRT-A test (1978 Perception and

  14. Visuospatial and psychomotor aptitude predicts endovascular performance of inexperienced individuals on a virtual reality simulator.

    Science.gov (United States)

    Van Herzeele, Isabelle; O'Donoghue, Kevin G L; Aggarwal, Rajesh; Vermassen, Frank; Darzi, Ara; Cheshire, Nicholas J W

    2010-04-01

    This study evaluated virtual reality (VR) simulation for endovascular training of medical students to determine whether innate perceptual, visuospatial, and psychomotor aptitude (VSA) can predict initial and plateau phase of technical endovascular skills acquisition. Twenty medical students received didactic and endovascular training on a commercially available VR simulator. Each student treated a series of 10 identical noncomplex renal artery stenoses endovascularly. The simulator recorded performance data instantly and objectively. An experienced interventionalist rated the performance at the initial and final sessions using generic (out of 40) and procedure-specific (out of 30) rating scales. VSA were tested with fine motor dexterity (FMD, Perdue Pegboard), psychomotor ability (minimally invasive virtual reality surgical trainer [MIST-VR]), image recall (Rey-Osterrieth), and organizational aptitude (map-planning). VSA performance scores were correlated with the assessment parameters of endovascular skills at commencement and completion of training. Medical students exhibited statistically significant learning curves from the initial to the plateau performance for contrast usage (medians, 28 vs 17 mL, P dexterity as well as with image recall at end of the training period. In addition to current recruitment strategies, VSA may be a useful tool for predictive validity studies.

  15. Single motor–variable stiffness actuator using bistable switching mechanisms for independent motion and stiffness control

    NARCIS (Netherlands)

    Groothuis, Stefan; Carloni, Raffaella; Stramigioli, Stefano

    This paper presents a proof of concept of a variable stiffness actuator (VSA) that uses only one (high power) input motor. In general, VSAs use two (high power) motors to be able to control both the output position and the output stiffness, which possibly results in a heavy, and bulky system. In

  16. The volcaniclastic sequence of Aranzazu: Record of the impact of volcanism on Neogene fluvial system in the middle part of the Central Cordillera, Colombia

    International Nuclear Information System (INIS)

    Borrero Pena, Carlos Alberto; Rosero Cespedes, Juan Sebastian; Valencia M, Julian David; Pardo Trujillo, Andres

    2008-01-01

    The volcaniclastic sequence of Aranzazu (VSA, late Pliocene - early Pleistocene?) was sourced from the northernmost sector of the Machin - Cerro Bravo volcanic complex. The volcaniclastic accumulations filled the pre-existing fault-bend depressions in the surroundings of Aranzazu town (Caldas department, Colombia). A new classification of volcaniclastic deposits is proposed, in which the lahars are defined as volcaniclastic resedimented deposits, and differentiated from the primary volcaniclastic and epiclastic deposits. The updating the sedimentology and rheology of the deposits related with the laharic events is aimed. The VSA stratigraphy is based on the lithofacies identification and the definition of the architectural elements for syn- and inter-eruptive periods. The VSA lower member corresponds to the successive aggradation of syneruptive lahars (SV and SB elements) resulted from re-sedimentation of pumice-rich pyroclastic deposits and transported as debris and hyperconcentrated stream/flood flows. The VSA middle and upper members defined by coal contents were formed during the dominion of inter-eruptive (FF element) over the syn-eruptive (SV and SB elements) periods. They were formed during the reestablishment of the fluvial condition after the syn-eruptive laharic activity. Once the fluvial deposition was strengthened, the necessary conditions for the peat formation were propitious and the coal-bearing bed sets were developed.

  17. Acquisition and decay of antibodies to pregnancy-associated variant antigens on the surface of Plasmodium falciparum-infected erythrocytes that protect against placental parasitemia

    DEFF Research Database (Denmark)

    Staalsoe, T; Megnekou, R; Fievét, N

    2001-01-01

    Otherwise clinically immune women in areas endemic for malaria are highly susceptible to Plasmodium falciparum malaria during their first pregnancy. Pregnancy-associated malaria (PAM) is characterized by placental accumulation of infected erythrocytes that adhere to chondroitin sulfate A (CSA). S...... adhesion to CSA. Data suggest that VSA(CSA) is a target for vaccination against PAM....

  18. Accuracy of quantitative visual soil assessment

    Science.gov (United States)

    van Leeuwen, Maricke; Heuvelink, Gerard; Stoorvogel, Jetse; Wallinga, Jakob; de Boer, Imke; van Dam, Jos; van Essen, Everhard; Moolenaar, Simon; Verhoeven, Frank; Stoof, Cathelijne

    2016-04-01

    Visual soil assessment (VSA) is a method to assess soil quality visually, when standing in the field. VSA is increasingly used by farmers, farm organisations and companies, because it is rapid and cost-effective, and because looking at soil provides understanding about soil functioning. Often VSA is regarded as subjective, so there is a need to verify VSA. Also, many VSAs have not been fine-tuned for contrasting soil types. This could lead to wrong interpretation of soil quality and soil functioning when contrasting sites are compared to each other. We wanted to assess accuracy of VSA, while taking into account soil type. The first objective was to test whether quantitative visual field observations, which form the basis in many VSAs, could be validated with standardized field or laboratory measurements. The second objective was to assess whether quantitative visual field observations are reproducible, when used by observers with contrasting backgrounds. For the validation study, we made quantitative visual observations at 26 cattle farms. Farms were located at sand, clay and peat soils in the North Friesian Woodlands, the Netherlands. Quantitative visual observations evaluated were grass cover, number of biopores, number of roots, soil colour, soil structure, number of earthworms, number of gley mottles and soil compaction. Linear regression analysis showed that four out of eight quantitative visual observations could be well validated with standardized field or laboratory measurements. The following quantitative visual observations correlated well with standardized field or laboratory measurements: grass cover with classified images of surface cover; number of roots with root dry weight; amount of large structure elements with mean weight diameter; and soil colour with soil organic matter content. Correlation coefficients were greater than 0.3, from which half of the correlations were significant. For the reproducibility study, a group of 9 soil scientists and 7

  19. Impairment of vowel articulation as a possible marker of disease progression in Parkinson's disease.

    Directory of Open Access Journals (Sweden)

    Sabine Skodda

    Full Text Available PURPOSE: The aim of the current study was to survey if vowel articulation in speakers with Parkinson's disease (PD shows specific changes in the course of the disease. METHOD: 67 patients with PD (42 male and 40 healthy speakers (20 male were tested and retested after an average time interval of 34 months. Participants had to read a given text as source for subsequent calculation of the triangular vowel space area (tVSA and vowel articulation index (VAI. Measurement of tVSA and VAI were based upon analysis of the first and second formant of the vowels /α/, /i/and /u/ extracted from defined words within the text. RESULTS: At first visit, VAI values were reduced in male and female PD patients as compared to the control group, and showed a further decrease at the second visit. Only in female Parkinsonian speakers, VAI was correlated to overall speech impairment based upon perceptual impression. VAI and tVSA were correlated to gait impairment, but no correlations were seen between VAI and global motor impairment or overall disease duration. tVSA showed a similar reduction in the PD as compared to the control group and was also found to further decline between first and second examination in female, but not in male speakers with PD. CONCLUSIONS: Measurement of VAI seems to be superior to tVSA in the description of impaired vowel articulation and its further decline in the course of the disease in PD. Since impairment of vowel articulation was found to be independent from global motor function but correlated to gait dysfunction, measurement of vowel articulation might have a potential to serve as a marker of axial disease progression.

  20. Strains of Lentinula edodes suppress growth of phytopathogenic fungi and inhibit Alagoas serotype of vesicular stomatitis virus Linhagens de Lentinula edodes inibem fungos fitopatogênicos e o vírus da estomatite vesicular, sorotipo Alagoas

    Directory of Open Access Journals (Sweden)

    Selma H. Sasaki

    2001-03-01

    Full Text Available Four Lentinula edodes strains (Le10, 46, K2, Assai were assessed for their antagonistic effect on four filamentous fungus species of agricultural importance (Helminthosporium euphorbiae, Helminthosporium sp, Fusarium solani and Phomopsis sojae and on Alagoas serotype of Vesicular Stomatitis Virus (VSA. The L. edodes strains studied had variable effects on the filamentous fungi and on VSA. The K2 and Le10 strains were antagonistic on the fungi assessed and the 46 and K2 strains were efficient on the Vesicular Stomatitis Virus. The results widened the list of beneficial effects of L. edodes on the control and prevention of animal pathogenic virus and filamentous fungi.Quatro linhagens de Lentinula edodes (Le10, 46, K2, ASSAI foram avaliadas quanto ao seu efeito inibitório sobre quatro espécies de fungos filamentosos de importância agrícola (Helminthosporium euphorbiae, Helminthosporium sp., Fusarium solani, Phomopsis sojae e sobre o sorotipo Alagoas vírus da estomatite vesicular (VSA. Foi observado que as linhagens de L. edodes estudadas apresentaram variabilidade quanto ao seu efeito, tanto sobre os fungos filamentosos quanto sobre o vírus VSA. As linhagens K2 e Le10 apresentaram-se antagônicas sobre os fungos e as linhagens 46 e K2 foram eficientes na inibição do vírus VSA. Os resultados obtidos permitem ampliar a lista de efeitos benéficos de algumas linhagens de L. edodes no controle e prevenção de vírus patogênicos animais e de fungos filamentosos.

  1. Vectorised Spreading Activation algorithm for centrality measurement

    Directory of Open Access Journals (Sweden)

    Alexander Troussov

    2011-01-01

    Full Text Available Spreading Activation is a family of graph-based algorithms widely used in areas such as information retrieval, epidemic models, and recommender systems. In this paper we introduce a novel Spreading Activation (SA method that we call Vectorised Spreading Activation (VSA. VSA algorithms, like “traditional” SA algorithms, iteratively propagate the activation from the initially activated set of nodes to the other nodes in a network through outward links. The level of the node’s activation could be used as a centrality measurement in accordance with dynamic model-based view of centrality that focuses on the outcomes for nodes in a network where something is flowing from node to node across the edges. Representing the activation by vectors allows the use of the information about various dimensionalities of the flow and the dynamic of the flow. In this capacity, VSA algorithms can model multitude of complex multidimensional network flows. We present the results of numerical simulations on small synthetic social networks and multi­dimensional network models of folksonomies which show that the results of VSA propagation are more sensitive to the positions of the initial seed and to the community structure of the network than the results produced by traditional SA algorithms. We tentatively conclude that the VSA methods could be instrumental to develop scalable and computationally efficient algorithms which could achieve synergy between computation of centrality indexes with detection of community structures in networks. Based on our preliminary results and on improvements made over previous studies, we foresee advances and applications in the current state of the art of this family of algorithms and their applications to centrality measurement.

  2. HIV impairs opsonic phagocytic clearance of pregnancy-associated malaria parasites.

    Directory of Open Access Journals (Sweden)

    Jessica Keen

    2007-05-01

    Full Text Available BACKGROUND: Primigravid (PG women are at risk for pregnancy-associated malaria (PAM. Multigravid (MG women acquire protection against PAM; however, HIV infection impairs this protective response. Protection against PAM is associated with the production of IgG specific for variant surface antigens (VSA-PAM expressed by chondroitin sulfate A (CSA-adhering parasitized erythrocytes (PEs. We hypothesized that VSA-PAM-specific IgG confers protection by promoting opsonic phagocytosis of PAM isolates and that HIV infection impairs this response. METHODS AND FINDINGS: We assessed the ability of VSA-PAM-specific IgG to promote opsonic phagocytosis of CSA-adhering PEs and the impact of HIV infection on this process. Opsonic phagocytosis assays were performed using the CSA-adherent parasite line CS2 and human and murine macrophages. CS2 PEs were opsonized with plasma or purified IgG subclasses from HIV-negative or HIV-infected PG and MG Kenyan women or sympatric men. Levels of IgG subclasses specific for VSA-PAM were compared in HIV-negative and HIV-infected women by flow cytometry. Plasma from HIV-negative MG women, but not PG women or men, promoted the opsonic phagocytosis of CSA-binding PEs (p < 0.001. This function depended on VSA-PAM-specific plasma IgG1 and IgG3. HIV-infected MG women had significantly lower plasma opsonizing activity (median phagocytic index 46 [interquartile range (IQR 18-195] versus 251 [IQR 93-397], p = 0.006 and levels of VSA-PAM-specific IgG1 (mean fluorescence intensity [MFI] 13 [IQR 11-20] versus 30 [IQR 23-41], p < 0.001 and IgG3 (MFI 17 [IQR 14-23] versus 28 [IQR 23-37], p < 0.001 than their HIV-negative MG counterparts. CONCLUSIONS: Opsonic phagocytosis may represent a novel correlate of protection against PAM. HIV infection may increase the susceptibility of multigravid women to PAM by impairing this clearance mechanism.

  3. Hispaania suursaadiku visiit / Reet Kääni

    Index Scriptorium Estoniae

    Kääni, Reet

    2001-01-01

    13.02.2001 külastas Tallinna Pedagoogikaülikooli Helsingis resideeruv Hispaania suursaadik Fernando Carderera Soleri ja saatkonna I sekretär Tereza Lizaranzu Perinat. Külaliste visiidi üheks eesmärgiks oli uurida võimalusi hispaania keele ja kultuuri õpetamiseks TPÜs. Dekaan Heli Mattisen oli ette valmistanud omapoolse ettepaneku hispaania keele kõrvalaine avamiseks 1.09.2001

  4. HAAGA-HELIA ammattikorkeakoulun alumniprofiilin kartoitus

    OpenAIRE

    Ahlfors, Nina; Portin, Satu

    2013-01-01

    Tässä tutkimuksessa selvitettiin, minkälainen on HAAGA-HELIA ammattikorkeakoulusta valmistuneiden alumniprofiili. Tutkimuksen pohjalta tavoitteena oli saada tuloksia, joita HAAGA-HELIAn alumnikoordinaattorit voivat hyödyntää tulevaisuudessa alumnitoiminnan suunnittelussa ja alumniviestinnän kehittämisessä. Tutkimus rajattiin koskemaan Helsingin toimipisteiden liiketalouden, myyntityön, rahoitus- ja finanssialan sekä International Business -koulutusohjelman alumneja. Kyseessä on HAAGA-HELI...

  5. Uudised

    Index Scriptorium Estoniae

    2005-01-01

    Rokiajaloo tähtsaima briti raadiodiskori John Peeli (30.08.1939-25.10.2005) mälestuseks anti tema nimi punasele tulbile, mille mugulatest saadud raha suunatakse briti koolidesse kontsertide korraldamiseks. Festivalist "Hea Uus Heli" 5.-8. okt. Tallinnas ja eelnevast HUHi klubiõhtust "1öö%" soome külalisesinejatega 9. sept. Von Krahli teatris. Briti rockansambli Pink Floyd uuest kokkutulekust

  6. Ergutavad, lohutavad ja ravivad värvid / Jana Rand

    Index Scriptorium Estoniae

    Rand, Jana, 1963-

    2005-01-01

    Altmõisa puhkemaja Läänemaal Tuuru külas. Hoone sisekujunduse on teinud Heli Tuksam, abiks olid kunstnikud Piret Veski ja Tuuli Puhvel ning Tartu Kõrgema Kunstikooli üliõpilased. Toad on kujundatud erinevates värvitoonides. Fuajees on mosaiikpõrand. Kasutatud ökoloogilisi ehitus- ja viimistlusmaterjale. Ill.: välisvaade 7 sisevaadet, värv.

  7. JPRS Report, East Europe.

    Science.gov (United States)

    1990-07-19

    environmental pollution in the environs of Bic- Mobiusz Meat Processing Enterprise, and the Budapest ske-Obarok. The case of pollution was called to the Chemical...POLITYKA 16 Jun] ....... 4 "Krakow Appeal " Intellectuals, Political Stance Ridiculed [TYGODNIK GDANSKI 24 Jun] ......... 5 Students Create New...forever in these regions. Education Minister Lajos Demeny in Marosvasar- hely...." From the standpoint of the continued effective and rational workings

  8. Areeni kultuuripreemiad 2007

    Index Scriptorium Estoniae

    2008-01-01

    Areeni kultuuripreemiad 2007 nominentide seas ansambel 3 Pead (heliplaatidega "Ilusaim heli" ja "Taevaluugid"), näitleja ja laulja Kärt Johanson (albumiga "Unistadt"), Ahto-Lembit Lehtmets ja ansambel Loits (heliplaadiga "Must album"). Hääletada saab meiliaadressil preemia &ekspress.ee, veebiküljel http://www.ekspress.ee/preemia (50 000 kroonine preemia antakse üle 2. aprillil)

  9. Pärnu turismikonverents

    Index Scriptorium Estoniae

    2006-01-01

    2005. aasta 1. detsembril toimus Strand Spa & Konverentsihotellis Pärnu 10. turismikonverents. Ülevaade OÜ Turismimaailm konsultandi Ain Hinsbergi, Pärnu linnavolikogu esimehe Ahti Kõo, Tiit Kase, AS-i Strand juhatuse liikme Egon Elsteini, Kuressaare linnavolikogu liikme Urmas Treieli, Tartu linnapea Laine Jänese, välisministeeriumi infobüroo direktori Krista Kilveti ning TÜ Pärnu Kolledzhi turismimajanduse lektori Heli Müristaja sõnavõttudest

  10. Tähelepanu, rahuldus, tähendusetus = Attention, satisfaction, meaninglessness / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2015-01-01

    Rahvusvaheline rühmanäitus "TL;DR" Tallinna Kunstihoone galeriis. Kuraator Stacey May Koosel. Digitaalkeskkonna ja infoliiasuse teemat vaagisid Varvara Guljajeva & Mar Canet, Pille Riin Jaik ja Eva Sepping läbi videoinstallatsioonide, Erki Kasemets ja Maris Karjatse fotoinstallatsiooniga, Sten Saarits heliinstallatsiooniga, Andres Lõo läbi heli ja stereograafia, Kiwa läbi trükisõna, Jesus Maria Rodriguez Santos grafitiga galerii akendel

  11. Does timbre affect pitch?: Estimations by musicians and non-musicians / Allan Vurma, Marju Raju, Annika Kuuda

    Index Scriptorium Estoniae

    Vurma, Allan, 1955-

    2011-01-01

    Muusikutel ja mittemuusikutel lasti kuulata lindilt inimhääle, vioola ja trompetihelisid ning hinnata järgmisena kõlanud helikatket võrreldes eelmisega kas "madalaks", "kõrgeks" või "hääles". Leiti, et tämbrist mõjutatud helikõrguse muutused võivad tekitada konflikti subjektiivse tunnetamise ja fundamentaalsel võnkesagedusel põhineva heli hindamise vahel

  12. CACDA JIFFY III War Game. Volume II. Methodology

    Science.gov (United States)

    1980-09-01

    heliEopter assessments of ground forces is: - SSKPI ROUNDSiJk - ADUSTi - ABORTi GFKILL I - all k ,. TGT (9-39 where, for ordnance type .i fired by...probability. ABORTI - the probability that the missile will not be aborted during its flight because of loss of line of sight to target, suppression...values extracted from the table. The number of rounds, ROUNDSIjk, is modified by the ABORTI and ADUSTI factors only when the ordnance type i is a missile

  13. Real time computer controlled weld skate

    Science.gov (United States)

    Wall, W. A., Jr.

    1977-01-01

    A real time, adaptive control, automatic welding system was developed. This system utilizes the general case geometrical relationships between a weldment and a weld skate to precisely maintain constant weld speed and torch angle along a contoured workplace. The system is compatible with the gas tungsten arc weld process or can be adapted to other weld processes. Heli-arc cutting and machine tool routing operations are possible applications.

  14. Kuu kultuurikulgur

    Index Scriptorium Estoniae

    2008-01-01

    Üritusest "Bazaar" 18. okt. Tallinnas Mustpeade majas (peaesinejad Meissa Niang & Diambaar). Tartu sügispäevadest 13.-19. oktoobrini. Festivalist "Hea Uus Heli" Tallinnas (3. okt. avakontsert Tallinnas baaris Juuksur ja klubiõhtu "1ÖÖ%" Von Krahli teatris, "HUH 2008" 4. okt. Mustpeade majas). Üritustesarjast "Tallinn Underground" Depeche Mode baaris. Üritusest "Vennaskond 24" 24. okt. Tallinnas Kultuurikatlas

  15. Bedwetters kihutab Eesti tuurile

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontserdid 29. nov. Tartus, 30. nov. Rakveres, 1. dets. Haapsalus ja 2. dets. Pärnus, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  16. Ehitaja Aastaehitised 2003 on selgunud

    Index Scriptorium Estoniae

    2004-01-01

    Aastaehitised 2003: uusehitis - Laulasmaa SPA & Konverentsihotell (arhitekt Priit Ehala, AB Ehala & Irik, projekteerija Projektbüroo Teinos, ehitaja FKSM), renoveeritud ehitis - korterelamu Tallinnas Piiskopi t. 2 (arhitekt Elmo Raukas, sisearhitekt Heli Eensalu, projektterija ja ehitaja Restor), rajatis - Turu sild Tartus (arhitektuurne lahendus: Tartu Arhitektuuribüroo, vantsüsteemide arvutused: Ehituse & Tarkvara Inseneribüroo), eramu - Merirahu eramu (arhitekt Tarmo Piirmets, projekteerija Estkonsult, ehitaja E-Betoonelement). 4 ill

  17. Krovavõje maltshiki / Ljudmila Pribõlskaja

    Index Scriptorium Estoniae

    Pribõlskaja, Ljudmila

    2006-01-01

    Non Grata üliõpilaste korraldatud näituse "Perfomance läheb galeriisse" ava-perfomance'st Pärnu Linnagaleriis. Linnagaleriis ja kontserdimaja kolmandal korrusel näidatakse raamitud pildimaterjali nii Eesti kui välismaa kunstnike teostatud performanceѫitest ning nende käigus kasutatud või sündinud objekte. Näitus toimub rahvusvahelise festivali "Diverse Universe II" raames. Kommenteerib galerii juhataja Heli Tambur

  18. Of mice and women: rodent models of placental malaria

    DEFF Research Database (Denmark)

    Hviid, Lars; Marinho, Claudio R F; Staalsoe, Trine

    2010-01-01

    Pregnant women are at increased malaria risk. The infections are characterized by placental accumulation of infected erythrocytes (IEs) with adverse consequences for mother and baby. Placental IE sequestration in the intervillous space is mediated by variant surface antigens (VSAs) selectively...... expressed in placental malaria (PM) and specific for chondroitin sulfate A (CSA). In Plasmodium falciparum, these VSA(PM) appear largely synonymous with the P. falciparum erythrocyte membrane protein 1 (PfEMP1) family variant VAR2CSA. As rodent malaria parasites do not possess PfEMP1 homologs......, the usefulness of experimental mouse PM models remains controversial. However, many features of murine and human PM are similar, including involvement of VSAs analogous to PfEMP1. It thus appears that rodent model studies can further the understanding of VSA-dependent malaria pathogenesis and immunity....

  19. Vibrationally-resolved Charge Transfer of O^3+ Ions with Molecular Hydrogen

    Science.gov (United States)

    Wang, J. G.; Stancil, P. C.; Turner, A. R.; Cooper, D. L.

    2003-05-01

    Charge transfer processes due to collisions of ground state O^3+ ions with H2 are investigated using the quantum-mechanical molecular-orbital close-coupling (MOCC) method. The MOCC calculations utilize ab initio adiabatic potentials and nonadiabatic radial coupling matrix elements obtained with the spin-coupled valence-bond approach. Vibrationally-resolved cross sections for energies between 0.1 eV/u and 2 keV/u using the infinite order sudden approximation (IOSA), vibrational sudden approximation (VSA), and electronic approximation (EA), but including Frank-Condon factors (the centroid approximation) will be presented. Comparison with existing experimental data for total cross sections shows best agreement with IOSA and discrepancies for VSA and EA. Triplet-singlet cross section ratios obtained with IOSA are found generally to be in harmony with experiment. JGW and PCS acknowledge support from NASA grant 11453.

  20. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  1. In vitro selection of Plasmodium falciparum 3D7 for expression of variant surface antigens associated with severe malaria in African children

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Nielsen, Morten A; Vestergaard, Lasse S

    2003-01-01

    ) in older semi-immune children. Establishment of the genetic mechanism underlying changes in VSA expression in response to in vitro selective pressure is now possible because of the availability of the entire genomic sequence of the P. falciparum clone 3D7. As a first step towards direct molecular...... identification of VSASM-encoding genes in 3D7, we report here a method of enforcing expression of VSASM-like antigens in this parasite clone by a novel selection method using plasma from semi-immune children with low VSAUM-specific, but high VSASM-specific, IgG reactivity. In addition to the resulting increase...... and epidemiologically diverse areas of endemic parasite transmission. The described selection method appears a useful tool in the identification of genes encoding VSA involved in severe and life-threatening P. falciparum malaria....

  2. Vulnerabilidad socio-ambiental y dimensiones de la sustentabilidad en un sector del periurbano marplatense

    Directory of Open Access Journals (Sweden)

    Laura Zulaica

    2010-12-01

    Full Text Available El crecimiento de las ciudades sobre las áreas circundantes deriva en la conformación de un espacio de interfase (periurbano, que manifiesta altos niveles de vulnerabilidad socio-ambiental (VSA. Asumiendo el concepto de VSA, el presente trabajo caracteriza una de las dimensiones de la sustentabilidad ambiental (sustentabilidad social en el sector sur del periurbano de Mar del Plata a partir de la construcción de un índice (IVSA, y examina su distribución, mediante el procedimiento de autocorrelación espacial. El análisis del IVSA revela que el área dista mucho de aproximarse a los logros de equidad y bienestar acordes con los principios de sustentabilidad. La metodología utilizada favorece la detección de zonas críticas y conforma un porcedimiento útil para establecer diferenciaciones internas en áreas periurbanas.

  3. Realistic neurons can compute the operations needed by quantum probability theory and other vector symbolic architectures.

    Science.gov (United States)

    Stewart, Terrence C; Eliasmith, Chris

    2013-06-01

    Quantum probability (QP) theory can be seen as a type of vector symbolic architecture (VSA): mental states are vectors storing structured information and manipulated using algebraic operations. Furthermore, the operations needed by QP match those in other VSAs. This allows existing biologically realistic neural models to be adapted to provide a mechanistic explanation of the cognitive phenomena described in the target article by Pothos & Busemeyer (P&B).

  4. Uric Acid Level Has a U-shaped Association with Clinical Outcomes in Patients with Vasospastic Angina.

    Science.gov (United States)

    Gwag, Hye Bin; Yang, Jeong Hoon; Park, Taek Kyu; Song, Young Bin; Hahn, Joo Yong; Choi, Jin Ho; Lee, Sang Hoon; Gwon, Hyeon Cheol; Choi, Seung Hyuk

    2017-08-01

    No data are available on the association of serum uric acid and vasospastic angina (VSA) which has endothelial dysfunction as a possible pathophysiologic mechanism. Low uric acid level might cause adverse outcomes in VSA in connection with endothelial dysfunction. We enrolled 818 VSA patients whose uric acid level was measured at admission. Patients were categorized according to tertiles of uric acid level: group I, ≤ 4.8 mg/dL; group II, 4.9-5.9 mg/dL; and group III, ≥ 6.0 mg/dL. Primary outcome was major adverse cardiac events (MACEs), defined as a composite of cardiac death, acute myocardial infarction (MI), ischemic stroke, coronary revascularization, and rehospitalization for angina. Median follow-up duration was 49.2 months. Median uric acid values were 4.1 mg/dL for group I, 5.4 mg/dL for group II, and 6.7 mg/dL for group III. In the overall population, group II had a significantly lower incidence of MACE compared to group I (47 [17.1%] vs. 66 [24.6%]; hazard ratio [HR], 1.52; 95% confidence interval [CI], 1.02-2.26; P = 0.040) and a tendency of lower incidence of MACEs compared to Group III (47 [17.1%] vs. 62 [22.5%]; HR, 1.44; 95% CI, 0.98-2.13; P = 0.067). Among group I patients, those who received nitrates had a higher incidence of MACEs than those without nitrate therapy (P uric acid level was associated with adverse clinical outcomes, while high uric acid level had a trend toward an increase in it. Use of nitrate in patients with low uric acid level might have adverse effects on clinical outcomes of VSA. © 2017 The Korean Academy of Medical Sciences.

  5. El Fenomeno Chavez: Hugo Chavez of Venezuela, Modern Day Bolivar

    Science.gov (United States)

    2007-03-01

    Venezuela’s state owned oil company, Petroleos de Venezuela. Ever seeking opportunities to provoke the giant United States, Chavez agreed to provide...controlled joint “El Fenomeno Chavez” . . . 9 venture, Petroleos de Venezuela SA (PDVSA). Exxon Mobil Corporation decided to sell their stakes among...exploited. 9. Major oil companies in Venezuela: 1. Petroleos de Venezuela (PdVSA) – government-owned; generates 1/3 of national GDP; monopolized the

  6. Scattering of the Dirac particle by a Coulomb plus scalar potential in two dimensions

    International Nuclear Information System (INIS)

    Dong Shihai; Lozada-Cassou, M.

    2004-01-01

    The scattering of the two-dimensional Dirac particle by the Coulomb potential Vc=-A1/r plus the scalar one Vs=-A2/r is studied. The phase shifts are obtained exactly. The special case A1=A2 is also discussed. We find that a very interesting feature of the cross section σ(θ) for the special case A1=A2 is symmetrical with respect to the scattering angle θ=π

  7. Haemoglobin C and S role in acquired immunity against Plasmodium falciparum malaria.

    Directory of Open Access Journals (Sweden)

    Federica Verra

    2007-10-01

    Full Text Available A recently proposed mechanism of protection for haemoglobin C (HbC; beta6Glu-->Lys links an abnormal display of PfEMP1, an antigen involved in malaria pathogenesis, on the surface of HbC infected erythrocytes together with the observation of reduced cytoadhesion of parasitized erythrocytes and impaired rosetting in vitro. We investigated the impact of this hypothesis on the development of acquired immunity against Plasmodium falciparum variant surface antigens (VSA encoding PfEMP1 in HbC in comparison with HbA and HbS carriers of Burkina Faso. We measured: i total IgG against a single VSA, A4U, and against a panel of VSA from severe malaria cases in human sera from urban and rural areas of Burkina Faso of different haemoglobin genotypes (CC, AC, AS, SC, SS; ii total IgG against recombinant proteins of P. falciparum asexual sporozoite, blood stage antigens, and parasite schizont extract; iii total IgG against tetanus toxoid. Results showed that the reported abnormal cell-surface display of PfEMP1 on HbC infected erythrocytes observed in vitro is not associated to lower anti- PfEMP1 response in vivo. Higher immune response against the VSA panel and malaria antigens were observed in all adaptive genotypes containing at least one allelic variant HbC or HbS in the low transmission urban area whereas no differences were detected in the high transmission rural area. In both contexts the response against tetanus toxoid was not influenced by the beta-globin genotype. These findings suggest that both HbC and HbS affect the early development of naturally acquired immunity against malaria. The enhanced immune reactivity in both HbC and HbS carriers supports the hypothesis that the protection against malaria of these adaptive genotypes might be at least partially mediated by acquired immunity against malaria.

  8. Beyond imperviousness: A statistical approach to identifying functional differences between development morphologies on variable source area-type response in urbanized watersheds

    Science.gov (United States)

    Lim, T. C.

    2016-12-01

    Empirical evidence has shown linkages between urbanization, hydrological regime change, and degradation of water quality and aquatic habitat. Percent imperviousness, has long been suggested as the dominant source of these negative changes. However, recent research identifying alternative pathways of runoff production at the watershed scale have called into question percent impervious surface area's primacy in urban runoff production compared to other aspects of urbanization including change in vegetative cover, imported water and water leakages, and the presence of drainage infrastructure. In this research I show how a robust statistical methodology can detect evidence of variable source area (VSA)-type hydrologic response associated with incremental hydraulic connectivity in watersheds. I then use logistic regression to explore how evidence of VSA-type response relates to the physical and meterological characteristics of the watershed. I find that impervious surface area is highly correlated with development, but does not add significant explanatory power beyond percent developed in predicting VSA-type response. Other aspects of development morphology, including percent developed open space and type of drainage infrastructure also do not add to the explanatory power of undeveloped land in predicting VSA-type response. Within only developed areas, the effect of developed open space was found to be more similar to that of total impervious area than to undeveloped land. These findings were consistent when tested across a national cross-section of urbanized watersheds, a higher resolution dataset of Baltimore Metropolitan Area watersheds, and a subsample of watersheds confirmed not to be served by combined sewer systems. These findings suggest that land development policies that focus on lot coverage should be revisited, and more focus should be placed on preserving native vegetation and soil conditions alongside development.

  9. Initial Orbit Determination Based on Propagation of Admissible Regions with Differential Algebra

    Science.gov (United States)

    2017-01-19

    Politecnico di Milano LAURA PIROVANO, ROBERTO ARMELLIN, JUAN FELIX SAN JUAN Universidad de la Rioja ALEXANDER WITTIG Advanced concepts team, ESA...report has detailed the work of the team in the period June, 16 2016 - January, 16 2017. The Universidad de la Rioja (UR) team has completed the...release: distribution unlimited. TSA too short arc UR Universidad de la Rioja VO virtual observatory VSA very short arc 53 DISTRIBUTION A. Approved for public release: distribution unlimited.

  10. Die invloed van die neo-marxistiese kultuuranalise op die Wêreldraad van Kerke en die Gereformeerde Kerke van Nederland

    Directory of Open Access Journals (Sweden)

    J. M. Vorster

    1979-05-01

    Full Text Available Toe die studente dwarsoor die VSA en Europa in die laat sestigerjare ’n plotselinge en radikale verset openbaar het teen die bestaande orde, het hulle die deur geopen vir ’n nuwe mededinger om die hart van die Westerse kultuur. Dit is die nou reeds bekende neo-Marxisme. Sedertdien het hierdie jongeling sy voetspore op vele vlakke van die Westerse kultuur gelaat.

  11. Corrective Action Management Unit Report of Post-Closure Care Activities Calendar Year 2017.

    Energy Technology Data Exchange (ETDEWEB)

    Ziock, Robert [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Little, Bonnie Colleen [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2018-02-01

    The Corrective Action Management Unit (CAMU) at Sandia National Laboratories, New Mexico (SNL/NM) consists of a containment cell and ancillary systems that underwent regulatory closure in 2003 in accordance with the Closure Plan in Appendix D of the Class 3 Permit Modification (SNL/NM September 1997). The containment cell was closed with wastes in place. On January 27, 2015, the New Mexico Environment Department (NMED) issued the Hazardous Waste Facility Operating Permit (Permit) for Sandia National Laboratories (NMED January 2015). The Permit became effective February 26, 2015. The CAMU is undergoing post-closure care in accordance with the Permit, as revised and updated. This CAMU Report of Post-Closure Care Activities documents all activities and results for Calendar Year (CY) 2017 as required by the Permit. The CAMU containment cell consists of engineered barriers including a cover system, a bottom liner with a leachate collection and removal system (LCRS), and a vadose zone monitoring system (VZMS). The VZMS provides information on soil conditions under the cell for early leak detection. The VZMS consists of three monitoring subsystems, which include the primary subliner (PSL), a vertical sensor array (VSA), and the Chemical Waste Landfill (CWL) sanitary sewer (CSS) line. The PSL, VSA, and CSS monitoring subsystems are monitored quarterly for soil moisture concentration, the VSA is monitored quarterly for soil temperature, and the VSA and CSS monitoring subsystems are monitored annually for volatile organic compound (VOC) concentrations in the soil vapor at various depths. Baseline data for the soil moisture, soil temperature, and soil vapor were established between October 2003 and September 2004.

