WorldWideScience

Sample records for vsa heli meripld

  1. Dicty_cDB: VSA508 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA508 (Link to dictyBase) - - - Contig-U13926-1 VSA508Z (Link... to Original site) - - VSA508Z 492 - - - - Show VSA508 Library VS (Link to library) Clone ID VSA508 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/VS/VSA5-A/VSA508Q.Seq.d/ Representative seq. ID VSA508...Z (Link to Original site) Representative DNA sequence >VSA508 (VSA508Q) /CSM/VS/VSA5-A/VSA508Q.Seq.d/ XXXXX...nkntpsinyl*ikk Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSA508 (VSA508

  2. Heli Laaksonen ja Jan Rahman

    Index Scriptorium Estoniae

    2006-01-01

    Rahman, Jan ; Heli Laaksonen. Maapuupäiv : [luulõtuisi : runoi]. Võru : Võro Selts VKKF : Sammakko, 2000. Kohtumine väljaande tutvustamiseks Tartu Kirjanduse Majas 13. jaan. Vt. ka Eesti Päevaleht : Arkaadia, 13. jaan., lk. 16

  3. Arnold Hely and Australian Adult Education

    Science.gov (United States)

    Morris, Roger

    2011-01-01

    Arnold Hely (1907-1967) was a most significant figure in the history of adult education in New Zealand, in Australia and internationally. Arnold Hely, a New Zealander, Director of Tutorial Classes (later Adult Education) at the University of Adelaide from 1957 to 1965, was the prime mover in the establishment in 1964 of the Asian South Pacific…

  4. Dicty_cDB: VSA477 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA477 (Link to dictyBase) - - - - VSA477Z (Link to Original s...ite) - - VSA477Z 609 - - - - Show VSA477 Library VS (Link to library) Clone ID VSA477 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...AA sequence update 2000. 2.21 Translated Amino Acid sequence ---FLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDKGCVWCGSE GICT...nce (All Frames) Frame A: ---FLTFVNSSEIDHQYSLTSSINGSSSGVSNSTDNTGCGEYTSCGDCREDKGCVWCGSE GICTEGTFYGTKPLNINGACK

  5. Dicty_cDB: VSA762 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VSA762 (VSA762Q) /...8 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AL603886 |AL603886...Homology vs Protein Score E Sequences producing significant alignments: (bits) Value AM285329_10( AM285329

  6. Dicty_cDB: VSA624 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA624 (Link to dictyBase) - - - Contig-U15476-1 VSA624E (Link to Original site)...- - - - - - VSA624E 556 Show VSA624 Library VS (Link to library) Clone ID VSA624 (Link to dictyBase)...AL398924 |AL398924.1 T7 end of clone AS0AA012A08 of library AS0AA from strain CLIB 533 of Saccharomyces bayanus...AL402826 |AL402826.1 T7 end of clone AT0AA004H11 of library AT0AA from strain CBS 4311 of Saccharomyces servazzii...AL392519 |AL392519.1 T3 end of clone AR0AA005C02 of library AR0AA from strain CBS 732 of Zygosaccharomyces

  7. Dicty_cDB: VSA138 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA138 (Link to dictyBase) - - - Contig-U15185-1 VSA138E (Link to Original site)...- - - - - - VSA138E 332 Show VSA138 Library VS (Link to library) Clone ID VSA138 (Link to dictyBase)...AL116011 |AL116011.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15...AL116009 |AL116009.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15...AL115603 |AL115603.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 3e-15

  8. Dicty_cDB: VSA643 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA643 (Link to dictyBase) - - - Contig-U15185-1 VSA643E (Link to Original site)...- - - - - - VSA643E 380 Show VSA643 Library VS (Link to library) Clone ID VSA643 (Link to dictyBase)...AL116011 |AL116011.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 4e-15...AL116009 |AL116009.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 4e-15...AL115603 |AL115603.1 Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 84 4e-15

  9. Dicty_cDB: VSA228 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VS (Link to library) VSA228 (Link to dictyBase) - - - Contig-U06228-1 VSA228Z (Link to Original site)...- - VSA228Z 586 - - - - Show VSA228 Library VS (Link to library) Clone ID VSA228 (Link to dictyBase)...AL402293 |AL402293.1 T3 end of clone AT0AA001A10 of library AT0AA from strain CBS 4311 of Saccharomyces servazzii...AL402477 |AL402477.1 T3 end of clone AT0AA002C09 of library AT0AA from strain CBS 4311 of Saccharomyces servazzii...AL404331 |AL404331.1 T3 end of clone AT0AA014F06 of library AT0AA from strain CBS 4311 of Saccharomyces servazzii

  10. 76 FR 16462 - In the Matter of Heli Electronics Corp., Order of Suspension of Trading

    Science.gov (United States)

    2011-03-23

    ... From the Federal Register Online via the Government Publishing Office SECURITIES AND EXCHANGE COMMISSION In the Matter of Heli Electronics Corp., Order of Suspension of Trading March 21, 2011. It appears... concerning the securities of Heli Electronics Corp. (``HELI''), a Nevada corporation with headquarters and...

  11. The effect of virtual sales agent (VSA) gender – product gender congruence on product advice credibility, trust in VSA and online vendor, and purchase intention

    NARCIS (Netherlands)

    Beldad, Ardion Daroca; Hegner, Sabrina; Hegner, Sabrina; Hoppen, Jip

    2016-01-01

    Online vendors are increasingly using virtual sales assistants (VSA), either in the form of an animated picture or a photograph of a real person, to help customers with their product-related information needs. Currently, what is known is that the use of a VSA in an online web shop results in

  12. MMA/MPEOMA/VSA copolymer as a novel blood-compatible material: ex vivo platelet adhesion study.

    Science.gov (United States)

    Lee, Jin Ho; Oh, Se Heang; Kim, Won Gon

    2004-02-01

    MMA/MPEOMA/VSA copolymers with both pendant polyethylene oxide (PEO) side chains and negatively chargeable side groups were synthesized by random copolymerization of methyl methacrylate (MMA), methoxy PEO monomethacrylate (MPEOMA; PEO mol. wt, 1000), and vinyl sulfonic acid sodium salt (VSA) monomers with different monomer composition to evaluate their blood compatibility. MMA/MPEOMA copolymer (with PEO side chains) and MMA/VSA copolymer (with negatively chargeable side groups) were also synthesized for the comparison purpose. The synthesized copolymers were coated onto polyurethane (PU) tubes (inner diameter, 4.6 mm) by a spin coating. The platelet adhesion of the MMA/MPEOMA/VSA copolymer-coated tube surfaces was compared with that of tube surface coated with MMA/MPEOMA or MMA/VSA copolymer with similar MPEOMA or VSA composition, using an ex vivo canine arterio-artery shunt method. The platelet adhesion was evaluated by radioactivity counting of technetium (99mTc)-labeled platelets adhered on the surfaces after 30 and 120 min of blood circulation. The MMA/MPEOMA/VSA copolymer (monomer molar ratio 9/0.5/0.5 or 8/1/1) was better in preventing platelet adhesion on the surface than the MMA/MPEOMA or MMA/VSA copolymer with similar MPEOMA or VSA composition, probably owing to the combined effects of highly mobile, hydrophilic PEO side chains and negatively charged VSA side groups.