  12. Photoluminescence and reflectivity studies of high energy light ions irradiated polymethyl methacrylate films

    Science.gov (United States)

    Bharti, Madhu Lata; Singh, Fouran; Ramola, R. C.; Joshi, Veena

    2017-11-01

    The self-standing films of non-conducting polymethyl methacrylate (PMMA) were irradiated in vacuum using high energy light ions (HELIs) of 50 MeV Lithium (Li+3) and 80 MeV Carbon (C+5) at various ion dose to induce the optical changes in the films. Upon HELI irradiation, films exhibit a significant enhancement in optical reflectivity at the highest dose. Interestingly, the photoluminescence (PL) emission band with green light at (514.5 nm) shows a noticeable increase in the intensity with increasing ion dose for both ions. However, the rate of increase in PL intensity is different for both HELI and can be correlated with the linear energy transfer by these ions in the films. Origin of PL is attributed to the formation of carbon cluster and hydrogenated amorphous carbon in the polymer films. HAC clusters act as PL active centres with optical reflectivity. Most of the harmful radiation like UV are absorbed by the material and is becoming opaque after irradiation and this PL active material are useful in fabrication of optoelectronic devices, UV-filter, back-lit components in liquid crystal display systems, micro-components for integrate optical circuits, diffractive elements, advanced materials and are also applicable to the post irradiation laser treatment by means of ion irradiation.

  13. Vasospastic angina and microvascular angina are differentially influenced by PON1 A632G polymorphism in the Japanese.

    Science.gov (United States)

    Mashiba, Junko; Koike, George; Kamiunten, Hitoshi; Ikeda, Manami; Sunagawa, Kenji

    2005-12-01

    Ethnicity and smoking are well-known risk factors for the pathogenesis of coronary vasospasm. Oxidative stress induced by smoking plays a crucial role in coronary vasospasm, but is not enough to account for the pathogenesis of coronary vasospasm, indicating that genetic factors are strongly involved. The study group comprised 162 vasospastic angina patients (VSAs), 61 microvascular angina patients (MVAs) and 61 non-responders (NRs) diagnosed by acetylcholine provocation test. Four polymorphisms of the oxidative stress related genes, cytochrome b-245, alpha polypeptide gene (CYBA) C242T and A640G, paraoxonase 1 gene (PON1) A632G, phospholipase A2 group VII gene (PLA2G7) G994T were genotyped. Allele frequency of PON1 632-G was significantly higher in both the VSA with dominant fashion and the MVA with recessive fashion compared with NR. This association was strongly influenced by gender in the MVA only. There were no significant associations between the other polymorphisms and coronary vasospasm. In addition, the allele frequency of PON1 632-G in the Japanese was higher than in Caucasians. There was a significant association between PON1 A632G polymorphism and MVA as well as VSA, but the impact of this on VSA and MVA is different in the Japanese.

  14. In-straw cryoprotectant dilution of IVP bovine blastocysts vitrified in hand-pulled glass micropipettes.

    Science.gov (United States)

    Vieira, A D; Forell, F; Feltrin, C; Rodrigues, J L

    2007-06-01

    The aim of this study was to determine the influence of two ethylene glycol-based vitrification solutions on in vitro and in vivo survival after in-straw cryoprotectant dilution of vitrified in vitro-produced bovine embryos. Day-7 expanded blastocysts were selected according to diameter (> or = 180 microm) and osmotic characteristics and randomly assigned to one of three groups (i) VSa: vitrification in 40% EG+17.1% SUC+0.1% PVA; (ii) VSb: vitrification in 20% EG+20% DMSO; (iii) control: non-vitrified embryos. Vitrification was performed in hand-pulled glass micropipettes (GMP) and cryoprotectant dilution in 0.25 ml straws after warming in a plastic tube. Embryo viability was assessed by re-expansion and hatching rates after 72 h of IVC and by pregnancy rates after direct transfer of vitrified embryos. No differences in re-expansion rates were observed between vitrified groups after 24 h in culture (VSa=84.5%; VSb=94.8%). However, fewer VSa embryos (55.2%, Pstraw cryoprotectant dilution and direct embryo transfer.

  15. Student Perceptions of Sectional CT/MRI Use in Teaching Veterinary Anatomy and the Correlation with Visual Spatial Ability: A Student Survey and Mental Rotations Test.

    Science.gov (United States)

    Delisser, Peter J; Carwardine, Darren

    2017-11-29

    Diagnostic imaging technology is becoming more advanced and widely available to veterinary patients with the growing popularity of veterinary-specific computed tomography (CT) and magnetic resonance imaging (MRI). Veterinary students must, therefore, be familiar with these technologies and understand the importance of sound anatomic knowledge for interpretation of the resultant images. Anatomy teaching relies heavily on visual perception of structures and their function. In addition, visual spatial ability (VSA) positively correlates with anatomy test scores. We sought to assess the impact of including more diagnostic imaging, particularly CT/MRI, in the teaching of veterinary anatomy on the students' perceived level of usefulness and ease of understanding content. Finally, we investigated survey answers' relationship to the students' inherent baseline VSA, measured by a standard Mental Rotations Test. Students viewed diagnostic imaging as a useful inclusion that provided clear links to clinical relevance, thus improving the students' perceived benefits in its use. Use of CT and MRI images was not viewed as more beneficial, more relevant, or more useful than the use of radiographs. Furthermore, students felt that the usefulness of CT/MRI inclusion was mitigated by the lack of prior formal instruction on the basics of CT/MRI image generation and interpretation. To be of significantly greater use, addition of learning resources labeling relevant anatomy in tomographical images would improve utility of this novel teaching resource. The present study failed to find any correlation between student perceptions of diagnostic imaging in anatomy teaching and their VSA.

  16. Impacts of soil moisture content on visual soil evaluation

    Science.gov (United States)

    Emmet-Booth, Jeremy; Forristal, Dermot; Fenton, Owen; Bondi, Giulia; Creamer, Rachel; Holden, Nick

    2017-04-01

    Visual Soil Examination and Evaluation (VSE) techniques offer tools for soil quality assessment. They involve the visual and tactile assessment of soil properties such as aggregate size and shape, porosity, redox morphology, soil colour and smell. An increasing body of research has demonstrated the reliability and utility of VSE techniques. However a number of limitations have been identified, including the potential impact of soil moisture variation during sampling. As part of a national survey of grassland soil quality in Ireland, an evaluation of the impact of soil moisture on two widely used VSE techniques was conducted. The techniques were Visual Evaluation of Soil Structure (VESS) (Guimarães et al., 2011) and Visual Soil Assessment (VSA) (Shepherd, 2009). Both generate summarising numeric scores that indicate soil structural quality, though employ different scoring mechanisms. The former requires the assessment of properties concurrently and the latter separately. Both methods were deployed on 20 sites across Ireland representing a range of soils. Additional samples were taken for soil volumetric water (θ) determination at 5-10 and 10-20 cm depth. No significant correlation was observed between θ 5-10 cm and either VSE technique. However, VESS scores were significantly related to θ 10-20 cm (rs = 0.40, sig = 0.02) while VSA scores were not (rs = -0.33, sig = 0.06). VESS and VSA scores can be grouped into quality classifications (good, moderate and poor). No significant mean difference was observed between θ 5-10 cm or θ 10-20 cm according to quality classification by either method. It was concluded that VESS scores may be affected by soil moisture variation while VSA appear unaffected. The different scoring mechanisms, where the separate assessment and scoring of individual properties employed by VSA, may limit soil moisture effects. However, moisture content appears not to affect overall structural quality classification by either method. References

  17. Inferior J waves in patients with vasospastic angina might be a risk factor for ventricular fibrillation.

    Science.gov (United States)

    Fumimoto, Tomoko; Ueyama, Takeshi; Shimizu, Akihiko; Yoshiga, Yasuhiro; Ono, Makoto; Kato, Takayoshi; Ishiguchi, Hironori; Okamura, Takayuki; Yamada, Jutaro; Yano, Masafumi

    2017-09-01

    There is little information about the relationship between J waves and the occurrence of ventricular fibrillation (VF) in patients with vasospastic angina (VSA). The present study aimed to assess the incidence of J waves and the occurrence of VF in patients with VSA. The subjects consisted of 62 patients with VSA diagnosed by acetylcholine provocation tests in our institution from 2002 to 2014. We investigated the VF events, prevalence of J waves, and relationship between the VF events and J waves. J waves were observed in 16 patients (26%) and VF events were documented in 11 (18%). The incidence of VF in the patients with J waves was significantly higher than that in those without J waves (38% vs 11%, p=0.026). J waves were observed in the inferior leads in 14 patients, lateral leads in 5, and anterior leads in 3. A univariate analysis indicated that the incidence of VF in the inferior leads of J wave positive patients (46%=6/14) was significantly (p=0.01) higher than that in the inferior leads of J wave negative patients (10%=5/48). The J waves in the anterior and/or lateral leads were not related to the incidence of VF. Notched type and slurred type J waves were not associated with VF. A multivariate analysis revealed that J waves in VSA patients were associated with VF [odds ratio (OR) 6.41, 95% confidence interval (CI) 1.37-29.93, p=0.02] and organic stenosis (OR 6.98, 95% CI 1.39-35.08, p=0.02). Further, J waves in the inferior leads were strongly correlated with VF (OR 11.85, 95% CI 2.05-68.42, p=0.006). The results suggest that the existence of J waves, especially in the inferior leads, might be a risk factor for VF in VSA patients. Copyright © 2016 Japanese College of Cardiology. Published by Elsevier Ltd. All rights reserved.

  18. Improvement and comparison of likelihood functions for model calibration and parameter uncertainty analysis within a Markov chain Monte Carlo scheme

    Science.gov (United States)

    Cheng, Qin-Bo; Chen, Xi; Xu, Chong-Yu; Reinhardt-Imjela, Christian; Schulte, Achim

    2014-11-01

    In this study, the likelihood functions for uncertainty analysis of hydrological models are compared and improved through the following steps: (1) the equivalent relationship between the Nash-Sutcliffe Efficiency coefficient (NSE) and the likelihood function with Gaussian independent and identically distributed residuals is proved; (2) a new estimation method of the Box-Cox transformation (BC) parameter is developed to improve the effective elimination of the heteroscedasticity of model residuals; and (3) three likelihood functions-NSE, Generalized Error Distribution with BC (BC-GED) and Skew Generalized Error Distribution with BC (BC-SGED)-are applied for SWAT-WB-VSA (Soil and Water Assessment Tool - Water Balance - Variable Source Area) model calibration in the Baocun watershed, Eastern China. Performances of calibrated models are compared using the observed river discharges and groundwater levels. The result shows that the minimum variance constraint can effectively estimate the BC parameter. The form of the likelihood function significantly impacts on the calibrated parameters and the simulated results of high and low flow components. SWAT-WB-VSA with the NSE approach simulates flood well, but baseflow badly owing to the assumption of Gaussian error distribution, where the probability of the large error is low, but the small error around zero approximates equiprobability. By contrast, SWAT-WB-VSA with the BC-GED or BC-SGED approach mimics baseflow well, which is proved in the groundwater level simulation. The assumption of skewness of the error distribution may be unnecessary, because all the results of the BC-SGED approach are nearly the same as those of the BC-GED approach.

  19. High plasma levels of soluble intercellular adhesion molecule (ICAM)-1 are associated with cerebral malaria.

    Science.gov (United States)

    Adukpo, Selorme; Kusi, Kwadwo A; Ofori, Michael F; Tetteh, John K A; Amoako-Sakyi, Daniel; Goka, Bamenla Q; Adjei, George O; Edoh, Dominic A; Akanmori, Bartholomew D; Gyan, Ben A; Dodoo, Daniel

    2013-01-01

    Cerebral malaria (CM) is responsible for most of the malaria-related deaths in children in sub-Saharan Africa. Although, not well understood, the pathogenesis of CM involves parasite and host factors which contribute to parasite sequestration through cytoadherence to the vascular endothelium. Cytoadherence to brain microvasculature is believed to involve host endothelial receptor, CD54 or intercellular adhesion molecule (ICAM)-1, while other receptors such as CD36 are generally involved in cytoadherence of parasites in other organs. We therefore investigated the contributions of host ICAM-1 expression and levels of antibodies against ICAM-1 binding variant surface antigen (VSA) on parasites to the development of CM. Paediatric malaria patients, 0.5 to 13 years were recruited and grouped into CM and uncomplicated malaria (UM) patients, based on well defined criteria. Standardized ELISA protocol was used to measure soluble ICAM-1 (sICAM-1) levels from acute plasma samples. Levels of IgG to CD36- or ICAM-1-binding VSA were measured by flow cytometry during acute and convalescent states. Wilcoxon sign rank-test analysis to compare groups revealed association between sICAM-1 levels and CM (p0.05). Median levels of antibodies to CD36-binding VSAs were also comparable between acute and convalescent samples within any patient group. Median levels of antibodies to ICAM-1-binding VSAs were however significantly lower at admission time than during recovery in both groups. High levels of sICAM-1 were associated with CM, and the sICAM-1 levels may reflect expression levels of the membrane bound form. Anti-VSA antibody levels to ICAM-binding parasites was more strongly associated with both UM and CM than antibodies to CD36 binding parasites. Thus, increasing host sICAM-1 levels were associated with CM whilst antibodies to parasite expressing non-ICAM-1-binding VSAs were not.

  20. High plasma levels of soluble intercellular adhesion molecule (ICAM-1 are associated with cerebral malaria.

    Directory of Open Access Journals (Sweden)

    Selorme Adukpo

    Full Text Available BACKGROUND: Cerebral malaria (CM is responsible for most of the malaria-related deaths in children in sub-Saharan Africa. Although, not well understood, the pathogenesis of CM involves parasite and host factors which contribute to parasite sequestration through cytoadherence to the vascular endothelium. Cytoadherence to brain microvasculature is believed to involve host endothelial receptor, CD54 or intercellular adhesion molecule (ICAM-1, while other receptors such as CD36 are generally involved in cytoadherence of parasites in other organs. We therefore investigated the contributions of host ICAM-1 expression and levels of antibodies against ICAM-1 binding variant surface antigen (VSA on parasites to the development of CM. METHODOLOGY/PRINCIPAL FINDINGS: Paediatric malaria patients, 0.5 to 13 years were recruited and grouped into CM and uncomplicated malaria (UM patients, based on well defined criteria. Standardized ELISA protocol was used to measure soluble ICAM-1 (sICAM-1 levels from acute plasma samples. Levels of IgG to CD36- or ICAM-1-binding VSA were measured by flow cytometry during acute and convalescent states. Wilcoxon sign rank-test analysis to compare groups revealed association between sICAM-1 levels and CM (p0.05. Median levels of antibodies to CD36-binding VSAs were also comparable between acute and convalescent samples within any patient group. Median levels of antibodies to ICAM-1-binding VSAs were however significantly lower at admission time than during recovery in both groups. CONCLUSIONS/SIGNIFICANCE: High levels of sICAM-1 were associated with CM, and the sICAM-1 levels may reflect expression levels of the membrane bound form. Anti-VSA antibody levels to ICAM-binding parasites was more strongly associated with both UM and CM than antibodies to CD36 binding parasites. Thus, increasing host sICAM-1 levels were associated with CM whilst antibodies to parasite expressing non-ICAM-1-binding VSAs were not.

  1. Candeias (Eremanthus sp.): espacialização e interações ambientais no município de Mariana (MG)

    OpenAIRE

    Faria, Maola Monique

    2012-01-01

    Os remanescentes florestais de Minas Gerais abrigam grande riqueza e diversidade de espécies vegetais nativas, dentre essas as espécies do gênero Eremanthus sp., conhecidas popularmente como candeia, se destacam. Esta se desenvolve sobre solos pouco férteis e rasos originando povoamentos puros, denominados de monodominantes. Sua ocorrência também é registrada dentro de florestas após alguma perturbação com consequente formação de clareiras, visto que essa é heliófila. A candeia apresenta alto...

  2. HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation - FANTOM5 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data List Contact us FANTOM...at) Data file File name: fantom5_new_experimental_details.zip File URL: ftp://ftp.biosciencedbc.jp/archive/fantom5/LATEST/fantom...osciencedbc.jp/archive/fantom5/datafiles/LATEST/basic/ File size: 2.5 TB Simple s...earch URL http://togodb.biosciencedbc.jp/togodb/view/fantom5_new_experimental_details#en Data acquisition me...thod - Data analysis method HeliScopeCAGE ( http://fantom.gsc.riken.jp/protocols/heliscope.html ) Delve (Ali

  3. Graafikatriennaali grand prix Korea kunstnikule

    Index Scriptorium Estoniae

    1998-01-01

    Tallinna XI graafikatriennaali rahvusvaheline žürii andis grand prix korea kunstnikule Chung¡Sang-Gonile, kolm võrdset preemiat - soome kunstnikele Anita Jensenile ja Tapani Mikkonenile ning jaapani kunstnikule Estuko Obatale. Eesti Kunstimuuseumi preemia - Wendy Swallow. Tallinna linna preemia ja Ivar Luki sponsoripreemia - Walter Jule. Sponsoripreemiad : Paletti Eesti AS preemia - Inga Heamägi; Rannila Profiili preemia - Mojca Zlokarnik; UNDP preemia - Andrea Juan. Rotermanni soolalao arhitektuuri- ja kunstikeskuse diplom - Lis Ingram, Heli Päivikki Kurunsaari, Randi Strand, Wendy Swallow

  4. Map showing minimum depth to water in shallow aquifers (1963-72) in the Sugar House quadrangle, Salt Lake County, Utah

    Science.gov (United States)

    Mower, R.W.; Van Horn, Richard

    1973-01-01

    The depth to ground water in shallow aquifers in the Sugar Horse quadrangle ranges from zero in areas of springs and seeps to more than 10 feet beneath most of the area shown on the map. The depth to water differs from place to place because of irregular topography, and the varying capability of different rock materials to transmit water. Ground water also occurs under unconfined and confined conditions in deep aquifers beneath the Sugar Horse quadrangle, as shown by the block diagram and as described by Hely, Mower, and Harr (1971a, p. 17-111).

  5. Dicty_cDB: Contig-U15509-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available UM1404.b1_G16.ab1 CHU(LMS) puzzle sunflower Hel... 46 3.5 1 ( EL468759 ) CHTS7396.b1_H01.ab1 CHT(LMS) Jerusa...69.b1_I21.ab1 CHU(XYZ) puzzle sunflower Heli... 46 3.5 1 ( EL512621 ) CHTY392.b1_O01.ab1 CHT(XYZ) Jerusalem ... CHWX417.b1_A09.ab1 CHW(XYZ) silverleaf sunflower ... 46 3.5 1 ( EL513701 ) CHUY4

  6. Punanahklusest: Majakovskist indiaanlasteni / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2011-01-01

    Tutvustus: Jangfeldt, Bengt. Mäng elu peale : Vladimir Majakovski ja tema lähikond / tõlkinud Anu Saluäär. Tallinn : Varrak, 2011 ; Céline, Louis-Ferdinand. Reis öö lõppu / tõlkinud Heli Allik. Tallinn : Varrak, 2010 ; Simone, Claude. Flandria tee / tõlkinud Leena Tomasberg. Tallinn : Eesti Raamat, 2011 ; Härm, Tiiu. Jää voolab : Eesti polaarränduri August Masiku maailm. Tallinn : Eesti Raamat, 2010 ; Page, Jake. Suure vaimu rüpes : Ameerika indiaanlaste 20 000-aastane ajalugu / tõlkinud Matti Piirimaa. Tallinn : Tänapäev, 2011

  7. Dicty_cDB: Contig-U12108-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available _tissue_mixed_st... 48 0.37 1 ( EK415671 ) 1095515461096 Global-Ocean-Sampli...( BC087733 |pid:none) Mus musculus transcription termina... 95 2e-18 (Q7ZU90) RecName: Full=Chromodomain-heli...095458006916 Global-Ocean-Sampling_GS-31-01-01-1... 36 2.6 2 ( DR395822 ) USDA-FP_155757 Adult Alate Aphis g...06f CUGI Rice BAC Library Oryza sativa J... 44 5.7 1 ( EJ951574 ) 1093018948721 Global-Ocean-Sampling_GS-30-...02-01-1... 44 5.7 1 ( EJ038559 ) 1095454082808 Global-Ocean-Sampling_GS-26-01-01-

  8. Unustatuid eurolaulude tipp-10. Naine nagu Eurovisioon / Olavi Pihlamägi

    Index Scriptorium Estoniae

    Pihlamägi, Olavi, 1949-

    2008-01-01

    Eurovisiooni lauludest: Austria 1976 Waterloo & Robisnon "My Little Word" (5. koht), Suurbritannia 1972 The New Seekers "Beg, Steal or Borrow" (2. koht), Jugoslaavia 1983 Daniel "Dzuli (Julie)" (4. koht), Cliff Richard "Power To All Our Friends (3. koht)", Luksemburg 1967 Vicky Leandros "L'Amour Est Bleu" (4. koht), Holland 1974 Mouth & McNeal "I See A Star" (3. koht), Soome 1969 Jarkko & Laura "Kuin silloin ennen" (12. koht), Saksamaa 1981 Lena Valaitis "Johnny Blue", Saksamaa Katja Ebstein "Diese Welt" (3. koht), Luksemburg 1980 "Le Papa pinquin" (10. koht). Heli Läätsa lauldud eesti keelde kaverdatud eurolauludest

  9. Kas praegune triennaal õnnestus? : tarbekunst / Ketli Tiitsar ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Tiitsar, Ketli

    2006-01-01

    Tallinna IV rakenduskunsti triennaali töögrupi liige K. Tiitsar triennaalist, näituse kujundusest (3+1 Arhitektid), eesti tarbekunstist, seminarist ja esitluste päevast (Mecky van den Brinki, Heli Hietala, Marie-Louise Kristenseni, Outi Liusvaara esinemine), satelliitnäitustest (Anneli Porri ja Pille-Triin Männiku kuraatoriprojekt "Teadus ja tänapäev", Hollandi Gerrit Rietveldi akadeemia ehteosakonna üliõpilaste tööde näitus EKA galeriis)

  10. Customer Orientation vs. Customer Orientation Perception : Case J & J Lakkapää Oy Tornio

    OpenAIRE

    Angeria, Heli

    2011-01-01

    Heli, Angeria 2011. Customer Orientation vs. Customer Orientation Perception. Case: J & J Lakkapää Oy Tornio. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 51. Appendices 5. The objective of this thesis is to study customer orientation with the help of a widely adapted Selling-Orientation-Customer Orientation (SOCO) scale, in order to find out what is the extent to which J & J Lakkapää Oy Tornio and its consumer customers agree or disagree about the company’s cus...

  11. In vitro anticancer screening of South African plants

    CSIR Research Space (South Africa)

    Fouché, Gerda

    2008-10-01

    Full Text Available , coughs, asthma and pneumonia (Van Wyk and Gericke, 2000). Vhavenda use leaf infusions as anthelmintics for respiratory d as A d roo r a decoctio Cadab powde The ro C d for ) C D E Go Heli Ipomoe K K Leucoside Kigeli Lippi Oncosipho P... Dryand. Leaf infusions ar in emetics taken chrysum nudifolium Less. Roots decoction reported to be u Africa roots are us 1996) a cairica (L.) Sweet Leaves are traditional crushed in a cup alanchoe paniculata Harv. Ash from leaves et al., 1996...

  12. Keuhkoahtaumatautiin sairastuneiden elämänlaatuun vaikuttavia tekijöitä

    OpenAIRE

    Vornila, Karita

    2012-01-01

    Tämän opinnäytetyön tarkoituksena oli kartoittaa elämänlaatuun vaikuttavia tekijöitä keuh-koahtaumatautiin sairastuneilta. Opinnäytetyön tavoitteena oli lisätä tietoisuutta keuhkoahtaumatautia sairastavan potilaan elämänlaatuun vaikuttavista tekijöistä. Tietoa opinnäytetyöntekijä keräsi Hengitysliitto Heli ry:n internet-sivuille avatun keskustelualustan avulla. Hengitysliitto on sosiaali- ja terveysalan järjestö, jonka tarkoituksena on edistää muun muassa hengityssairaan hyvää elämää. Keskus...

  13. EKA 90. aastapäeva juubelinädalale on planeeritud mitmeid üritusi nii peamajas kui osakondades

    Index Scriptorium Estoniae

    2004-01-01

    Kunstööstuskooli tutvustavast näitusest. 29. X audoktorite Udo Kultermanni ja Juhani Pallasmaa loengud ning ümarlaua ettekanded (osalejad loetletud), ümarlauda juhib Jüri Soolep. EKA galeriis valgusinstallatsioonide näitus "Think Lightly", osalevad Sirli Põllumäe, Riho Tiivel, Helis Podnek, Marion Uuspõld, Pent Talvet, Mehis Tiitsar, Merike Rehepapp, Veiko Vaine. Üliõpilaste loomingu väljapanekud. 30. X vilistlaspäev, pidulikul aktusel promoveeritakse audoktoriteks Juhani Pallasmaa, Udo Kultermann, Lars Olof Larsson ja Yrjö Sotamaa. Vabade kunstide osakonna rändnäitus "Ekskursioon" sisekaitseakadeemias

  14. Areeni aasta albumid 2004. Personaalsed tipud / Erkki Tero

    Index Scriptorium Estoniae

    Tero, Erkki

    2007-01-01

    Heliplaatidest: Vaiko Eplik ja Eliit "2: Aastaajad", LCD Soundsystem "Sound of Silver", Arcade Fire "Neon Bible", M.I.A "Kala", Burial "Untrue", Chalice "Taevas ja Perse", Panda Bear "Person Pitch", Ans. Andur "Topeltvikerkaar", Animal Collective "Strawberry Jam", PJ Harvey "White Chalk", Devendra Banhart "Smokey Rolls Down The Thunder Canyon", Kreatiivmootor "Irratsionaalne", Holy Fuck "LP", 3 Pead "Ilusaim heli", Throbbing Gristle "Part Two: The Endless Not", Battles "Mirrored", Kings Of Leon "Because of the Times", Robert Wyatt "Comicopera", National "Boxer", Simian Mobile Disco "Attack Decay Sustain Release"

  15. Van Bevrydingsteologie na Swart Teologie in Suid-Afrika

    Directory of Open Access Journals (Sweden)

    B. Spoelstra

    1988-06-01

    Full Text Available Die bevrydingsteologie reageer teen strukture en praktyke wat die menswaardigheid van die mens en persoon aantas. Die wortels daarvan lê in Suid-Amerika en die VSA. Tog het Hitler se filosofie van die Ariërs as Herrenvolk en vervolging van die Jode die Tweede Wereldoorlog gemotiveer. Reeds in die oorlog het Bonhoeffer aandag gevra vir die ander mens in nood. Jy moet God dien in wat jy aan die ander doen. Dr. C. F. Beyers Naudé trek reglynig ’n parallel tussen Naziisme van Hitler en “apartheid” in Suid-Afrika (Berkhof, 1985 : 168.

  16. Četrta industrijska revolucija

    OpenAIRE

    Slekovec, Tadea

    2017-01-01

    Diplomski projekt obravnava pojem industrijske revolucije, natančneje zadnje, četrte industrijske revolucije. Četrta industrijska revolucija obravnava tako napredek v tehnologiji kot napredek v programskih opremah. Pojem zajema vsa področja našega življenja, tako osebno kot poslovno. V sodobni zgodovini obstaja več industrijskih revolucij, ki so druga na drugo vplivale posredno in tudi neposredno, sem vsako obdobje posebej opredelila časovno, prostorsko ter tehnološko. Poudarek sem dala četrt...

  17. Die sendingkonferensie van die G.E.S. te Kaapstad op 2–6 Augustus 1976 – ’n terugblik

    Directory of Open Access Journals (Sweden)

    L. J. Botha

    1977-05-01

    Full Text Available Dit is inderdaad ’n grootse ervaring om ’n byeenkoms van Gereformeerdgesinde Christene van oor die hele wêreld by te woon. Die ekumeniese karakter van die konferensie te Kaapstad blyk duidelik uit die presensielys. Daar was afgevaardigdes van Gereformeerdgesinde kerke vanuit Malawi, Nigerië, Rhodesië, Suid-Afrika, Suidwes-Afrika, Zambië, Siri Lanka, Japan, Frankryk, Noord-Ierland, Nederland, Skotland, V.S.A., Suid-Amerika, Australië, Indonesië en Nieu-Seeland.

  18. Die pastorale sielkundige as diakonale pastor

    Directory of Open Access Journals (Sweden)

    A. J. Smuts

    1985-08-01

    Full Text Available In die bedieningspatroon van die Ned. Geref. Kerk het die pastorale sielkundige die afgelope aantal jare steeds meer op die voorgrond begin tree. Hy is egter 'n problematiese figuur, wie se identiteit van meer as een kant onder bespreking is. In ander lande, selfs in die VSA waar die kerk veel gebruik maak van die sielkunde, is dit moeilik om 'n presiese parallel vir hom te vind. Sowel binne as buite die kerk word hy deur sommige bevraagteken. Daarom is dit noodsaaklik om vanuit die teologie te kyk na die werk wat hy doen.

  19. A/D-PRETVORBA VIDEOSIGNALA IN OSNOVE VIRTUALNE SCENOGRAFIJE

    OpenAIRE

    Koščak, Andrej

    2014-01-01

    Tako kot vsa področja tehnike je tudi televizija v zadnjih letih doživela bliskovit razvoj. V zadnjih dveh letih (2010-2013) smo na Televiziji Slovenija (v nadaljevanju TV Slovenija) prešli iz analogne tehnologije na digitalno. V nalogi želim narediti pregled razvoja televizije od začetka, v črno-beli tehniki, prek barvne televizije do digitalne. V prvem poglavju sem naredil kratek zgodovinski pregled razvoja televizijske tehnike, v drugem pa opisal analizo in sintezo slike. V naslednji...

  20. Pengaruh Kandungan Ca Pada Cao-zeolit Terhadap Kemampuan Adsorpsi Nitrogen

    OpenAIRE

    M Nasikin; Tania Surya Utami; Agustina TP Siahaan

    2002-01-01

    In industry, Ca zeolite is used as nitrogen selective adsorbent with the use of PSA (Pressure Swing Adsorption)/VSA (Vacuum Swing Adsorption) methods. Natural zeolite modified to be Cao-zeolite by ion exchange process using Ca(OH)2. Adsorption test was done on CaO-zeolite with different Ca concentration to understand how it's adsorption phenomena on oxygen and nitrogen. Adsorption test has been done for CaO-zeolite with Ca concentration = 0,682%, 0,849% and 1,244% to oxygen and nitrogen with ...

  1. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  2. Kultura športnega plesalca

    OpenAIRE

    Plohl, Martina

    2012-01-01

    Pogajanja so po navadi začetek sklepanja novih plesnih partnerstev, zato je pomembno, da kadar se pogajamo z nekom iz druge kulture za sklenitev plesnega partnerstva, je potrebno da se pozanimamo o kulturi in njenih značilnostih, ter poiščemo vsa odstopanja med našo in tujo kulturo. Le tako bomo lahko v pogajanjih uspešni, prav tako pa se bomo že na začetku izognili težavam in nesoglasjem v prihodnosti. Vse to je potrebno vedeti že pred samimi pogajanji, saj je od tega odvisen kasnejši uspeh...

  3. Evaluation of a Fully Automated Analyzer for Rapid Measurement of Water Vapor Sorption Isotherms for Applications in Soil Science

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Tuller, Markus; Moldrup, Per

    2014-01-01

    The characterization and description of important soil processes such as water vapor transport, volatilization of pesticides, and hysteresis require accurate means for measuring the soil water characteristic (SWC) at low water potentials. Until recently, measurement of the SWC at low water...... potentials was constrained by hydraulic decoupling and long equilibration times when pressure plates or single-point, chilled-mirror instruments were used. A new, fully automated Vapor Sorption Analyzer (VSA) helps to overcome these challenges and allows faster measurement of highly detailed water vapor...

  4. Adequacy of M16A1 Rifle Performance and Its Implications for Marksmanship Training

    Science.gov (United States)

    1980-09-01

    CEN *FT, 04CCLELLAN ATTMI AYZN-mP-ACE 4AL5A INSTITUITE A A4NMUMT~RATI-Ok- AIT4 RSDM TPA"NIN MA~NAGEMENT 1 4VsA v3WLO APTIL EO,sRt00 "CAO 6RP1 SWOT ...01LITARY ATTACHE -I. CAMAnIAN FORCdES UASE COINNIALLIS LYT~ii OfRSONNEL SELEcT’ION 2 CANAOIAN FOICES PERSONNEL APPL RSCH UNITY I ARMY PERSONNEL

  5. Design and development of multi-lane smart electromechanical actuators

    CERN Document Server

    Annaz, Fawaz Yahya

    2014-01-01

    Design and Development of Multi-Lane Smart Electromechanical Actuators presents the design of electromechanical actuators in two types of architectures, namely, Torque Summed Architecture (TSA) and Velocity Summed Architecture, (VSA). It examines them in: * Hardware redundancy, where the architecture is made up of 3 or 4 lanes. * Digital Math Model redundancy, where a more compact two lanes architectures will be presented. The book starts with the very basic concepts and introduces the design process logically so that an understanding of the smart multi-lane systems that drive an aileron

  6. VAR2CSA and protective immunity against pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Hviid, L; Salanti, A

    2007-01-01

    People living in areas with stable transmission of P. falciparum parasites acquire protective immunity to malaria over a number of years and following multiple disease episodes. Immunity acquired this way is mediated by IgG with specificity for parasite-encoded, clonally variant surface antigens...... that the selective placental accumulation of IEs that characterizes pregnancy-associated malaria (PAM) is caused by an immunologically and functionally unique subset of VSA (VSAPAM) that is only expressed by parasites infecting pregnant women, and that protective immunity to PAM is mediated by IgG with specificity...

  7. POMEN DOJENJA ZA OTROKA IN MATER

    OpenAIRE

    Apat, Alja

    2014-01-01

    Dojenje je naravni način hranjenja otroka v prvih mesecih njegovega življenja. Omogoča optimalno telesno in duševno rast ter razvoj otroka. Materino mleko vsebuje vsa življenjsko pomembna hranila v pravilnem ravnovesju. Dojenje ima mnoge prednosti, tako za mater, ki doji, kakor za njenega otroka. Pomembno vlogo pri dojenju imajo tudi medicinske sestre v porodnišnici in patronažne medicinske sestre. Njihova naloga je tudi zdravstveno-vzgojno delo pri dojenju. Cilj raziskave je bil ugotoviti os...