  13. Elamusrohked Kuressaare kammermuusika päevad / heli Jalakas ; interv. Ia Remmel

    Index Scriptorium Estoniae

    Jalakas, heli

    2008-01-01

    5.-9. VIII toimunud XIV Kuressaare kammermuusika päevadest jagavad muljeid Kuressaare linna kultuurinõunik Heli Jalakas, Kuressaare muusikakooli viiuliõpetaja Laine Sepp, klaveripedagoog Lembit Tiivas ja EMTA tudeng Kermo Koit

  14. Loomulik ja loominguline koostööprojekt "Ruhrpott" : Ruhri katel / Heli Meisterson ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Meisterson, Heli

    2007-01-01

    Goethe Instituudi kultuuriprogrammide referent Heli Meisterson Nordrhein-Westfaleni Liidumaa kultuurifestifalist "Ruhrpott" Eestis, programmist. 2006. a. eelnenud Baltimaade kultuurifestivali "scene nrw" kava koostamisest

  15. HELI-DEM portal for geo-processing services

    Science.gov (United States)

    Cannata, Massimiliano; Antonovic, Milan; Molinari, Monia

    2014-05-01

    HELI-DEM (Helvetia-Italy Digital Elevation Model) is a project developed in the framework of Italy/Switzerland Operational Programme for Trans-frontier Cooperation 2007-2013 whose major aim is to create a unified digital terrain model that includes the alpine and sub-alpine areas between Italy and Switzerland. The partners of the project are: Lombardy Region, Piedmont Region, Polytechnic of Milan, Polytechnic of Turin and Fondazione Politecnico from Italy; Institute of Earth Sciences (SUPSI) from Switzerland. The digital terrain model has been produced by integrating and validating the different elevation data available for the areas of interest, characterized by different reference frame, resolutions and accuracies: DHM at 25 m resolution from Swisstopo, DTM at 20 m resolution from Lombardy Region, DTM at 5 m resolution from Piedmont Region and DTM LiDAR PST-A at about 1 m resolution, that covers the main river bed areas and is produced by the Italian Ministry of the Environment. Further results of the project are: the generation of a unique Italian Swiss geoid with an accuracy of few centimeters (Gilardoni et al. 2012); the establishment of a GNSS permanent network, prototype of a transnational positioning service; the development of a geo-portal, entirely based on open source technologies and open standards, which provides the cross-border DTM and offers some capabilities of analysis and processing through the Internet. With this talk, the authors want to present the main steps of the project with a focus on the HELI-DEM geo-portal development carried out by the Institute of Earth Sciences, which is the access point to the DTM outputted from the project. The portal, accessible at http://geoservice.ist.supsi.ch/helidem, is a demonstration of open source technologies combined for providing access to geospatial functionalities to wide non GIS expert public. In fact, the system is entirely developed using only Open Standards and Free and Open Source Software (FOSS

  16. The Health Equity Leadership Institute (HELI): Developing workforce capacity for health disparities research.

    Science.gov (United States)

    Butler, James; Fryer, Craig S; Ward, Earlise; Westaby, Katelyn; Adams, Alexandra; Esmond, Sarah L; Garza, Mary A; Hogle, Janice A; Scholl, Linda M; Quinn, Sandra C; Thomas, Stephen B; Sorkness, Christine A

    2017-06-01

    Efforts to address health disparities and achieve health equity are critically dependent on the development of a diverse research workforce. However, many researchers from underrepresented backgrounds face challenges in advancing their careers, securing independent funding, and finding the mentorship needed to expand their research. Faculty from the University of Maryland at College Park and the University of Wisconsin-Madison developed and evaluated an intensive week-long research and career-development institute-the Health Equity Leadership Institute (HELI)-with the goal of increasing the number of underrepresented scholars who can sustain their ongoing commitment to health equity research. In 2010-2016, HELI brought 145 diverse scholars (78% from an underrepresented background; 81% female) together to engage with each other and learn from supportive faculty. Overall, scholar feedback was highly positive on all survey items, with average agreement ratings of 4.45-4.84 based on a 5-point Likert scale. Eighty-five percent of scholars remain in academic positions. In the first three cohorts, 73% of HELI participants have been promoted and 23% have secured independent federal funding. HELI includes an evidence-based curriculum to develop a diverse workforce for health equity research. For those institutions interested in implementing such an institute to develop and support underrepresented early stage investigators, a resource toolbox is provided.

  17. Golden eagle indifference to heli-skiing and military helicopters in northern Utah

    Science.gov (United States)

    Teryl G. Grubb; David K. Delaney; William W. Bowerman; Michael R. Wierda

    2010-01-01

    In 2006-2007, during Wasatch Powderbird Guides (WPG) permit renewal for heli-skiing in the Tri-Canyon Area (TCA) of the Wasatch Mountains, Utah, USA, we recorded 303 helicopter passes between 0 m and 3,000 m (horizontal distance) near >30 individual golden eagles (Aquila chrysaetos) in 22 nesting territories, through passive observation and active experimentation...

  18. 14 CFR 77.29 - Airport imaginary surfaces for heli-ports.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Airport imaginary surfaces for heli-ports. 77.29 Section 77.29 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRSPACE OBJECTS AFFECTING NAVIGABLE AIRSPACE Obstruction Standards § 77.29 Airport...

  19. Siim Nestor soovitab : Hea Uus Heli. Vibe 5. sünnipäev / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2003-01-01

    Üritustest "Võlu Music" Mustpeade Majas 9. okt., "1ÖÖ%" Von Krahlis 10. okt., "Kontsert" Tartu Peetri kirikus 10. okt ja Tallinna Niguliste kirikus 11. okt., "Valge Laigu Klubi" Hobuveskis 11. okt. popmuusikafestivali "Hea Uus Heli" raames. Üritusest "Vibe" Liiva keskuses 11. oktoobril

  20. Siim Nestor soovitab : Hea Uus Heli. Dillinja. Lisa Millett / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2004-01-01

    Jaapanlase Emi Maeda kontserdist Kanuti Gildi saalis 8. okt.ja elektroonilise muusika esitajatest muusikafestivali Hea Uus Heli raames Von Krahlis ning kultuuritehases Polymer 8. ja 9. okt.. Inglise muusik Dillinja üritusel The Force klubis Dekolte 8. okt.. Inglise laulja Lisa Millett klubis BonBon 8. oktoobril

  1. Presidendi preemia said Urmas Kokassaar, Terje Varul, Heli Adamovitš ja Mihhail Gusev / Eve Kruuse

    Index Scriptorium Estoniae

    Kruuse, Eve, 1959-

    2009-01-01

    Vabariigi Presidendi Kultuurirahastu hariduspreemia pälvisid Tartu Ülikooli loodus- ja tehnoloogiateaduskonna loodusteadusliku hariduse keskuse bioloogia didaktika lektor ning Hugo Treffneri gümnaasiumi bioloogia ja keemia süvaõppega loodussuuna bioloogiaõpetaja Urmas Kokassaar, Kolga keskkooli eesti keele ja kirjanduseõpetaja Terje Varul ning Narva lasteaia "Päikene" juhataja Heli Adamovitš. Reaalteaduste eripreemia pälvis Tallinna Tõnismäe Reaalkooli matemaatikaõpetaja Mihhail Gusev

  2. cgHeliParm: analysis of dsDNA helical parameters for coarse-grained MARTINI molecular dynamics simulations.

    Science.gov (United States)

    Faustino, Ignacio; Marrink, S J

    2017-12-01

    We introduce cgHeliParm, a python program that provides the conformational analysis of Martini-based coarse-grained double strand DNA molecules. The software calculates the helical parameters such as base, base pair and base pair step parameters. cgHeliParm can be used for the analysis of coarse grain Martini molecular dynamics trajectories without transformation into atomistic models. This package works with Python 2.7 on MacOS and Linux. The program is freely available for download from https://github.com/ifaust83/cgheliparm. Together with the main script, the base reference files CG_X_std.lib, a number of examples and R scripts are also available from the same website. A tutorial on the use and application is also available at http://cgmartini.nl/index.php/tutorials-general-introduction/tutorial-martini-dna. i.faustino@rug.nl. Supplementary data are available at Bioinformatics online.

  3. CREATION OF A MULTIRESOLUTION AND MULTIACCURACY DTM: PROBLEMS AND SOLUTIONS FOR HELI-DEM CASE STUDY

    Directory of Open Access Journals (Sweden)

    L. Biagi

    2014-01-01

    Full Text Available The work is part of "HELI-DEM" (HELvetia-Italy Digital Elevation Model project, funded by the European Regional Development Fund within the Italy-Switzerland cooperation program. The aim of the project is the creation of a unique DTM for the alpine and subalpine area between Italy (Piedmont, Lombardy and Switzerland (Ticino and Grisons Cantons; at present, different DTMs, that are in different reference frames and have been obtained with different technologies, accuracies, and resolutions, have been acquired. The final DTM should be correctly georeferenced and produced validating and integrating the data that are available for the project. DTMs are fundamental in hydrogeological studies, especially in alpine areas where hydrogeological risks may exist. Moreover, when an event, like for example a landslide, happens at the border between countries, a unique and integrated DTM which covers the interest area is useful to analyze the scenario. In this sense, HELI-DEM project is helpful. To perform analyses along the borders between countries, transnational geographic information is needed: a transnational DTM can be obtained by merging regional low resolution DTMs. Moreover high resolution local DTMs should be used where they are available. To be merged, low and high resolution DTMs should be in the same three dimensional reference frame, should not present biases and should be consistent in the overlapping areas. Cross-validation between the different DTMs is therefore needed. Two different problems should be solved: the merging of regional, partly overlapping low and medium resolution DTMs into a unique low/medium resolution DTM and the merging with other local high resolution/high accuracy height data. This paper discusses the preliminary processing of the data for the fusion of low and high resolution DTMs in a study-case area within the Lombardy region: Valtellina valley. In this region the Lombardy regional low resolution DTM is available, with

  4. Creation of a Multiresolution and Multiaccuracy Dtm: Problems and Solutions for Heli-Dem Case Study

    Science.gov (United States)

    Biagi, L.; Carcano, L.; Lucchese, A.; Negretti, M.

    2013-01-01

    The work is part of "HELI-DEM" (HELvetia-Italy Digital Elevation Model) project, funded by the European Regional Development Fund within the Italy-Switzerland cooperation program. The aim of the project is the creation of a unique DTM for the alpine and subalpine area between Italy (Piedmont, Lombardy) and Switzerland (Ticino and Grisons Cantons); at present, different DTMs, that are in different reference frames and have been obtained with different technologies, accuracies, and resolutions, have been acquired. The final DTM should be correctly georeferenced and produced validating and integrating the data that are available for the project. DTMs are fundamental in hydrogeological studies, especially in alpine areas where hydrogeological risks may exist. Moreover, when an event, like for example a landslide, happens at the border between countries, a unique and integrated DTM which covers the interest area is useful to analyze the scenario. In this sense, HELI-DEM project is helpful. To perform analyses along the borders between countries, transnational geographic information is needed: a transnational DTM can be obtained by merging regional low resolution DTMs. Moreover high resolution local DTMs should be used where they are available. To be merged, low and high resolution DTMs should be in the same three dimensional reference frame, should not present biases and should be consistent in the overlapping areas. Cross-validation between the different DTMs is therefore needed. Two different problems should be solved: the merging of regional, partly overlapping low and medium resolution DTMs into a unique low/medium resolution DTM and the merging with other local high resolution/high accuracy height data. This paper discusses the preliminary processing of the data for the fusion of low and high resolution DTMs in a study-case area within the Lombardy region: Valtellina valley. In this region the Lombardy regional low resolution DTM is available, with a horizontal

  5. Qualidade de vida no trabalho: um estudo de caso das enfermeiras do Hospital Heliópolis Life quality at work: a study of case of the nurses of Heliópolis Hospital

    Directory of Open Access Journals (Sweden)

    Lourdes Margareth Leite Pizzoli

    2005-12-01

    Full Text Available O artigo apresenta um estudo de caso referente à Qualidade de Vida no Trabalho (QVT da população de enfermeiras do Hospital Heliópolis, mediante indicadores baseados nas dimensões do modelo de Richard Walton. Suas dimensões apresentam indicadores amplos que melhor se adaptam à cultura socioeconômica brasileira, adequando-se à condição organizacional da comunidade onde se situa a população-alvo. A instituição é pública, caracterizada por especialidades de alta complexidade, predominância cirúrgica, hospital de referência, em São Paulo. A pesquisa fez parte da dissertação aprovada para mestrado em Ciências da Administração e Valores Humanos no Centro Universitário Capital, em 2002. Pesquisa exploratória, de campo, qualitativa na elaboração fundamental de conceitos para confecção do questionário, e quantitativa nos procedimentos de mensuração das respostas fechadas, com tratamento estatístico por meio de análise descritiva e distribuição das freqüências das variáveis abordadas. Os resultados apresentaram-se positivos quanto à integração, relevância social, oportunidade de uso e ao desenvolvimento das capacidades; e negativos quanto à ausência de reconhecimento pelo trabalho, ausência de plano de carreira, comunicação deficiente e remuneração incompatível com a função.The article presents a study of case referring the verification of Life Quality at Work (LQW of the nurses’ population of Heliópolis Hospital, by means of indicators based on dimensions of the Richard Walton’ model. These dimensions propound wide indicators which better adapt to the Brazilian socioeconomic culture, adapting to the community’s organization structure where situates the target population. The institution is public, characterized by high complexity specialties, with predominance in surgical activity, considered reference hospital, located in São Paulo State, Brazil. The research made part of the dissertation

  6. Etteheited räsivad pidu / Henri Reeder, Ly Rääsk, Heli Jürgenson ... [jt.] ; intervjueerinud Anneli Aasmäe

    Index Scriptorium Estoniae

    2009-01-01

    Küsimustele tänavusele üldlaulu- ja üldtantsupeole minekust ja peo repertuaari raskusest vastavad Aruküla noortekoori laulja Henri Reeder, Äksi segakoori dirigent Ly Rääsk, üldlaulupeo segakooride liigijuht Heli Jürgenson, Laulu- ja Tantsupeo SA muusikatoimetaja Ave Sopp, Laulu- ja Tantsupeo SA tantsutoimetaja Kadri Tiis , Lüganuse segakoori dirigent Priit-Andres Pärtna ja kolme tantsurühma juhendaja Vändrast Kädi Pärnoja

  7. Intervjuu American Wind Symphony Orchestra dirigendi Robert Austin Boudreau'ga = Interview with Mr. Robert Austin Boudreau, director of the American Wind Symphony Orchestra / Robert Austin Boudreau ; interv. Heli Ojamaa

    Index Scriptorium Estoniae

    Boudreau, Robert Austin

    2007-01-01

    11. IV 2007. a. tehtud telefoniintervjuu Robert A. Boudreau'ga, kellele arhitekt Louis I. Kahn disainis kontserdilaevad Point Counterpoint I (valmis 1961) ja Point Counterppoint II (kavandamist alustati 1966, valmis 1975). Louis I. Kahnist, koostööst arhitektiga ja laevadest. Selgitav kaaskiri arhitekt Heli Ojamaalt. Ill.: I laeva makett, II laeva joonised ja 4 värv. fotot

  8. Redescription of two subterranean amphipods Niphargus molnari Méhely, 1927 and Niphargus gebhardti Schellenberg, 1934 (Amphipoda, Niphargidae and their phylogenetic position

    Directory of Open Access Journals (Sweden)

    Dorottya Angyal

    2015-06-01

    Full Text Available A detailed redescription of two endemic, cave-dwelling niphargid species of the Hungarian Mecsek Mts., Niphargus molnari Méhely, 1927 and Niphargus gebhardti Schellenberg, 1934 is given based on newly collected material. Morphology was studied under light microscopy and with scanning electon microscopy. Morphological descriptions are complemented with mitochondrial cytochrome c oxidase subunit I (COI sequences as barcodes for both species and with notes on their ecology. Using three independent molecular markers we showed that N. gebhardti belongs to the clade distributed between Central and Eastern Europe, whereas phylogenetic relationship of N. molnari to the rest of Niphargus species is not clear. The two species from the Mecsek Mts. are phylogenetically not closely related. Both species need to be treated as vulnerable according to IUCN Red List of Threatened Species.

  9. Esiplaanil heli / Harri Slip

    Index Scriptorium Estoniae

    Slip, Harri

    2015-01-01

    Kõrvaklapid hinnaga alla 200 €: AKG Y50BT, Audio-Technica, Beyerdynamic Custom Street, Bose SoundTrue around-ear II, Creative Aurvana Gold, Denon AH-MM200, Focal Spirit One S, Grado SR 80e, JBL Everest V300, Klipsch Reference On Ear, Panasonic RP-HD10, Philips SHB8850NC, Sennheiser HD 25, SMS Audio On-Ear Wired Sport, Sony MDR-100AAP

  10. Muudatustest hooldusravis / Heli Paluste

    Index Scriptorium Estoniae

    Paluste, Heli

    2010-01-01

    Alates 1. jaanuarist 2010. a. moodustab hooldusravi voodipäevade hinnast isiku omaosalus 15 % (VV määrusest nr. 49 (19. veebruarist 2009. a.), mis jõustus 1. jaanuaril 2010. a. ja millega hooldusravi rahastamine muutus)

  11. Kevadtiivul Eestisse / Heli Silma

    Index Scriptorium Estoniae

    Silma, Heli

    2000-01-01

    Kathleen Caillier'i (s. 1967) näitus "Kevadtiivul" La Galerie Passage'is. Eksponeeritud õrnades toonides lillemaalid, natüürmordid ja maastikud aastatest 1994-2000. Kunstnik on täiendanud töid luuleridadega.