  8. Generation of Constructs for DNA-Directed RNA Interference of Venezuelan Equine Encephalitis Virus Genes

    Science.gov (United States)

    2006-12-01

    Plans fulurs :Les \\ ctecurs decxpi ession de petils ARMi scront tesi ~s pour leur capacit a’ soumetie a1 effet de choc trois e:’nes EY essentick ci til...Minister of National Defence. 2000 VSa mlajcst ]a t cine. ecpi 6senl~e par le ininistre de la Defense nationale. 2006 Abstract ___ Venezuelan equine...viral genome. Resum6 Le virus de l’enc~phalomy~lite 6quine du Venezuela (EEV) est un pathog~ne humain et v&t6rinaire important pour lequel il n’existe pas

  9. Surface and anti-fouling properties of a polyampholyte hydrogel grafted onto a polyethersulfone membrane.

    Science.gov (United States)

    Zhang, Wei; Yang, Zhe; Kaufman, Yair; Bernstein, Roy

    2018-05-01

    Zwitterion polymers have anti-fouling properties; therefore, grafting new zwitterions to surfaces, particularly as hydrogels, is one of the leading research directions for preventing fouling. Specifically, polyampholytes, polymers of random mixed charged subunits with a net-electric charge, offer a synthetically easy alternative for studying new zwitterions with a broad spectrum of charged moieties. Here, a novel polyampholyte hydrogel was grafted onto the surface of polyethersulfone membrane by copolymerizing a mixture of vinylsulfonic acid (VSA) and [2-(methacryloyloxy)ethyl]trimethylammonium chloride (METMAC) as the negatively and positively charged monomers, respectively, using various monomer ratios in the polymerization solution, and with N,N'-methylenebisacrylamide as the crosslinker. The physicochemical, morphological and anti-fouling properties of the modified membranes were systematically investigated. Hydrophilic hydrogels were successfully grafted using monomers at different molar ratios. A thin-film zwitterion hydrogel (∼90 nm) was achieved at a 3:1 [VSA:METMAC] molar ratio in the polymerization solution. Among all examined membranes, the zwitterion polyampholyte-modified membrane demonstrated the lowest adsorption of proteins, humic acid, and sodium alginate. It also had low fouling and high flux recovery following filtration with a protein or with an extracellular polymeric substance solution. These findings suggest that this polyampholyte hydrogel is applicable as a low fouling surface coating. Copyright © 2018 Elsevier Inc. All rights reserved.

  10. Review of bench-, pilot-, and full-scale Orimulsion trademark combustion tests. Report for November 1998--January 1999

    International Nuclear Information System (INIS)

    Miller, C.A.; Srivastava, R.K.; Hall, R.E.

    1999-01-01

    During the late 1980s and through the 1990s, a new fossil fuel with the trade name Orimulsion has been marketed by its producer, Petroleos de Venezuela, S.A. (PdVSA), as an alternative to coal and heavy fuel oil. Orimulsion, a bitumen-in-water emulsion, is produced from bitumen extracted from the Cerro Negro field of the Orinoco Belt of eastern Venezuela. Economically recoverable Orinoco bitumen reserves are estimated at 267 billion barrels (oil equivalent) representing approximately 26% of the world's recoverable crude oil reserves and 27% of the US recoverable coal reserves. Orimulsion is produced by Bitumenes Orinoco, S.A. (Bitor), a subsidiary of PdVSA, and derives its name from the combination of Orinoco and emulsion. In 1997, the US Congress directed the Environmental Protection Agency to ''initiate a research activity to provide better scientific data on the qualities and characteristics of this product and the potential environmental impact of its introduction.'' As a first step in conducting this research activity, a review of the available literature on the topic of Orimulsion combustion and emissions was undertaken. The emphasis of this review is on the emissions of air pollutants rather than on the combustion behavior of the fuel, and particular emphasis will be placed on emissions from electric utility power boilers. While the combustion characteristics of Orimulsion will be addressed, it will be addressed primarily from the perspective of its ability to strongly influence the emissions of air pollutants

  11. The Virtual Seismic Atlas Project: sharing the interpretation of seismic data

    Science.gov (United States)

    Butler, R.; Mortimer, E.; McCaffrey, B.; Stuart, G.; Sizer, M.; Clayton, S.

    2007-12-01

    Through the activities of academic research programs, national institutions and corporations, especially oil and gas companies, there is a substantial volume of seismic reflection data. Although the majority is proprietary and confidential, there are significant volumes of data that are potentially within the public domain and available for research. Yet the community is poorly connected to these data and consequently geological and other research using seismic reflection data is limited to very few groups of researchers. This is about to change. The Virtual Seismic Atlas (VSA) is generating an independent, free-to-use, community based internet resource that captures and shares the geological interpretation of seismic data globally. Images and associated documents are explicitly indexed using not only existing survey and geographical data but also on the geology they portray. By using "Guided Navigation" to search, discover and retrieve images, users are exposed to arrays of geological analogues that provide novel insights and opportunities for research and education. The VSA goes live, with evolving content and functionality, through 2008. There are opportunities for designed integration with other global data programs in the earth sciences.

  12. Maternally transmitted antibodies to pregnancy-associated variant antigens on the surface of erythrocytes infected with Plasmodium falciparum: relation to child susceptibility to malaria

    DEFF Research Database (Denmark)

    Cot, Michel; Le Hesran, Jean Yves; Staalsoe, Trine

    2003-01-01

    The consequences of pregnancy-associated malaria on a child's health have been poorly investigated. Malarial infection of the placenta seems to result in a higher susceptibility of children to the parasite during their first year of life. In 1993-1995, the authors investigated the role of antibod......The consequences of pregnancy-associated malaria on a child's health have been poorly investigated. Malarial infection of the placenta seems to result in a higher susceptibility of children to the parasite during their first year of life. In 1993-1995, the authors investigated the role......, Cameroon. These newborns were subsequently followed up for 2 years to determine the date of first occurrence of blood parasites and mean parasite density during follow-up. Maternally transmitted antibodies to VSA expressed by CSA-binding parasites, but not antibodies to any other specificity, were...... negatively related to time of first appearance of Plasmodium falciparum in a child's blood and were positively related to mean parasite density during the first 2 years of life. If maternal infection is thought to be the main mechanism influencing susceptibility of the newborn to malaria, antibodies to VSA...

  13. Synthesis, screening and QSAR studies of 3-benzoyl-2-oxo/thioxo-1,2,3,4-tetrahydro-pyrimidine analogues as antibacterial agents

    Directory of Open Access Journals (Sweden)

    Ramesh L. Sawant

    2008-12-01

    Full Text Available The purpose of this study was to synthesize several 3-benzoyl-5-acyl-6-methyl-4-substituted-2-oxo/thioxo-1,2,3,4-tetrahydropyrimidines, evaluate them for their antibacterial activity and to establish correlation between the activity and physicochemical properties. 5-Acyl-6-methyl-4-substituted-2-oxo/thioxo-1,2,3,4-tetrahydropyrimidines (A were synthesized by cyclocondensation reaction between appropriate aldehyde, acetoacetate and urea/thiourea in presence of aluminium chloride and hydrochloric acid which upon treatment with benzoyl chloride in presence of pyridine in benzene furnish the title compounds (1-28. The structures of all title compounds have been confirmed on the basis of their analytical, IR and NMR spectral data. The title compounds have been tested for antibacterial activity against Staphylococcus aureus. The compounds were divided into training and test sets. A quantitative structure activity relationship study was made using various descriptors. Several statistical expressions were developed using stepwise multiple linear regression analysis. The best quantitative structure activity relationship model was further cross validated. The study revealed that total positive partial charge (PC+ and total polar negative Van der Waals surface area (Q_VSA_PNEG contributes negatively where as contribution of Van der Waals surface area to molar refractivity (SMR_VSA7 contributes positively to the antibacterial activity. The compounds with improved antibacterial potential can be successfully designed with selected quantitative structure activity relationship model.

  14. Effect of narrowing the base of support on the gait, gaze and quiet eye of elite ballet dancers and controls.

    Science.gov (United States)

    Panchuk, Derek; Vickers, Joan N

    2011-08-01

    We determined the gaze and stepping behaviours of elite ballet dancers and controls as they walked normally and along progressively narrower 3-m lines (l0.0, 2.5 cm). The ballet dancers delayed the first step and then stepped more quickly through the approach area and onto the lines, which they exited more slowly than the controls, which stepped immediately but then slowed their gait to navigate the line, which they exited faster. Contrary to predictions, the ballet group did not step more precisely, perhaps due to the unique anatomical requirements of ballet dance and/or due to releasing the degrees of freedom under their feet as they fixated ahead more than the controls. The ballet group used significantly fewer fixations of longer duration, and their final quiet eye (QE) duration prior to stepping on the line was significantly longer (2,353.39 ms) than the controls (1,327.64 ms). The control group favoured a proximal gaze strategy allocating 73.33% of their QE fixations to the line/off the line and 26.66% to the exit/visual straight ahead (VSA), while the ballet group favoured a 'look-ahead' strategy allocating 55.49% of their QE fixations to the exit/VSA and 44.51% on the line/off the line. The results are discussed in the light of the development of expertise and the enhanced role of fixations and visual attention when more tasks become more constrained.

  15. Comparative study of various normal mode analysis techniques based on partial Hessians.

    Science.gov (United States)

    Ghysels, An; Van Speybroeck, Veronique; Pauwels, Ewald; Catak, Saron; Brooks, Bernard R; Van Neck, Dimitri; Waroquier, Michel

    2010-04-15

    Standard normal mode analysis becomes problematic for complex molecular systems, as a result of both the high computational cost and the excessive amount of information when the full Hessian matrix is used. Several partial Hessian methods have been proposed in the literature, yielding approximate normal modes. These methods aim at reducing the computational load and/or calculating only the relevant normal modes of interest in a specific application. Each method has its own (dis)advantages and application field but guidelines for the most suitable choice are lacking. We have investigated several partial Hessian methods, including the Partial Hessian Vibrational Analysis (PHVA), the Mobile Block Hessian (MBH), and the Vibrational Subsystem Analysis (VSA). In this article, we focus on the benefits and drawbacks of these methods, in terms of the reproduction of localized modes, collective modes, and the performance in partially optimized structures. We find that the PHVA is suitable for describing localized modes, that the MBH not only reproduces localized and global modes but also serves as an analysis tool of the spectrum, and that the VSA is mostly useful for the reproduction of the low frequency spectrum. These guidelines are illustrated with the reproduction of the localized amine-stretch, the spectrum of quinine and a bis-cinchona derivative, and the low frequency modes of the LAO binding protein. 2009 Wiley Periodicals, Inc.

  16. INTERPRETATION OF AIRBORNE ELECTROMAGNETIC AND MAGNETIC DATA IN THE 600 AREA

    Energy Technology Data Exchange (ETDEWEB)

    CUMMINS GD

    2010-11-11

    As part of the 200-PO-1 Phase I geophysical surveys, Fugro Airborne Surveys was contracted to collect airborne electromagnetic (EM) and magnetic surveys of the Hanford Site 600 Area. Two helicopter survey systems were used with the HeliGEOTEM{reg_sign} time domain portion flown between June 19th and June 20th, 2008, and the RESOLVE{reg_sign} frequency domain portion was flown from June 29th to July 1st, 2008. Magnetic data were acquired contemporaneously with the electromagnetic surveys using a total-field cesium vapor magnetometer. Approximately 925 line kilometers (km) were flown using the HeliGEOTEM{reg_sign} II system and 412 line kilometers were flown using the RESOLVE{reg_sign} system. The HeliGEOTEM system has an effective penetration of roughly 250 meters into the ground and the RESOLVE system has an effective penetration of roughly 60 meters. Acquisition parameters and preliminary results are provided in SGW-39674, Airborne Electromagnetic Survey Report, 200-PO-1 Groundwater Operable Unit, 600 Area, Hanford Site. Airborne data are interpreted in this report in an attempt to identify areas of likely preferential groundwater flow within the aquifer system based on the presence of paleochannels or fault zones. The premise for the interpretation is that coarser-grained intervals have filled in scour channels created by episodic catastrophic flood events during the late Pleistocene. The interpretation strategy used the magnetic field anomaly data and existing bedrock maps to identify likely fault or lineament zones. Combined analysis of the magnetic, 60-Hz noise monitor, and flight-altitude (radar) data were used to identify zones where EM response is more likely due to cultural interference and or bedrock structures. Cross-sectional and map view presentations of the EM data were used to identify more electrically resistive zones that likely correlate with coarser-grained intervals. The resulting interpretation identifies one major northwest-southeast trending

  17. Stratospheric platforms: a novel technological support for Earth observation and remote sensing applications

    Science.gov (United States)

    Dovis, Fabio; Lo Presti, Letizia; Magli, Enrico; Mulassano, Paolo; Olmo, Gabriella

    2001-12-01

    The international community agrees that the new technology based on the use of Unmanned Air Vehicles High Altitude Very long Endurance (UAV-HAVE) could play an important role for the development of remote sensing and telecommunication applications. A UAV-HAVE vehicle can be described as a low- cost flying infrastructure (compared with satellites) optimized for long endurance operations at an altitude of about 20 km. Due to such features, its role is similar to satellites, with the major advantages of being less expensive, more flexible, movable on demand, and suitable for a larger class of applications. According to this background, Politecnico di Torino is involved as coordinator in an important project named HeliNet, that represent one of the main activities in Europe in the field of stratospheric platforms, and is concerned with the development of a network of UAV-HAVE aircraft. A key point of this project is the feasibility study for the provision of several services, namely traffic monitoring, environmental surveillance, broadband communications and navigation. This paper reports preliminary results on the HeliNet imaging system and its remote sensing applications. In fact, many environmental surveillance services (e.g. regional public services for agriculture, hydrology, fire protection, and more) require very high-resolution imaging, and can be offered at a lower cost if operated by a shared platform. The philosophy behind the HeliNet project seems to be particularly suitable to manage such missions. In particular, we present a system- level study of possible imaging payloads to be mounted on- board of a stratospheric platform to collect Earth observation data. Firstly, we address optical payloads such as multispectral and/or hyperspectral ones, which are a very short-term objective of the project. Secondly, as an example of mid-term on-board payload, we examine the possibility to carry on the platform a light-SAR system. For both types of payload, we show

  18. Analysis of correlation between white matter changes and functional responses in thalamic stroke: a DTI & EEG study.

    Science.gov (United States)

    Duru, Adil Deniz; Duru, Dilek Göksel; Yumerhodzha, Sami; Bebek, Nerses

    2016-06-01

    Diffusion tensor imaging (DTI) allows in vivo structural brain mapping and detection of microstructural disruption of white matter (WM). One of the commonly used parameters for grading the anisotropic diffusivity in WM is fractional anisotropy (FA). FA value helps to quantify the directionality of the local tract bundle. Therefore, FA images are being used in voxelwise statistical analyses (VSA). The present study used Tract-Based Spatial Statistics (TBSS) of FA images across subjects, and computes the mean skeleton map to detect voxelwise knowledge of the tracts yielding to groupwise comparison. The skeleton image illustrates WM structure and shows any changes caused by brain damage. The microstructure of WM in thalamic stroke is investigated, and the VSA results of healthy control and thalamic stroke patients are reported. It has been shown that several skeleton regions were affected subject to the presence of thalamic stroke (FWE, p EEG (qEEG) scores and neurophysiological tests with the FA skeleton for the entire test group is also investigated. We compared measurements that are related to the same fibers across subjects, and discussed implications for VSA of WM in thalamic stroke cases, for the relationship between behavioral tests and FA skeletons, and for the correlation between the FA maps and qEEG scores.Results obtained through the regression analyses did not exceed the corrected statistical threshold values for multiple comparisons (uncorrected, p EEG, cingulum bundle and corpus callosum were found to be related. These areas are parts of the Default Mode Network (DMN) where DMN is known to be involved in resting state EEG theta activity. The relation between the EEG alpha band power values and FA values of the skeleton was found to support the cortico-thalamocortical cycles for both subject groups. Further, the neurophysiological tests including Benton Face Recognition (BFR), Digit Span test (DST), Warrington Topographic Memory test (WTMT

  19. Understanding Hydrological Processes in Variable Source Areas in the Glaciated Northeastern US Watersheds under Variable Climate Conditions

    Science.gov (United States)

    Steenhuis, T. S.; Azzaino, Z.; Hoang, L.; Pacenka, S.; Worqlul, A. W.; Mukundan, R.; Stoof, C.; Owens, E. M.; Richards, B. K.

    2017-12-01

    The New York City source watersheds in the Catskill Mountains' humid, temperate climate has long-term hydrological and water quality monitoring data It is one of the few catchments where implementation of source and landscape management practices has led to decreased phosphorus concentration in the receiving surface waters. One of the reasons is that landscape measures correctly targeted the saturated variable source runoff areas (VSA) in the valley bottoms as the location where most of the runoff and other nonpoint pollutants originated. Measures targeting these areas were instrumental in lowering phosphorus concentration. Further improvements in water quality can be made based on a better understanding of the flow processes and water table fluctuations in the VSA. For that reason, we instrumented a self-contained upland variable source watershed with a landscape characteristic of a soil underlain by glacial till at shallow depth similar to the Catskill watersheds. In this presentation, we will discuss our experimental findings and present a mathematical model. Variable source areas have a small slope making gravity the driving force for the flow, greatly simplifying the simulation of the flow processes. The experimental data and the model simulations agreed for both outflow and water table fluctuations. We found that while the flows to the outlet were similar throughout the year, the discharge of the VSA varies greatly. This was due to transpiration by the plants which became active when soil temperatures were above 10oC. We found that shortly after the temperature increased above 10oC the baseflow stopped and only surface runoff occurred when rainstorms exceeded the storage capacity of the soil in at least a portion of the variable source area. Since plant growth in the variable source area was a major variable determining the base flow behavior, changes in temperature in the future - affecting the duration of the growing season - will affect baseflow and

  20. Keegi ei tea mu nime : [luuletused] / Veiko Märka

    Index Scriptorium Estoniae

    Märka, Veiko, 1964-

    2002-01-01

    Tõlgitud Veiko Märka luulekogust "Tühja aju korinad". Sisu: Keegi ei tea mu nime = Kukaan ei tiedä mun nimee ; "Kui ma kuulen sõnu..." = "Kun kuulen ilmauksen..." ; "Esimese..." = "Ensimmäisenä..." ; "Igal hommikul..." = "Joka aamu..." / tlk. Hannu Oittinen. Väike perenaine = Pikku perheenäiti / tlk. Hannu Oittinen ja Tuglas-seuran kääntäjäpiiri. Progressi triumf : (Poeem) = Kehityksen voitto : (Runoelma) / tlk. Hannu Oittinen. Minimalistlikud muinasjutud = Minimalistisia satuja / tlk. Heli Laaksonen ja Hannu Oittinen. Kõige turvalisem seks = Turvallisinta seksiä ; Abistame Aafrikat! = Autetaan Afrikkaa! ; "Taome..." = "Taotaan..." ; "Edasi..." = "Eteenpäin..." ; "Isegi juhus..." = "Edes sattuma..." ; "Miinus ja miinus..." = "Miinus ja miinus..." / tlk. Hannu Oittinen. Leijonien pakottaja ; Kotka ja Vaasa: Ystävyyskaupunkit

  1. Eesti teatri aastaauhinnad 2004

    Index Scriptorium Estoniae

    2005-01-01

    Lavastajaauhind Tiit Ojasoo, naisnäitleja auhind Epp Eespäev, meesnäitleja Hendrik Toompere jun, naiskõrvalosatäitja Kadri Lepp, meeskõrvalosatäitja Herardo Kontreras, kunstnikuauhind Jaak Vaus, žürii eriauhind lavastaja Anne Türnpule ja kunstnik Liina Tepandile "Valgelaev ja taevakäijad" eest, kriitikuauhind Kristiina Garancis, Kristallkingakese auhind Mirtel Pohla ja Kaspar Jancis, muusikalavastuse auhind "Eesti ballaadid" kooslusele ja Heli Veskusele, tantsulavastuse auhind Maria Seletskajale ja ZUGA Ühendatud Tantsijatele, Priit Põldroosi preemia Aime Unt, Ants Lauteri preemia Indrek Saar, Liina Vahtrik, Salme Reegi preemia Peeter Tammearu, Aleksander Kurtna preemia Martin Algus, Natalie Mei preemia Eldor Renter, balleti- ja tantsulavastuse eriauhind Kaie Kõrb, Georg Otsa preemia Mati Kõrts, parima teatritöötaja auhind : Riina Roose, Jane Kaas, Ott Mölter, Eda Kaljo, Aino Kartul, Kaja Kupp, Ain Jürisson, Jelena Oleinikova, Kalle Kuningas ja Moonika Lausvee

  2. Ion pair production and chemi-ionisation in collisions of He*(2sup(1,3)S) with Li

    International Nuclear Information System (INIS)

    Wang, D.P.; Tang, S.Y.; Neynaber, R.H.

    1987-01-01

    A merging-beams technique has been used to study collisions of He*(2sup(1,3)S) with Li. The He* represents a composite of 13% He(2 1 S) and 87% He(2 3 S). Absolute and relative cross sections, Q, have been measured in a range of relative kinetic energy, W, from 150 to 1500 eV for the ion pair production (IPP) of He + + Li - , and from 0.01 to 500 eV for chemi-ionisation (CI). Information obtained for CI shows that: the Penning ionisation reaction is directed with most of the Li + scattered in the incident Li direction, the He*-Li system is attractive with a measured well depth of 0.73 eV and the value of Q for total ionisation varies as Wsup(-0.34). Similarities to the He*-He* system are also given. (author)

  3. Teatri aastaauhindade laureaadid 2008

    Index Scriptorium Estoniae

    2008-01-01

    Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

  4. Eesti teatri aastaauhinnad 2007

    Index Scriptorium Estoniae

    2008-01-01

    Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

  5. Mis tuleb

    Index Scriptorium Estoniae

    2004-01-01

    Detsembris Mahtra talurahvamuuseumis Atla mõisa keraamika- ja taimeseaderingi Takjanupud jõuluseadete näitus. 4. XII Tallinnas Säästva Renoveerimise Infokeskuses naturaalkrohvi töötuba. Kuni 4. XII Rapla keskraamatukogus Saima Randjärve näitus "Valguses". 9., 11., 17. ja 18. XII Säästva Renoveerimise Keskuses Jüri Kuusmanni loodusvärvide kursus. 11. XII Türi kultuurimajas tekstiilist kuuskede konkurss "Kuusepuu 2004". 14. XII Eesti Rahva Muuseumis 9. koolidevaheline jõuluteemaline võistujoonistamine. Tartu Mämguasjamuuseumis on 15.-23. XII avatud jõuluhõnguline mängutuba ja näitus Heli Männi mänguasjade kogust

  6. Dicty_cDB: Contig-U16068-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Primary rat hepatocyte toxicity modeling. 46 1e-13 5 ( EL485357 ) CHUM7113.b1_A04.ab1 CHU(LMS) puzzle...T(LMS) Jerusalem artichoke ... 54 8e-08 3 ( EL484942 ) CHUM6734.b1_K04.ab1 CHU(LMS) puzzle sunflower Hel... ... MUSR Musa acuminata cDNA 5', mRNA seque... 44 3e-07 4 ( EL513970 ) CHUY742.b1_L18.ab1 CHU(XYZ) puzzle sunfl...Y525.b1_J11.ab1 CHU(XYZ) puzzle sunflower Heli... 54 5e-06 2 ( DY934089 ) CHPX124...ld sunflowe... 54 5e-06 2 ( EL476432 ) CHUL4354.b1_D09.ab1 CHU(LMS) puzzle sunflower Hel... 54 5e-06 2 ( DY9

  7. Dicty_cDB: Contig-U14068-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A(XYZ) common wild sunflowe... 52 3e-06 2 ( EL475764 ) CHUL3727.b1_M20.ab1 CHU(LMS) puzzle sunflower Hel... ...44 2e-05 3 ( EL484083 ) CHUM594.b1_C06.ab1 CHU(LMS) puzzle sunflower Heli... 44 3e-05 3 ( EH295921 ) UAHYP_0...) serpentine sunflower... 44 5e-04 2 ( EL482465 ) CHUM4440.b1_O06.ab1 CHU(LMS) puzzle sunflower Hel... 44 5e...16607_g1 Cowpea IT97K-461-4 Mixed Tis... 38 5e-04 2 ( EL489951 ) CHUS5070.b1_K19.ab1 CHU(LMS) puzzle... hirsutum cDNA clon... 34 0.002 3 ( EL480989 ) CHUM2981.b1_J02.ab1 CHU(LMS) puzzle

  8. Significado prognóstico do linfonodo metastático N3 em carcinomas epidermóides de cabeça e pescoço

    OpenAIRE

    Amar,Ali; Curioni,Otávio Alberto; Rapoport,Abrão

    2004-01-01

    OBJETIVO: Avaliar os resultados do tratamento da doença metastática em estádio avançado (N3) e sua relação com o prognóstico do carcinoma espinocelular de cabeça e pescoço. MÉTODO: Foram revisados as informações de prontuários de 241 pacientes, com carcinoma espinocelular de boca, orofaringe, laringe e hipofaringe com metástases cervicais maiores que 6 cm (N3) submetidos à cirurgia e/ou radioterapia, no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis...

  9. Meestele

    Index Scriptorium Estoniae

    1985-01-01

    Irene Truuts on suveks meestele kavandanud kombinesooni, blusooni ja püksid, sportliku ülikonna (5 moejoonist). Nr. 2, lk. 28-3: Meeste päevasest rõivastusest. Mudelite autorid Heli Kohk (6 moejoonist), Liivi Raid (5 moejoonist). Nr. 3, lk. 18-25: Meestemoest Üleliidulise Esteetikakomisjoni prognooside ja rahvusvaheliste moeajakirjade põhjal. Vaatluse all: stiilid, mantlid, joped, jakid, ülikonnad, püksid, särgid, jalatsid, peakatted, lipsud. Mudelid (6 moejoonist, 7 fotomudelit) on kavandanud Irene Truuts. Nr. 3, lk. 26-27: Kahe meeste džempri kudumise õpetus. Mudelite autorid Krista Kajandu ja Anu Stranberg. Nr. 4, lk. 30-33: Moodsad meesterõivad (7 moejoonist) kavandas kunstnik Irene Truuts.

  10. [Quality of life of the colostomized person with or without use of methods of bowel control].

    Science.gov (United States)

    Cesaretti, Isabel Umbelina Ribeiro; Santos, Vera Lúcia Conceição Gouveia; Vianna, Lucila Amaral Carneiro

    2010-01-01

    To evaluate and to compare the quality of life (QoL) of colostomy people, using or not using the bowel control methods (BCM), in other words, the colostomy irrigation and the plug system, considering the hypothesis that people who used them had better QoL. This study was carried out in the Heliópolis Hospital Outpatient Department, after the project approval for the Ethical and Research Committee, using the WHOQoL-bref. The sample was constituted of two groups: 50 colostomy people with BCM and 50, without BCM. The Group with BCM had a QoL significantly higher, being this observed in all the Domains and in the Overall QoL, than those of the Group without BCM. The study confirmed the hypothesis that the QoL of the Group with BCM is better than the Group without BCM.

  11. Candidíase oral como marcador de prognóstico em pacientes portadores do HIV

    OpenAIRE

    Cavassani Valdinês Gonçalves dos Santos; Andrade Sobrinho Jozias de; Homem Maria da Graça Naclério; Rapoport Abrão

    2002-01-01

    Introdução: A candidíase oral é uma das doenças oportunistas mais fortemente associadas à infecção pelo Vírus da Imunodeficiência Humana (HIV). Vários relatos epidemiológicos enfatizam a prevalência da candidíase em pacientes HIV positivos e ressaltam a sua importância como marcador da progressão da doença e preditivo para o aumento da imunodepressão. Objetivo: Verificar as alterações estomatológicas em pacientes portadores do HIV tratados no Hospital Heliópolis - São Paulo, Brasil e comparar...

  12. Study of Λ-production in central nucleus-nucleus interactions at the momentum of 4.6 GeV/c per incident nucleon

    International Nuclear Information System (INIS)

    Anikina, M.; Golokhvastov, A.; Goncharova, L.

    1983-01-01

    Transverse momenta and rapidities of Λ particles produced in central nucleus-nucleus collisions at 4.5 GeV/c per nucleon (cC, CNe, ONe, CCu, CZr, CPb, OPb) have been studied and compared with those from ineiolastic He-Li interactns at the same incident momentum. Polarization of Λ hyperons was found to be consistent (within the errors) with zero (αP=-0.06+-0.11) for 224 Λ particles from central collisions. The upper limit of anti Λ/Λ production ratio was estimated to be less than 10 -2 at a 90% confidence level. The analyzed experimental data were obtained using the triggered 2 m streamer spectrometer SKM-200

  13. Environmental and regulatory considerations when planning a geophysical program

    International Nuclear Information System (INIS)

    Down-Cicoria, C.

    1999-01-01

    Public concerns regarding the environmental impact of geophysical programs have resulted in more pressure on the federal and provincial governments to regulate and protect unique ecosites. In the past decade, about 1 million kilometres of seismic have been shot by the petroleum industry in Alberta alone, representing about 70,000 hectares of land base. This paper reviewed how a preliminary assessment of any geophysical project should consider the effects of all projects on the terrain, climate, vegetation, soils, fisheries, wildlife, aquatic ecosystems, heritage resources, and timber dispositions. Geo-administrative boundaries, field assessments, environmental assessments and mitigation measures such as low impact line cutting methods, timing methods, and heli-portable operations must also be considered. Special considerations when planning a three-dimensional program were highlighted. Certain equipment suitable as mitigation measures such as mulchers, hydro-axes, enviro-drills, biodegradable lathes, tracked/low PSI equipment, and doglegs were also reviewed. 15 refs., 2 tabs., 18 figs

  14. Conditions of fragment formation in central and peripheral collisions

    International Nuclear Information System (INIS)

    Mueller, W.F.J.

    1999-01-01

    We report on new measurements of the breakup temperature determined from isotope ratios as well as from state population ratios for the decay of the spectator in Au+Au collisions at 600 and 1000 A MeV and compare them to results for the decay of the participant region at beam energies of 50-200 A MeV. Temperatures deduced from the new isotope thermometer T BeLi exhibit a pronounced rise with increasing excitation energy and are consistent with the previously studied T HeLi . In contrast, temperatures determined from state population ratios show no dependence on excitation energy. An improved calorimetric determination of the excitation energy for the spectator shows a significant increase with increasing bombarding energy which is in contrast to the observed universality of the fragment production. (orig.)

  15. Distillation of hydrogen isotopes for polarized HD targets

    Energy Technology Data Exchange (ETDEWEB)

    Ohta, T., E-mail: takeshi@rcnp.osaka-u.ac.jp [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Bouchigny, S. [IN2P3, Institut de Physique Nucleaire, F-91406 Orsay (France); CEA LIST, BP6-92265 Fontenay-aux-Roses, CEDEX (France); Didelez, J.-P. [IN2P3, Institut de Physique Nucleaire, F-91406 Orsay (France); Fujiwara, M. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Fukuda, K. [Kansai University of Nursing and Health Sciences, Shizuki Awaji 656-2131 (Japan); Kohri, H.; Kunimatsu, T.; Morisaki, C.; Ono, S. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Rouille, G. [IN2P3, Institut de Physique Nucleaire, F-91406 Orsay (France); Tanaka, M. [Kobe Tokiwa University, Ohtani-cho 2-6-2, Nagata, Kobe 653-0838 (Japan); Ueda, K.; Uraki, M.; Utsuro, M. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan); Wang, S.Y. [Institute of Physics, Academia Sinica, Taipei 11529, Taiwan (China); Department of Physics, National Kaohsiung Normal University, Kaohsiung 824, Taiwan (China); Yosoi, M. [Research Center for Nuclear Physics, Osaka University, Mihogaoka 10-1, Ibaraki, Osaka 567-0047 (Japan)

    2012-02-01

    We have developed a new cryogenic distillation system to purify Hydrogen-Deuteride (HD) gas for polarized HD targets in LEPS experiments at SPring-8. A small amount of ortho-H{sub 2} ({approx}0.01%) in the HD gas plays an important role in efficiently polarizing the HD target. Since there are 1-5% impurities of H{sub 2} and D{sub 2} in commercially available HD gases, it is necessary to purify the HD gas up to {approx}99.99%. The distillation system is equipped with a cryogenic distillation unit filled with many small stainless steel cells called 'Heli-pack'. The distillation unit consists of a condenser part, a rectification part, and a reboiler part. The unit is kept at the temperature of 17-21 K. The Heli-pack has a large surface area that makes a good contact between gases and liquids. An amount of 5.2 mol of commercial HD gas is fed into the distillation unit. Three trials were carried out to purify the HD gas by changing temperatures (17.5 K and 20.5 K) and gas extraction speeds (1.3 ml/min and 5.2 ml/min). The extracted gas was analyzed using a gas analyzer system combining a quadrupole mass spectrometer with a gas chromatograph. One mol of HD gas with a purity better than 99.99% has been successfully obtained for the first time. The effective NTP (Number of Theoretical Plates), which is an indication of the distillation performances, is obtained to be 37.2{+-}0.6. This value is in good agreement with a designed value of 37.9. The HD target is expected to be efficiently polarized under a well-controlled condition by adding an optimal amount of ortho-H{sub 2} to the purified HD gas.

  16. Design Calculations 81’ MLW Structure. East Coast Air Combat Maneuvering Range Offshore Kitty Hawk, North Carolina.

    Science.gov (United States)

    1976-09-01

    8217 30.00m 33,L!)0 L53 35L50530L 0 n In 0 A M.3 0 3 IV a 313, 4FIV f > Nf 2 II. -0 IL VA A. IA0 I0 Ii10.I. I D CL IL 11 VL IL VLI4 I a ID -& t.I It i...0gC vlJV%5N.N ow flow . la I ru t" ccz 2 441 11ItI t t* tW 1. It. l0 110 11 tD 1iii C w* r iii I s ~ I ’ 0 ~~~u GO 0 0 ))0~ 9995" 0 4 ..-. P 0 0 v.sa’s

  17. Baryonic density of the universe: Big Bang nucleosynthesis versus CMB observations

    International Nuclear Information System (INIS)

    Vangioni-Flam, E.; Coc, A.; Casse, M.

    2003-01-01

    Thanks to recent nuclear reaction rate compilations (NACRE[2]) and new experimental and theoretical works in nuclear physics, we have updated Standard Big Bang Nucleosynthesis (SBBN) calculations. The results are compared to the most representative light element abundances, measured in pristine astrophysical media to derive the baryonic density of the Universe. We confront Ω b h 2 obtained in this study with other values deduced from recent independent approaches as the observations of the anisotropies of the Cosmic Microwave Background (BOOMERANG, CBI, DASI, MAXIMA and VSA experiments) or the Lyman-α forest at high redshifts. Comparison between these results is a test of their consistency and could provide a better determination of this important cosmological parameter

  18. Preferential transcription of conserved rif genes in two phenotypically distinct Plasmodium falciparum parasite lines

    DEFF Research Database (Denmark)

    Wang, Christian W; Magistrado, Pamela A; Nielsen, Morten A

    2009-01-01

    transcribed in the VAR2CSA-expressing parasite line. In addition, two rif genes were found transcribed at early and late intra-erythrocyte stages independently of var gene transcription. Rif genes are organised in groups and inter-genomic conserved gene families, suggesting that RIFIN sub-groups may have......Plasmodium falciparum variant surface antigens (VSA) are targets of protective immunity to malaria. Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) and repetitive interspersed family (RIFIN) proteins are encoded by the two variable multigene families, var and rif genes, respectively...... novel rif gene groups, rifA1 and rifA2, containing inter-genomic conserved rif genes, were identified. All rifA1 genes were orientated head-to-head with a neighbouring Group A var gene whereas rifA2 was present in all parasite genomes as a single copy gene with a unique 5' untranslated region. Rif...

  19. An Electro-thermal MEMS Gripper with Large Tip Opening and Holding Force: Design and Characterization

    Directory of Open Access Journals (Sweden)

    Jay J. KHAZAAI

    2011-12-01

    Full Text Available This paper presents the design, fabrication, and characterization of a novel MEMS gripper that is driven electro-thermally by a new V-shape actuator (VSA and a set of modified Guckel U-shape actuators (mUSA. The modification of the angle between the hot and cold arms in the mUSA facilitates unidirectional in-plane displacement causing the opening of the gripper. This configuration distinguishes the MEMS gripper from others in its ability to generate larger tip displacement and greater holding force. The metallic structures allow for a low operating voltage and low overall power consumption. A tip opening of 173.4 μm has been measured at the operating voltage of 1 V with consuming power of 0.85 W. MetalMUMPs is employed to fabricate the device, in which electroplated nickel is used as the structural material.