  12. Filmile tardunud heli / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2001-01-01

    Kinomajas esitleti Lepo Sumera filmimuusika plaati "Film music by Lepo Sumera" ("Muusikat "Tallinnfilmi" filmidest") firmalt Antes CD. Ka teistest eesti filmiheliloojatest, lähemalt Sumera õpilasest Jüri Reinverest

  13. Saluste gurmeetalus neelab keele alla / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Ingvar Tshizhikovi ja Külli Järgi Saluste turismitalust Vara vallas Tartumaal. Renoveeritud elamust, saunadest, I. Tshizhikovi firmas AS Vinnal kunstnik Igor Shagelini jooniste järgi valminud uksest, mida ehib puulõige "Küllus", 1989. a. ehitatud hoonest, kus asub köök ja saal, vene ahjust, toitudest jm. Seinapaneele, uksi, kaminat ja ahju kaunistavad keraamilised motiivid ja savinõud on teinud keraamik Lea Rahusoo. Saali seinamaalingud on tehtud Kalli Kikase kavandi järgi. 14 ill

  14. Võitjat inspireeris rehetare katus / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2007-01-01

    Tartus 14.-15. IX toimunud Eesti meistrivõistlustest lilleseades. Eesti meister ja juunioride meister - Reine Väli, juuniorid: II koht - Kristiina Roots, III koht - Kristel Veri, seeniorid: II koht - Jevgeni Bulahtin, III koht - Kati Lõhmus

  15. Ene Sepp esitles esikteost "Medaljon" / Heli Talinurm

    Index Scriptorium Estoniae

    Talinurm, Heli

    2009-01-01

    Ene Sepp esitles 19. veebruaril Rapla Keskraamatukogus oma raamatut, mis pälvis kolmanda koha Eesti Lastekirjanduse Teabekeskuse ja kirjastuse Tänapäev 2008. aasta noorsooromaani võistlusel. Ly Ehini mõtteid, mida Ene Sepa raamat temas tekitas

  16. Ülimaruline aplaus flamencole / Heli Talinurm

    Index Scriptorium Estoniae

    Talinurm, Heli

    2006-01-01

    Tohisoo mõisas toimunud flamenco tantsulaagri lõpukontserdist. Laagri korraldaja oli Tallinna Nõmme Noortemaja juurde kuuluva flamencostuudio Fiesta õpetaja Anne Mäses-Anderson, kes kontserdil esines koos Hispaaniast saabunud professionaalse flamencotantsija Estefania Cuevasega

  17. Kaitseliit ja Naiskodukaitse jagasid tunnustust / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2016-01-01

    Kaitseliidu ülem brigaadikindral Meelis Kiili ja Naiskodukaitse esinaise ülesandeid täitev Ave Proos kuulutasid Viljandi pärimusmuusika aidas välja aasta kaitseliitlase ja naiskodukaitsja. Need on Aare Kabel Kaitseliidu Järva malevast ja Triinu Küünal Naiskodukaitse Jõgeva ringkonnast

  18. Sotsiaalteenuste kvaliteedi hindamine ja kontroll / Heli Tooman

    Index Scriptorium Estoniae

    Tooman, Heli, 1949-

    2002-01-01

    Uurimisprojekti "Sotsiaalteenuste vajadus ja kasutamine - territoriaalsed, sotsiaalsed ja kultuurilised erinevused" raames katsetati SERVQUAL meetodit sotsiaalteenuste kvaliteedi mõõtmiseks Pärnu ja Narva sotsiaalasutustes. Tabelid. Bibliogr.

  19. Uus Euroopa - uued turismisihtkohad / Heli Tooman

    Index Scriptorium Estoniae

    Tooman, Heli, 1949-

    2008-01-01

    21.-23. maini Sloveenias toimunud rahvusvahelise turismikonverentsi "New Europa - New Destinations" läbivaks teemaks oli Euroopa uute turismisihtkohtade väljakutsed ning võimalused. Ülevaade professorite Tom Baumi, David Airey, Nigel Hemmingtoni ja Jay Kandampully ettekannetest

  20. Prantslastelt õppimas / Marve Koppel, Heli Leppik

    Index Scriptorium Estoniae

    Koppel, Marve

    2005-01-01

    Kuressaare ametikoolis järgmisel õppeaastal rakenduvast majutuskorralduse eriala õppekavast, mille koostamisel on eeskujuks võetud Prantsuse hotellikooli Lycee d'Hotellerie et de Tourisme Saint-Quentin-en-Yvelines õppekava

  1. Kohtumine minevikus pilguga tulevikku / Heli Susi

    Index Scriptorium Estoniae

    Susi, Heli, 1929-

    2009-01-01

    Reisist Moskvasse detsembris 2008 A. Solženitsõni 90. sünniaastapäevale pühendatud näituse avamisele. Näituse "Eesti saar Gulagi arhipelaagis" koostas ajakirja Вышгород peatoimetaja Ljudmila Gluškovskaja koostöös fondiraamatukoguga Русское Зарубежье. 25. märtsil 2009 avati sama näitus Eesti Rahvusraamatukogus

  2. Uus isikuandmete kaitse seadus / Heli Naeris

    Index Scriptorium Estoniae

    Naeris, Heli

    2008-01-01

    1. jaan. 2008 jõustunud isikuandmete kaitse seadusest, mis sätestab isikuandmete töötlemise tingimused ja korra, riikliku järelevalve teostamise korra isikuandmete töötlemisel ja vastutuse isikuandmete töötlemise nõuete rikkumise eest

  3. Aardejahil Luke mõisapargis / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Lühidalt Luke mõisa ajaloost, omanikest ja mõisaansamblist. Terrasside ja taastatud tiikidesüsteemiga pargist. Külastuskeskusest arhitekt Eva Laarmanni projekti järgi rekonstrueeritud puitpitsiga kärnerimajas. Veenuse kuju taastas firmas Kar-Grupp Tallinnas. SA Luke Mõis juhatuse liige Gea Järvela Luke tulevikuplaanidest. Mõisasüdame makett, 12 värv. vaadet

  4. THE IMPORTANCE OF İBRAHİM ALÂETTİN’S (GÖVSA’S NAMED ÇOCUK ŞİİRLERİ AROUND THE CHILDREN’S LITERATURE İBRAHİM ALÂETTİN’İN (GÖVSA ÇOCUK ŞİİRLERİ ADLI ESERİNİN ÇOCUK EDEBİYATINDAKİ YERİ

    Directory of Open Access Journals (Sweden)

    A. Mecit CANATAK

    2011-06-01

    Full Text Available İbrahim Alâettin (Gövsa has got an extremely sensitive and tactful personality. Furthermore he was interested in training children, psikology of children and litterature of children. His studies which about in that matters are very important. His poems and proses have been make out in Turkish litterature. But İbrahim Alâettin’s poems and proses are the first important precisions. Accordingly he has been regarded the builders of the Children’s Litterary Çocuk Şiirleri (Child’s Poems which published in 1911 is considerable study. İt is not only firstly product but also typed to state of mind of children. He comprehended political, literary, jurdicial, economical, social and intellectual issue of Tanzimat (Administratie Reforms, 1839, Meşrutiyet (Constitastional Monarchy and Cumhuriyet Devri (Cumhuriyet Area. The conceptions and feelings which invented from his poems was released by him is suitable of children’s minds İnce ruhlu ve aşırı duyarlı bir kişiliği olan İbrahim Alâettin’in (Gövsa çocuk eğitimi, çocuk psikolojisi ve Çocuk edebiyatı alanındaki çalışmaları ve analizleri dikkate değerdir. Türk Edebiyatında İbrahim Alâettin’e kadar Çocuk edebiyatı alanında birçok şiir ve düz yazı kaleme alınmış olmakla beraber, çocuk duyarlılığı noktasında önemli analiz ve bulguların onunla başladığı söylenebilir. Dolayısıyla Çocuk edebiyatının temellerini bilinçli bir şekilde oluşturanlardan biridir. Sanatçının 1911 yılında ilk baskısı yapılan Çocuk Şiirleri adlı eseri, Çocuk edebiyatı sahasında yazılmış önemli bir çalışmadır. Eserin önemi, alanında hem ilk olması hem de çocukların ruh hâliyle kaleme alınmış olmasıyla alakalıdır. Siyasi, edebi, hukuki, iktisadi, toplumsal ve düşünsel anlamda büyük değişimlerin olduğu ve arayışların yaşandığı Meşrutiyet ve Cumhuriyet dönemlerini idrak eden İbrahim Alâettin, muhtelif

  5. Dicty_cDB: VSA376 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence ---fsscsk*EFVFVCADEKLESYWKYQFENGDCRVLFRPKICNTNDVNTFKLETIIPTQ GVYTLMTRLNIKTNEQKMK...(All Frames) Frame A: ---fsscsk*EFVFVCADEKLESYWKYQFENGDCRVLFRPKICNTNDVNTFKLETIIPTQ GVYTLMTRLNIKTNEQKMK

  6. Dicty_cDB: VSA204 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ne 3D7, *** SEQUENCING IN PROGRESS ***, 4 unordered pieces. 36 0.001 6 BQ045548 |BQ045548.1 EST594665 P. infestans-challenged...mRNA sequence. 54 0.002 1 BQ047121 |BQ047121.1 EST596239 P. infestans-challenged potato leaf, incompatible r

  7. Dicty_cDB: VSA450 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e N BD283099 |BD283099.1 Flea head, nerve cord, hindgut and malpighian tubule nucleic acid molecules, protei...ns and uses thereof. 48 2e-06 2 BF779954 |BF779954.1 3254-25 hindgut and Malpighian tubule cDNA library Cten

  8. Dicty_cDB: VSA387 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ---HLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIARVLTVFNQTQKNHLRAVYSKK SSSKIPTDLRYKKTRAIRRRLTNKQXKVVTLRVSKTATNFPQRVFAVKA*ici*milk...QVKSPNPSKLAKIGTVRKAIARVLTVFNQTQKNHLRAVYSKK SSSKIPTDLRYKKTRAIRRRLTNKQXKVVTLRVSKTATNFPQRVFAVKA*ici*milknk iy*k

  9. Dicty_cDB: VSA557 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence ---nnsnfn*fwk*RYSMGNVTAFYPGSEEDLIGLEKSMKLVEALIEEEIKXGIPAERII LSGFSQGGALTLYTGYQSKHKLAALITLSGFSPSLS...C: ---nnsnfn*fwk*RYSMGNVTAFYPGSEEDLIGLEKSMKLVEALIEEEIKXGIPAERII LSGFSQGGALTLYTGYQSKHKLAALITLSGFSPSLS

  10. Dicty_cDB: VSA677 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available genomic clone UUGC1M0179J20 R, DNA sequence. 44 1.3 1 CA304055 |CA304055.1 As_adfo_10H09_T3 Ascaris... suum adult female ovary Ascaris suum cDNA clone As_adfo_10H09 5', mRNA sequence. 44 1.3 1

  11. Dicty_cDB: VSA222 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available e) Lepeophtheirus salmonis Pacific fo... 78 2e-13 BT076915_1( BT076915 |pid:none) Caligus rogercresseyi clon...e crog-e... 74 4e-12 BT077060_1( BT077060 |pid:none) Caligus rogercresseyi clone

  12. 33 CFR 104.305 - Vessel Security Assessment (VSA) requirements.

    Science.gov (United States)

    2010-07-01

    ... baggage; and (vi) Vessel stores; (2) Threat assessments, including the purpose and methodology of the... availability of security communications, information, and equipment. (c) Analysis and recommendations. In... may, if damaged or used illicitly, pose a risk to people, property, or operations on board the vessel...

  13. Dicty_cDB: VSA820 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ---vmklfrgsn*lfyfyfn*HPTFFFFFFYYFFNFILFFIFXXFIFYFCTDTNSKLIII SPYTFPHVYINI...sequence (All Frames) Frame A: ---vmklfrgsn*lfyfyfn*HPTFFFFFFYYFFNFILFFIFXXFIFYFCTDTNSKLIII SPYTFPHVYINI

  14. Dicty_cDB: VSA637 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 092 1 BI977733 |BI977733.1 lC02 Old Blush petal SMART library Rosa chinensis cDNA 5' similar to unknown...36 1 BI978917 |BI978917.1 yF10 Old Blush petal SMART library Rosa chinensis cDNA 5' similar to calmodulin

  15. Dicty_cDB: VSA561 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 38 7e-10 4 AF014821 |AF014821.1 Pisum sativum developmentally regulated GTP binding protein (PsDRG1) mRNA...of the end of plasmid PT025E15. Similarity to DEVELOPMENTALLY REGULATED GTP-BINDING PROTEIN 1 (DRG 1) (XDRG)...magnipapillata cDNA 3' similar to SW:DRG_XENLA P43690 DEVELOPMENTALLY REGULATED GTP-BINDING PROTEIN DRG ;, mRNA...Gm-c1075-3081 5' similar to TR:O22445 O22445 DEVELOPMENTALLY REGULATED GTP BINDING PROTEIN. ;, mRNA sequence...magnipapillata cDNA 3' similar to SW:DRG_XENLA P43690 DEVELOPMENTALLY REGULATED GTP-BINDING PROTEIN DRG ;, mRNA

  16. Dicty_cDB: VSA185 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 76 4e-14 2 BU768904 |BU768904.1 SJEBZB10 SJE Schistosoma japonicum cDNA, mRNA sequence. 54 0.002 1 AI067329...|AI067329.1 EST209007 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNAS63...|AI067936.1 EST209624 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNCG92...|AI067953.1 EST209642 Schistosoma mansoni, Phil LoVerde/Joe Merrick Schistosoma mansoni cDNA clone SMNCH20...54 0.002 1 BU776849 |BU776849.1 SJEDDD08 SJE Schistosoma japonicum cDNA, mRNA sequence. 54 0.002 1 AI067312

  17. Dicty_cDB: VSA479 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .y1 Gm-c1049 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1049-2353 5' similar to TR:O49447 O49447 AD...92b04.y1 Gm-c1016 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1016-7592 5' similar to TR:O49447 O494...ine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1017-4139 5' similar to TR:O49447

  18. Dicty_cDB: VSA282 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available uence. 50 0.021 1 BZ586316 |BZ586316.1 3590_1_16_1_B11.x_1 3590 - RescueMu Grid M Zea mays genomic, DNA sequ...ence. 50 0.021 1 BZ588965 |BZ588965.1 3590_1_61_1_E08.x_1 3590 - RescueMu Grid M ...ne BOGAN34, DNA sequence. 50 0.021 1 BZ586318 |BZ586318.1 3590_1_16_1_B12.x_1 3590 - RescueMu Grid M Zea may...s genomic, DNA sequence. 50 0.021 1 BZ591743 |BZ591743.1 3590_1_64_1_C11.x_1 3590 - RescueMu Grid

  19. Dicty_cDB: VSA753 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AAGAAAAAAAAAAAAA ACTTTGTAAAT sequence update 2000. 2.21 Translated Amino Acid sequence iykyqhcyflqiff*hitt...*dhhplfiylkkkke qnvveipkpkkqf*iyqe*rrtiig*skrqs*ihfpikkkn*f*lkf*sqihkrim*ii* kkkk*qplyvskkikekkkklck Frame C: iykyqhcyflqiff*hitt

  20. Dicty_cDB: VSA330 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available QKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Translated Am...TRAIRRRFTNKQSKVVTLRVSKTATNFPQRVF AVKA*ici*milknkiy*kkekkkkkkkkkkkkkkk Frame C: kklkllnsepktrlnylntsrnselssqv

  1. Dicty_cDB: VSA850 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IRRRLTNKQSKVVTLRVSKTATN FPQRVFAVKA*ici*milknkiy*k Translated Amino Acid sequence (All Frames) Frame A: QNFNM...RVSKTATN FPQRVFAVKA*ici*milknkiy*k Frame B: kistwpkklkllnsepktrlnylntsrnselssqv*e...AEKTKAFELRTKNKTQLLEHLKELRTELSSLRVAQVKSPNPSKLAKIGTVRKAIA RVLTVFNQTQKNHLRAVYSKKSSSKIPTDLRYKKTRAIRRRLTNKQSKVVTL

  2. Dicty_cDB: VSA209 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ed Amino Acid sequence ---GDDKWEDYPQDDNVEGNEANLKVGEAIKNIGNDYFKQGKSLEAIAKYNKALRYLDCC SNIDGLKNVQTICYNNMSQCYLKEKKVPMLWWLQKKH*nyhqmilk...IAKYNKALRYLDCC SNIDGLKNVQTICYNNMSQCYLKEKKVPMLWWLQKKH*nyhqmilkhsleklklyl*wrn mmklskiskkslkpiprikmqnln*kelklqk