  20. Immune selection and within-host competition can structure the repertoire of variant surface antigens in Plasmodium falciparum -a mathematical model

    DEFF Research Database (Denmark)

    van Noort, Sander P; Nunes, Marta C; Weedall, Gareth D

    2010-01-01

    BACKGROUND: The evolutionary mechanisms structuring the expression pattern of variant surface antigen (VSA) families that allow pathogens to evade immune responses and establish chronic and repeated infections pose major challenges to theoretical research. In Plasmodium falciparum, the best...... subset of PfEMP1 variants tends to dominate in non-immune patients and in patients with severe malaria, while more diverse subsets relate to uncomplicated infection and higher levels of pre-existing protective immunity. METHODOLOGY/PRINCIPAL FINDINGS: Here, we use the available molecular and serological......-host and diverse blocks that are favoured by immune selection at the population level. CONCLUSIONS/SIGNIFICANCE: The application of a monotonic dominance profile to VSAs encoded by a gene family generates two opposing selective forces and, consequently, two distinct clusters of genes emerge in adaptation to naïve...

  1. Antibodies from malaria-exposed pregnant women recognize trypsin resistant epitopes on the surface of Plasmodium falciparum-infected erythrocytes selected for adhesion to chondroitin sulphate A

    DEFF Research Database (Denmark)

    Sharling, Lisa; Enevold, Anders; Sowa, Kordai M P

    2004-01-01

    of CSA binding and surface recognition of CSA selected parasites by serum IgG from malaria exposed pregnant women. Thus, the complete molecular definition of an antigenic P. falciparum erythrocyte surface protein that can be used as a malaria in pregnancy vaccine has not yet been achieved.......-specific antibodies induced as a result of pregnancy associated malaria (PAM). METHODS: Fluorescence activated cell sorting (FACS) was used to measure the levels of adult Scottish and Ghanaian male, and Ghanaian pregnant female plasma immunoglobulin G (IgG) that bind to the surface of infected erythrocytes. P....... falciparum infected erythrocytes selected for adhesion to CSA were found to express trypsin-resistant VSA that are the target of naturally acquired antibodies from pregnant women living in a malaria endemic region of Ghana. However in vitro adhesion to CSA and HA was relatively trypsin sensitive. An improved...

  2. Coupling between the Output Force and Stiffness in Different Variable Stiffness Actuators

    Directory of Open Access Journals (Sweden)

    Amir Jafari

    2014-08-01

    Full Text Available The fundamental objective in developing variable stiffness actuators is to enable the actuator to deliberately tune its stiffness. This is done through controlling the energy flow extracted from internal power units, i.e., the motors of a variable stiffness actuator (VSA. However, the stiffness may also be unintentionally affected by the external environment, over which, there is no control. This paper analysis the correlation between the external loads, applied to different variable stiffness actuators, and their resultant output stiffness. Different types of variable stiffness actuators have been studied considering springs with different types of nonlinearity. The results provide some insights into how to design the actuator mechanism and nonlinearity of the springs in order to increase the decoupling between the load and stiffness in these actuators. This would significantly widen the application range of a variable stiffness actuator.

  3. Trening za razvijanje občutka za števila in količine pri predšolskih otrocih s posebnimi potrebami

    OpenAIRE

    Kuplenk, Petra

    2017-01-01

    Tako otroci kot tudi odrasli se z matematiko srečujemo na vsakem koraku, pa naj bo to na poti v vrtec, službo ali pa pri delu doma. Matematika vsakodnevno vpliva na naše življenje in delo. Na delovnem mestu, v vrtcu, opažam vse večje težave otrok s posebnimi potrebami na področju razvoja občutka za števila in količine. V predšolskem obdobju je namreč nujno, da otroci razvijejo občutek za števila in količine, saj vsa nadaljnja matematična znanja temeljijo na usvojenih spretnostih. V empirič...

  4. Maternal vitamin A supplementation and immunity to malaria in pregnancy in Ghanaian primigravids

    DEFF Research Database (Denmark)

    Cox, Sharon E; Staalsoe, Trine; Arthur, Paul

    2005-01-01

    BACKGROUND: Vitamin A supplementation is believed to enhance immune responses to infection but few studies have assessed its effects on anti-malarial immunity, especially during pregnancy when women are at increased risk from both vitamin A deficiency and pregnancy-associated malaria. The patholo......BACKGROUND: Vitamin A supplementation is believed to enhance immune responses to infection but few studies have assessed its effects on anti-malarial immunity, especially during pregnancy when women are at increased risk from both vitamin A deficiency and pregnancy-associated malaria...... in vitro (anti-VSACSA IgG or anti-VSA IgG). Placental malarial infection was determined by placental blood smear and histology. RESULTS: Vitamin A supplementation was non-significantly associated with a decreased risk of active or chronic-active placental malarial infection compared to past, resolved...

  5. CO2 Capacity Sorbent Analysis Using Volumetric Measurement Approach

    Science.gov (United States)

    Huang, Roger; Richardson, Tra-My Justine; Belancik, Grace; Jan, Darrell; Knox, Jim

    2017-01-01

    In support of air revitalization system sorbent selection for future space missions, Ames Research Center (ARC) has performed CO2 capacity tests on various solid sorbents to complement structural strength tests conducted at Marshall Space Flight Center (MSFC). The materials of interest are: Grace Davison Grade 544 13X, Honeywell UOP APG III, LiLSX VSA-10, BASF 13X, and Grace Davison Grade 522 5A. CO2 capacity was for all sorbent materials using a Micromeritics ASAP 2020 Physisorption Volumetric Analysis machine to produce 0C, 10C, 25C, 50C, and 75C isotherms. These data are to be used for modeling data and to provide a basis for continued sorbent research. The volumetric analysis method proved to be effective in generating consistent and repeatable data for the 13X sorbents, but the method needs to be refined to tailor to different sorbents.

  6. Determination of normal values for navicular drop during walking: a new model correcting for foot length and gender

    DEFF Research Database (Denmark)

    Nielsen, Rasmus G; Rathleff, Michael S; Simonsen, Ole H

    2009-01-01

    participants. Normal values have not yet been established as foot length, age, gender, and Body Mass Index (BMI) may influence the navicular drop. The purpose of the study was to investigate the influence of foot length, age, gender, and BMI on the navicular drop during walking. METHODS: Navicular drop...... was measured with a novel technique (Video Sequence Analysis, VSA) using 2D video. Flat reflective markers were placed on the medial side of the calcaneus, the navicular tuberosity, and the head of the first metatarsal bone. The navicular drop was calculated as the perpendicular distance between the marker...... on the navicular tuberosity and the line between the markers on calcaneus and first metatarsal head. The distance between the floor and the line in standing position between the markers on calcaneus and first metatarsal were added afterwards. RESULTS: 280 randomly selected participants without any foot problems...

  7. Characterisation and cleaning of biogas from sewage sludge for biomethane production.

    Science.gov (United States)

    Paolini, Valerio; Petracchini, Francesco; Carnevale, Monica; Gallucci, Francesco; Perilli, Mattia; Esposito, Giulio; Segreto, Marco; Occulti, Leandro Galanti; Scaglione, Davide; Ianniello, Antonietta; Frattoni, Massimiliano

    2018-07-01

    This study investigates the conversion of sewage sludge from wastewater treatment plants (WWTP) into biomethane for automotive fuel or grid injection. A prototype plant was monitored in Northern Italy, based on vacuum swing adsorption (VSA) on synthetic zeolite 13×: this biogas upgrading method is similar to pressure swing adsorption (PSA) and commonly used for other kinds of biomass. Measurements of biogas inlet, biomethane outlet and off-gas were performed including CH 4 , CO 2 , CO, H 2 , O 2 , N 2 , HCl, HF, NH 3 , H 2 S and volatile organic compounds (VOCs). Critical levels were observed in the biogas for of H 2 S and HCl, whose concentrations were 1570 and 26.8 mg m -3 , respectively. On the other hand, the concentration of halogenated VOCs (including tetrachloroethylene and traces of perfluoroalkilated substances, PFAS) and mercaptans were relatively low. A simultaneous and reversible adsorption on 13× zeolite was achieved for H 2 S and CO 2 , and carbon filters played a minor role in desulfurisation. The presence of HCl is due to clarifying agents, and its removal is necessary in order to meet the required biomethane characteristics: an additional carbon-supported basic adsorbent was successfully used to remove this contaminant. This study also highlights the interference of CO 2 towards HCl if sampling is performed in compliance with the new EU standard for biomethane. High total volatile silicon (TVS) was confirmed in sewage sludge biogas, with a major contribution of siloxane D5: the suitability of this compound as an indicator of total siloxanes is discussed. Results demonstrate that volatile methyl siloxanes (VMS) do not represent a critical issue for the VSA upgrading methodology. Copyright © 2018 Elsevier Ltd. All rights reserved.

  8. Resting state networks' corticotopy: the dual intertwined rings architecture.

    Directory of Open Access Journals (Sweden)

    Salma Mesmoudi

    Full Text Available How does the brain integrate multiple sources of information to support normal sensorimotor and cognitive functions? To investigate this question we present an overall brain architecture (called "the dual intertwined rings architecture" that relates the functional specialization of cortical networks to their spatial distribution over the cerebral cortex (or "corticotopy". Recent results suggest that the resting state networks (RSNs are organized into two large families: 1 a sensorimotor family that includes visual, somatic, and auditory areas and 2 a large association family that comprises parietal, temporal, and frontal regions and also includes the default mode network. We used two large databases of resting state fMRI data, from which we extracted 32 robust RSNs. We estimated: (1 the RSN functional roles by using a projection of the results on task based networks (TBNs as referenced in large databases of fMRI activation studies; and (2 relationship of the RSNs with the Brodmann Areas. In both classifications, the 32 RSNs are organized into a remarkable architecture of two intertwined rings per hemisphere and so four rings linked by homotopic connections. The first ring forms a continuous ensemble and includes visual, somatic, and auditory cortices, with interspersed bimodal cortices (auditory-visual, visual-somatic and auditory-somatic, abbreviated as VSA ring. The second ring integrates distant parietal, temporal and frontal regions (PTF ring through a network of association fiber tracts which closes the ring anatomically and ensures a functional continuity within the ring. The PTF ring relates association cortices specialized in attention, language and working memory, to the networks involved in motivation and biological regulation and rhythms. This "dual intertwined architecture" suggests a dual integrative process: the VSA ring performs fast real-time multimodal integration of sensorimotor information whereas the PTF ring performs multi

  9. Resting State Networks' Corticotopy: The Dual Intertwined Rings Architecture

    Science.gov (United States)

    Mesmoudi, Salma; Perlbarg, Vincent; Rudrauf, David; Messe, Arnaud; Pinsard, Basile; Hasboun, Dominique; Cioli, Claudia; Marrelec, Guillaume; Toro, Roberto; Benali, Habib; Burnod, Yves

    2013-01-01

    How does the brain integrate multiple sources of information to support normal sensorimotor and cognitive functions? To investigate this question we present an overall brain architecture (called “the dual intertwined rings architecture”) that relates the functional specialization of cortical networks to their spatial distribution over the cerebral cortex (or “corticotopy”). Recent results suggest that the resting state networks (RSNs) are organized into two large families: 1) a sensorimotor family that includes visual, somatic, and auditory areas and 2) a large association family that comprises parietal, temporal, and frontal regions and also includes the default mode network. We used two large databases of resting state fMRI data, from which we extracted 32 robust RSNs. We estimated: (1) the RSN functional roles by using a projection of the results on task based networks (TBNs) as referenced in large databases of fMRI activation studies; and (2) relationship of the RSNs with the Brodmann Areas. In both classifications, the 32 RSNs are organized into a remarkable architecture of two intertwined rings per hemisphere and so four rings linked by homotopic connections. The first ring forms a continuous ensemble and includes visual, somatic, and auditory cortices, with interspersed bimodal cortices (auditory-visual, visual-somatic and auditory-somatic, abbreviated as VSA ring). The second ring integrates distant parietal, temporal and frontal regions (PTF ring) through a network of association fiber tracts which closes the ring anatomically and ensures a functional continuity within the ring. The PTF ring relates association cortices specialized in attention, language and working memory, to the networks involved in motivation and biological regulation and rhythms. This “dual intertwined architecture” suggests a dual integrative process: the VSA ring performs fast real-time multimodal integration of sensorimotor information whereas the PTF ring performs multi

  10. A cross strain Plasmodium falciparum microarray optimized for the transcriptome analysis of Plasmodium falciparum patient derived isolates

    KAUST Repository

    Subudhi, Amit

    2016-07-20

    Malarial parasite P. falciparum, an apicomplexan protozoan has a 23.3 MB nuclear genome and encodes ~ 5600 transcripts. The genetic diversity of the parasite within and across geographical zones is a challenge to gene expression studies which are essential for understanding of disease process, outcome and developing markers for diagnostics and prognostics. Here, we describe the strategy involved in designing a custom P. falciparum 15K array using the Agilent platform and Genotypic\\'s Right Design methodology to study the transcriptome of Indian field isolates for which genome sequence information is limited. The array contains probes representing genome sequences of two distinct geographical isolates (i.e. 3D7 and HB3) and sub-telomeric var gene sequences of a third isolate (IT4) known to adhere in culture condition. Probes in the array have been selected based on their efficiency to detect transcripts through a 244K array experimentation. Array performance for the 15K array, was evaluated and validated using RNA materials from P. falciparum clinical isolates. A large percentage (91%) of the represented transcripts was detected from Indian P. falciparum patient isolates. Replicated probes and multiple probes representing the same gene showed perfect correlation between them suggesting good probe performance. Additional transcripts could be detected due to inclusion of unique probes representing HB3 strain transcripts. Variant surface antigen (VSA) transcripts were detected by optimized probes representing the VSA genes of three geographically distinct strains. The 15K cross strain P. falciparum array has shown good efficiency in detecting transcripts from P. falciparum parasite samples isolated from patients. The low parasite loads and presence of host RNA makes arrays a preferred platform for gene expression studies over RNA-Seq.

  11. A cross strain Plasmodium falciparum microarray optimized for the transcriptome analysis of Plasmodium falciparum patient derived isolates

    KAUST Repository

    Subudhi, Amit; Boopathi, P.A.; Middha, Sheetal; Acharya, Jyoti; Rao, Sudha Narayana; Mugasimangalam, Raja C.; Sirohi, Paramendra; Kochar, Sanjay K.; Kochar, Dhanpat K.; Das, Ashis

    2016-01-01

    Malarial parasite P. falciparum, an apicomplexan protozoan has a 23.3 MB nuclear genome and encodes ~ 5600 transcripts. The genetic diversity of the parasite within and across geographical zones is a challenge to gene expression studies which are essential for understanding of disease process, outcome and developing markers for diagnostics and prognostics. Here, we describe the strategy involved in designing a custom P. falciparum 15K array using the Agilent platform and Genotypic's Right Design methodology to study the transcriptome of Indian field isolates for which genome sequence information is limited. The array contains probes representing genome sequences of two distinct geographical isolates (i.e. 3D7 and HB3) and sub-telomeric var gene sequences of a third isolate (IT4) known to adhere in culture condition. Probes in the array have been selected based on their efficiency to detect transcripts through a 244K array experimentation. Array performance for the 15K array, was evaluated and validated using RNA materials from P. falciparum clinical isolates. A large percentage (91%) of the represented transcripts was detected from Indian P. falciparum patient isolates. Replicated probes and multiple probes representing the same gene showed perfect correlation between them suggesting good probe performance. Additional transcripts could be detected due to inclusion of unique probes representing HB3 strain transcripts. Variant surface antigen (VSA) transcripts were detected by optimized probes representing the VSA genes of three geographically distinct strains. The 15K cross strain P. falciparum array has shown good efficiency in detecting transcripts from P. falciparum parasite samples isolated from patients. The low parasite loads and presence of host RNA makes arrays a preferred platform for gene expression studies over RNA-Seq.

  12. Qualidade de vida de pessoas colostomizadas com e sem uso de métodos de controle intestinal Calidad de vida de personas colostomizadas con o sin uso de métodos de control intestinal Quality of life of the colostomized person with or without use of methods of bowel control

    Directory of Open Access Journals (Sweden)

    Isabel Umbelina Ribeiro Cesaretti

    2010-02-01

    Full Text Available OBJETIVO: Avaliar e comparar a qualidade de vida (QV de pessoas colostomizadas que utilizam e não utilizam os métodos de controle intestinal (MCI, ou seja, a irrigação e o sistema oclusor da colostomia, considerando a hipótese de que aquelas que os utilizam têm melhor QV. Método: O estudo foi desenvolvido no Ambulatório do Hospital Heliópolis, após a aprovação do projeto pelo Comitê de Ética, usando o WHOQoL-abreviado. A amostra foi constituída de dois grupos: 50 pessoas colostomizadas usando os dois MCI e 50, sem os MCI. Resultados: A QV do Grupo com MCI foi significativamente melhor em todos os Domínios e na QV Geral do que daquelas do Grupo sem MCI. Conclusão: O estudo confirmou a hipótese de que a QV do Grupo com MCI é melhor do que a do Grupo sem MCI.OBJETIVO: Evaluar y comparar la calidad de vida (CV de las personas colostomizadas, con y sin el uso de los métodos de control intestinal (MCI, es decir, la irrigación y el sistema obturador de la colostomia, teniendo en cuenta la hipótesis de que aquellas que los utilizan tienen mejor CV. Método: El estudio fue llevado a cabo en el Ambulatorio del Hospital Heliópolis después de la aprobación del proyecto por lo Comité de Ética, usando el WHOQoL-bref. La muestra fue constituida de dos grupos: 50 personas colostomizadas usando los dos MCI y 50, sin los MCI. Resultados: Las personas del Grupo con MCI tenían CV perceptiblemente mejor, siendo eso observado en todos los Dominios y en la CV General, que aquellas del Grupo sin MCI. Conclusión: El estudio confirmo la hipótesis que la CV del Grupo con MCI es mejor que la del Grupo sin MCI.OBJECTIVE: To evaluate and to compare the quality of life (QoL of colostomy people, using or not using the bowel control methods (BCM, in other words, the colostomy irrigation and the plug system, considering the hypothesis that people who used them had better QoL. Method: This study was carried out in the Heliópolis Hospital Outpatient

  13. Candidíase oral como marcador de prognóstico em pacientes portadores do HIV Oral candidiasis as prognostic marker of HIV-infected patients

    Directory of Open Access Journals (Sweden)

    Valdinês Gonçalves dos Santos Cavassani

    2002-10-01

    Full Text Available Introdução: A candidíase oral é uma das doenças oportunistas mais fortemente associadas à infecção pelo Vírus da Imunodeficiência Humana (HIV. Vários relatos epidemiológicos enfatizam a prevalência da candidíase em pacientes HIV positivos e ressaltam a sua importância como marcador da progressão da doença e preditivo para o aumento da imunodepressão. Objetivo: Verificar as alterações estomatológicas em pacientes portadores do HIV tratados no Hospital Heliópolis - São Paulo, Brasil e comparar com a literatura. Forma de Estudo: Retrospectivo clínico não-randomizado. Casuística e Método: Foram analisados 431 pacientes HIV+/AIDS (298 homens e 133 mulheres no Hospital Heliópolis - São Paulo, Brasil, no período de 1995 a 2001. Resultados: A idade média mais comum foi dos 31 aos 40 anos (47,10%; a via de contágio mais comum foi a sexual (71,26%. Dentre as patologias, a candidíase apresentou maior prevalência (29,69%, seguida pela gengivite (16,70% e queilite angular (14,15%. Conclusões: Concluímos que o exame oral e o diagnóstico precoce da candidíase em pacientes infectados pelo HIV são fundamentais para o tratamento imediato, melhorando a sua qualidade de vida, uma vez que a candidíase é uma lesão bucal muito freqüente nesta população.Introduction: Strongly associated with Human Immunodeficiency Virus(HIV, oral candidiasis is one of the most common opportunistic infections. Various epedemiological data now emphasize the prevalence of candidiasis in HIV-infected patients and its importance as useful marker for disease progression and prediction for increasing immunossupression. Aim: The purposes of this study were to assess a group of HIV positive patients treated in Heliopólis Hospital, Hosphel - São Paulo, Brazil and refer the oral changing related to the syndrom and compared the results to the literature. Study design: Retrospective clinical no randomized. Casuistic and method: Four hundred thirty one

  14. Low Cost, High Capacity Regenerable Sorbent for Carbon Dioxide Capture from Existing Coal-fired Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Alptekin, Gokhan [TDA Research, Inc., Wheat Ridge, CO (United States); Jayaraman, Ambalavanan [TDA Research, Inc., Wheat Ridge, CO (United States); Dietz, Steven [TDA Research, Inc., Wheat Ridge, CO (United States)

    2016-03-03

    In this project TDA Research, Inc (TDA) has developed a new post combustion carbon capture technology based on a vacuum swing adsorption system that uses a steam purge and demonstrated its technical feasibility and economic viability in laboratory-scale tests and tests in actual coal derived flue gas. TDA uses an advanced physical adsorbent to selectively remove CO2 from the flue gas. The sorbent exhibits a much higher affinity for CO2 than N2, H2O or O2, enabling effective CO2 separation from the flue gas. We also carried out a detailed process design and analysis of the new system as part of both sub-critical and super-critical pulverized coal fired power plants. The new technology uses a low cost, high capacity adsorbent that selectively removes CO2 in the presence of moisture at the flue gas temperature without a need for significant cooling of the flue gas or moisture removal. The sorbent is based on a TDA proprietary mesoporous carbon that consists of surface functionalized groups that remove CO2 via physical adsorption. The high surface area and favorable porosity of the sorbent also provides a unique platform to introduce additional functionality, such as active groups to remove trace metals (e.g., Hg, As). In collaboration with the Advanced Power and Energy Program of the University of California, Irvine (UCI), TDA developed system simulation models using Aspen PlusTM simulation software to assess the economic viability of TDA’s VSA-based post-combustion carbon capture technology. The levelized cost of electricity including the TS&M costs for CO2 is calculated as $116.71/MWh and $113.76/MWh for TDA system integrated with sub-critical and super-critical pulverized coal fired power plants; much lower than the $153.03/MWhand $147.44/MWh calculated for the corresponding amine based systems. The cost of CO2 captured for TDA’s VSA based system is $38

  15. Carcinoma espinocelular do conduto auditivo externo: estudo por tomografia computadorizada de seis casos Squamous cell carcinoma of the external auditory canal: computed tomography findings in six cases

    Directory of Open Access Journals (Sweden)

    Fábio Mota Gonzalez

    2005-06-01

    Full Text Available OBJETIVO: Analisar a importância da avaliação tomográfica da extensão profunda dos carcinomas espinocelulares do conduto auditivo externo. MATERIAIS E MÉTODOS: Foram realizados exames tomográficos com cortes axiais e coronais com janelas para partes moles e óssea em seis pacientes com carcinoma espinocelular do conduto auditivo externo, com idade variando entre 55 e 71 anos, internados no Hospital Heliópolis, no período entre maio de 1995 e dezembro de 2003. RESULTADOS: Dos seis pacientes, todos apresentavam aumento de partes moles no conduto auditivo externo, cinco (83,3% tinham erosão óssea e invasão da orelha média, quatro (66,7% possuíam comprometimento da mastóide e da glândula parótida, três (50% apresentavam invasão da articulação temporomandibular, dois (33,3% tinham invasão da fossa média, do canal carotídeo e linfonodomegalia júgulo-carotídea alta ipisilateral. CONCLUSÃO: A avaliação da extensão tumoral profunda fornecida pela tomografia computadorizada é importante no estadiamento clínico, possibilitando um planejamento terapêutico mais eficaz.OBJECTIVE: To evaluate the role of computed tomography in the assessment of deep extension of squamous cell carcinoma of the external auditory canal. MATERIALS AND METHODS: In the period between May 1995 and December 2003 six patients with squamous cell carcinoma of the external auditory canal were submitted to computed tomography scan at "Hospital Heliópolis", São Paulo, SP, Brazil, including axial and coronal slices with soft tissue and bone algorithms. RESULTS: Thickening of the soft tissue of the external auditory canal was seen in all patients, bone erosion and invasion of the middle ear in five (83.3%, invasion of the mastoid and parotid gland in four (66.7%, invasion of the temporomandibular joint in three (50%, and invasion of the middle cranial fossa, carotid canal and cervical lymph node enlargement in two (33.3% patients. CONCLUSION: Assessment of

  16. Analysis of IgG with specificity for variant surface antigens expressed by placental Plasmodium falciparum isolates

    Directory of Open Access Journals (Sweden)

    Kremsner Peter G

    2004-07-01

    Full Text Available Abstract Background Pregnancy-associated malaria (PAM is caused by Plasmodium falciparum-infected erythrocytes that can sequester in placental intervillous space by expressing particular variant surface antigens (VSA that can mediate adhesion to chondroitin sulfate A (CSA in vitro. IgG antibodies with specificity for the VSA expressed by these parasites (VSAPAM are associated with protection from maternal anaemia, prematurity and low birth weight, which is the greatest risk factor for death in the first month of life. Methods In this study, the development of anti-VSAPAM antibodies in a group of 151 women who presented to the maternity ward of Albert Schweitzer Hospital in Lambaréné, Gabon for delivery was analysed using flow cytometry assays. Plasma samples from placenta infected primiparous women were also investigated for their capacity to inhibit parasite binding to CSA in vitro. Results In the study cohort, primiparous as well as secundiparous women had the greatest risk of infection at delivery as well as during pregnancy. Primiparous women with infected placentas at delivery showed higher levels of VSAPAM-specific IgG compared to women who had no malaria infections at delivery. Placental isolates of Gabonese and Senegalese origin tested on plasma samples from Gabon showed parity dependency and gender specificity patterns. There was a significant correlation of plasma reactivity as measured by flow cytometry between different placental isolates. In the plasma of infected primiparous women, VSAPAM-specific IgG measured by flow cytometry could be correlated with anti-adhesion antibodies measured by the inhibition of CSA binding. Conclusion Recognition of placental parasites shows a parity- and sex- dependent pattern, like that previously observed in laboratory strains selected to bind to CSA. Placental infections at delivery in primiparous women appear to be sufficient to induce functional antibodies which can both recognize the surface of

  17. Geração do deflúvio de uma microbacia com Mata Atlântica, Cunha, SP. Runoff generation in a small catchment with Atlantic Rainforest, Cunha, SP, Brazil.

    Directory of Open Access Journals (Sweden)

    Maurício RANZINI

    2011-12-01

    area (V.S.A.. In the other, an increasein precipitation resulted in an increase in peak flow, even during the heaviest rainstorms,suggesting that V.S.A. occupied a smaller part of the catchment, close to the channel.These results indicated that antecedent soil moisture was important for the response of runoffto rainfall.

  18. Visual Resource Analysis for Solar Energy Zones in the San Luis Valley

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, Robert [Argonne National Laboratory (ANL), Argonne, IL (United States). Environmental Science Division; Abplanalp, Jennifer M. [Argonne National Laboratory (ANL), Argonne, IL (United States). Environmental Science Division; Zvolanek, Emily [Argonne National Laboratory (ANL), Argonne, IL (United States). Environmental Science Division; Brown, Jeffery [Bureau of Land Management, Washington, DC (United States). Dept. of the Interior

    2016-01-01

    This report summarizes the results of a study conducted by Argonne National Laboratory’s (Argonne’s) Environmental Science Division for the U.S. Department of the Interior Bureau of Land Management (BLM). The study analyzed the regional effects of potential visual impacts of solar energy development on three BLM-designated solar energy zones (SEZs) in the San Luis Valley (SLV) in Colorado, and, based on the analysis, made recommendations for or against regional compensatory mitigation to compensate residents and other stakeholders for the potential visual impacts to the SEZs. The analysis was conducted as part of the solar regional mitigation strategy (SRMS) task conducted by BLM Colorado with assistance from Argonne. Two separate analyses were performed. The first analysis, referred to as the VSA Analysis, analyzed the potential visual impacts of solar energy development in the SEZs on nearby visually sensitive areas (VSAs), and, based on the impact analyses, made recommendations for or against regional compensatory mitigation. VSAs are locations for which some type of visual sensitivity has been identified, either because the location is an area of high scenic value or because it is a location from which people view the surrounding landscape and attach some level of importance or sensitivity to what is seen from the location. The VSA analysis included both BLM-administered lands in Colorado and in the Taos FO in New Mexico. The second analysis, referred to as the SEZ Analysis, used BLM visual resource inventory (VRI) and other data on visual resources in the former Saguache and La Jara Field Offices (FOs), now contained within the San Luis Valley FO (SLFO), to determine whether the changes in scenic values that would result from the development of utility-scale solar energy facilities in the SEZs would affect the quality and quantity of valued scenic resources in the SLV region as a whole. If the regional effects were judged to be significant, regional

  19. Determinants of Indices of Cerebral Volume in Former Very Premature Infants at Term Equivalent Age.

    Directory of Open Access Journals (Sweden)

    Aurelie Naud

    Full Text Available Conventional magnetic resonance imaging (MRI at term equivalent age (TEA is suggested to be a reliable tool to predict the outcome of very premature infants. The objective of this study was to determine simple reproducible MRI indices, in premature infants and to analyze their neonatal determinants at TEA. A cohort of infants born before 32 weeks gestational age (GA underwent a MRI at TEA in our center. Two axial images (T2 weighted, were chosen to realize nine measures. We defined 4 linear indices (MAfhlv: thickness of lateral ventricle; CSI: cortex-skull index; VCI: ventricular-cortex index; BOI: bi occipital index and 1 surface index (VS.A: volume slice area. Perinatal data were recorded. Sixty-nine infants had a GA (median (interquartile range of 30.0 weeks GA (27.0; 30.0 and a birth weight of 1240 grams (986; 1477. MRI was done at 41.0 (40.0; 42.0 weeks post menstrual age (PMA. The inter-investigator reproducibility was good. Twenty one MRI (30.5% were quoted abnormal. We observed an association with retinopathy of prematurity (OR [95CI] = 4.205 [1.231-14.368]; p = 0.017, surgery for patent ductus arteriosus (OR = 4.688 [1.01-21.89]; p = 0.036, early onset infection (OR = 4.688 [1.004-21.889]; p = 0.036 and neonatal treatment by cefotaxime (OR = 3.222 [1.093-9.497]; p = 0.03. There was a difference for VCI between normal and abnormal MRI (0.412 (0.388; 0.429 vs. 0.432 (0.418; 0.449; p = 0,019; BOI was higher when fossa posterior lesions were observed; VS.A seems to be the best surrogate for cerebral volume, 80% of VS.As' variance being explained by a multiple linear regression model including 7 variables (head circumference at birth and at TEA, PMA, dopamine, ibuprofen treatment, blood and platelets transfusions. These indices, easily and rapidly achievable, seem to be useful but need to be validated in a large population to allow generalization for diagnosis and follow-up of former premature infants.

  20. Using slope-area and apatite fission track analysis to decipher the rock uplift pattern of the Yumu Shan: New insights into the growth of the NE Tibetan Plateau

    Science.gov (United States)

    Wang, Yizhou; Zheng, Dewen; Pang, Jianzhang; Zhang, Huiping; Wang, Weitao; Yu, Jingxing; Zhang, Zhuqi; Zheng, Wenjun; Zhang, Peizhen; Li, Youjuan

    2018-05-01

    Studies have shown that the growth of the Qilian Shan, the northeastern margin of the Tibetan Plateau, started 10 Ma ago. However, when and how it expanded northwards is still under debate. Here we focus on the rock uplift pattern of the Yumu Shan, an active fault-related fold in the Hexi Corridor north to the Qilian Shan. Normalized channel steepness achieved from the analysis of river longitudinal profiles shows a spatially variant rock uplift pattern, with higher rates in the middle part and lower rates towards the west and east tips. The compression of the mountain is typically accommodated by fault-fold related shortening and vertical thickening. Apatite fission track thermochronology reveals that the growth of the Yumu Shan started 4 Ma ago, similar to the work on active tectonics. Combining the onset ages of the growth of the Qilian Shan (10 Ma), Laojunmiao anticline (3-4 Ma), Baiyanghe anticline (3-4 Ma), Wenshu Shan (4.5 Ma) and Heli Shan (2 Ma), we draw an conclusion that the NE margin of the Tibetan Plateau initiated growth in the mid-Miocene and expanded to the Hexi Corridor and to the south of the Alxa block in the early Pleistocene.

  1. Kasvatusteaduslike tööde konkursi tulemused / Ulve Kala

    Index Scriptorium Estoniae

    Kala, Ulve, 1947-

    2002-01-01

    Eesti keeles publitseeritud teadustöö preemia anti Aleksander Elangole, Inger Kraavile ja Kristi Kõivule, diplom Ühiskondlikule Pedagoogika Uurimise Instituudile, Viivi Ekstale, Inger Kraavile, Inge Undile, Viivi Maansole. Võõrkeeles publitseeritud teadustöö preemia monograafiale "Integration als Problem in der Erziehungswissenschaft" (koostaja Airi Liimets, autorid Airi Liimets, Saila Anttonen, Gunnar Bergendal, Gerd-Bodo Reinert von Carlsburg, Helmut Wehr, Tiiu Kuurme, Pauli Siljander, Jüri Kruusvall, Sirje Priimägi, Ene-Silvia Sarv, Kristi Kõiv, Meri-Liis Laherand, Jaan Mikk, Hannele Niemi, Marika Veisson, Irina Würscher, Susanne Jena, Tiina Aunin, Reet Liimets, Heli Mattisen, Aivo Saar, Maie Vikat), diplom Aino Saarele ja Katrin Niglasele. Didaktilis-rakenduslike tööde preemia Eda Heinlale, Estelle Laanele ja Kalle Laanele, Tiiu Kadajasele. Populaarteadusliku töö preemia Maie Tuulikule, diplom Kristi Kõivule. H. Liimetsa nim magistritööde preemia Rain Mikserile, Margus Pedastele, Ülle Rannutile, Inger Kraavile, Tago Sarapuule, Martin Ehalale

  2. Conceptual study on advanced PWR system

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Yoon Young; Chang, M H; Yu, K J; Lee, D J; Cho, B H; Kim, H Y; Yoon, J H; Lee, Y J; Kim, J P; Park, C T; Seo, J K; Kang, H S; Kim, J I; Kim, Y W; Kim, Y H

    1997-07-01

    In this study, the adoptable essential technologies and reference design concept of the advanced reactor were developed and related basic experiments were performed. (1) Once-through Helical Steam Generator: a performance analysis computer code for heli-coiled steam generator was developed for thermal sizing of steam generator and determination of thermal-hydraulic parameters. (2) Self-pressurizing pressurizer : a performance analysis computer code for cold pressurizer was developed. (3) Control rod drive mechanism for fine control : type and function were surveyed. (4) CHF in passive PWR condition : development of the prediction model bundle CHF by introducing the correction factor from the data base. (5) Passive cooling concepts for concrete containment systems: development of the PCCS heat transfer coefficient. (6) Steam injector concepts: analysis and experiment were conducted. (7) Fluidic diode concepts : analysis and experiment were conducted. (8) Wet thermal insulator : tests for thin steel layers and assessment of materials. (9) Passive residual heat removal system : a performance analysis computer code for PRHRS was developed and the conformance to EPRI requirement was checked. (author). 18 refs., 55 tabs., 137 figs.