  3. Dicty_cDB: VSA723 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence ---SEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKXIQ NMDPHELYTYAKEIQAPLE...kinnfyfyyfflkkkkkk Frame C: ---SEFKVPFVCGCRNLGEALRRISEGAAMIRTKGEAGTGDVVEAVRHARAVNKEIKXIQ NMDPHELYTYAKEIQAPLE

  4. Dicty_cDB: VSA426 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 538 |BI863538.1 kx45d11.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides tri...1858 |BG661858.1 kx07c07.y1 Parastrongyloides trichosuri IL SL1 TOPO v2 Parastrongyloides trichosuri cDNA si...23 3 BI744149 |BI744149.1 kx56c02.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastrongyloides

  5. Dicty_cDB: VSA457 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 38 |BI863538.1 kx45d11.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides tric...858 |BG661858.1 kx07c07.y1 Parastrongyloides trichosuri IL SL1 TOPO v2 Parastrongyloides trichosuri cDNA sim...3 3 BI744149 |BI744149.1 kx56c02.y1 Parastrongyloides trichosuri PA pAMP1 v1 Chiapelli McCarter Parastrongyloides

  6. Dicty_cDB: VSA751 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ngyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides.... 80 1e-18 3 BG661408 |BG661408.1 kx01e04.y1 Parastrongyloides trichosuri IL SL1 TOPO v2 Parastrongyloides t... mRNA sequence. 80 1e-18 3 BG661537 |BG661537.1 kx03b05.y1 Parastrongyloides trichosuri IL SL1 TOPO v2 Parastrongyloides...e. 80 2e-18 3 BG661715 |BG661715.1 kx05e02.y1 Parastrongyloides trichosuri IL SL1 TOPO v2 Parastrongyloide...somal protein S22 (RPS22), and ribosomal protein S14 (RPS14) genes, complete cds. 66 2e-19 3 BI743342 |BI743342.1 kx41g12.y1 Parastro

  7. Dicty_cDB: VSA732 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g significant alignments: (bits) Value N AY077834 |AY077834.1 Sheeppox virus strain NISKHI, complete genome.... 38 4e-05 9 AY077832 |AY077832.1 Sheeppox virus strain TU-V02127, complete genome. 38 4e-05 9 AY077833 |AY077833.1 Sheep

  8. Dicty_cDB: VSA424 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available DGSLCPNSNTCCSASDGSYACCPTP NAQCCSDKQHCCPYQFTCGNGGNICKPQQGXRFSFNR*tklkkhl*tssikkkkkknxnk qfns*cyycfffflkikkkkkkkkkkk...DGSLCPNSNTCCSASDGSYACCPTP NAQCCSDKQHCCPYQFTCGNGGNICKPQQGXRFSFNR*tklkkhl*tssikkkkkknxnk qfns*cyycfffflkikkkkkkkkkkk

  9. Dicty_cDB: VSA296 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NXPV (Nsf Xylem Planings wood Vertical) Pinus taeda cDNA clone NXPV_097_C04 5', mRNA sequence. 38 2.0 2 CC3...12 5', mRNA sequence. 38 2.4 2 BG319073 |BG319073.1 NXPV_023_D07_F NXPV (Nsf Xylem Planings wood Vertical

  10. Dicty_cDB: VSA776 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Translated Amino Acid sequence ---katlfslnnn**s**YNEMTFVKGVCFDPAQAKKSVLDVKETLLNLETQVKKTSLSK DEAVDAYKIYET...sequence (All Frames) Frame A: ---katlfslnnn**s**YNEMTFVKGVCFDPAQAKKSVLDVKETLLNLETQVKKTSLSK DEAVDAYKIYET

  11. Dicty_cDB: VSA791 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SEQUENCE, 16 ordered pieces. 46 0.18 1 CB832903 |CB832903.1 USDA-FP_100931 Adult Alate Brown Citrus Aphid T...Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-13_A08 5', mR...NA sequence. 46 0.18 1 CB832902 |CB832902.1 USDA-FP_100930 Adult Alate Brown Citrus Aphid Toxoptera citricid...a cDNA clone WHWTC-13_A09 5', mRNA sequence. 46 0.18 1 CB909967 |CB909967.1 USDA-FP_101710 Adult Alate Brown Citrus Aphid

  12. Dicty_cDB: VSA260 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 250 0.0 10 CB909775 |CB909775.1 USDA-FP_101518 Adult Alate Brown Citrus Aphid Toxoptera citricida cD...103145 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-42_B01 5', mRNA sequence. 54 3e-0...8D10A.19C CE21417 ;, mRNA sequence. 64 4e-09 2 CD450786 |CD450786.1 USDA-FP_102764 Adult Alate Brown Citrus Aphid...D451804 |CD451804.1 USDA-FP_104110 Adult Alate Brown Citrus Aphid Toxoptera citricida cDNA clone WHWTC-51_A1...1 5', mRNA sequence. 54 6e-09 3 CB814948 |CB814948.1 USDA-FP_100421 Adult Alate Brown Citrus Aphid Toxoptera

  13. Dicty_cDB: VSA883 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IARVLTVFNQTQKNHLRAVYSKKSS SKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici*milknkiy *kkekkkkk Translated ...KAIARVLTVFNQTQKNHLRAVYSKKSS SKIPTDLRYKKTRAIRRRLTNKQSKVVTLRVSKTATNFPQRVFAVKA*ici*milk

  14. Dicty_cDB: VSA527 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |AF462563.1 Hemibagrus nemurus clone PCTB3-1 microsatellite sequence. 44 5e-05 2 BF610997 |BF610997.1 dd96d11...|AF520891.1 Aphelocoma coerulescens clone ApCo31 microsatellite sequence. 46 1e-04 2 CD329868 |CD329868.1 AGENCOURT_14291777

  15. Dicty_cDB: VSA317 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM615669 |BM615669.1 17000687147375 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449732747 5'...BM609776 |BM609776.1 17000687107051 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449692879 5'

  16. Dicty_cDB: VSA312 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available BM594030 |BM594030.1 17000687444142 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449728440 5'...BM606698 |BM606698.1 17000687084185 A.Gam.ad.cDNA.blood1 Anopheles gambiae cDNA clone 19600449696728 5'

  17. Dicty_cDB: VSA304 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |BI814886.1 PfESToaa07f05.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BQ633598.1 PfESToab44b04.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5', mRNA sequence...|BQ596231.1 PfESToab31a06.y1 Plasmodium falciparum 3D7 asexual cDNA Plasmodium falciparum cDNA 5' similar to

  18. Dicty_cDB: VSA514 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available KEFSDQLSDDPIIHSHLTELYSNLLEQDLCRIIEPFSRVEISHIAKLIDLPVDVVERKLS LMILDKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVDLLYEKTNKLS*iis...KEFSDQLSDDPIIHSHLTELYSNLLEQDLCRIIEPFSRVEISHIAKLIDLPVDVVERKLS LMILDKKYNGILDQGTGTLIVFEEQKEDKLFNCSLETIGALSRVVDLLYEKTNKLS*iis

  19. Dicty_cDB: VSA252 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available genomic DNA, chromosome 9, PAC clone:P0705B06, WORKING DRAFT SEQUENCE, 1 ordered pieces. 52 5e-04 3 AP005577...genomic DNA, chromosome 9, BAC clone:OJ1655_B12, WORKING DRAFT SEQUENCE, 1 ordered pieces. 52 0.005 1 AP004777...genomic DNA, chromosome 2, PAC clone:P0458B05, WORKING DRAFT SEQUENCE, 1 ordered pieces. 44 0.025 6 BZ921801...AC007698 |AC007698.1 Homo sapiens chromosome 4, WORKING DRAFT SEQUENCE, 32 unordered pieces. 46 0.34 1...AC116804 |AC116804.4 Mus musculus clone RP24-343C24, WORKING DRAFT SEQUENCE, 9 unordered pieces. 46 0.34 1 AC055861

  20. Dicty_cDB: VSA116 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Homo sapiens chromosome 12 clone RP11-743I10, WORKING DRAFT SEQUENCE, 5 unordered pieces. 42 1.0 1 AC069489...sapiens chromosome 5 clone CTD-2016H11 map 5, WORKING DRAFT SEQUENCE, 27 unordered pieces. 42 1.0 1 AC074297...Homo sapiens chromosome 12 clone RP11-731D10, WORKING DRAFT SEQUENCE, 5 unordered pieces. 42 1.0 1 AP002016...genomic DNA, chromosome 4q22-q24, clone:2016H11, WORKING DRAFT SEQUENCE, unordered pieces. 42 1.0 1 AC112169...1 Homo sapiens chromosome 16 clone ICI-39HD10, WORKING DRAFT SEQUENCE, 172 unordered pieces. 42 1.0 1