  3. Relationship of Halitosis with Gastric Helicobacter Pylori Infection

    Directory of Open Access Journals (Sweden)

    Farnaz HajiFattahi

    2015-10-01

    Full Text Available Objectives: Gastric infection with Helicobacter pylori may be one of the main causes of halitosis. This study was performed to evaluate the relationship of Heli- cobacter pylori infection with halitosis.Materials and Methods: This case control study was performed on 44 dyspeptic patients with a mean age of 34.29±13.71 years (range 17 to 76 years. The case group included 22 patients with halitosis and no signs of diabetes mellitus, renal or liver failure, upper respiratory tract infection, malignancies, deep carious teeth, severe  periodontitis,  coated  tongue,  dry  mouth  or poor  oral  hygiene.  Control group included 22 patients without halitosis and the same age, sex, systemic and oral conditions as the case group. Halitosis was evaluated using organoleptic test (OLT and Helicobacter pylori infection was evaluated by Rapid Urease Test (RUT during endoscopy. The data were statistically analyzed using chi square, Mann Whitney and t-tests.Results: Helicobacter pylori infection was detected in 20 (91% out of 22 halitosis patients, and 7 control subjects (32% (P<0.001.Conclusion: Helicobacter pylori gastric infection can be a cause of bad breath. Dentists should pay more attention to this infection and refer these patients to in- ternists to prevent further gastrointestinal (GI complications and probable malig- nancies.

  4. Experimental Investigation for RUAV's Actuator Fault Detections with AESMF

    Directory of Open Access Journals (Sweden)

    Dalei Song

    2015-07-01

    Full Text Available The adaptive extended set-membership filter (AESMF algorithm for robots' online modelling is today proposed for use in this field. Compared to the traditional ESMF, this novel filter method improves estimation accuracy under variable boundaries of unknown but bounded (UBB process noise, which is often caused by the uncertainties of robotic dynamics. However, the applicability and stability of the AESMF method have not been tested in detail or demonstrated for real robotic systems. In this research, AESMF is applied for the actuator fault detections of a rotor-craft unmanned air vehicle (RUAV. The stability of AESMF is firstly analysed using mathematics and actuator healthy coefficients (AHC are introduced for building the actuator failure model of RUAVs. AESMF is employed for the online boundary estimation of flight states and AHC parameters for fault tolerance control. Based on the proposed AESMF actuator fault estimation, flight experiments are conducted using a ServoHeli-40 RUAV platform and the flight results are compared with traditional ESMF and the adaptive extended Kalman filter (AEKF in order to demonstrate its effectiveness, as well as for suggesting improvements for the actuator failure detection of RUAVs.

  5. Cambios en la medida de las horas de insolación: Análisis de su impacto en dos observatorios de las Islas Baleares (España

    Directory of Open Access Journals (Sweden)

    José A. Guijarro

    2007-12-01

    Full Text Available Se han comparado las medidas de horas de sol realizadas en paralelo con el heliógrafo Campbell-Stokes, utilizado tradicionalmente en los observatorios españoles, con las medidas de los nuevos instrumentos de Kipp&Zonen, basados en el umbral de irradiación directa de 120 Wm-2. La comparación se ha realizado con los datos de dos observatorios de Baleares, ubicados en los aeropuertos de Menorca e Ibiza, en los que las nuevas medidas son generalmente inferiores a las antiguas, con diferencias medias diarias de -0,97 y -0,58 horas respectivamente. En términos relativos, la disminución respecto al promedio anual del periodo 1971-2000 es de un 13,2% en Menorca y un 7,8% en Ibiza. Se han realizado ajustes por regresión lineal simple y múltiple que explican un 94% de la varianza de la insolación diaria. Las ecuaciones obtenidas pueden servir para homogeneizar las series de datos diarios de horas de sol, con errores típicos de 0,98 horas en el aeropuerto de Menorca y 0,86 en el de Ibiza, pero no son aplicables a otros observatorios.

  6. Selected technological problems of repair of hydraulic drive systems for shearer loaders with the example of A2V-107 pumps and SHT-630W motors

    Energy Technology Data Exchange (ETDEWEB)

    Kusak, E.; Paluch, J.

    1983-07-01

    Major elements of hydraulic drive systems as well as their wear and repair characteristics are described. Types of wear and standardized repair methods are comparatively evaluated. The evaluations are aimed at development of standardized procedures for use in large repair shops. The following stages of repair operations of A2V-107 pumps and SHT-630W motors are analyzed: disassembling hydraulic systems, washing and cleaning, classification of equipment elements (elements for scrapping and for regeneration), regeneration, assembling and final tests. The following regeneration methods are discussed: cutting, burnishing, bushing (e.g. the Heli Coil method), regeneration using copper, tin or zinc dusts and a temperature from 950 to 1,000 K under inert atmosphere, heat treatments. Methods are reviewed for comparative evaluations of repair efficiency and repair quality as well as documents used for recording repair in the shops. Economic aspects of using standardized procedures for repair of hydraulic equipment for shearer loaders are discussed and recommendations are made. (6 refs.)

  7. Comparison of Salivary and Serum Enzyme Immunoassays for the Diagnosis of Helicobacter pylori Infection

    Directory of Open Access Journals (Sweden)

    John M Embil

    1998-01-01

    Full Text Available Infection with Helicobacter pylori has been established as an important risk factor for the development of peptic ulcer disease, gastritis and gastric cancer. The diagnosis of H pylori infection can be established by invasive or noninvasive techniques. Two noninvasive enzyme immunoassays (EIAs for antibody detection – HeliSal and Pylori Stat – were compared with histology. Both assays detect immunoglobulin (Ig G directed against purified H pylori antigen. The test populations consisted of 104 consecutive patients scheduled for upper gastrointestinal endoscopy. Of these patients, 97 (93% had symptoms compatible with peptic ulcer disease. Saliva and serum were collected simultaneously at the time of endoscopy. Salivary EIA had a sensitivity of 66%, specificity of 67%, positive predictive value of 67% and negative predictive value of 66% compared with the serum EIA, where the results were 98%, 48%, 64% and 96%, respectively. Although the salivary EIA is an appealing noninvasive test, it was not a sensitive and specific assay. The serum EIA also lacked specificity, but was highly sensitive with a good negative predictive value. Although a negative serum EIA rules out H pylori infection, a positive result must be interpreted in the clinical context and confirmed with a more specific measure.

  8. Changes in default mode network as automaticity develops in a categorization task.

    Science.gov (United States)

    Shamloo, Farzin; Helie, Sebastien

    2016-10-15

    The default mode network (DMN) is a set of brain regions in which blood oxygen level dependent signal is suppressed during attentional focus on the external environment. Because automatic task processing requires less attention, development of automaticity in a rule-based categorization task may result in less deactivation and altered functional connectivity of the DMN when compared to the initial learning stage. We tested this hypothesis by re-analyzing functional magnetic resonance imaging data of participants trained in rule-based categorization for over 10,000 trials (Helie et al., 2010) [12,13]. The results show that some DMN regions are deactivated in initial training but not after automaticity has developed. There is also a significant decrease in DMN deactivation after extensive practice. Seed-based functional connectivity analyses with the precuneus, medial prefrontal cortex (two important DMN regions) and Brodmann area 6 (an important region in automatic categorization) were also performed. The results show increased functional connectivity with both DMN and non-DMN regions after the development of automaticity, and a decrease in functional connectivity between the medial prefrontal cortex and ventromedial orbitofrontal cortex. Together, these results further support the hypothesis of a strategy shift in automatic categorization and bridge the cognitive and neuroscientific conceptions of automaticity in showing that the reduced need for cognitive resources in automatic processing is accompanied by a disinhibition of the DMN and stronger functional connectivity between DMN and task-related brain regions. Copyright © 2016 Elsevier B.V. All rights reserved.

  9. StructUre and test results of the Tokamak-7 device cryogenic system

    International Nuclear Information System (INIS)

    Babaev, I.V.; VolobUev, A.N.; Zhul'kin, V.F.

    1982-01-01

    A cryogenic system (CS) of the Tokamak-7 (T-7) installation with the longitudinal field superconducting magnetic system (SMS) is described. The CS is designed for cool-down, cryostatic cooling and heating of the T-7 cryogenic objects and consists of a helium system (HS) and a nitrogen cryogenic system (NCS). The HS consists of:a a heliUm delivery system intended for distributing and controlling the helium flows in the SMS; cryogenic helium units; a 1.25 m 3 volume for storing liquid helium; a compressor compartment using piston compressors at the 3 MPa operating pressure and 140 g/s total capacity; gaseous helium storages (3600 m 3 under normal conditions); helium cleaning and drying systems; a gas holder of 20 m 3 operating volume; cryogenic pipelines and pipe fittings. The NCS operates on delivered nitrogen and includes a 120 m 3 liquid nitrogen storage, evaporators and electric heaters producing up to 230 g/s of gaseous nitrogen at 300 K, a separator, cryogenic pipelines and fittings. It is found that the CS has the necessary cold production reserve, ensures reliable operation of the Tokamak-7 device and permits to carry out practically continuous plasma experiments

  10. The New Evolution for SIA Rotorcraft UAV Project

    Directory of Open Access Journals (Sweden)

    Juntong Qi

    2010-01-01

    Full Text Available This paper describes recent research on the design, implement, and testing of a new small-scaled rotorcraft Unmanned Aerial Vehicle (RUAV system—ServoHeli-40. A turbine-powered UAV weighted less than 15 kg was designed, and its major components were tested at the Shenyang Institute of Automation, Chinese Academy of Sciences in Shenyang, China. The aircraft was designed to reach a top speed of more than 20 mps, flying a distance of more than 10 kilometers, and it is going to be used as a test-bed for experimentally evaluating advanced control methodologies dedicated on improving the maneuverability, reliability, as well as autonomy of RUAV. Sensors and controller are all onboard. The full system has been tested successfully in the autonomous mode using the multichannel active modeling controller. The results show that in a real windy environment the rotorcraft UAV can follow the trajectory which was assigned by the ground control station exactly, and the new control method is obviously more effective than the one in the past year's research.

  11. Paragangliomas of the head and neck: clinical, morphological and immunohistochemical aspects

    Directory of Open Access Journals (Sweden)

    Pedro de Alcântara de Andrade Filho

    2001-05-01

    Full Text Available CONTEXT: Protein marker positivity can assist in the definition of the therapeutic approach towards head and neck paragangliomas. The establishment of the therapeutic approach should incorporate the results of such an investigation. OBJECTIVE: To establish criteria for benignancy and malignancy of vagal and jugular-tympanic paragangliomas, via the study of the relationships of sex, age, tumor size, duration of complaints, site, family history, presence of metastases, treatment, histological architecture and cell type with the immunohistochemical reactions to S100 protein, chromogranin and AgKi67. DESIGN: A retrospective study of histological and clinical records. SETTING: The Heliópolis and Oswaldo Cruz tertiary general hospitals, São Paulo. SAMPLE: 8 cases of head and neck paragangliomas. MAIN MEASUREMENTS: Determination of degree of positivity to paragangliomas via immunohistochemical reactions. RESULTS: 1. The protein markers for the principal cells (AgKi67 and chromogranin were sensitive in 100% of the tumors when used together. 2. S100 protein was well identified in the cytoplasm and nucleus of sustentacular cells and underwent reduction in the neoplasias. CONCLUSIONS: Chromogranin was proven to be a generic marker for neuroendocrine tumors; S100 protein was positive in all 8 cases and the AgKi67 had low positivity in all cases.

  12. Estimativa da distribuição da energia solar no Estado de São Paulo An estimative on the distribution of solar energy in the State of São Paulo

    Directory of Open Access Journals (Sweden)

    Admar Cervellini

    1966-01-01

    Full Text Available Os autores analisam a distribuição da energia solar no Estado de São Paulo, área limitada pelas latitudes de 20°S a 25°S. É apresentada uma equação média para determinação da radiação na superfície, partindo de dados de insolação para as condições da referida área. Utilizou-se o método clássico da correlação entre dados de actinógrafo e heliógrafo.The authors analyse the distribution of solar energy in the State of São Paulo, an area which is limited within 20° and 25° south. An average equation is presented for the determination of radiation on the surface, starting from insolation data for the conditions of the mentioned area. For this purpose the classic method was utilized of correlation between data from actinograph and heliograph.

  13. Conceptual study on advanced PWR system

    International Nuclear Information System (INIS)

    Bae, Yoon Young; Chang, M. H.; Yu, K. J.; Lee, D. J.; Cho, B. H.; Kim, H. Y.; Yoon, J. H.; Lee, Y. J.; Kim, J. P.; Park, C. T.; Seo, J. K.; Kang, H. S.; Kim, J. I.; Kim, Y. W.; Kim, Y. H.

    1997-07-01

    In this study, the adoptable essential technologies and reference design concept of the advanced reactor were developed and related basic experiments were performed. 1) Once-through Helical Steam Generator: a performance analysis computer code for heli-coiled steam generator was developed for thermal sizing of steam generator and determination of thermal-hydraulic parameters. 2) Self-pressurizing pressurizer : a performance analysis computer code for cold pressurizer was developed. 3) Control rod drive mechanism for fine control : type and function were surveyed. 4) CHF in passive PWR condition : development of the prediction model bundle CHF by introducing the correction factor from the data base. 5) Passive cooling concepts for concrete containment systems: development of the PCCS heat transfer coefficient. 6) Steam injector concepts: analysis and experiment were conducted. 7) Fluidic diode concepts : analysis and experiment were conducted. 8) Wet thermal insulator : tests for thin steel layers and assessment of materials. 9) Passive residual heat removal system : a performance analysis computer code for PRHRS was developed and the conformance to EPRI requirement was checked. (author). 18 refs., 55 tabs., 137 figs

  14. Report on the results of the FY 1998 hydrogen utilization international clean energy system technology (WE-NET). Subtask 7. Survey/study on hydrogen utilization technology; 1998 nendo suiso riyo kokusai clean energy system (WE-NET). 7. Suiso riyo gijutsu ni kansuru chosa kento

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-03-01

    The paper described the results of survey/study of the FY 1998 WE-NET project. In Subtask 7, survey/study have been made on the main hydrogen utilization technologies except the hydrogen combustion gas turbine since FY 1993. Based on the survey results having been obtained, study was made on conditions for introducing promising technology, future prospects, etc. in FY 1998. As to the power generation, the basic combustion test and test on hydrogen injection equipment as element test, and test on ignition equipment were carried out using rapid compression/expansion equipment. A scenario for introducing hydrogen vehicle was made, and at the same time environmental LCA was conducted by which environmental influences can be assessed. The survey of the market of pure hydrogen polymer electrolyte fuel cells were made in terms of the electric utility use, industrial use, residential/commercial use, and movement/vehicle use. Study was conducted on the combined process of oxygen production equipment and He Brayton cycle in the subzero fractionation/low-temperature VSA method. Various methods including performance, price, etc. were surveyed/studied, making it a precondition that hydrogen supply stations are installed in stand-alone distribution near places of consumption. (NEDO)

  15. Inside Out: Organizations as Service Systems Equipped with Relational Boundaries

    Directory of Open Access Journals (Sweden)

    María Jimena Crespo Garrido

    2017-04-01

    Full Text Available Currently, literature on organizational boundaries is at the center of a heated debate, characterized by a shift from a transactional approach to a broader immaterial perspective centered on the concept of boundless organizations. However, the overestimation of the effects of contemporary dematerialization on business processes can lead to the progressive neglect of the existence of corporate borders. In light of this consideration, the present work aims at proposing a new type of criterion for defining organizational boundaries, halfway between the conception of the firm’s total openness and total closure. To this end, the authors envisage the use of a new interpretive logic defined as “relational”, resulting from the specification of the systemic view (and as the sum of the logic underlying the viable systems approach (VSA. This approach views the definition of boundaries. Therefore, in the large and intricate scenery of the studies dedicated to organizational boundaries, this work contributes to a better understanding of border selection as an interactive and changeable process capable of pushing organizations towards a greater awareness of their strategic dimension. This paper also offers some insights for future research, suggesting that both scholars and professionals investigate, firstly, new frontiers for the identification of organizational boundaries and, secondly, the possible positive repercussions that new organizational redesign modes could determine for a greater competitive success.

  16. Improving risk estimates of runoff producing areas: formulating variable source areas as a bivariate process.

    Science.gov (United States)

    Cheng, Xiaoya; Shaw, Stephen B; Marjerison, Rebecca D; Yearick, Christopher D; DeGloria, Stephen D; Walter, M Todd

    2014-05-01

    Predicting runoff producing areas and their corresponding risks of generating storm runoff is important for developing watershed management strategies to mitigate non-point source pollution. However, few methods for making these predictions have been proposed, especially operational approaches that would be useful in areas where variable source area (VSA) hydrology dominates storm runoff. The objective of this study is to develop a simple approach to estimate spatially-distributed risks of runoff production. By considering the development of overland flow as a bivariate process, we incorporated both rainfall and antecedent soil moisture conditions into a method for predicting VSAs based on the Natural Resource Conservation Service-Curve Number equation. We used base-flow immediately preceding storm events as an index of antecedent soil wetness status. Using nine sub-basins of the Upper Susquehanna River Basin, we demonstrated that our estimated runoff volumes and extent of VSAs agreed with observations. We further demonstrated a method for mapping these areas in a Geographic Information System using a Soil Topographic Index. The proposed methodology provides a new tool for watershed planners for quantifying runoff risks across watersheds, which can be used to target water quality protection strategies. Copyright © 2014 Elsevier Ltd. All rights reserved.

  17. Impacts of dark matter particle annihilation on recombination and the anisotropies of the cosmic microwave background

    International Nuclear Information System (INIS)

    Zhang Le; Chen Xuelei; Lei Yian; Si Zongguo

    2006-01-01

    The recombination history of the Universe provides a useful tool for constraining the annihilation of dark matter particles. Even a small fraction of dark matter particles annihilated during the cosmic dark age can provide sufficient energy to affect the ionization state of the baryonic gas. Although this effect is too small for neutralinos, lighter dark matter particle candidates, e.g. with mass of 1-100 MeV, which was proposed recently to explain the observed excess of positrons in the galactic center, may generate observable differences in the cosmic microwave background (CMB) temperature and polarization anisotropies. The annihilations at the era of recombination affects mainly the CMB anisotropy at small angular scales (large l), and is distinctively different from the effect of early reionization. We perform a multiparameter analysis of the CMB data, including both the Wilkinson Microwave Anisotropy Probe (WMAP) first year and three year data, and the ACBAR, Boomerang, CBI, and VSA data. Assuming that the observed excess of e + e - pairs in the galactic center region is produced by dark matter annihilation, and that a sizable fraction of the energy produced in the annihilation is deposited in the baryonic gas during recombination, we obtain a 95% dark matter mass limit of M<8 MeV with the current data set

  18. Constraints on models with a break in the primordial power spectrum

    Energy Technology Data Exchange (ETDEWEB)

    Li Hong, E-mail: hongli@mail.ihep.ac.c [Institute of High Energy Physics, Chinese Academy of Science, P.O. Box 918-4, Beijing 100049 (China); Theoretical Physics Center for Science Facilities (TPCSF), Chinese Academy of Science (China); Kavli Institute for Theoretical Physics, Chinese Academy of Science, Beijing 100190 (China); Xia Junqing [Scuola Internazionale Superiore di Studi Avanzati, Via Bonomea 265, I-34136 Trieste (Italy); Brandenberger, Robert [Department of Physics, McGill University, 3600 University Street, Montreal, QC, H3A 2T8 (Canada); Institute of High Energy Physics, Chinese Academy of Science, P.O. Box 918-4, Beijing 100049 (China); Theoretical Physics Center for Science Facilities (TPCSF), Chinese Academy of Science (China); Kavli Institute for Theoretical Physics, Chinese Academy of Science, Beijing 100190 (China); Zhang Xinmin [Institute of High Energy Physics, Chinese Academy of Science, P.O. Box 918-4, Beijing 100049 (China); Theoretical Physics Center for Science Facilities (TPCSF), Chinese Academy of Science (China)

    2010-07-05

    One of the characteristics of the 'Matter Bounce' scenario, an alternative to cosmological inflation for producing a scale-invariant spectrum of primordial adiabatic fluctuations on large scales, is a break in the power spectrum at a characteristic scale, below which the spectral index changes from n{sub s}=1 to n{sub s}=3. We study the constraints which current cosmological data place on the location of such a break, and more generally on the position of the break and the slope at length scales smaller than the break. The observational data we use include the WMAP five-year data set (WMAP5), other CMB data from BOOMERanG, CBI, VSA, and ACBAR, large-scale structure data from the Sloan Digital Sky Survey (SDSS, their luminous red galaxies sample), Type Ia Supernovae data (the 'Union' compilation), and the Sloan Digital Sky Survey Lyman-{alpha} forest power spectrum (Ly{alpha}) data. We employ the Markov Chain Monte Carlo method to constrain the features in the primordial power spectrum which are motivated by the matter bounce model. We give an upper limit on the length scale where the break in the spectrum occurs.

  19. Constraints on models with a break in the primordial power spectrum

    International Nuclear Information System (INIS)

    Li Hong; Xia Junqing; Brandenberger, Robert; Zhang Xinmin

    2010-01-01

    One of the characteristics of the 'Matter Bounce' scenario, an alternative to cosmological inflation for producing a scale-invariant spectrum of primordial adiabatic fluctuations on large scales, is a break in the power spectrum at a characteristic scale, below which the spectral index changes from n s =1 to n s =3. We study the constraints which current cosmological data place on the location of such a break, and more generally on the position of the break and the slope at length scales smaller than the break. The observational data we use include the WMAP five-year data set (WMAP5), other CMB data from BOOMERanG, CBI, VSA, and ACBAR, large-scale structure data from the Sloan Digital Sky Survey (SDSS, their luminous red galaxies sample), Type Ia Supernovae data (the 'Union' compilation), and the Sloan Digital Sky Survey Lyman-α forest power spectrum (Lyα) data. We employ the Markov Chain Monte Carlo method to constrain the features in the primordial power spectrum which are motivated by the matter bounce model. We give an upper limit on the length scale where the break in the spectrum occurs.

  20. Constraining slow-roll inflation in the presence of dynamical dark energy

    International Nuclear Information System (INIS)

    Xia Junqing; Zhang Xinmin

    2008-01-01

    In this Letter we perform a global analysis of the constraints on the inflationary parameters in the presence of dynamical dark energy models from the current observations, including the three-year Wilkinson Microwave Anisotropy Probe (WMAP3) data, Boomerang-2K2, CBI, VSA, ACBAR, SDSS LRG, 2dFGRS and ESSENCE (192 sample). We use the analytic description of the inflationary power spectra in terms of the horizon-flow parameters {ε i }. With the first order approximation in the slow-roll expansion, we find that the constraints on the horizon-flow parameters are ε 1 2 =0.034±0.024 (1σ) in the ΛCDM model. In the framework of dynamical dark energy models, the constraints become obviously weak, ε 1 2 =-0.006±0.039 (1σ), and the inflation models with a 'blue' tilt, which are excluded about 2σ in the ΛCDM model, are allowed now. With the second order approximation, the constraints on the horizon-flow parameters are significantly relaxed further. If considering the non-zero ε 3 , the large running of the scalar spectral index is found for the ΛCDM model, as well as the dynamical dark energy models

  1. Late radiation effects of low doses from occupational exposure. Antibodies to cytomegalovirus, Epstein-Barr virus and human T cell lymphotropic virus type 1 in radiological technologists

    Energy Technology Data Exchange (ETDEWEB)

    Kumagai, Etsuko; Tanoue, Shozo (Kumamoto Univ. (Japan). Coll. of Medical Science); Sawada, Shozo

    1989-05-01

    To elucidate the effects of long-term exposure to low dose irradiation, serostatus of antibodies to cytomegalovirus (CMV), Epstein-Barr virus (EBV) and human T cell lymphotropic virus type 1 (HTLV-1) was determined in 99 radiological technologists and 96 healthy volunteers. Abnormal seropositivity rate for CMV was significantly higher in technologists working for 15 years or more than in those working for less than 15 years. For the same age group, however, there was no significant difference between technologists and controls. Seropositivity rates for EBV-viral capsid antigen (VSA)/IgG and early antigen (EA)/IgG were significantly higher in technologists working for 15 years or more than in the age-matched control group. In the group of technologists exposed to 0.3 Sv or more, seropositivity rates of these antibodies were significantly higher than in those exposed to less than 0.3 Sv. However, there was no correlation between exposure doses and both EBV-associated nuclear antigen antibody and HTLV-1 antibody. Few technologists seronegative for CMV antibody had seropositive antibodies of EBV-VCA/IgG and EA/IgG. For technologists seropositive for CMV antibody, 31% and 54% were seropositive for EBV-VCA/IgG and EA/IgG antibodies, respectively. (Namekawa, K).

  2. The role of reward in word learning and its implications for language acquisition.

    Science.gov (United States)

    Ripollés, Pablo; Marco-Pallarés, Josep; Hielscher, Ulrike; Mestres-Missé, Anna; Tempelmann, Claus; Heinze, Hans-Jochen; Rodríguez-Fornells, Antoni; Noesselt, Toemme

    2014-11-03

    The exact neural processes behind humans' drive to acquire a new language--first as infants and later as second-language learners--are yet to be established. Recent theoretical models have proposed that during human evolution, emerging language-learning mechanisms might have been glued to phylogenetically older subcortical reward systems, reinforcing human motivation to learn a new language. Supporting this hypothesis, our results showed that adult participants exhibited robust fMRI activation in the ventral striatum (VS)--a core region of reward processing--when successfully learning the meaning of new words. This activation was similar to the VS recruitment elicited using an independent reward task. Moreover, the VS showed enhanced functional and structural connectivity with neocortical language areas during successful word learning. Together, our results provide evidence for the neural substrate of reward and motivation during word learning. We suggest that this strong functional and anatomical coupling between neocortical language regions and the subcortical reward system provided a crucial advantage in humans that eventually enabled our lineage to successfully acquire linguistic skills. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. Augmenting distractor filtering via transcranial magnetic stimulation of the lateral occipital cortex.

    Science.gov (United States)

    Eštočinová, Jana; Lo Gerfo, Emanuele; Della Libera, Chiara; Chelazzi, Leonardo; Santandrea, Elisa

    2016-11-01

    Visual selective attention (VSA) optimizes perception and behavioral control by enabling efficient selection of relevant information and filtering of distractors. While focusing resources on task-relevant information helps counteract distraction, dedicated filtering mechanisms have recently been demonstrated, allowing neural systems to implement suitable policies for the suppression of potential interference. Limited evidence is presently available concerning the neural underpinnings of these mechanisms, and whether neural circuitry within the visual cortex might play a causal role in their instantiation, a possibility that we directly tested here. In two related experiments, transcranial magnetic stimulation (TMS) was applied over the lateral occipital cortex of healthy humans at different times during the execution of a behavioral task which entailed varying levels of distractor interference and need for attentional engagement. While earlier TMS boosted target selection, stimulation within a restricted time epoch close to (and in the course of) stimulus presentation engendered selective enhancement of distractor suppression, by affecting the ongoing, reactive instantiation of attentional filtering mechanisms required by specific task conditions. The results attest to a causal role of mid-tier ventral visual areas in distractor filtering and offer insights into the mechanisms through which TMS may have affected ongoing neural activity in the stimulated tissue. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Sustainability and the Viable Systems Approach: Opportunities and Issues for the Governance of the Territory

    Directory of Open Access Journals (Sweden)

    Sergio Barile

    2018-03-01

    Full Text Available The aim of this paper is to propose an approach for representing the territory as a dynamic system of intersubjective relationships that is able to guarantee not only the efficiency of the processes within organizations, but also effective results in the general context and a sustainable impact on the broader environment. This contribution is developed on the basis of the viable systems approach (vSa, which is intended as a theoretical framework for the analysis of social phenomena as well as for orienting government processes. Using this theoretical framework, the proposed approach leads to the representation of the territory as a viable system that is capable of surviving in its own context by creating value for the other entities of the context (public groups of governments, communities, investors, natural environment, future generations, non-human species, thus defining the essential conditions for a sustainable equilibrium. The consideration that social phenomena have to be analyzed by taking into account the different relations and interactions that orient the behavior of individuals and, as a consequence, their main collective manifestations, i.e., organizations, underlines the importance of shifting from a traditional reductionist approach to a systemic approach. In what follows, taking a cue from the definition of sustainability that implies a wider sharing, we provide some initial critical positions, and finally shape the useful elements that can be preparatory to the introduction of a working hypothesis that is capable of delineating a possible itinerary for the development of the territory.

  5. Evaluation of lung epithelial permeability in the volatile substance abuse using Tc-99m DTPA aerosol scintigraphy

    International Nuclear Information System (INIS)

    Cayir, D.; Demirel, K.; Korkmaz, M.; Koca, G.

    2011-01-01

    Chronic inhalant use is associated with significant toxic effects, including neurological, renal, hepatic, and pulmonary damage. However, there is a paucity of reports regarding respiratory complications in inhalant abusers. The aim of this study was to evaluate pulmonary epithelial permeability in the volatile substance abuse (VSA) using technetium-99m-labeled diethylenetriamine pentaacetic acid (Tc-99m DTPA) aerosol scintigraphy. This study included 18 patients with volatile substance abuse and 18 volunteer controls. All of patients and controls were smokers. Tc-99m DTPA aerosol scintigraphy was performed in all cases. Time-activity curves from each lung were generated and clearance half-time (T 1/2 ) of Tc-99m DTPA were calculated. T 1/2 of whole lung was calculated as a mean of the T 1/2 of left and right lung. The T 1/2 values of Tc-99m DTPA clearance in the substance abusers were significantly decreased as compared to the control group with respective mean values of 28.86±8.44, and 62.14±26.12 min (p=0.001). It was seen Tc-99m DTPA clearance from lung was faster as the duration of substance abuse was increased. Tc-99m DTPA pulmonary clearance is markedly accelerated in the volatile substance abuse. This suggests that inhalant abuse of substance may produce abnormalities in pulmonary alveolo-capillary membrane function. (author)

  6. Evaluation of lung epithelial permeability in the volatile substance abuse using Tc-99m DTPA aerosol scintigraphy.

    Science.gov (United States)

    Cayir, Derya; Demirel, Koray; Korkmaz, Meliha; Koca, Gokhan

    2011-10-01

    Chronic inhalant use is associated with significant toxic effects, including neurological, renal, hepatic, and pulmonary damage. However, there is a paucity of reports regarding respiratory complications in inhalant abusers. The aim of this study was to evaluate pulmonary epithelial permeability in the volatile substance abuse (VSA) using Tc-99m DTPA aerosol scintigraphy. This study included 18 patients with volatile substance abuse and 18 volunteer controls. All of patients and controls were smokers. Tc-99m DTPA aerosol scintigraphy was performed in all cases. Time-activity curves from each lung were generated and clearance half-time (T(1/2)) of Tc-99m DTPA were calculated. T(1/2) of whole lung was calculated as a mean of the T(1/2) of left and right lung. The T(1/2) values of Tc-99m DTPA clearance in the substance abusers were significantly decreased as compared to the control group with respective mean values of 28.86 ± 8.44, and 62.14 ± 26.12 min (p = 0.001). It was seen Tc-99m DTPA clearance from lung was faster as the duration of substance abuse was increased. Tc-99m DTPA pulmonary clearance is markedly accelerated in the volatile substance abuse. This suggests that inhalant abuse of substance may produce abnormalities in pulmonary alveolo-capillary membrane function.

  7. Summer Student Report 2014: Schottky component qualification and RF filter characterization

    CERN Document Server

    Egidos Plaja, Nuria

    2014-01-01

    This Summer Student project has been developed in BE-BI-QP department under the supervision of Manfred Wendt. Main goals of the task to be performed are the following: 1)\tFilter characterization: the student will get familiar with the Vector Network Analizer (VNA), S-parameter measurement and PSPICE modelling of low-pass filters. 2)\tFilter response matching: an algorithm to compare and classify filter responses into best-matching pairs will be developed. 3)\tSchottky monitor filter qualification: S-parameter and time domain measurements will be carried out with filters related to Schottky monitor and results will be benchmarked. 4)\tSchottky monitor amplifier measurement: noise figure and gain at a given frequency will be measured for a set of Low Noise Amplifiers related to Schottky monitor. -1dB compression point and 3rd order interception point will be measured too for education purposes. For the development of this project, the student will get familiar with RF measure devices (VNA, VSA), theoretical concep...

  8. Switchable CO2 electroreduction via engineering active phases of Pd nanoparticles

    Institute of Scientific and Technical Information of China (English)

    Dunfeng Gao; Fan Yang; Shu Miao; Jianguo Wang; Guoxiong Wang; Xinhe Bao; Hu Zhou; Fan Cai; Dongniu Wang; Yongfeng Hu; Bei Jiang; Wen-Bin Cai; Xiaoqi Chen; Rui Si

    2017-01-01

    Active-phase engineering is regularly utilized to tune the selectivity of metal nanoparticles (NPs) in heterogeneous catalysis.However,the lack of understanding of the active phase in electrocatalysis has hampered the development of efficient catalysts for CO2 electroreduction.Herein,we report the systematic engineering of active phases of Pd NPs,which are exploited to select reaction pathways for CO2 electroreduction.In situ X-ray absorption spectroscopy,in situ attenuated total reflection-infrared spectroscopy,and density functional theory calculations suggest that the formation of a hydrogen-adsorbed Pd surface on a mixture of the α-and β-phases of a palladium-hydride core (α+β PdHx@PdHx) above-0.2 V (vs.a reversible hydrogen electrode) facilitates formate production via the HCOO* intermediate,whereas the formation of a metallic Pd surface on the β-phase Pd hydride core (β PdHx@Pd) below-0.5 V promotes CO production via the COOH* intermediate.The main product,which is either formate or CO,can be selectively produced with high Faradaic efficiencies (>90%) and mass activities in the potential window of 0.05 to-0.9 V with scalable application demonstration.

  9. Venezuela opens up to explorers

    International Nuclear Information System (INIS)

    Kielmas, M.

    1995-01-01

    The opening of Venezuela's first exploration bidding round since oil nationalisation in 1976 was a turning-point in the country's energy policy. The state oil company, Petroleos de Venezuela (PdVSA), has said that the bidding round could generate investment of some $11 billion eventually in development investment and that over the next 10 years, nearly 20 percent of a planned $55 billion, 10-year state oil company investment programme could also come from foreign or private sector oil investment. Should this optimistic prediction materialise, Venezuela, whose 2.75 million b/d oil production in October was some 400,000 b/d over its Opec quota, will remain both the dominant oil producer in Latin America and the top-ranking oil exporter to the US market. In May this year, Venezuelan oil exports topped 1.43 million b/d, or some 16.8 percent of the US market, compared with Saudi Arabia's 15.7 percent. (author)

  10. Fission, fusion and annihilation in the interaction of localized structures for the (2 + 1)-dimensional generalized Broer-Kaup system

    International Nuclear Information System (INIS)

    Yomba, Emmanuel; Peng, Yan-ze

    2006-01-01

    Based on the WTC truncation method and the general variable separation approach (GVSA), we have first found a general solution including three arbitrary functions for the (2 + 1)-dimensional simplified generalized Broer-Kaup (GBK) system (B = 0). A class of double periodic wave solutions is obtained by selecting these arbitrary functions appropriately. The interaction properties of the periodic waves are numerically studied and found to be non-elastic. Limit cases are considered and some new localized coherent structures are obtained, the interaction properties of these solutions reveal that some of them are completely elastic and some are non-completely elastic. After that, starting from the (2 + 1)-dimensional GBK system (B ≠ 0) and using the variable separation approach (VSA) including two arbitrary functions in the general solution, we have constructed by selecting the two arbitrary functions appropriately a rich variety of new coherent structures. The interaction properties of these structures reveal new physical properties like fusion, fission, or both and present mutual annihilation of these solutions as time increasing. The annihilation in this model has found to be rule by the parameter K 1 , when this parameter is taken to be zero, the annihilation disappears in this model and the above mentioned structures recover the solitonic structure properties

  11. Rational Design of QCM-D Virtual Sensor Arrays Based on Film Thickness, Viscoelasticity, and Harmonics for Vapor Discrimination.

    Science.gov (United States)

    Speller, Nicholas C; Siraj, Noureen; Regmi, Bishnu P; Marzoughi, Hassan; Neal, Courtney; Warner, Isiah M

    2015-01-01

    Herein, we demonstrate an alternative strategy for creating QCM-based sensor arrays by use of a single sensor to provide multiple responses per analyte. The sensor, which simulates a virtual sensor array (VSA), was developed by depositing a thin film of ionic liquid, either 1-octyl-3-methylimidazolium bromide ([OMIm][Br]) or 1-octyl-3-methylimidazolium thiocyanate ([OMIm][SCN]), onto the surface of a QCM-D transducer. The sensor was exposed to 18 different organic vapors (alcohols, hydrocarbons, chlorohydrocarbons, nitriles) belonging to the same or different homologous series. The resulting frequency shifts (Δf) were measured at multiple harmonics and evaluated using principal component analysis (PCA) and discriminant analysis (DA) which revealed that analytes can be classified with extremely high accuracy. In almost all cases, the accuracy for identification of a member of the same class, that is, intraclass discrimination, was 100% as determined by use of quadratic discriminant analysis (QDA). Impressively, some VSAs allowed classification of all 18 analytes tested with nearly 100% accuracy. Such results underscore the importance of utilizing lesser exploited properties that influence signal transduction. Overall, these results demonstrate excellent potential of the virtual sensor array strategy for detection and discrimination of vapor phase analytes utilizing the QCM. To the best of our knowledge, this is the first report on QCM VSAs, as well as an experimental sensor array, that is based primarily on viscoelasticity, film thickness, and harmonics.

  12. Sociokulturna animacija v bolnišnici in pravica do kulture

    Directory of Open Access Journals (Sweden)

    Dušana Findeisen

    2015-01-01

    Full Text Available Sociokulturna animacija ima v francoskih bolnišnicah dolgo tradicijo, ki se je najverjetneje začela v letih od 1800 do 1810 z Markizom de Sadom, ko je bil ta hospitaliziran v eni od pariških bolnišnic in je skupaj z bolniki pripravil gledališko predstavo, te pa se je udeležila domala vsa pariška družbena smetana. V letu 1999 so podpisali konvencijo »Kultura in zdravje« in kultura se je začela seliti v bolnišnice. Te so se začele spreminjati v ustanove, odprte v kraj, kjer delujejo, po drugi strani pa so bolniki in osebje tako pridobili drugačen pogled na telo in kulturo. Slovenska univerza za tretje življenjsko obdobje že dalj časa izobražuje bolnišnične kulturne mediatorje (svoje študente, ki znanje in kulturo, ki ju pridobivajo s študijem na univerzi, posredujejo bolnikom, sorodnikom bolnikov in osebju, vse v okviru Univerzitetnega kliničnega centra Ljubljana. V članku oblikujemo okvir za razmišljanje o pomenu in implikacijah temeljne pravice do kulture.

  13. Elizandra Souza: escrita periférica em diálogo transatlântico

    Directory of Open Access Journals (Sweden)

    Sílvia Regina Lorenso Castro

    2016-01-01

    Full Text Available En este artículo, se discuten las conexiones entre la vida y la obra de Elizandra de Souza, escritora asociada con la producción literaria de la periferia de São Paulo, en el contexto de las discusiones teóricas sobre la diáspora africana, el pensamiento feminista negro y el pensamiento decolonial latinoamericano. Argumento que Elizandra toma como punto de partida una formación identitataria espiralada/sampleada que atraviesa y expande las páginas del libro en su materialidad impresa con la intención de construir un puente entre la música (hip hop, la literatura (Punga e Águas da cabaça y la tecnología (la Radio Comunitaria de Heliópolis. De este modo, Elizandra establece una presencia política que borronea e impugna la percepción que la sociedad tiene respecto a los habitantes de la periferia como sujetos definidos por la falta. Sostengo además que no es posible entender la obra de Elizandra o la actual periferia brasileña si no se toman en cuenta una multiplicidad de elementos, tales como: los mecanismos alternativos de comunicación comunitaria, la cultura hip hop y los saraus. Mi argumento final es que su libro Águas da cabaça desafía una centralidad masculina que se ha tornado predominante en las narrativas sobre la periferia, mientras que señala una alianza transatlántica con otras escritoras de la diáspora africana.

  14. Efecto de la tala de Podocarpus glomeratus (Podocarpaceae sobre la estructura de un bosque de neblina en los Andes (Cochabamba, Bolivia

    Directory of Open Access Journals (Sweden)

    Ariel Isaías Ayma-Romay

    2011-07-01

    Full Text Available En el presente trabajo fueron analizados los efectos de la tala sobre la estructura, composición y la regeneración natural de un bosque andino de neblina. Se instalaron 40 parcelas de 707 m2 para medir individuos >10 cm DAP y sub-parcelas de 5 m2 para evaluar la regeneración de individuos <10 cm DAP y de 1 m2 para evaluar el banco de semillas. Se evaluó la densidad y cobertura de todos los árboles. Se realizó un análisis cluster para establecer las categorías de cobertura de dosel y un análisis de componentes principales para determinar su asociación con la densidad de diferentes especies de plántulas. La tala ha modificado la cobertura (p= <0,001 generando doseles de poco a fuertemente intervenidos. Los claros de dosel favorecen a las heliófitas (Myrsine pseudocrenata, Vallea stipularis, Nectandra sp., Trichilia hirta, Miconia theaezans, algunas esciófitas que requieren luz en clases avanzadas (Podocarpus glomeratus y Myrcianthes osteomeloides y otros arbustos (Solanaceae, Verbenaceae y otras. Por otra parte, algunas esciófitas reducen su densidad en doseles inter- venidos (Weinmannia microphylla, Condalia weberbaueri, Blepharocalix salicifolius y Styloceras columnare. El manejo del bosque debe mantener la cobertura de individuos > 60 cm DAP, la creación de reservas en bosques maduros y prácticas de facilitación para el crecimiento de especies de árboles claves.

  15. Properties and decay modes of hot nuclei produced in the reaction: {sup 36}Ar on {sup 58}Ni and detected with INDRA device; Proprietes et modes de desexcitation des noyaux chauds observes dans la reaction {sup 36}Ar sur {sup 58}Ni avec le detecteur INDRA

    Energy Technology Data Exchange (ETDEWEB)

    Nalpas, L [CEA Centre d` Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d` Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l` Instrumentation Associee; [Paris-11 Univ., 91 - Orsay (France)

    1997-01-01

    Hot nuclei are formed in heavy ion collisions covering the Fermi energy domain. According to the excitation energy deposited into these nuclei, several de-excitation processes can be observed, in particular the emission of complex fragments (Z {>=} 3) which remains poorly understood. The GANIL facility offers the possibility to cover the excitation function for the Ar on Ni reaction over a broad energy range from 32 to 95 MeV/u where the hot nuclei evolve from classical `evaporation` to complete `vaporization` into light particles (neutrons, isotopes of H, He). The study of reaction mechanisms shows that from peripheral to central collisions the total cross section is dominated by binary dissipative collisions. Both partners coming from well-characterized events with the INDRA detector are reconstructed using the `Minimum Spanning Tree` method. Thus excitation energy up to 20 MeV/A are reached in the most violent collisions at the highest bombarding energy. The deposited energy is not shared in the mass ratio between the quasi-projectile and the quasi-target, the quasi-projectile being hotter. For total excitation energies ranging roughly from 2 to 8 MeV/A, the proportion of `multifragmentation` events increases to reach a plateau at about 10 MeV/A due to the rising probability to have complete `vaporization` of the system above 8 MeV/A. The steady increase of the temperature extracted from the double isotopic He-Li ratios with excitation energy for the quasi-projectile suggests a progressive evolution of the de-excitation processes as predicted by statistical models. No signal of first order liquid-gas phase transition is seen in our data. (author) 124 refs.

  16. Properties and decay modes of hot nuclei produced in the reaction: 36Ar on 58Ni and detected with INDRA device

    International Nuclear Information System (INIS)

    Nalpas, L.

    1997-01-01

    Hot nuclei are formed in heavy ion collisions covering the Fermi energy domain. According to the excitation energy deposited into these nuclei, several de-excitation processes can be observed, in particular the emission of complex fragments (Z ≥ 3) which remains poorly understood. The GANIL facility offers the possibility to cover the excitation function for the Ar on Ni reaction over a broad energy range from 32 to 95 MeV/u where the hot nuclei evolve from classical 'evaporation' to complete 'vaporization' into light particles (neutrons, isotopes of H, He). The study of reaction mechanisms shows that from peripheral to central collisions the total cross section is dominated by binary dissipative collisions. Both partners coming from well-characterized events with the INDRA detector are reconstructed using the 'Minimum Spanning Tree' method. Thus excitation energy up to 20 MeV/A are reached in the most violent collisions at the highest bombarding energy. The deposited energy is not shared in the mass ratio between the quasi-projectile and the quasi-target, the quasi-projectile being hotter. For total excitation energies ranging roughly from 2 to 8 MeV/A, the proportion of 'multifragmentation' events increases to reach a plateau at about 10 MeV/A due to the rising probability to have complete 'vaporization' of the system above 8 MeV/A. The steady increase of the temperature extracted from the double isotopic He-Li ratios with excitation energy for the quasi-projectile suggests a progressive evolution of the de-excitation processes as predicted by statistical models. No signal of first order liquid-gas phase transition is seen in our data. (author)

  17. ITER task T48 (1994); low-inventory cryogenic distillation tests

    International Nuclear Information System (INIS)

    Woodall, K.; Robins, J.; Bellamy, D.

    1995-01-01

    Previous work at Ontario Hydro Technologies (OHT) had shown that small cryogenic columns could be stably controlled and designed to much lower inventories than had been previously thought possible. Among the results were measurements of Height-of-Equivalent-Theoretical-Plate (HETP) versus holdup for Heli-Pak A and B in columns up to 20 mm diameter. ITER cryogenic distillation column designs suggest that the final high-tritium columns could be 30-70 mm diameter. The objective of this ITER task was to design and construct a column section for demonstration of scale-up of low inventory cryogenic distillation. The experiments were to be carried out in an upgraded Cryogenics Distillation Laboratory at OHT, in the facility used for previous low-inventory column tests. The ITER scaled-up test system as the following characteristics: 55 W condenser capacity; 30 mm diameter column loaded with Helipak B; 1500 mm packed height. The first task was to design and build the scaled-up test facility. In order to reduce costs, it was necessary to use existing 30-35 W helium refrigerators. Therefore, to provide 60-W duty to the scaled-up column, the two refrigerators had to be well coupled thermally, but not mechanically, since the refrigerator cold heads have very thin shells. The solution was to attach the column firmly to one cold head and indirectly to an adjacent cold head through flexible copper braid. Several iterations were required to obtain the desired good heat transfer with flexible mechanical connection. This facility is now operational and ready to begin measurements on the 30 mm column. Also during 1994, the Princeton Tritium Processing System (TPS) was installed and commissioned. The results from this experience are relevant to the ITER distillation system. 2 refs., 10 figs

  18. Design windows and cost analysis on helical reactors

    International Nuclear Information System (INIS)

    Kozaki, Y.; Imagawa, S.; Sagara, A.

    2007-01-01

    The LHD type helical reactors are characterized by a large major radius but slender helical coil, which give us different approaches for power plants from tokamak reactors. For searching design windows of helical reactors and discussing their potential as power plants, we have developed a mass-cost estimating model linked with system design code (HeliCos), thorough studying the relationships between major plasma parameters and reactor parameters, and weight of major components. In regard to cost data we have much experience through preparing ITER construction. To compare the weight and cost of magnet systems between tokamak and helical reactors, we broke down magnet systems and cost factors, such as weights of super conducting strands, conduits, support structures, and winding unit costs, through estimating ITER cost data basis. Based on FFHR2m1 deign we considered a typical 3 GWth helical plant (LHD type) with the same magnet size, coil major radius Rc 14 m, magnetic energy 120 GJ, but increasing plasma densities. We evaluated the weight and cost of magnet systems of 3 GWth helical plant, the total magnet weights of 16,000ton and costs of 210 BYen, which are similar values of tokamak reactors (10,200 ton, 110 BYen in ITER 2002 report, and 21,900 ton, 275 BYen in ITER FDR1999). The costs of strands and winding occupy 70% of total magnet costs, and influence entire power plants economics. The design windows analysis and comparative economics studies to optimize the main reactor parameters have been carried out. Economics studies show that it is misunderstanding to consider helical coils are too large and too expensive to achieve power plants. But we should notice that the helical reactor design windows and economics are very sensitive to allowable blanket space (depend on ergodic layer conditions) and diverter configuration for decreasing heat loads. (orig.)

  19. ITER task T48 (1994); low-inventory cryogenic distillation tests

    Energy Technology Data Exchange (ETDEWEB)

    Woodall, K; Robins, J; Bellamy, D [Ontario Hydro, Toronto, ON (Canada). Research Div.; Sood, S; Fong, C [Ontario Hydro, Toronto, ON (Canada)

    1995-01-01

    Previous work at Ontario Hydro Technologies (OHT) had shown that small cryogenic columns could be stably controlled and designed to much lower inventories than had been previously thought possible. Among the results were measurements of Height-of-Equivalent-Theoretical-Plate (HETP) versus holdup for Heli-Pak A and B in columns up to 20 mm diameter. ITER cryogenic distillation column designs suggest that the final high-tritium columns could be 30-70 mm diameter. The objective of this ITER task was to design and construct a column section for demonstration of scale-up of low inventory cryogenic distillation. The experiments were to be carried out in an upgraded Cryogenics Distillation Laboratory at OHT, in the facility used for previous low-inventory column tests. The ITER scaled-up test system as the following characteristics: 55 W condenser capacity; 30 mm diameter column loaded with Helipak B; 1500 mm packed height. The first task was to design and build the scaled-up test facility. In order to reduce costs, it was necessary to use existing 30-35 W helium refrigerators. Therefore, to provide 60-W duty to the scaled-up column, the two refrigerators had to be well coupled thermally, but not mechanically, since the refrigerator cold heads have very thin shells. The solution was to attach the column firmly to one cold head and indirectly to an adjacent cold head through flexible copper braid. Several iterations were required to obtain the desired good heat transfer with flexible mechanical connection. This facility is now operational and ready to begin measurements on the 30 mm column. Also during 1994, the Princeton Tritium Processing System (TPS) was installed and commissioned. The results from this experience are relevant to the ITER distillation system. 2 refs., 10 figs.

  20. Short cognitive behavioral therapy and cognitive training for adults with ADHD – a randomized controlled pilot study

    Directory of Open Access Journals (Sweden)

    Maarit Virta

    2010-07-01

    Full Text Available Maarit Virta1,2, Anita Salakari1, Mervi Antila1, Esa Chydenius1, Markku Partinen1, Markus Kaski1, Risto Vataja3, Hely Kalska2, Matti Iivanainen11Rinnekoti Research Centre, Espoo, Finland; 2Department of Psychology, University of Helsinki, Finland; 3Kellokoski Hospital, Kellokoski, FinlandAbstract: In clinical practice, a growing need exists for effective non-pharmacological ­treatments of adult attention-deficit/hyperactivity disorder (ADHD. Here, we present the results of a pilot study of 10 adults with ADHD participating in short-term individual ­cognitive-behavioral therapy (CBT, 9 adults participating in cognitive training (CT, and 10 controls. Self-report ­questionnaires, independent evaluations, and computerized neurocognitive testing were ­collected before and after the treatments to evaluate change. There were distinctive pre-hypotheses regarding the treatments, and therefore the statistical comparisons were conducted in pairs: CBT vs control, CT vs control, and CBT vs CT. In a combined ADHD symptom score based on self-reports, 6 participants in CBT, 2 in CT and 2 controls improved. Using independent evaluations, improvement was found in 7 of the CBT participants, 2 of CT ­participants and 3 controls. There was no treatment-related improvement in cognitive performance. Thus, in the CBT group, some encouraging improvement was seen, although not as clearly as in ­previous research with longer interventions. In the CT group, there was improvement in the trained tasks but no generalization of the improvement to the tasks of the neurocognitive testing, the ­self-report questionnaires, or the independent evaluations. These preliminary results warrant further studies with more participants and with more elaborate cognitive testing.Keywords: CBT, attention-deficit/hyperactivity disorder, cognitive testing, non-­pharmacological treatments

  1. Environmental Public Health Surveillance for Exposure to Respiratory Health Hazards: A Joint NASA/CDC Project to Use Remote Sensing Data for Estimating Airborne Particulate Matter Over the Atlanta, Georgia Metropolitan Area

    Science.gov (United States)

    Quattrochi, Dale A.; Al-Hamdan, Mohammad; Estes, Maurice; Crosson, William

    2007-01-01

    As part of the National Environmental Public Health Tracking Network (EPHTN) the National Center for Environmental Health (NCEH) at the Centers for Disease Control and Prevention (CDC) is leading a project called Health and Environment Linked for Information Exchange (HELiX-Atlanta). The goal of developing the National Environmental Public Health Tracking Network is to improve the health of communities. Currently, few systems exist at the state or national level to concurrently track many of the exposures and health effects that might be associated with environmental hazards. An additional challenge is estimating exposure to environmental hazards such as particulate matter whose aerodynamic diameter is less than or equal to 2.5 micrometers (PM2.5). HELIX-Atlanta's goal is to examine the feasibility of building an integrated electronic health and environmental data network in five counties of Metropolitan Atlanta, GA. NASA Marshall Space Flight Center (NASA/MSFC) is collaborating with CDC to combine NASA earth science satellite observations related to air quality and environmental monitoring data to model surface estimates of PM2.5 concentrations that can be linked with clinic visits for asthma. While use of the Air Quality System (AQS) PM2.5 data alone could meet HELIX-Atlanta specifications, there are only five AQS sites in the Atlanta area, thus the spatial coverage is not ideal. We are using NASA Moderate Resolution Imaging Spectroradiometer (MODIS) satellite Aerosol Optical Depth (AOD) data for estimating daily ground level PM2.5 at 10 km resolution over the metropolitan Atlanta area supplementing the AQS ground observations and filling their spatial and temporal gaps.

  2. Sleep Quality and Academic Progression among Students of Tabriz University of Medical Sciences, Northwest of Iran

    Directory of Open Access Journals (Sweden)

    Horyeh Sarbazvatan

    2017-06-01

    Full Text Available Background: Sleep deprivation and drowsiness are very common among university students. The aim of this study was to examine the sleep quality and academic achievement among university students across all medical disciplines in Northwest of Iran. Methods: This study was based on data from a longitudinal study, the "Health and Lifestyle of University Students" (HeLiS. The Pittsburgh Sleep Quality Index (PSQI, a self-administered questionnaire consisting of general information about sleep quality, was completed by students during the first eight weeks of the first semester and academic achievement was assessed via Grade Point Average (GPA in the two semesters following the administration of the PSQI. Results: The mean age of students was 19.16±1.04 and the majority were female (64%. The mean overall score on the PSQI was 6.87±2.25; the majority of students (70% had a global PSQI score greater than 5, indicating they were poor sleepers. Only 28% reported getting over 7 hours of sleep. Female students had higher scores than male students in subjective sleep quality, which was statistically significant (2.15 vs. 1.95 respectively, P = 0.01; however, there was no difference between males and females on other component scores or on the global score. Results of a multiple regression model showed that PSQI score was a predictor of academic achievement (β=-.07, P=0.035, which implies that GPA will be lower among students whose quality of sleep is lower. Conclusion: Based on our sleep quality should be considered and assessed, and sleep hygiene should be promoted among medical university students in order to improve academic achievement.

  3. Arginine, N-carbamylglutamate, and glutamine exert protective effects against oxidative stress in rat intestine

    Directory of Open Access Journals (Sweden)

    Liang Xiao

    2016-09-01

    Full Text Available The objective of the current study is to evaluate the effects of dietary supplementation with arginine (ARG, N-carbamylglutamate (NCG, and glutamine (GLN on rat intestinal morphology and antioxidant status under oxidative stress. Rats were fed for 30 d with one of the following iso-nitrogenous diets: basal diet (BD, BD plus 1% ARG, BD plus 0.1% NCG, and BD plus 1% GLN. On day 28, half of the rats fed BD were intraperitoneally injected with 12 mg/kg body weight of diquat (DT; i.e., the DT group and the other half was intraperitoneally injected with sterile solution (i.e., the control group. The other diet groups were intraperitoneally injected with 12 mg/kg body weight of DT (i.e., DT + 1% GLN [DT + GLN], DT + 1% ARG [DT + ARG], and DT + 0.1% NCG [DT + NCG]. Rat jejunum samples obtained at 48 h after DT injection were analyzed. Results showed that DT significantly decreased catalase (CAT activity and glutathione (GSH content by 58.25% and 56.57%, respectively, and elevated malondialdehyde (MDA content and crypt depth (CD by 19.39% and 22.13%, respectively, in the jejunum (P < 0.05, relative to the control group. Compared with the DT group, the DT + GLN group exhibited significantly improved villus height (VH, villus width (VW, villus surface area (VSA, CD and total antioxidant capacity (T-AOC activity (P < 0.05; the DT + ARG group exhibited significantly increased the ratio of VH to CD (H:D and T-AOC activity (P < 0.05; the DT + GLN, DT + ARG and DT + NCG groups exhibited significantly enhanced CAT activity and GSH content as well as decreased MDA content (P < 0.05. Moreover, VH, VW, VSA, CD and GSH content in the DT + GLN group were higher whereas MDA content was lower compared with the corresponding values observed in both the DT + ARG and the DT + NCG groups (P < 0.05. The H:D ratio in the DT + ARG group significantly increased compared with that in the DT + NCG and DT + GLN groups (P < 0

  4. Unifying distance-based goodness-of-fit indicators for hydrologic model assessment

    Science.gov (United States)

    Cheng, Qinbo; Reinhardt-Imjela, Christian; Chen, Xi; Schulte, Achim

    2014-05-01

    The goodness-of-fit indicator, i.e. efficiency criterion, is very important for model calibration. However, recently the knowledge about the goodness-of-fit indicators is all empirical and lacks a theoretical support. Based on the likelihood theory, a unified distance-based goodness-of-fit indicator termed BC-GED model is proposed, which uses the Box-Cox (BC) transformation to remove the heteroscedasticity of model errors and the generalized error distribution (GED) with zero-mean to fit the distribution of model errors after BC. The BC-GED model can unify all recent distance-based goodness-of-fit indicators, and reveals the mean square error (MSE) and the mean absolute error (MAE) that are widely used goodness-of-fit indicators imply statistic assumptions that the model errors follow the Gaussian distribution and the Laplace distribution with zero-mean, respectively. The empirical knowledge about goodness-of-fit indicators can be also easily interpreted by BC-GED model, e.g. the sensitivity to high flow of the goodness-of-fit indicators with large power of model errors results from the low probability of large model error in the assumed distribution of these indicators. In order to assess the effect of the parameters (i.e. the BC transformation parameter λ and the GED kurtosis coefficient β also termed the power of model errors) of BC-GED model on hydrologic model calibration, six cases of BC-GED model were applied in Baocun watershed (East China) with SWAT-WB-VSA model. Comparison of the inferred model parameters and model simulation results among the six indicators demonstrates these indicators can be clearly separated two classes by the GED kurtosis β: β >1 and β ≤ 1. SWAT-WB-VSA calibrated by the class β >1 of distance-based goodness-of-fit indicators captures high flow very well and mimics the baseflow very badly, but it calibrated by the class β ≤ 1 mimics the baseflow very well, because first the larger value of β, the greater emphasis is put on

  5. Towards a New Linguistic Model for Detecting Political Lies

    Directory of Open Access Journals (Sweden)

    Амр М Эль-Завави

    2017-12-01

    Full Text Available The present study addresses the problem of how the two US presidential candidates Donald Trump and Hillary Clinton use statements judged to be false by the Politifact site while delivering their campaign speeches. Two corpora of Clinton’s and Trump’s alleged lies were compiled. Each corpus contained 16 statements judged to be false or ridiculously untrue (‘pants on fire’ by the Pulitzer Prize Winner site Politifact. Some statements were accompanied by the video recordings where they appeared; others had no video recordings affiliated because they are either tweets or their events had not been recorded on Youtube or elsewhere. The present research made use of CBCA (Criteria-based Content Analysis but as a stepping stone for building a new model of detecting lies in political discourse to suit the characteristics of campaign discourse. This furnished the qualitative dimension of the research. As for the quantitative dimension, data were analyzed using software, namely LIWC (Linguistic Inquiry & Word Count, and also focused on the content analysis of the deception cues that can be matched with the results obtained from computerized findings. When VSA (Voice Stress Analysis was required, Praat was used. Statistical analyses were occasionally applied to reach highly accurate results. The study concluded that the New Model (NM is not context-sensitive, being a quantitative one, and is thus numerically oriented in its decisions. Moreover, when qualitative analysis intervenes, especially in examining Politifact rulings, context plays a crucial role in passing judgements on deceptive vs. non-deceptive discourse.

  6. BEST PRACTICES IN NEW PRODUCT DEVELOPMENT: THE ZYRAY WIRELESS CASE STUDY

    Directory of Open Access Journals (Sweden)

    P. Koekemoer

    2012-01-01

    Full Text Available

    ENGLISH ABSTRACT: Successful high-tech start-up companies are rare. This case study investigates the New Product Development (NPD process of Zyray Wireless, a very successful startup 3G technology company that originated in South Africa but relocated to California in the USA. The research looked into the differences between generally accepted NPD best practices and those implemented by this start-up company. Zyray Wireless scored above the industry average in the following categories: customer involvement, project selection, product strategy, technological leadership, and product goal. The best practices for metrics, human resource development, documentation, and change control implemented by Zyray Wireless scored at or below the industry average. The best practice results showed that this very successful start-up company focused more on strategy and engineering and less on process control than average.

    AFRIKAANSE OPSOMMING: Suksesvolle nuwe hoë-tegnologie maatskappye is skaars. Hierdie gevallestudie het die Nuwe Produk Ontwikkelingproses (NPO ondersoek van Zyray Wireless, ʼn baie suksesvolle nuwe maatskappy wat in Suid-Afrika ontstaan het maar na Kalifornië in die VSA verskuif is. Die navorsing het na die verskille gekyk tussen algemeen aanvaarde NPO beste praktyke en dié wat deur hierdie maatskappy geïmplementeer is. Zyray Wireless het bo die industriegemiddelde gepresteer in die volgende kategorieë: kliëntbetrokkenheid, projekkeuse, produkstrategie, tegnologiese leierskap, en produkdoelwitte. Die beste praktyke vir maatstawwe, menslike hulpbronontwikkeling, dokumentasie, en veranderingsbeheer wat deur Zyray Wireless geïmplementeer is, het onder die industriegemiddeldes gepresteer. Die beste praktykresultate het getoon dat hierdie baie suksesvolle nuwe maatskappy meer gefokus het op strategie en ingenieurswese en minder op prosesbeheer as die gemiddelde.

  7. Evaluation of the Quality of Life and Psychiatric Symptoms of Patients with Primary Coxarthrosis after Total Hip Arthroplasty.

    Science.gov (United States)

    Balik, M S; Hocaoğlu, Ç; Erkut, A; Güvercin, Y; Keskin, D

    2017-01-01

    PURPOSE OF THE STUDY In this study, it was aimed to examine the preoperative and postoperative quality of life and psychiatric symptoms of the patients with primary coxarthrosis after total hip arthroplasty. MATERIAL AND METHODS 150 patients undergone total hip arthroplasty were involved in this study. The socio-demographical data form prepared by the researchers was utilized before and after the operation in order to demonstrate disease-related socio-demographical characteristics of the patient. The Quality of Life Scale Short Form (SF-36), Beck Depression Inventory (BDI), Beck Anxiety Inventory (BAI), Harris Hip Score (HHS) and Visual Analog Scale (VSA) were implemented in the preoperative period and at 6th and 12th week after the operation. RESULTS Of the patients involved in study, 28.7% were male and 71.3% were female. Their mean age was 58.34±11.92 year. While statistically significant differences were found between the preoperative and postoperative periods in terms of physical function, physical role limitation, emotional role limitation, energy, social function, pain, and general health subscales of SF-36, no significant differences were found relating mental health subscale. In BAI, BDI, VAS, and HHS comparison, statistically significant differences were found between the preoperative and postoperative periods, except for BAI. CONCLUSIONS In this study, it was determined that primary coxarthrosis affects significantly the quality of the patients' lives in a negative way and can be accompanied by mental symptoms. After total hip arthroplasty, significant improvement was observed in quality of life, depression and pain scores. Key words: total hip prosthesis, quality of life, mental symptoms.

  8. Calcite/aragonite-biocoated artificial coral reefs for marine parks

    Directory of Open Access Journals (Sweden)

    Volodymyr Ivanov

    2017-08-01

    Full Text Available Natural formation of the coral reefs is complicated by slow biomediated precipitation of calcium carbonate from seawater. Therefore, manufactured artificial coral reefs can be used for the formation of “underwater gardens” in marine parks for the recreational fishing and diving that will protect natural coral reefs from negative anthropogenic effects. Additionally, the coating of the concrete, plastic or wooden surfaces of artificial coral reef with calcium carbonate layer could promote attachment and growth of coral larvae and photosynthetic epibiota on these surfaces. Three methods of biotechnological coating of the artificial coral reefs have been tested: (1 microbially induced calcium carbonate precipitation from concentrated calcium chloride solution using live bacterial culture of Bacillus sp. VS1 or dead but urease-active cells of Yaniella sp. VS8; (2 precipitation from calcium bicarbonate solution; (3 precipitation using aerobic oxidation of calcium acetate by bacteria Bacillus ginsengi strain VSA1. The thickness of biotechnologically produced calcium carbonate coating layer was from 0.3 to 3 mm. Biocoating using calcium salt and urea produced calcite in fresh water and aragonite in seawater. The calcium carbonate-coated surfaces were colonized in aquarium with seawater and hard corals as inoculum or in aquarium with fresh water using cyanobacteria Chlorella sorokiana as inoculum. The biofilm on the light-exposed side of calcium carbonate-coated surfaces was formed after six weeks of incubation and developed up to the average thickness of 250 µm in seawater and about 150 µm in fresh water after six weeks of incubation. The biotechnological manufacturing of calcium carbonate-coated concrete, plastic, or wooden surfaces of the structures imitating natural coral reef is technologically feasible. It could be commercially attractive solution for the introduction of aesthetically pleasant artificial coral reefs in marine parks and

  9. Preliminary Evaluation of Moniliformin as a Potential Threat for Teleosts

    Directory of Open Access Journals (Sweden)

    Rui Goncalves

    2018-01-01

    Full Text Available Aquaculture feed manufacturers and producers increasingly recognize the importance of mycotoxins, which contaminate plant-based meals used in compound aquafeeds, and their potential to negatively impact production. Though data on the worldwide occurrence of legislated mycotoxins e.g., trichothecenes and zearalenone (ZEN are well documented, relatively little information is available regarding other mycotoxins also produced by Fusarium, notably moniliformin (MON. Given that MON is known to affect the survival, growth, skeletal formation and bone mineralization in terrestrial species, its widespread occurrence on maize and maize by-products typically used in aquaculture makes it relevant to study these parameters in teleost fish. In the present work we have tested the effect of MON exposure on survival, bone development and mineralization using zebrafish (Danio rerio as a model species and fish derived osteo-chondroprogenitor cell line for in vitro studies. Moniliformin exposure did not decrease bone mineralization in zebrafish larvae or extracellular matrix mineralization in the mineralogenic cell line VSa13. Here, the minimal in vitro cytotoxicity concentration was found to be 1000 µg L−1 MON. Incidence of deformities was also not altered by MON at the concentration tested (450 µg L−1 although larval growth was affected, as shown by a decrease in the standard length of exposed specimens at 20 days post fertilization. Survival decreased significantly in larvae exposed to MON concentrations higher than 900 μg L−1. Influence of MON on survival and growth might be relevant for aquaculture industry. As MON is a water-soluble mycotoxin, its leaching from feed is highly probable, so MON assimilation into the surrounding aqueous environment should also be considered. Tested levels in fish larvae are within the reported occurrence levels of MON in commercial feed and plant meals.

  10. Characterizing mercury concentrations and fluxes in a Coastal Plain watershed: Insights from dynamic modeling and data

    Science.gov (United States)

    Golden, H.E.; Knightes, C.D.; Conrads, P.A.; Davis, G.M.; Feaster, T.D.; Journey, C.A.; Benedict, S.T.; Brigham, M.E.; Bradley, P.M.

    2012-01-01

    Mercury (Hg) is one of the leading water quality concerns in surface waters of the United States. Although watershed-scale Hg cycling research has increased in the past two decades, advances in modeling watershed Hg processes in diverse physiographic regions, spatial scales, and land cover types are needed. The goal of this study was to assess Hg cycling in a Coastal Plain system using concentrations and fluxes estimated by multiple watershed-scale models with distinct mathematical frameworks reflecting different system dynamics. We simulated total mercury (HgT, the sum of filtered and particulate forms) concentrations and fluxes from a Coastal Plain watershed (McTier Creek) using three watershed Hg models and an empirical load model. Model output was compared with observed in-stream HgT. We found that shallow subsurface flow is a potentially important transport mechanism of particulate HgT during periods when connectivity between the uplands and surface waters is maximized. Other processes (e.g., stream bank erosion, sediment re-suspension) may increase particulate HgT in the water column. Simulations and data suggest that variable source area (VSA) flow and lack of rainfall interactions with surface soil horizons result in increased dissolved HgT concentrations unrelated to DOC mobilization following precipitation events. Although flushing of DOC-HgT complexes from surface soils can also occur during this period, DOC-complexed HgT becomes more important during base flow conditions. TOPLOAD simulations highlight saturated subsurface flow as a primary driver of daily HgT loadings, but shallow subsurface flow is important for HgT loads during high-flow events. Results suggest limited seasonal trends in HgT dynamics.

  11. Determining cosmological parameters with the latest observational data

    International Nuclear Information System (INIS)

    Xia Junqing; Li Hong; Zhao Gongbo; Zhang Xinmin

    2008-01-01

    In this paper, we combine the latest observational data, including the WMAP five-year data (WMAP5), BOOMERanG, CBI, VSA, ACBAR, as well as the baryon acoustic oscillations (BAO) and type Ia supernovae (SN) ''union'' compilation (307 sample), and use the Markov Chain Monte Carlo method to determine the cosmological parameters, such as the equation of state (EoS) of dark energy, the curvature of the universe, the total neutrino mass, and the parameters associated with the power spectrum of primordial fluctuations. In a flat universe, we obtain the tight limit on the constant EoS of dark energy as w=-0.977±0.056(stat)±0.057(sys). For the dynamical dark energy models with the time evolving EoS parametrized as w de (a)=w 0 +w 1 (1-a), we find that the best-fit values are w 0 =-1.08 and w 1 =0.368, while the ΛCDM model remains a good fit to the current data. For the curvature of the universe Ω k , our results give -0.012 k de =-1. When considering the dynamics of dark energy, the flat universe is still a good fit to the current data, -0.015 k s ≥1 are excluded at more than 2σ confidence level. However, in the framework of dynamical dark energy models, the allowed region in the parameter space of (n s ,r) is enlarged significantly. Finally, we find no strong evidence for the large running of the spectral index.