  1. Dicty_cDB: VSA544 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CC082389 |CC082389.1 CSU-K33r.23H22.SP6 CSU-K33r Aedes aegypti genomic clone CSU-K33r.23H22, DNA sequence...CC082083 |CC082083.1 CSU-K33r.24F16.SP6 CSU-K33r Aedes aegypti genomic clone CSU-K33r.24F16, DNA sequence...|CC864783.1 NDL.120C14.T7 Notre Dame Liverpool Aedes aegypti genomic clone NotreDame Liverpool-120C14...|CC855774.1 NDL.116I22.SP6 Notre Dame Liverpool Aedes aegypti genomic clone NotreDame Liverpool-116I22...CC154207 |CC154207.1 CSU-K34.128N20.SP6 CSU-K34 Aedes aegypti genomic clone CSU-K34-128N20, DNA sequence

  2. Dicty_cDB: VSA165 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N BQ507669 |BQ507669.2 EST615084 Generation of a set of potato cDNA clones for microarray analyses ...ence. 32 0.070 3 BQ507668 |BQ507668.1 EST615083 Generation of a set of potato cDNA clones for microarray ana

  3. Dicty_cDB: VSA173 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available s) Value N BQ507669 |BQ507669.2 EST615084 Generation of a set of potato cDNA clones for microarray analyses ...ence. 32 0.070 3 BQ507668 |BQ507668.1 EST615083 Generation of a set of potato cDNA clones for microarray ana

  4. Dicty_cDB: VSA292 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available A clone PPCAN74 5' sequence, mRNA sequence. 34 0.001 3 BQ515097 |BQ515097.1 EST622512 Generation of a set of..., mRNA sequence. 34 0.002 3 BQ515098 |BQ515098.1 EST622513 Generation of a set of

  5. Dicty_cDB: VSA803 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AK151375_1( AK151375 |pid:none) Mus musculus bone marrow macrophag... 56 3e-07 AK296587_1( AK296587 |pid:none)...AK150500_1( AK150500 |pid:none) Mus musculus bone marrow macrophag... 56 3e-07 (Q4PF30) RecName: Full=T

  6. Dicty_cDB: VSA268 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TCCGAAGGGAGACC sequence update 2000. 2.29 Translated Amino Acid sequence hasglndkfkv*GEKIGEIEESCKRKMFITDLYANKKKDVRMNERL*gkykkelai...*eknvyngslck*ekgrtnerkvigki*krvsnsn*r sinirret Frame C: hasglndkfkv*GEKIGEIEESCKRKMFITDLYANKKKDVRMNERL*gkykkelai

  7. Dicty_cDB: VSA537 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sequence SHIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKL GMRHFHLLRNQYHCPTVSLEKIWTLVPESVRK...Frame B: SHIKMPTRFSKHRKSRGDVCAGYGRVGKHRKHPGGRGNAGGLTHHRINFDKYHPGYFGKL GMRHFHLLRNQYHCPTVSLEKIWTLVPESVRK

  8. Dicty_cDB: VSA716 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 4e-14 1 AL112228...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 4e-14 1 AL111406...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 4e-14 1 AL113572...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 4e-14 1 AL116357...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 90 4e-14 1 AL113025

  9. Dicty_cDB: VSA733 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 82 4e-14 2 AL116009...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 82 4e-14 2 AL115603...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 82 4e-14 2 AL112083...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 82 4e-14 2 AL112069...Botrytis cinerea strain T4 cDNA library under conditions of nitrogen deprivation. 82 4e-14 2 AL111042

  10. Dicty_cDB: VSA196 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available quence. 44 0.13 2 BF294945 |BF294945.1 010PbE09 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali P... Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA 5', mRNA sequence. 44 0.

  11. Dicty_cDB: VSA206 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Acid sequence giqlnmmf*LITWVKIKINGFLVVYHENNNNNNNNNYINYIKVSLLVF*swyk*nsknkk *kti*kl Translated Amino Acid...Frames) Frame A: giqlnmmf*LITWVKIKINGFLVVYHENNNNNNNNNYINYIKVSLLVF*swyk*nsknkk *kti*kl Frame B: gss*i*cfn*

  12. Dicty_cDB: VSA232 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NNQKNIFKWLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGRESGSDSWKQYCRRST NTINYGNTMPLSQGINFN*nyqkkktkcnlhninkrillifvhn*kkkkkkkkk...NNQKNIFKWLGPTGSDCGIVNVNVATNGAEIGGAFGGEKETGGGRESGSDSWKQYCRRST NTINYGNTMPLSQGINFN*nyqkkktkcnlhninkrillifvhn*kkkkkkkkk

  13. Dicty_cDB: VSA725 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CRKKKLMISLFYLKIRILKTIKKNCKLFFFFI*kkkklinc ilyvn*yf Frame C: ---npsvkksfqlyvilvivvkkn**fhyfi*kyef*kpskkivnyff...TGTAAATTAATATTTCT sequence update 2000. 2.28 Translated Amino Acid sequence ---ksvs*KIISIICYISHCRKKKLMISLFYL...KIRILKTIKKNCKLFFFFI*kkkklinc ilyvn*yf Translated Amino Acid sequence (All Frames) Frame A: ---kirqlknhfnymly

  14. Dicty_cDB: VSA635 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available m mRNA for unknown protein with homology to spore germination protein. 86 5e-41 5 CA930567 |CA930567.1 MTU4CA.P24.B01 Aspen apex... cDNA Library Populus tremuloides cDNA, mRNA sequence. 34 0.37 2 CA930485 |CA930485.1 MTU4CA.P23.B04 Aspen apex...0.37 2 CA930468 |CA930468.1 MTU4CA.P22.H11 Aspen apex cDNA Library Populus tremuloides cDNA, mRNA sequence. ...34 0.37 2 CA930577 |CA930577.1 MTU4CA.P24.B11 Aspen apex cDNA Library Populus tremuloides cDNA, mRNA sequenc

  15. Dicty_cDB: VSA784 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tula EST MtBC39A08F1 : T3 end of clone MtBC39A08 of cDNA library MtBC from arbuscular mycorrhiza of cultivar...C10B03F1 : T3 end of clone MtBC10B03 of cDNA library MtBC from arbuscular mycorrhiza... cDNA library MtBC from arbuscular mycorrhiza of cultivar Jemalong of Medicago truncatula (barrel medic). 62

  16. Dicty_cDB: VSA678 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available dawvik*IKKKNKMSFLKINKIALKSSTNIDNHHLSKLTSNWIKQAKERDQLENISKLLE LKLELIHKQQQQIKEEQQK*ink*ink*kkikkk* Translated...dawvik*IKKKNKMSFLKINKIALKSSTNIDNHHLSKLTSNWIKQAKERDQLENISKLLE LKLELIHKQQQQIKEEQQK*ink*ink*kkikkk* Homology

  17. Dicty_cDB: VSA531 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Amino Acid sequence FASFFSSTSTSATLNGSSNNKTVVPKSLENISSASQFNFSTFFIISDDDDV****yriik ikkkkkeinkeeenk*engkqkkk*kkkk*kkyi*tik...ikkiylnn*k Frame B: FASFFSSTSTSATLNGSSNNKTVVPKSLENISSASQFNFSTFFIISDDDDV****yriik ikkkkkeinkeeenk*engkqkkk*kkkk*kkyi*tik

  18. Dicty_cDB: VSA155 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VVNPIMSKLYQEGGMPQGGGMPGG MSNDSPKSSNNKVDELD*rnfseenisik*is*kiis**nq*sfsyivhinifife Translated Amino Acid...VVNPIMSKLYQEGGMPQGGGMPGG MSNDSPKSSNNKVDELD*rnfseenisik*is*kiis**nq*sfsyivhinifife Frame B: ---vfqkkk

  19. Dicty_cDB: VSA754 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available LVIPVYNSVSEACQQCPNADVFLNFASHRSAYQSSLLALREPSIQTVVIIAEGVPENEAR SLISIAKKLGKVIIGPATVGGIQAGIQSGEIEVVEPK*ti*tqnfkykykkkkkkkk...LVIPVYNSVSEACQQCPNADVFLNFASHRSAYQSSLLALREPSIQTVVIIAEGVPENEAR SLISIAKKLGKVIIGPATVGGIQAGIQSGEIEVVEPK*ti*tqnfkykykkkkkkkk