  12. In Vitro Variant Surface Antigen Expression in Plasmodium falciparum Parasites from a Semi-Immune Individual Is Not Correlated with Var Gene Transcription

    Science.gov (United States)

    Tschan, Serena; Flötenmeyer, Matthias; Koch, Iris; Berger, Jürgen; Kremsner, Peter; Frank, Matthias

    2016-01-01

    Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) is considered to be the main variant surface antigen (VSA) of Plasmodium falciparum and is mainly localized on electron-dense knobs in the membrane of the infected erythrocyte. Switches in PfEMP1 expression provide the basis for antigenic variation and are thought to be critical for parasite persistence during chronic infections. Recently, strain transcending anti-PfEMP1 immunity has been shown to develop early in life, challenging the role of PfEMP1 in antigenic variation during chronic infections. In this work we investigate how P. falciparum achieves persistence during a chronic asymptomatic infection. The infected individual (MOA) was parasitemic for 42 days and multilocus var gene genotyping showed persistence of the same parasite population throughout the infection. Parasites from the beginning of the infection were adapted to tissue culture and cloned by limiting dilution. Flow cytometry using convalescent serum detected a variable surface recognition signal on isogenic clonal parasites. Quantitative real-time PCR with a field isolate specific var gene primer set showed that the surface recognition signal was not correlated with transcription of individual var genes. Strain transcending anti-PfEMP1 immunity of the convalescent serum was demonstrated with CD36 selected and PfEMP1 knock-down NF54 clones. In contrast, knock-down of PfEMP1 did not have an effect on the antibody recognition signal in MOA clones. Trypsinisation of the membrane surface proteins abolished the surface recognition signal and immune electron microscopy revealed that antibodies from the convalescent serum bound to membrane areas without knobs and with knobs. Together the data indicate that PfEMP1 is not the main variable surface antigen during a chronic infection and suggest a role for trypsin sensitive non-PfEMP1 VSAs for parasite persistence in chronic infections. PMID:27907004

  13. Rights Information Infrastructures and Voluntary Stakeholders Agreements in Digital Library Programmes

    Directory of Open Access Journals (Sweden)

    Piero Attanasio

    2010-11-01

    Full Text Available Rights management for digital library programs is affected by high transaction costs and this calls for new schemes of collective management. Voluntary Stakeholders Agreements (VSA is proposed as a solution. However, there is a need to reshape the way of defining the scope of such agreements. In the past, the scope was set by limiting the type of uses licensed in the collective agreement, while other uses, pertaining the primary exploitation of works, remain in the sphere of direct management by the rightholder. In the agreements under discussion in several countries in relation to digital library initiatives, the scope is rather defined through limiting the type of works included in the agreement, while the licensed use is broad, including full making available in the Internet. A key distinction is the commercial status of a work, if it is in-print or out-of-print.Such new VSAs require innovative forms of managing of rights information, i.e. set of metadata referred to rights management. A significant part of transaction costs derives from the search of rightholders, and thus there is a trend to call for reducing or even abolishing the need for this search. However, the identification of the right status (public domain vs. in-copyright and the commercial status (in print vs. out of print requires a title by title management of information, which is inevitable because of the characteristics of the emerging VSAs. The proper rightholder search cost should be assessed as an additional cost to something that is in the nature of the agreements. The paper tries to set the terms and conditions to achieve this assessment, and to figure out practical solutions to the problem.

  14. Effects of light availability and growth rate on leaf lifespan of four temperate rainforest Proteaceae Efectos de la luminosidad y de las tasas de crecimiento sobre longevidad foliar de cuatro Proteáceas del bosque templado lluvioso

    Directory of Open Access Journals (Sweden)

    CHRISTOPHER H LUSK

    2011-06-01

    de la longevidad foliar, y también los vínculos con otros rasgos foliares. Sin embargo, una teoría comprensiva de la longevidad foliar aún no emerge de dichos estudios. El efecto de las tasas de crecimiento sobre el autosombramiento podría ser determinante en la variación tanto intra- como interespecífica en la longevidad foliar. De ser así, se esperaría que la longevidad foliar de las especies heliófitas, de crecimiento rápido, respondiera más marcadamente a la luminosidad que la de las especies tolerantes a la sombra, de crecimiento lento. Medimos crecimiento en altura, sobrevivencia foliar y producción de nuevas hojas, en árboles juveniles de cuatro Proteáceas Chilenas, con el objetivo de explorar los efectos de la luminosidad y del autosombramiento sobre la longevidad foliar. La longevidad foliar mostró una relación inversa con la disponibilidad de luz difusa, y la pendiente de esta relación fue más elevada en dos especies heliófitas (Embothrium coccineum, Lomatia hirsuta que en dos especies más tolerantes a la sombra (Lomatia ferruginea, Gevuina avellana. Dicho patrón mostró cierta simetría con la variación interespecífica en el efecto de la luminosidad sobre el crecimiento en altura, ya que el crecimiento de las dos especies heliófitas respondió más notoriamente a la luminosidad que el crecimiento de L. ferruginea y G. avellana. Un análisis de vías sugirió que la luminosidad influyó en la longevidad foliar principalmente por el efecto del crecimiento sobre el autosombramiento: cuando la tasa de producción de nuevas hojas se mantuvo constante mediante la regresión múltiple, la luminosidad en sí no tuvo efecto significativo sobre la longevidad foliar de ninguna de las cuatro especies. Sin embargo, entre 29 y 79 % de la variación intraespecífica en la longevidad foliar no pudo explicarse por la luminosidad o la tasa de producción foliar. Si el autosombramiento efectivamente es el principal determinante inmediato de la

  15. Testing the Runoff Tool in Sicilian vineyards: adopting best management practices to prevent agricultural surface runoff

    Science.gov (United States)

    Singh, Manpriet; Dyson, Jeremy; Capri, Ettore

    2016-04-01

    Over the last decades rainfall has become more intense in Sicily, making large proportions of steeply sloping agricultural land more vulnerable to soil erosion, mainly orchards and vineyards (Diodato and Bellocchi 2010). The prevention of soil degradation is indirectly addressed in the European Union's Water Framework Directive (2000/60/EC) and Sustainable Use Directive (2009/128/EC). As a consequence, new EU compliance conditions for food producers requires them to have tools and solutions for on-farm implementation of sustainable practices (Singh et al. 2014). The Agricultural Runoff and Best Management Practice Tool has been developed by Syngenta to help farm advisers and managers diagnose the runoff potential from fields with visible signs of soil erosion. The tool consists of 4 steps including the assessment of three key landscape factors (slope, topsoil permeability and depth to restrictive horizon) and 9 mainly soil and crop management factors influencing the runoff potential. Based on the runoff potential score (ranging from 0 to 10), which is linked to a runoff potential class, the Runoff Tool uses in-field and edge-of-the-field Best Management Practices (BMPs) to mitigate runoff (aligned with advice from ECPA's TOPPS-prowadis project). The Runoff tool needs testing in different regions and crops to create a number of use scenarios with regional/crop specific advice on BMPs. For this purpose the Tool has been tested in vineyards of the Tasca d'Almerita and Planeta wineries, which are large family-owned estates with long-standing tradition in viticulture in Sicily. In addition to runoff potential scores, Visual Soil Assessment (VSA) scores have been calculated to allow for a comparison between different diagnostic tools. VSA allows for immediate diagnosis of soil quality (a higher score means a better soil quality) including many indicators of runoff (Shepherd 2008). Runoff potentials were moderate to high in all tested fields. Slopes were classified as

  16. In the Light of the Midnight Sun

    Directory of Open Access Journals (Sweden)

    Heli Ruokamu

    2015-11-01

    Full Text Available Media Education Conference (MEC 2015 “In the Light of the Midnight Sun” was organized in Sallatunturi, Finland in 15-17 of June 2015. Selected papers submitted by the conference participants are published in this special issue of seminar.net.MEC (former NBE is an informal and friendly conference which participants attend to exchange ideas and information dealing with media education, educational use of ICTs and learning environments. MEC is organized by the Centre for Media Pedagogy at the University of Lapland.Themes and topics of the sixth MEC conference were as follows: Playful and Game-based Learning; Media and Code Literacies; Empowerment through Media; Media and ICT in Teaching and Learning; Digital Story Telling; 3D, Virtual and Simulation-based Learning; and Internet and Social Media in Everyday Life.In the first article, Tuulikki Keskitalo and Heli Ruokamo of the University of Lapland present “A model for simulation-based learning in healthcare”. Simulations and virtual reality do have a major focus in current healthcare education. The authors designed the study in order to fill a gap about our knowledge the pedagogical models that underpin the present activities. They studied several cases involving facilitators and students, in order to find out when and how simulations should and could be used for the benefit of the students and their learning. They describe how a refined pedagogical was developed, a model that will provide a more holistic and meaningful approach to teaching and learning in health care.The second article is written by a group pf researchers from the university of Eastern Finland, Teemu Valtonen, Erkko T. Sointu and Jari Kukkonen of the department situated in Joensuu, while Kati Mäkitalo-Siegl is based in Savonlinna. The title of their paper is “Developing a TPACK measurement instrument for 21st century pre-service teachers”. The investigate how terms, such as “Future skills”, “21st century skills

  17. TESTING GROUND BASED GEOPHYSICAL TECHNIQUES TO REFINE ELECTROMAGNETIC SURVEYS NORTH OF THE 300 AREA, HANFORD, WASHINGTON

    International Nuclear Information System (INIS)

    Petersen, S.W.

    2010-01-01

    Airborne electromagnetic (AEM) surveys were flown during fiscal year (FY) 2008 within the 600 Area in an attempt to characterize the underlying subsurface and to aid in the closure and remediation design study goals for the 200-PO-1 Groundwater Operable Unit (OU). The rationale for using the AEM surveys was that airborne surveys can cover large areas rapidly at relatively low costs with minimal cultural impact, and observed geo-electrical anomalies could be correlated with important subsurface geologic and hydrogeologic features. Initial interpretation of the AEM surveys indicated a tenuous correlation with the underlying geology, from which several anomalous zones likely associated with channels/erosional features incised into the Ringold units were identified near the River Corridor. Preliminary modeling resulted in a slightly improved correlation but revealed that more information was required to constrain the modeling (SGW-39674, Airborne Electromagnetic Survey Report, 200-PO-1 Groundwater Operable Unit, 600 Area, Hanford Site). Both time-and frequency domain AEM surveys were collected with the densest coverage occurring adjacent to the Columbia River Corridor. Time domain surveys targeted deeper subsurface features (e.g., top-of-basalt) and were acquired using the HeliGEOTEM(reg s ign) system along north-south flight lines with a nominal 400 m (1,312 ft) spacing. The frequency domain RESOLVE system acquired electromagnetic (EM) data along tighter spaced (100 m (328 ft) and 200 m (656 ft)) north-south profiles in the eastern fifth of the 200-PO-1 Groundwater OU (immediately adjacent to the River Corridor). The overall goal of this study is to provide further quantification of the AEM survey results, using ground based geophysical methods, and to link results to the underlying geology and/or hydrogeology. Specific goals of this project are as follows: (1) Test ground based geophysical techniques for the efficacy in delineating underlying geology; (2) Use ground

  18. TESTING GROUND BASED GEOPHYSICAL TECHNIQUES TO REFINE ELECTROMAGNETIC SURVEYS NORTH OF THE 300 AREA HANFORD WASHINGTON

    Energy Technology Data Exchange (ETDEWEB)

    PETERSEN SW

    2010-12-02

    Airborne electromagnetic (AEM) surveys were flown during fiscal year (FY) 2008 within the 600 Area in an attempt to characterize the underlying subsurface and to aid in the closure and remediation design study goals for the 200-PO-1 Groundwater Operable Unit (OU). The rationale for using the AEM surveys was that airborne surveys can cover large areas rapidly at relatively low costs with minimal cultural impact, and observed geo-electrical anomalies could be correlated with important subsurface geologic and hydrogeologic features. Initial interpretation of the AEM surveys indicated a tenuous correlation with the underlying geology, from which several anomalous zones likely associated with channels/erosional features incised into the Ringold units were identified near the River Corridor. Preliminary modeling resulted in a slightly improved correlation but revealed that more information was required to constrain the modeling (SGW-39674, Airborne Electromagnetic Survey Report, 200-PO-1 Groundwater Operable Unit, 600 Area, Hanford Site). Both time-and frequency domain AEM surveys were collected with the densest coverage occurring adjacent to the Columbia River Corridor. Time domain surveys targeted deeper subsurface features (e.g., top-of-basalt) and were acquired using the HeliGEOTEM{reg_sign} system along north-south flight lines with a nominal 400 m (1,312 ft) spacing. The frequency domain RESOLVE system acquired electromagnetic (EM) data along tighter spaced (100 m [328 ft] and 200 m [656 ft]) north-south profiles in the eastern fifth of the 200-PO-1 Groundwater OU (immediately adjacent to the River Corridor). The overall goal of this study is to provide further quantification of the AEM survey results, using ground based geophysical methods, and to link results to the underlying geology and/or hydrogeology. Specific goals of this project are as follows: (1) Test ground based geophysical techniques for the efficacy in delineating underlying geology; (2) Use ground

  19. Blind Geothermal System Exploration in Active Volcanic Environments; Multi-phase Geophysical and Geochemical Surveys in Overt and Subtle Volcanic Systems, Hawai’i and Maui

    Energy Technology Data Exchange (ETDEWEB)

    Fercho, Steven [Ormat Nevada, Inc., Reno, NV (United States); Owens, Lara [Ormat Nevada, Inc., Reno, NV (United States); Walsh, Patrick [Ormat Nevada, Inc., Reno, NV (United States); Drakos, Peter [Ormat Nevada, Inc., Reno, NV (United States); Martini, Brigette [Corescan Inc., Ascot (Australia); Lewicki, Jennifer L. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kennedy, Burton M. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2015-08-01

    Suites of new geophysical and geochemical exploration surveys were conducted to provide evidence for geothermal resource at the Haleakala Southwest Rift Zone (HSWRZ) on Maui Island, Hawai’i. Ground-based gravity (~400 stations) coupled with heli-bourne magnetics (~1500 line kilometers) define both deep and shallow fractures/faults, while also delineating potentially widespread subsurface hydrothermal alteration on the lower flanks (below approximately 1800 feet a.s.l.). Multi-level, upward continuation calculations and 2-D gravity and magnetic modeling provide information on source depths, but lack of lithologic information leaves ambiguity in the estimates. Additionally, several well-defined gravity lows (possibly vent zones) lie coincident with magnetic highs suggesting the presence of dike intrusions at depth which may represent a potentially young source of heat. Soil CO2 fluxes were measured along transects across geophysically-defined faults and fractures as well as young cinder cones along the HSWRZ. This survey generally did not detect CO2 levels above background, with the exception of a weak anomalous flux signal over one young cinder cone. The general lack of observed CO2 flux signals on the HSWRZ is likely due to a combination of lower magmatic CO2 fluxes and relatively high biogenic surface CO2 fluxes which mix with the magmatic signal. Similar surveys at the Puna geothermal field on the Kilauea Lower East Rift Zone (KLERZ) also showed a lack of surface CO2 flux signals, however aqueous geochemistry indicated contribution of magmatic CO2 and He to shallow groundwater here. As magma has been intercepted in geothermal drilling at the Puna field, the lack of measured surface CO2 flux indicative of upflow of magmatic fluids here is likely due to effective “scrubbing” by high groundwater and a mature hydrothermal system. Dissolved inorganic carbon (DIC) concentrations, δ13C compositions and 3He/4He values were sampled at Maui from several shallow

  20. Didelphis albiventris como indutor de germinação de Rapanea ferruginea (Myrcinaceae em área de Cerrado, Mato Grosso do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Ademir K. M. Oliveira

    2013-12-01

    Full Text Available A endozoocoria é um dos processos mais importantes na dispersão de sementes em florestas tropicais, dependente em grande parte de aves e mamíferos, onde a passagem dos frutos pelo sistema digestório permite a escarificação química das sementes e sua germinação. Entre as diversas espécies consumidas por animais está Rapanea ferruginea Ruiz et Pav. (Myrsinaceae, uma árvore perenifólia, heliófila, higrófila e pioneira, cujos frutos são ingeridos pelo marsupial Didelphis albiventris Lund, um pequeno mamífero onívoro de hábito noturno. Levando-se em consideração a importância do conhecimento sobre os processos de mutualismo dispersivo, o objetivo neste experimento foi avaliar a germinação de sementes de R. ferruginea que passaram pelo sistema digestório de D. albiventris. As sementes foram submetidas a seis tratamentos: (1 Grupo-Controle - sementes sem tratamento; (2 Grupo Lixa - sementes escarificadas; (3 Grupo Sistema Digestório - sementes que passaram pelo sistema digestório dos animais; (4 Grupo pH 2; (5 Grupo pH 3; (6 Grupo pH4. Os resultados indicaram que o processo de escarificação foi necessário para a obtenção de maiores taxas e velocidades de germinação da espécie estudada. O tratamento com lixa alcançou resultados significativamente diferentes do Grupo Controle, porém inferiores aos demais tratamentos. O tratamento Grupo Sistema Digestório apresentou a maior taxa e velocidade de germinação. Estes resultados indicam que D. albiventris pode ser considerado um frugívoro indutor da taxa e velocidade de germinação de R. ferruginea.

  1. Recuperación post-fuego de la comunidad de líquenes epífitos en la provincia de Córdoba, Argentina Post-fire recovery of the epiphytic-lichen community in Cordoba province, Argentina

    Directory of Open Access Journals (Sweden)

    Juan Manuel Rodriguez

    2009-09-01

    Full Text Available Los líquenes son reconocidos bioindicadores de la calidad del ambiente. Estudios de comunidades de líquenes en relación a los incendios forestales, han demostrado como responden al fuego por encima de las variables microambientales que modelan la comunidad en ausencia de este disturbio. El objetivo de la presente contribución es reconocer el efecto del fuego en la comunidad de líquenes del Bosque Serrano en Córdoba. Se seleccionaron dos zonas, una testigo y otra sometida a fuego en 1996. A través de un muestreo sistemático y estandarizado se relevó la presencia y cobertura de especies de líquenes en árboles y arbustos en las dos áreas estudiadas. Entre el área testigo y el incendiado la diversidad y cobertura de líquenes es similar pero varia su composición. Las especies en la zona incendiadas corresponden a líquenes heliófilos y adaptados a situaciones de estrés. El fuego como disturbio frecuente favorece la presencia de pocas especies con importantes coberturas que resistan las condiciones que el disturbio impone. Los incendios de alta intensidad y frecuencia dejan a la comunidad de líquenes sin posibilidades de desarrollo, disminuyendo la diversidad general y la calidad de los sistemas forestales en los que viven.Lichens are recognized bioindicators of environmental quality. Studies of lichen communities in relation to forest fires have shown the response to fire over micro-environmental variables that shape the community in the absence of this disturbance. The aim of this contribution is to recognize the effect of fire on the lichen community of Sierra Chaco in Cordoba province. Two areas were selected, one without past fire and the other with fire in 1996. Coverage and presence of lichen species on trees and shrubs were recorded in the two areas using systematic, standardized sampling. Diversity and coverage of lichens is similar between the two areas but composition varies. The lichen species in the burned area are

  2. Estudo de variáveis demográficas, ocupacionais e co-carcinogenéticas no carcinoma espinocelular da base de língua nas mulheres

    Directory of Open Access Journals (Sweden)

    Amorim Filho Francisco S.

    2003-01-01

    Full Text Available Avaliar a relação entre carcinógenos e o carcinoma espinocelular no sexo feminino. FORMA DE ESTUDO: Retrospectivo não randomizado. OBJETIVO: Determinar a relação entre carcinógenos (álcool e fumo e o carcinoma espinocelular no sexo feminino na base da língua. MATERIAL E MÉTODOS: Estudo retrospectivo de 31 pacientes do sexo feminino realizado no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo (1977 a 2000. Foram analisados variáveis como etnia, idade, profissão, tabagismo, etilismo, queixa principal, o intervalo de tempo entre o início da queixa e a procura do médico e o estadiamento clínico. Quanto ao tratamento estatístico, foram utilizados os Testes de Kappa e o de Mc Nemar. RESULTADOS: Houve predomínio da raça branca (58,1% sobre a negra (35,5% e a amarela (6,4%, bem como da 6feminine décadade vida; sendo profissionais do lar (83,9% trabalhadoras na agricultura 6,4%. Indústria (3,2%, comércio e liberais (3,2%. Houve mais consumo isolado do tabagismo (48,4%, ambos (45,2% e nenhum (6,4%. Quanto à sintomatologia, odinofagia (48,4%, nódulo no pescoço (19,3%, disfagia (12,9%; otalgia (9,7%, ferida na língua (6,4% e rouquidão (3,2%. Quanto ao estadiamento, T3-4 (74,1%, T1-2 (25,8%, N0 (29,0%, N1(29,0%, N2-3 (42,0%. CONCLUSÕES: O carcinoma espinocelular em mulheres predominou na 6feminine década, na raça branca, tendo como principais sintomas odinofagia e linfonodo cervical metastático. Houve predomínio do tabagismo sobre o etilismo, em paciente T3-4, sendo que a maioria já portador de metástase linfonodal à 1feminine consulta.

  3. Significado prognóstico do linfonodo metastático N3 em carcinomas epidermóides de cabeça e pescoço

    Directory of Open Access Journals (Sweden)

    Ali Amar

    Full Text Available OBJETIVO: Avaliar os resultados do tratamento da doença metastática em estádio avançado (N3 e sua relação com o prognóstico do carcinoma espinocelular de cabeça e pescoço. MÉTODO: Foram revisados as informações de prontuários de 241 pacientes, com carcinoma espinocelular de boca, orofaringe, laringe e hipofaringe com metástases cervicais maiores que 6 cm (N3 submetidos à cirurgia e/ou radioterapia, no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo, de 1988 a 1998. Nos pacientes submetidos à cirurgia foi avaliada a radicalidade cirúrgica, macroscopicamente completa ou não, e naqueles tratados pela radioterapia, foi analisada a resposta do sítio primário e do pescoço imediatamente ao término do tratamento. A sobrevida livre de doença foi estimada pelo método de Kapplan Meier no grupo submetido à cirurgia. RESULTADOS: A irressecabilidade da lesão primária e metastática no pescoço justificou a indicação da radioterapia na dose média de 65 Gy, em 69 pacientes ocorrendo resposta completa no sítio primário em 24(36%, no pescoço em 12 (18%, e em ambos os sítios em 11 casos (16%. No grupo sumetido à cirurgia seguido de radioterapia, a dose média foi de 56 Gy. Dos 25 pacientes com ressecção macroscópica radical do pescoço, cinco (20% recidivaram, e dos cinco com ressecção incompleta e radioterapia, dois tiveram sobrevida de sete a 12 meses após o tratamento, quando foram perdidos de seguimento. A sobrevida livre de doença em dois anos neste grupo foi de 58%. CONCLUSÕES: Para pacientes com linfonodo metastático N3, o esvaziamento cervical seguido de radioterapia foi eficiente no controle regional da doença enquanto que nos inoperáveis, a radioterapia é um tratamento paliativo.

  4. Fuel cells science and engineering. Materials, processes, systems and technology. Vol. 1

    Energy Technology Data Exchange (ETDEWEB)

    Stolten, Detlef; Emonts, Bernd (eds.) [Forschungszentrum Juelich GmbH (DE). Inst. fuer Energieforschung (IEF), Brennstoffzellen (IEF-3)

    2012-07-01

    The first volume is divided in four parts and 22 chapters. It is structured as follows: PART I: Technology. Chapter 1: Technical Advancement of Fuel-Cell Research and Development (Dr. Bernd Emonts, Ludger Blum, Thomas Grube, Werner Lehnert, Juergen Mergel, Martin Mueller and Ralf Peters); 2: Single-Chamber Fuel Cells (Teko W. Napporn and Melanie Kuhn); 3: Technology and Applications of Molten Carbonate Fuel Cells (Barbara Bosio, Elisabetta Arato and Paolo Greppi); 4: Alkaline Fuel Cells (Erich Guelzow); 5: Micro Fuel Cells (Ulf Groos and Dietmar Gerteisen); 6: Principles and Technology of Microbial Fuel Cells (Jan B. A. Arends, Joachim Desloover, Sebastia Puig and Willy Verstraete); 7: Micro-Reactors for Fuel Processing (Gunther Kolb); 8: Regenerative Fuel Cells (Martin Mueller). PART II: Materials and Production Processes. Chapter 9: Advances in Solid Oxide Fuel Cell Development between 1995 and 2010 at Forschungszentrum Juelich GmbH, Germany (Vincent Haanappel); 10: Solid Oxide Fuel Cell Electrode Fabrication by Infiltration (Evren Gunen); 11: Sealing Technology for Solid Oxide Fuel Cells (K. Scott Weil); 12: Phosphoric Acid, an Electrolyte for Fuel Cells - Temperature and Composition Dependence of Vapor Pressure and Proton Conductivity (Carsten Korte); 13: Materials and Coatings for Metallic Bipolar Plates in Polymer Electrolyte Membrane Fuel Cells (Heli Wang and John A. Turner); 14: Nanostructured Materials for Fuel Cells (John F. Elter); 15: Catalysis in Low-Temperature Fuel Cells - An Overview (Sabine Schimpf and Michael Bron). PART III: Analytics and Diagnostics. Chapter 16: Impedance Spectroscopy for High-Temperature Fuel Cells (Ellen Ivers-Tiffee, Andre Leonide, Helge Schichlein, Volker Sonn and Andre Weber); 17: Post-Test Characterization of Solid Oxide Fuel-Cell Stacks (Norbert H. Menzler and Peter Batfalsky); 18: In Situ Imaging at Large-Scale Facilities (Christian Toetzke, Ingo Manke and Werner Lehnert); 19: Analytics of Physical Properties of Low

  5. Líquens da reserva biológica do Alto da Serra de Paranapiacaba

    Directory of Open Access Journals (Sweden)

    Wilson Roberto Pereira

    1989-01-01

    Full Text Available Com o objetivo principal de levantamento florístico foi efetuado estudo de material depositado no herbário do Instituto de Botânica de São Paulo mais coletas dos autores no ano de 1988. Foram encontradas ao todo 63 espécies, sendo que a maior parte do material antigo não foi recoletado e a amostragem atual revela uma flora heliófila composta principalmente por Parmeliaceae. Lobariaceae presentes nas coletas antigas não puderam ser encontradas, sendo notada também a ausência de liquens fruticosos como Usnea e Ramalina. A alteração da mata por poluição do ar proveniente de Cubatão aliada às condições de excessiva umidade e sombra podem ser os fatores responsáveis pela pobreza da flora liquênica encontrada.The biological reserve of the Serra de Paranapiacaba is part of the Serra do Mar at Santo André city, São Paulo state, Brazil (23º4TS, 46º19'W, 800m above sea level. It is covered with a tropical rain forest and is the most rainy place of Brazil. It stands near (16km of Cubatão city (at sea level from were receives a great deal of air pollutants. The principal aim of this work is verify the old and recent lichen floras of the reserve. Altogether 63 species were found. The most (16 of the 25 species held at the SP herbarium (Instituto de Botânica de São Paulo could not be collected in 1988 and nowadays 60% of the lichens are Parmelia s.l. species. No Stictaceae or corticolous fruticose species, wliich are present at the herbarium, could be recollected in 1988. Air pollution, too high umidity and shade can together be the responsible for the flora poorness.

  6. Connectivity to computers and the Internet among patients with schizophrenia spectrum disorders: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Välimäki M

    2017-04-01

    Full Text Available Maritta Välimäki,1–3 Lauri Kuosmanen,1,4,5 Heli Hätönen,1 Marita Koivunen,1,6 Anneli Pitkänen,7 Christina Athanasopoulou,1 Minna Anttila1 1Department of Nursing Science, Faculty of Medicine, University of Turku, Finland; 2Development Unit, Turku University Hospital, Turku, Finland; 3School of Nursing, Hong Kong Polytechnic University, Kowloon, Hong Kong, SAR, China; 4University of Helsinki and Helsinki University Hospital, Helsinki, Finland; 5Social and Healthcare Department, City of Vantaa, Vantaa, Finland; 6Administrative Centre, Research and Development, Satakunta Hospital District, Pori, Finland; 7Administration Centre, Pirkanmaa Hospital District, Tampere, Finland Purpose: Information and communication technologies have been developed for a variety of health care applications and user groups in the field of health care. This study examined the connectivity to computers and the Internet among patients with schizophrenia spectrum disorders (SSDs.Patients and methods: A cross-sectional survey design was used to study 311 adults with SSDs from the inpatient units of two psychiatric hospitals in Finland. The data collection lasted for 20 months and was done through patients’ medical records and a self-reported, structured questionnaire. Data analysis included descriptive statistics.Results: In total, 297 patients were included in this study (response rate =96%. More than half of them (n=156; 55% had a computer and less than half of them (n=127; 44% had the Internet at home. Of those who generally had access to computers and the Internet, more than one-fourth (n=85; 29% used computers daily, and >30% (n=96; 33% never accessed the Internet. In total, approximately one-fourth of them (n=134; 25% learned to use computers, and less than one-third of them (n=143; 31% were known to use the Internet by themselves. Older people (aged 45–65 years and those with less years of education (primary school tended not to use the computers and the

  7. Seminar.net with special issue from Finland

    Directory of Open Access Journals (Sweden)

    Yngve Nordkvelle

    2016-11-01

    Full Text Available Most of the world has learned to ”see to Finland” over the last decade, beacuse of its reputation as a leading nation in educational achievement, as well as its many creative and diligent approaches in technology. Since 1990 Finnish researchers in media, technology and education have met annually to discuss research matters and further advances in the area. For the conference of 2016, held 13-15th April in Hämeenlinna, Finland, we were asked to have the best papers published in Seminar.net. After a rigourous review process we will print six papers, four in this issue and two in the next.Antti Syvänen, Jaana-Piia Mäkiniemi, Sannu Syrjä, Kirsi Heikkilä-Tammi and Jarmo Viteli, all of the University of Tampere, present the paper “When does the educational use of ICT become a source of technostress for Finnish teachers?» This interesting paper is based on the analysis of questionnaires filled in by 2741 Finnish teachers. It provides significant insight into what causes teachers to experience stress and alienation when using information and communication technologies (ICT in their classrooms.Tuulikki Keskitalo and Heli Ruokamo of Lapland University present a paper dealing with “Students’ Expectations and Experiences of Meaningful Simulation-Based Medical Education». Simulation in nursing education is a very rapidly developing area, and the students – as well as their teachers – have high expectation. This project is about student’s expectations and the very positive result from this study was that their experiences were even higher than their expectations.Hanna Vuojärvi, of the University of Lapland and Miikka Eriksson, of the University of Eastern Finland, have written the article «Using Mobile Tools to Support Meaningful Work-based Learning in Vocational Education» together. Their case study focused on meaningful work-based learning (WBL and the pedagogical use of mobile information and communication technologies (ICTs

  8. Constraining cosmological parameters with observational data including weak lensing effects

    Energy Technology Data Exchange (ETDEWEB)

    Li Hong [Institute of High Energy Physics, Chinese Academy of Science, PO Box 918-4, Beijing 100049 (China); Theoretical Physics Center for Science Facilities (TPCSF), Chinese Academy of Science (China)], E-mail: hongli@mail.ihep.ac.cn; Liu Jie [Institute of High Energy Physics, Chinese Academy of Science, PO Box 918-4, Beijing 100049 (China); Xia Junqing [Scuola Internazionale Superiore di Studi Avanzati, Via Beirut 2-4, I-34014 Trieste (Italy); Sun Lei; Fan Zuhui [Department of Astronomy, School of Physics, Peking University, Beijing 100871 (China); Tao Charling; Tilquin, Andre [Centre de Physique des Particules de Marseille, CNRS/IN2P3-Luminy and Universite de la Mediterranee, Case 907, F-13288 Marseille Cedex 9 (France); Zhang Xinmin [Institute of High Energy Physics, Chinese Academy of Science, PO Box 918-4, Beijing 100049 (China); Theoretical Physics Center for Science Facilities (TPCSF), Chinese Academy of Science (China)

    2009-05-11

    In this Letter, we study the cosmological implications of the 100 square degree Weak Lensing survey (the CFHTLS-Wide, RCS, VIRMOS-DESCART and GaBoDS surveys). We combine these weak lensing data with the cosmic microwave background (CMB) measurements from the WMAP5, BOOMERanG, CBI, VSA, ACBAR, the SDSS LRG matter power spectrum and the Type Ia Supernoave (SNIa) data with the 'Union' compilation (307 sample), using the Markov Chain Monte Carlo method to determine the cosmological parameters, such as the equation-of-state (EoS) of dark energy w, the density fluctuation amplitude {sigma}{sub 8}, the total neutrino mass {sigma}m{sub {nu}} and the parameters associated with the power spectrum of the primordial fluctuations. Our results show that the {lambda}CDM model remains a good fit to all of these data. In a flat universe, we obtain a tight limit on the constant EoS of dark energy, w=-0.97{+-}0.041 (1{sigma}). For the dynamical dark energy model with time evolving EoS parameterized as w{sub de}(a)=w{sub 0}+w{sub a}(1-a), we find that the best-fit values are w{sub 0}=-1.064 and w{sub a}=0.375, implying the mildly preference of Quintom model whose EoS gets across the cosmological constant boundary during evolution. Regarding the total neutrino mass limit, we obtain the upper limit, {sigma}m{sub {nu}}<0.471 eV (95% C.L.) within the framework of the flat {lambda}CDM model. Due to the obvious degeneracies between the neutrino mass and the EoS of dark energy model, this upper limit will be relaxed by a factor of 2 in the framework of dynamical dark energy models. Assuming that the primordial fluctuations are adiabatic with a power law spectrum, within the {lambda}CDM model, we find that the upper limit on the ratio of the tensor to scalar is r<0.35 (95% C.L.) and the inflationary models with the slope n{sub s}{>=}1 are excluded at more than 2{sigma} confidence level. In this Letter we pay particular attention to the contribution from the weak lensing data and

  9. The CRADLE vital signs alert: qualitative evaluation of a novel device designed for use in pregnancy by healthcare workers in low-resource settings.

    Science.gov (United States)

    Nathan, Hannah L; Boene, Helena; Munguambe, Khatia; Sevene, Esperança; Akeju, David; Adetoro, Olalekan O; Charanthimath, Umesh; Bellad, Mrutyunjaya B; de Greeff, Annemarie; Anthony, John; Hall, David R; Steyn, Wilhelm; Vidler, Marianne; von Dadelszen, Peter; Chappell, Lucy C; Sandall, Jane; Shennan, Andrew H

    2018-01-05

    Vital signs measurement can identify pregnant and postpartum women who require urgent treatment or referral. In low-resource settings, healthcare workers have limited access to accurate vital signs measuring devices suitable for their environment and training. The CRADLE Vital Signs Alert (VSA) is a novel device measuring blood pressure and pulse that is accurate in pregnancy and designed for low-resource settings. Its traffic light early warning system alerts healthcare workers to the need for escalation of care for women with hypertension, haemorrhage or sepsis. This study evaluated the usability and acceptability of the CRADLE VSA device. Evaluation was conducted in community and primary care settings in India, Mozambique and Nigeria and tertiary hospitals in South Africa. Purposeful sampling was used to convene 155 interviews and six focus groups with healthcare workers using the device (n = 205) and pregnant women and their family members (n = 41). Interviews and focus groups were conducted in the local language and audio-recorded, transcribed and translated into English for analysis. Thematic analysis was undertaken using an a priori thematic framework, as well as an inductive approach. Most healthcare workers perceived the CRADLE device to be easy to use and accurate. The traffic lights early warning system was unanimously reported positively, giving healthcare workers confidence with decision-making and a sense of professionalism. However, a minority in South Africa described manual inflation as tiring, particularly when measuring vital signs in obese and hypertensive women (n = 4) and a few South African healthcare workers distrusted the device's accuracy (n = 7). Unanimously, pregnant women liked the CRADLE device. The traffic light early warning system gave women and their families a better understanding of the importance of vital signs in pregnancy and during the postpartum period. The CRADLE device was well accepted by healthcare workers

  10. Agricultural conservation practices can help mitigate the impact of climate change.

    Science.gov (United States)

    Wagena, Moges B; Easton, Zachary M

    2018-09-01

    Agricultural conservation practices (CPs) are commonly implemented to reduce diffuse nutrient pollution. Climate change can complicate the development, implementation, and efficiency of agricultural CPs by altering hydrology, nutrient cycling, and erosion. This research quantifies the impact of climate change on hydrology, nutrient cycling, erosion, and the effectiveness of agricultural CP in the Susquehanna River Basin in the Chesapeake Bay Watershed, USA. We develop, calibrate, and test the Soil and Water Assessment Tool-Variable Source Area (SWAT-VSA) model and select four CPs; buffer strips, strip-cropping, no-till, and tile drainage, to test their effectiveness in reducing climate change impacts on water quality. We force the model with six downscaled global climate models (GCMs) for a historic period (1990-2014) and two future scenario periods (2041-2065 and 2075-2099) and quantify the impact of climate change on hydrology, nitrate-N (NO 3 -N), total N (TN), dissolved phosphorus (DP), total phosphorus (TP), and sediment export with and without CPs. We also test prioritizing CP installation on the 30% of agricultural lands that generate the most runoff (e.g., critical source areas-CSAs). Compared against the historical baseline and with no CPs, the ensemble model predictions indicate that climate change results in annual increases in flow (4.5±7.3%), surface runoff (3.5±6.1%), sediment export (28.5±18.2%) and TN export (9.5±5.1%), but decreases in NO 3 -N (12±12.8%), DP (14±11.5), and TP (2.5±7.4%) export. When agricultural CPs are simulated most do not appreciably change the water balance, however, tile drainage and strip-cropping decrease surface runoff, sediment export, and DP/TP, while buffer strips reduce N export. Installing CPs on CSAs results in nearly the same level of performance for most practices and most pollutants. These results suggest that climate change will influence the performance of agricultural CPs and that targeting agricultural

  11. Carcinoma epidermóide da boca em idosos de São Paulo Squamous cell carcinoma of the mouth in the elderly in São Paulo

    Directory of Open Access Journals (Sweden)

    MÁRIO R. PERUSSI

    2002-12-01

    Full Text Available OBJETIVO: Verificar a influência das variáveis sexo e localização do tumor primário na sobrevida, em idosos portadores de câncer da boca. MÉTODOS: Estudo retrospectivo com 1440 fichas clínicas de pacientes com carcinoma epidermóide da boca do Serviço de Cirurgia de Cabeça e Pescoço do Hospital Heliópolis, São Paulo, de 1978-1997. Foram encontrados 562 idosos (idade mínima de 60 anos - critério da OMS para países em desenvolvimento e 878 nas 1ª e 2ª idades, comparando-se as freqüências das variáveis do estudo (sexo e localização do tumor. Como critério de evolução utilizou-se o tempo de vida, em meses, após o diagnóstico. Foi utilizado como método estatístico o qui-quadrado com nível de significância de 5% ( a = 0,05. RESULTADOS: A freqüência do câncer da boca em idosos permaneceu estável no período estudado (39,5% em 1978-87 vs 38,2% em 1989-1997. A relação masculino:feminino foi de 3:1 em pacientes com mais de 60 anos e 8:1 antes dos 60 anos. Observou-se um predomínio em idosos no câncer da região jugal (56% e palato (47% quando comparados com os tumores de pacientes mais jovens localizados em língua e soalho (67% e língua (62%. Não foram observadas diferenças na percentagem de pacientes falecidos antes do início do tratamento (11,6% vs 10,5% em jovens e nas percentagens de sobrevida em diferentes períodos (seis meses a cinco anos. CONCLUSÕES: Existe uma maior proporção de mulheres com câncer da boca entre os idosos quando comparadas as 1ª e 2ª idades. Compararativamente, os tumores do andar superior da boca (palato foram mais freqüentes nos indivíduos com menos de 60 anos enquanto que a localização na língua e soalho ocorreu com maior freqüência nos pacientes com idade de 60 e mais anos. As diferenças observadas em relação ao sexo e localização não se refletiram em modificação de sobrevida dos pacientes estudados.OBJECTIVE: To assess the influence of sex and primary tumor

  12. Variação morfológica e reprodutiva de Aechmea lindenii (E. Morren Baker var. lindenii (Bromeliaceae Morphological and reproductive variation of Aechmea lindenii (E. Morren Baker var. lindenii (Bromeliaceae

    Directory of Open Access Journals (Sweden)

    Maurício Lenzi

    2006-06-01

    Full Text Available Buscou-se determinar o efeito da intensidade luminosa sobre as características morfológicas e reprodutivas de A.lindenii, em ambientes de restinga herbácea (alta luminosidade e sub-bosque de restinga arbórea (baixa luminosidade, em Florianópolis, SC, onde os resultados indicam que a luminosidade pode influenciar no seu fenótipo, produção de néctar, fenologia e sucesso reprodutivo. As plantas esciófitas são maiores e apresentam um período de floração em torno de 120 dias, enquanto que as heliófitas são menores e florescem ao longo de todo o ano. A espécie apresenta atributos florais à ornitofilia, estando o volume (16,7 µL ± 4 e concentração (27,25% do néctar produzido pelas flores dentro do esperado para espécies polinizadas por beija-flores. A freqüente visitação de Amazilia fimbriata, Thalurania glaucopis e Thalurania sp. (Trochilidae confirma esta observação, porém abelhas e borboletas também foram consideradas potenciais polinizadores, sugerindo co-evolução de síndromes florais secundárias. Baseando-se nos resultados dos testes de polinizações manuais e no desenvolvimento dos tubos polínicos, pode-se concluir que a espécie não apresenta auto-incompatibilidade, formando frutos com sementes férteis, com germinação superior a 80%, oriundas tanto de fecundação cruzada quanto da autopolinização. A população heliófita apresentou elevadas taxas de partenocarpia (52, 95% e mostrou ser um método seguro e eficaz de se avaliar a fertilização das flores, podendo-se assim, relacionar a sua freqüência e abundância à ausência ou ineficiência dos visitantes florais. Os frutos e sementes foram dispersos por pássaros das famílias Thraupidae e Pipridae e predados por lagartas da borboleta Tecla sp. (Lycaenidae.The purpose of this study was to determine the effect of the luminosity on morphological and reproductive characteristics of A. lindenii, in environments of "restinga herbácea" (high

  13. Paradigma da disseminação local do carcinoma epidermóide da base de língua Paradigm of local spreading in squamous cell carcinoma of the base of the tongue

    Directory of Open Access Journals (Sweden)

    Francisco S. Amorim Filho

    2004-08-01

    Full Text Available OBJETIVO: Analisar o padrão de disseminação local através da delimitação clínica da extensão da lesão primária assim como os subsítios invadidos. FORMA DE ESTUDO: Clínico retrospectivo. MATERIAL E MÉTODO: Foram analisados os prontuários de 290 pacientes com carcinoma epidermóide de base de língua no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo - Brasil, de 1977 a 2000, sendo estadiados pelo TNM da UICC, e os resultados analisados pelo teste do Quiquadrado para tabelas Z x N (Cochran para estudo da associação dos sítios e dimensão da neoplasia em relação à invasão da linha média. RESULTADOS: Com predomínio dos homens (8:1 e da 6ª década de vida (41,0%, 83,8% eram etilistas e tabagistas e em 4,7% os hábitos estavam ausentes. Quanto aos sintomas, odinofagia (37,6%, linfonodo (21,7% e a média de tempo entre o 1º sintoma e o diagnóstico de 6 meses (62,0%. Quanto ao estadiamento, tivemos T1-T2 (18,3%, T3 (32,4%, T4(50,7%. Quanto à disseminação local, em direção à valécula (25,3%, epiglote (18,7%, glote (2,7%, anteriormente para o v lingual em (22,4% e póstero lateralmente para a prega faringloepiglótica (6,6% e seio piriforme (2,2%. Quanto a ultrapassagem da linha média, isso ocorreu em 66,2% dos casos, sendo 42,2% (T2, 54,2% (T3 e 82,9% (T4. CONCLUSÃO: o carcinoma epidermóide no estádio T4 ultrapassa a linha média da base da língua em 82,9%.AIM: To analyse the local spreading pattern through clinical delimitation of primary lesion extension as well as subsites involvement. STUDY DESIGN: Chart review. MATERIAL AND METHOD: Files of 290 patients with squamous cell carcinoma (SCC of the base of the tongue from Department of Head Neck and Surgery and Otorhinolaryngology of Hospital Heliópolis, Hosphel, São Paulo, Brazil from 1977 to 2000, were analysed. They were staged through TNM from UICC, and then through thoygh K square text with Z x

  14. Morfologia do fruto, da semente e morfo-anatomia da plântula de Vitex megapotamica (Spreng. Moldenke (Lamiaceae Fruit and seed morphology and morpho-anatomy of seedlings of Vitex megapotamica (Spreng. Moldenke (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Nelson Luiz Cosmo

    2009-06-01

    Full Text Available Vitex megapotamica (tarumã é espécie arbórea, decídua, com ocorrência, no Brasil, desde Minas Gerais até o Rio Grande do Sul. Visando à caracterização morfológica do fruto, da semente e morfo-anatômica da plântula, frutos desta espécie foram coletados e as sementes postas para germinar em laboratório. As plântulas foram coletadas desde a protrusão da raiz até o desenvolvimento do primeiro par de eofilo. Foram realizadas medições e pesagem de frutos, e contagem do número de sementes por frutos. As características morfológicas do fruto e da semente são aqui descritas e ilustradas, assim como a morfo-anatomia da plântula. O fruto é drupóide, nuculânio, tetralocular, contendo apenas uma ou duas sementes com fina camada de endosperma e embrião axial, foliáceo. O diásporo (pirênio é constituído pelo endocarpo mais a semente. O endocarpo lenhoso parece exercer restrição sobre a germinação das sementes desta espécie. A plântula é epigea, fanerocotiledonar, com paracotilédones elípticos, com margem inteira, e eofilos opostos, simples, elípticos, com margem serreada, apresentando tricomas tectores. Tanto o paracotilédone quanto o eofilo apresentam mesofilo heterogêneo, dorsiventral, feixe colateral em forma de arco e estômatos anomocíticos. A raiz é poliarca, com córtex parênquimático; o hipocótilo possui tricomas glandulares e não-glandulares, colo distinto, e com cerca de 20 dias encontra-se em início de crescimento secundário. Diversas das características da plântula de Vitex megapotamica estão relacionadas à sua condição de espécie heliófila.Vitex Megapotamica (tarumã is a deciduous tree occurring in Brazil from Minas Gerais to Rio Grande do Sul States. In order to characterize fruit and seed morphology and morpho-anatomy of seedlings, fruits of this species were collected and seeds were germinated in the laboratory. Seedlings were collected from root protrusion to development of the

  15. Outcome-based anatomic criteria for defining the hostile aortic neck.

    Science.gov (United States)

    Jordan, William D; Ouriel, Kenneth; Mehta, Manish; Varnagy, David; Moore, William M; Arko, Frank R; Joye, James; de Vries, Jean-Paul P M

    2015-06-01

    There is abundant evidence linking hostile proximal aortic neck anatomy to poor outcome after endovascular aortic aneurysm repair (EVAR), yet the definition of hostile anatomy varies from study to study. This current analysis was undertaken to identify anatomic criteria that are most predictive of success or failure at the aortic neck after EVAR. The study group comprised 221 patients in the Aneurysm Treatment using the Heli-FX Aortic Securement System Global Registry (ANCHOR) clinical trial, a population enriched with patients with challenging aortic neck anatomy and failure of sealing. Imaging protocols were not protocol specified but were performed according to the institution's standard of care. Core laboratory analysis assessed the three-dimensional centerline-reformatted computed tomography scans. Failure at the aortic neck was defined by type Ia endoleak occurring at the time of the initial endograft implantation or during follow-up. Receiver operating characteristic curve analysis was used to assess the value of each anatomic measure in the classification of aortic neck success and failure and to identify optimal thresholds of discrimination. Binary logistic regression was performed after excluding highly intercorrelated variables, creating a final model with significant predictors of outcome after EVAR. Among the 221 patients, 121 (54.8%) remained free of type Ia endoleak and 100 (45.2%) did not. Type Ia endoleaks presented immediately after endograft deployment in 58 (58.0%) or during follow-up in 42 (42.0%). Receiver operating characteristic curve analysis identified 12 variables where the classification of patients with type Ia endoleak was significantly more accurate than chance alone. Increased aortic neck diameter at the lowest renal artery (P = .013) and at 5 mm (P = .008), 10 mm (P = .008), and 15 mm (P = .010) distally; aneurysm sac diameter (P = .001), common iliac artery diameters (right, P = .012; left, P = .032), and a conical (P = .049) neck

  16. Larval fish distribution and their relationship with environmental factors in the southern Tyrrhenian Sea (central Mediterranean during two years of sampling

    Directory of Open Access Journals (Sweden)

    Adriana Profeta

    2014-06-01

    , Vi_a (Vinciguerria attenuata. Fig. 2. Results of CCA analysis for larval fish species and sampled stations during June 2006. Two first axes (CCA1 and CCA2 are represented . Species abbreviations in alphabetical order: Acto_ris (Arctozenus risso, Arno_tho (Arnoglossus thori, Boop_boo (Boops boops, Auxi_roc Cara_acu Cera_mad (Ceratoscopelus maderensis, Cyclo_bra (Cyclothone braueri, Diap_hol (Diaphus holti, Gobi_nig (Gobius niger, Heli_dac (Helicolenus dactylopterus, Hygo_hyg (Hygophum hygomii, Lamp_cro (Lampanyctus crocodilus, Lamp_pus (Lampanyctus pusillus, Lest_jay (Lestidiops jayakari, Myct_pun (Myctophum punctatum, Nezu_aeq (Nezumia aequalis Noto_bol (Notoscopelus bolini, Noto_elo (Notoscopelus elongatus, Para_spe (Paralepis speciosa, Sync_pha (Synchiropus phaeton Spic_sma (Spicara smaris, Trac_tra (Trachurus trachurus.

  17. Airborne imaging for heritage documentation using the Fotokite tethered flying camera

    Science.gov (United States)

    Verhoeven, Geert; Lupashin, Sergei; Briese, Christian; Doneus, Michael

    2014-05-01

    Since the beginning of aerial photography, researchers used all kinds of devices (from pigeons, kites, poles, and balloons to rockets) to take still cameras aloft and remotely gather aerial imagery. To date, many of these unmanned devices are still used for what has been referred to as Low-Altitude Aerial Photography or LAAP. In addition to these more traditional camera platforms, radio-controlled (multi-)copter platforms have recently added a new aspect to LAAP. Although model airplanes have been around for several decades, the decreasing cost, increasing functionality and stability of ready-to-fly multi-copter systems has proliferated their use among non-hobbyists. As such, they became a very popular tool for aerial imaging. The overwhelming amount of currently available brands and types (heli-, dual-, tri-, quad-, hexa-, octo-, dodeca-, deca-hexa and deca-octocopters), together with the wide variety of navigation options (e.g. altitude and position hold, waypoint flight) and camera mounts indicate that these platforms are here to stay for some time. Given the multitude of still camera types and the image quality they are currently capable of, endless combinations of low- and high-cost LAAP solutions are available. In addition, LAAP allows for the exploitation of new imaging techniques, as it is often only a matter of lifting the appropriate device (e.g. video cameras, thermal frame imagers, hyperspectral line sensors). Archaeologists were among the first to adopt this technology, as it provided them with a means to easily acquire essential data from a unique point of view, whether for simple illustration purposes of standing historic structures or to compute three-dimensional (3D) models and orthophotographs from excavation areas. However, even very cheap multi-copters models require certain skills to pilot them safely. Additionally, malfunction or overconfidence might lift these devices to altitudes where they can interfere with manned aircrafts. As such, the

  18. Cheirolophus intybaceus (Asteraceae, Centaureinae or the constancy of 2C value

    Directory of Open Access Journals (Sweden)

    Sánchez-Jiménez, I.

    2009-12-01

    Full Text Available Cheirolophus intybaceus (Asteraceae, Centaureinae or the constancy of 2C value.- Cheirolophus intybaceus is a heliophyte growing in thermal Mediterranean scrublands along a coastal belt of 50 km large, stretching from Toulon (France to the Southern part of the Iberian Peninsula, occurring also in the Balearic Islands (with the exception of Minorca. Moreover, this species is also growing in high and sunny lands in the Mediterranean river basins, constituting a complex of taxa closely related among them. The objectives of this work are: i to provide new genome size data for some Asteraceae species; ii to study the variation of DNA amount along a species distribution area; iii to evaluate the discrimination capability of this parameter at low taxonomic levels. A signicantly positive correlation between the DNA amount and the latitude has been found, that is, in drier and warmer habitats genome size tends to decrease in this species. The variation in the whole distribution area of Ch. intybaceus is 1.15-fold. This low variability supports the constancy of 2C-value.

    Cheirolophus intybaceus es una especie heliófila propia de los matorrales mediterráneos termófilos que crece en una franja litoral de unos 50 km de anchura que va desde Tolón (Var, Francia hasta el sur de la península Ibérica, estando también presente en las islas Baleares (excepto en Menorca. Se encuentra también en las zonas elevadas y soleadas de las cuencas fluviales mediterráneas, formando un complejo de táxones estrechamente relacionados entre sí. Los objetivos de este trabajo son: i contribuir a la aportación de datos de tamaño del genoma para diversas especies de Asteraceae; ii estudiar la variación de la cantidad de ADN a lo largo del área de distribución de una especie; iii evaluar la capacidad de discriminación de este parámetro a niveles taxonómicos bajos. Se ha encontrado una correlación positiva y significativa entre la

  19. Hábitos orais de sucção: estudo piloto em população de baixa renda Suction oral habits: initial study in low income population

    Directory of Open Access Journals (Sweden)

    Valdinês G.S. Cavassani

    2003-01-01

    : Nine Brazilian children (8 girls and 1 boy were examined in "I Mutirão da Comunicação" at Heliópolis Hospital, Hosphel/São Paulo, Brazil, on October 27, 2001. RESULTS: The most common speech and voice disorder detected was articulation impairment (55.56%, followed by oral motor disorder (33.33%. Open bite was detected in eight cases (88.89%. In seven cases (77.78% we observed mouth breathing. CONCLUSIONS: Speech and articulation and dental disorders are normally detected in children with suction oral habits. The importance of interrelating dental, speech and otorhinolaryngology abnormalities in association with public health programs must be established for the low-income population.

  20. Chromosome studies on Brazilian cerrado plants

    Directory of Open Access Journals (Sweden)

    Eliana Regina Forni-Martins

    2000-12-01

    Full Text Available Cerrado is the Brazilian name for the neotropical savanna, which occurs mainly in Brazilian Central Plateau, composed of herbaceous-subshrubby and shrubby-arboreal floras, both of which are heliophilous, highly diverse and regionally differentiated. Considering species distribution and chromosome numbers, some authors have proposed that the herbaceous-subshrubby flora of the neotropical savanna is quite old, while the shrubby-arboreal flora is derived from forests, a hypothesis that implies higher chromosome numbers in the savanna than in the forest. If, however, chromosome numbers are similar in the cerrado and in forests, both could be similarly old, indicating that bi-directional flow of flora occurred in the past. This paper presents data on chromosome numbers and microsporogenesis for 20 species in 13 families collected in the States of São Paulo, Goiás and Minas Gerais, providing previously unpublished data for Myrcia (Myrtaceae, Luxemburgia (Ochnaceae and Hortia (Rutaceae. Meiosis proved to be normal, indicating regularity in the sexual reproductive process. Chromosome numbers varied from 2n = 18 (Allamanda angustifolia: Apocynaceae to 2n = ca. 104 (Ouratea spectabilis: Ochnaceae, being low (20 Cerrado é a palavra que, no Brasil, designa a savana neotropical, com área nuclear no Planalto Central, constituída de uma flora herbáceo-subarbustiva e outra arbustivo-arbórea, ambas heliófilas, altamente diversificadas e regionalmente diferenciadas. Considerando a distribuição de espécies e de números cromossômicos, alguns autores propuseram que a flora herbáceo-subarbustiva da savanna neotropical seria bastante antiga, enquanto a flora arbustivo-arbórea seria derivada das florestas Atlântica e Amazônica, uma hipótese que implica na ocorrência de números cromossômicos mais altos no cerrado que nas florestas. Porém, se os números cromossômicos forem similares no cerrado e nas florestas, ambos os tipos de formação poderiam

  1. Synthesis, characterization, and application of Zn(NH 3)(CO3) for selective adsorptive separation of CO2

    Science.gov (United States)

    Khazeni, Naasser

    (NH3)(CO 3), renders this compound a potential candidate for separating CO 2 from H2and N2. The adsorbent selection screening affirmed that Zn(NH3)(CO 3) can be a potential candidate for LFG separation using PSA, LFG separation using VSA, oxy-fuel CO2 purification using PSA, and air separation using PSA at 263K. For those applications, the low CO2 uptake by Zn(NH3)(CO3) was offset by considerable selectivity, regenerability, and adsorbent selection parameter.

  2. Cosmic microwave background snapshots: pre-WMAP and post-WMAP.

    Science.gov (United States)

    Bond, J Richard; Contaldi, Carlo; Pogosyan, Dmitry

    2003-11-15

    We highlight the remarkable evolution in the cosmic microwave background (CMB) power spectrum C(l) as a function of multipole l over the past few years, and in the cosmological parameters for minimal inflation models derived from it: from anisotropy results before 2000; in 2000 and 2001 from Boomerang, Maxima and the Degree Angular Scale Interferometer (DASI), extending l to approximately 1000; and in 2002 from the Cosmic Background Imager (CBI), Very Small Array (VSA), ARCHEOPS and Arcminute Cosmology Bolometer Array Receiver (ACBAR), extending l to approximately 3000, with more from Boomerang and DASI as well. Pre-WMAP (pre-Wilkinson Microwave Anisotropy Probe) optimal band powers are in good agreement with each other and with the exquisite one-year WMAP results, unveiled in February 2003, which now dominate the l less, similar 600 bands. These CMB experiments significantly increased the case for accelerated expansion in the early Universe (the inflationary paradigm) and at the current epoch (dark energy dominance) when they were combined with "prior" probabilities on the parameters. The minimal inflation parameter set, [omega(b), omega(cdm), Omega(tot), Omega(Lambda), n(s), tau(C), sigma(8)], is applied in the same way to the evolving data. C(l) database and Monte Carlo Markov Chain (MCMC) methods are shown to give similar values, which are highly stable over time and for different prior choices, with the increasing precision best characterized by decreasing errors on uncorrelated "parameter eigenmodes". Priors applied range from weak ones to stronger constraints from the expansion rate (HST-h), from cosmic acceleration from supernovae (SN1) and from galaxy clustering, gravitational lensing and local cluster abundance (LSS). After marginalizing over the other cosmic and experimental variables for the weak + LSS prior, the pre-WMAP data of January 2003 compared with the post-WMAP data of March 2003 give Omega(tot) = 1.03(-0.04)(+0.05) compared with 1

  3. Is the inverse leafing phenology of the dry forest understory shrub Jacquinia nervosa (Theophrastaceae a strategy to escape herbivory?

    Directory of Open Access Journals (Sweden)

    Óscar M Chaves

    2006-09-01

    by insect herbivores in young leaves, fruits, and seeds, as well as the low reproductive index observed in J. nervosa, shows that the inverse leafing phenology of this species is not consistent with the "escape hypothesis" since J. nervosa was considerably attacked during the dry season. Considering the strong seasonality of the tropical dry forest and the heliophyte character of J. nervosa, it is more likely that this phenological strategy evolved in response to seasonal fluctuations in light availability, light quality, and daylength. Rev. Biol. Trop. 54 (3: 951-963. Epub 2006 Sept. 29.Analizamos la hipótesis de "escape de la herbivoría" como explicación para la fenología foliar inversa del arbusto de sotobosque del bosque seco Jacquinia nervosa, el cual produce sus hojas durante la estación seca y se mantiene sin ellas durante la estación lluviosa. Medimos la producción de hojas, flores y frutos, el daño por herbivoría en hojas y semillas, y la fauna de herbívoros en 36 plantas adultas de octubre del 2000 a agosto del 2001 en Santa Rosa, Costa Rica. La herbivoría foliar acumulada durante la estación seca fue similar a la herbivoría de otras especies que concentran la producción foliar en la estación lluviosa. En las hojas maduras la mayor parte del daño fue causado por el escarabajo Coptocycla rufonotata (Chrysomelidae. La depredación de semillas predispersión fue de 42 % (DE= 47 %, N= 122 y es causada por larvas de polilla de la familia Tortricidae. Los niveles de daño indican que la fenología foliar de J. nervosa no coincide con la hipótesis de "escape". Considerando la fuerte estacionalidad del bosque seco y el carácter heliófito de J. nervosa, es probable que esta estrategia fenológica evolucionara en respuesta a cambios estacionales en la disponibilidad y calidad de la luz, y duración del fotoperíodo.

  4. Influência de diferentes meios de cultura sobre o crescimento de Pfaffia glomerata (Spreng. Pedersen (Amaranthaceae para conservação in vitro Influence of different culture media on the growth of Pfaffia glomerata (Spreng. Pendersen (Amaranthaceae for conservation in vitro

    Directory of Open Access Journals (Sweden)

    R.B.N. Alves

    2010-12-01

    Full Text Available Pfaffia glomerata ocorre em vários estados do Brasil e países limítrofes da região Sul às margens de rios e nas orlas das matas de galerias, é espécie hidrófita e heliófita. As raízes de espécies do gênero Pfaffia são usadas na medicina popular brasileira, especialmente como tônico, afrodisíaco e no controle do diabete. O objetivo deste trabalho foi estabelecer um banco de germoplasma in vitro de Pfaffia glomerata. O experimento em delineamento inteiramente casualizado foi conduzido com seis tratamentos: 1 MS + 2% de sacarose + 4% de sorbitol; 2 MS/2 + 2% de sacarose + 4% de sorbitol; 3 MS + 2% de sacarose + 4% de sorbitol + 2 mg L-1 de pantotenato de cálcio; 4 MS/2 + 2% de sacarose + 4% de sorbitol + 2 mg L-1de pantotenato de cálcio; 5 MS + 2% de sacarose + 3% de manitol + 2 mg L-1de pantotenato de cálcio; 6 MS/2 + 2% de sacarose + 3% de manitol + 2 mg L-1de pantotenato de cálcio. Os resultados obtidos foram submetidos à análise de variância e ao teste de separação de médias de Scott Knott. Os tratamentos um, três e quatro apresentaram, significativamente, o maior número de segmentos nodais por haste, quando comparados com os tratamentos dois, cinco e seis. O tratamento dois foi o mais indicado para a conservação in vitro da espécie por ter promovido menor crescimento das plantas (altura de 3,1±1,9 cm, alto índice de sobrevivência, 100% de explantes com brotação e o maior número de brotos por explante, após seis meses de cultivo. Todas as plântulas produziram raízes e não houve formação de calos, também não ocorreu hiperhidricidade nos tratamentos avaliados. As plantas aclimatizadas apresentaram 100% de sobrevivência no ambiente ex vitro. A manutenção de acessos de P. glomerata no banco de germoplasma in vitro é viável tanto do ponto de vista da conservação quanto economicamente.Pfaffia glomerata occurs in several states of Brazil and its neighboring countries in the south region at riverbanks

  5. PREFACE: International Symposium on `Vacuum Science and Technology' (IVS 2007)

    Science.gov (United States)

    Mittal, K. C.; Gupta, S. K.

    2008-03-01

    equipments, accessories, products etc by different manufacturers and suppliers has been organized at the venue of the symposium hall for the benefit of the participants. The interest shown by the exhibitors reveals that the industry has come of age and the advances that have taken place over the years is quite significant. During the symposium, the Indian Vacuum Society felicitated two distinguished personalities who have contributed significantly for the development of vacuum science and technology in the country. The C AMBASANKARAN memorial and Smt SHAKUNTALABAI VYAWAHARE memorial Awards were also conferred on the two best contributed papers. A committee constituted by the Symposium Organizing Committee evaluated the relevance, scientific content, and clarity of presentation to decide the award winning papers. It is hoped that the discussion generated by the delegates at the symposium will help in a better understanding vacuum science and technology. K C Mittal Convener S K Gupta Co Convener International Advisory Committee Kakodkar, Anil DAE/India, Chairman Badve, Cdr A.V.(IN Retd.) Pfeiffer Vac India Banerjee, S. BARC/India Bhandari, R.K. BRNS/India Chander, Shekhar CEERI/India Chopra, K.L. IIT Delhi/India Day, Chris ITER Grover, R.B DAE,BARC/India Jakub, Szajman VSA/ Australia Jayaraj, R.N. NFC/India Kamath, H.S. BARC/India Kaw, P.K. IPR/India Kobayashi, M. VSJ/Japan Kumar, Lalit MTRDC, India Kumar, Vikram NPL., India Langley, Robert AVS, USA Larour, Jean Ecole/France Mendonsa, R.H. Lawrence and Mayo Myneni, Ganapatirao Jlab/USA Narsaiah, S.V. HHV Padamsee, Hasan Cornell/USA Pillay, R.G. TIFR Raj, Baldev IGCAR/India Raju, P.T. IVS/India Ramasami, T. DST/India Ray, A.K. BARC/India Reid, RJ IUVSTA/UK Roy, Amit IUAC/india Sahni, V.C. RRCAT, BARC/India Schamiloglu, E. UNM/USA Shankara, K.N. VSSC,ISRO/India Sinha, Bikash VEC,SINP/India Strubin, P. CERN/Switzerland Local Organizing Committee Ray, A.K. BARC (Chairman) Kailas, S. BARC, (Co Chairman) Chakravarty, D.P. BARC

  6. Stabilization by Shear and Negative V''; Stabilisation au Moyen du Croisement de Lignes de Champ et de l'Emploi d'un V'' Negatif; Stabilizatsiya spomoshch'yu shira i otritsatel'nogo V{sup ;} Estabilizacion por Cizallamiento y Empleo de V'' Negativa

    Energy Technology Data Exchange (ETDEWEB)

    Furth, H. P.; Killeen, J. [Lawrence Radiation Laboratory, Livermore, CA (United States); Rosenbluth, M. N. [General Atomic Division, General Dynamics Corporation and University of California (San Diego), La Jolla, CA (United States); Coppi, B. [University of California (San Diego), La Jolla, CA (United States)

    1966-04-15

    stagnation naturels auxquels on superpose des 'champs de gaufrants' (du type Script-Small-L = 0 et 2, Script-Small-L = 1 et 3 ou Script-Small-L = 0 et 3), pour creer les regions a {Delta}B favorable. 2. Des equilibres helicoiedaux au moyen de la courbure heli'cbidale globale pour creer des regions a {Delta}B favorable, la stagnation de la transformee rotationnelle etant obtenue a l'aide d'un courant circulant sur un conducteur axial, autour duquel s'enroule le tube de flux en equilibre dont la forme est helicoiedale. 3. Des equilibres toroiedaux, au moyen de la courbure toroiedale globale, pour creer les regions a {Delta}B favorable. La transformee rotationnelle est engendree par un enroulement helicoiedal du type Script-Small-L = 2. Sa stagnation est obtenue par un champ poloiedal auxiliaire. (author) [Spanish] Se establece en la presente memoria un criterio de estabilidad respecto del intercambio gravitatorio en los sistemas toroidales, usando la ecuacion hidrodinamica en la cual se tiene en cuenta una resistividad finita. La estabilidad depende de una expresion que se reduce al signo de la derivada segunda del volumen por unidad de flujo (V'') en el caso de que el plasma no rodee a ningun conductor 'flotante'. Si esta condicionlno se cumple aparece una inestabilidad resistiva rapida mientras que, en caso contrario, tanto el indice de aumento de la inestabilidad resistiva como el valor critico de {beta} mas alla del cual se manifiesta el modo de 'inflacion' depende de un valor caracteristico Tilde-Operator rRc {gamma}/L{sup 2}, donde r es el radio del plasma, L la distancia que separa las zonas 'buenas' {gamma} 'malas', medida a lo largo de las lineas de fuerza, R{sub c} el radio de curvatura medio, y {gamma} un factor de forma que depende de detalles de la configuracion. Analogas consideraciones se aplican a los modos 'serpenteados'. Sobre la base de los resultados de los calculos numericos, los autores analizan la estructura, las propiedades de estabilidad y el valor

  7. PREFACE: International Symposium on Vacuum Science & Technology and its Application for Accelerators (IVS 2012)

    Science.gov (United States)

    Pandit, V. S.; Pal, Gautam

    2012-11-01

    clearly indicates that industry has advanced quite significantly. During the symposium, the Indian Vacuum Society honoured two distinguished personalities for their remarkable and significant contributions to the field of vacuum science and development of technology in the country. Awards were presented for both oral and poster papers during the symposium. A committee evaluated the scientific content and clarity of presentation of contributed papers. We believe that deliberations and discussions at the symposium will help gain a better understanding of the complicated and involved technology of vacuum science and be of benefit to scientists and technologists. Subimal Saha Convener Gautam Pal Co-Convener V S Pandit Secretary Surajit Pal Treasurer Conference photograph International Advisory Committee National Advisory Committee S BanerjeeDAE/IndiaR K Bhandari (Chairman)VECC Rockett AngusAVS/USAD L BandyopadhyayIVS A V Dadve CdrPfeiffer Vac /IndiaS B BhattIPR M Barma TIFR/IndiaK G BhushanBARC R K BhandariVECC/IndiaAlok ChakrabartiVECC R C BudhaniNPL, IndiaD P ChakravartyBARC Shekhar ChanderCEERI/IndiaTushar DesaiMumbai Univ S C ChetalIGCAR/IndiaR DeyVECC K L ChopraIIT Delhi/IndiaS C GadkariBARC Christian DayKIT/GermanyS K GuptaIUVSTA/India Kraemer DieterFAIR/GermanyShrikrishna GuptaBARC L M GantayatBARC/IndiaRajendra JatharAgilent Technologies R B GroverDAE, BARC/IndiaS N JoshiCEERI P D Gupta RRCAT/IndiaD KanjilalIUAC Szajman JakubVSA/AustraliaC MallikVECC R N JayarajNFC/IndiaS G MarkandeyaBRNS S KailasBARC/IndiaK C MittalBARC P K KawIPR/IndiaS NagarjunHHV Bangalore Lalit KumarMTRDC/IndiaK G M NairIGCAR Jean Larour Ecole/FranceGautam Pal (Co-convener)VECC Marminga LiaTRIUMF/CanadaSurajit Pal (Treasurer)VECC Shekhar MishraFermilab/USA V S Pandit (Secretary)VECC Ganapatirao MyneniJlab/USaR G PillayTIFR S V NarasaiahHHV/IndiaMohan PradeepNPL K RadhakrishnanISRO/IndiaY Ranga RaoVac Techniques A S Raja RaoIVS/IndiaR RanganathanSINP T RamasamiDST/IndiaSubimal Saha (Convener