  20. Inga Kuusik vallutas tippe Kõrgõzstanis / Heli Talinurm

    Index Scriptorium Estoniae

    Talinurm, Heli

    2007-01-01

    Saku Õlletehase uus finantsdirektor tööst tubakatootja Imperial Tobacco Grupi Kesk-Aasia regiooni finantsdirektorina Kõrgõzstanis, kohalikest inimestest ja töökultuurist. Lisa: Fakte Kõrgõzstani kohta

  1. Trigon Farming ehitab Kaiu moodsa eurolauda / Heli Talinur

    Index Scriptorium Estoniae

    Talinur, Heli

    2007-01-01

    Trigon Farming tegutseb Eestis aastast 2003 ning firmal on laudad peale Kaiu veel Saaremaal Kärlas, lisaks tegutseb firma ka Venemaal ja Ukrainas. Farmingu emafirma on Trigon Agri, mis on noteeritud Stockholmi börsil

  2. Riik toetab 50 miljoniga rikkamaid suurperesid / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Lasterikastele peredele kodu ehitamiseks või remondiks mõeldud toetuse tahab majandusministeerium jagada ainult pangalaenu võtnud perede vahel, mis jätab paljud suurpered abi saamise võimalusest ilma. Vt. samas: Suure pere maja jaoks on annetatud 77 360 krooni; Lasterikaste perede liidu ettepanekud

  3. Juhtimiskriis kirikus / Frederick W Gluck ; tõlk. Heli Leek

    Index Scriptorium Estoniae

    Gluck, Frederick W

    2005-01-01

    USA Kiriku Juhtimise Riikliku Ümarlaua asutajaliige haldus- ja juhtimisprobleemidest ning kaasaegse juhtimissüsteemi rakendamise vajalikkusest katolikus kirikus, paavsti osast kiriku tegevuse ja mõju tõhustamisel. Kommenteerib Eesti Metodisti Kiriku pastor Üllas Tankler

  4. Kõrgharidus on loomult ebavõrdne / Heli Aru

    Index Scriptorium Estoniae

    Aru, Heli

    2007-01-01

    OECD ekspertide hinnangust, mille kohaselt pööratakse Eestis õppurite võimaluste võrdsusele ebaproportsionaalselt vähe tähelepanu, ning ekspertide soovitustest. Autor, OECD projekti Eesti koordinaator leiab, et üldise osalise õppemaksu kehtestamine on väga pragmaatiline. Vt. samas: Rein Raud. Võrdselt haritud või võrdselt võlgu? Küsitlus: kuidas vähendada ebavõrdsust kõrghariduses? Vastavad Maris Mälzer, Madis Habakuk ja Tõnis Lukas

  5. Pekka Toivanen jazzist Eestis / Pekka Toivanen ; interv. Heli Reimann

    Index Scriptorium Estoniae

    Toivanen, Pekka

    2008-01-01

    Lühiintervjuu soome saksofonisti ja pedagoogiga, kes võttis külalisena osa 29. veebruarist 1. märtsini toimunud Tartu Elleri-nimelise muusikakooli korraldatud esimesest noorte jazziüritusest nimetusega "Sax-oo!-foobia"

  6. Lehm lüpsab suust... / Heli Lehtsaar

    Index Scriptorium Estoniae

    Lehtsaar, Heli, 1976-

    2015-01-01

    Lüpsikarja söötmise kogemusi jagavad Piirsalu Põllumajanduse OÜ juht Elvo Leppmaa, OÜ Halinga loomakasvatusjuht Karin Feldmann, OÜ Kehtna Mõis juhataja Märt Riisenberg, Rotaks-R müügijuht Ivo Randveer

  7. Pindalatoetusi saab tänavu taotleda maikuus / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2005-01-01

    Sama ka Vali Uudised 27. aprill 2005, lk. 7 ; Vooremaa : Palamuse Valla Teataja 30. aprill 2005, lk. 3 ; Vooremaa : Pala Teataja 3. mai 2005, lk. 2 artiklis pealkiri kujul: Pindalatoetuse taotlusi ootab PRIA mais ; Vooremaa : Jõgeva Valla Teataja 7. mai 2005, lk. 3 ; Vooremaa : Saare Valla Teataja 14. mai 2005, lk. 2 artiklis pealkiri kujul: PRIA ootab pindalatoetuse taotlusi

  8. Siim Nestor soovitab : Hea Uus Heli / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2007-01-01

    Üritustest Tallinnas muusikafestivalist HUH raames: "Odessa Pop" 4. okt., Pedigree remix-albumi "Ghosts and Corpses" esitlusest 5. okt. Kultuurikatlas, "Krill" 5. okt. Von Krahlis, Cluster ja Analogue Birds 6. okt. Glehni lossis

  9. Täiskasvanute kursusi saadab suur menu / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Euroopa Sotsiaalfondi projekti "Täiskasvanute tööalane koolitus kutseõppeasutustes" raames toimuvad tasuta kursused 37 kutseõppeasutuses ja rakenduskõrgkoolis üle Eesti. Tasuta koolitusi pakuvad ka vabahariduskeskused maakondades

  10. Next Generation HeliMag UXO Mapping Technology

    Science.gov (United States)

    2010-01-01

    data. The output from SkyNet is either an ASCII xyz file or a Geosoft Oasis Montaj compatible database. Oasis is used to visualize the data and apply...advanced processing where required. The SkyNET/ Montaj combination facilitates data review, merging, correction, filtering, interpolation, and target

  11. Lauluväljaku uus skulptuur visualiseerib heli / Andreas Sepp

    Index Scriptorium Estoniae

    Sepp, Andreas

    2011-01-01

    14. mail Tallinna lauluväljakul Euroopa kultuuripealinna segakoori kontserdiga avatavast saksa skulptori Lukas Kühne loodud akustilisest skulptuurist "Chromatico". Teose arhitekt on Rosario Nuin (Uruguay), ehitas Nordecon Betoon

  12. Mis on looming.org? : elektrooniline heli / Andres Lõo

    Index Scriptorium Estoniae

    Lõo, Andres

    2004-01-01

    Võrguajakirjast www.looming.org, kuhu kogutakse infot põhiliselt kahe jaotuse põhjal: muusika ja helieksperimentalism ning kaasaegne kunst, kunsti ja meediaga seonduv. Idee autorid: Hanno Soans ja Andres Lõo. Ilmunud on looming.orgi esimene muusikakogumik "Lilled algebrale"

  13. Alma mater sõnas, pildis ja helis / Varje Sootak

    Index Scriptorium Estoniae

    Sootak, Varje, 1946-

    2007-01-01

    Tartu Ülikooli 375. aastapäeva puhul esitleti ülikooli kohvikus albumit "Universitas Tartuensis 375" ja samanimelise dokumentaalfilmi DVD-d. Viimase stsenaristideks on Jaak Lõhmus ja Lauri Vahtre, režissöörideks Rene Vilbre ja Märten Vaher

  14. ECM. Kauneim heli pärast vaikust / Immo Mihkelson

    Index Scriptorium Estoniae

    Mihkelson, Immo, 1959-

    2007-01-01

    Uutest Saksa plaadifirma ECM heliplaatidest Frode Haltli "Passing Images", Roscoe Mitchell "The Transatlantic Art Ensemble Composition", Chritian Wallumrod "TRhe Zoo Is Far", Valentin Silvestrov "Symphony No. 6"

  15. Kubja talukööki kogunevad mesilased / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Olvi ja Jüri Luguse Kubja mesindustalu renoveeritud köögist 1900. a. ehitatud elumajas Jõgevamaal. Köögis on puudega köetav pliit ja leso. Talus valmistatakse ka mesilasvahast küünlaid. Paljusid esemeid (kruuside kogu, padjad, serviis jm.) kaunistavad mesilaste pildid. Talu postkast on tarukujuline

  16. Miks Soome lehmad lüpsavad rohkem? / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2007-01-01

    Soome lehmad andsid mullu Eesti lehmadest keskmiselt 1600 kg rohkem piima. Kommenteerivad: Põlva Agro OÜ juhatuse esimees Kalev Kreegipuu, EPKK juhatuse liige Olav Kreen, Põllumajandusministeeriumi põllumajandusturu korraldamise osakonna juhataja Mai Talvik. Vt. samas: Võrdlevat statistikat Soome ja Eesti piimatootmise kohta

  17. Mannide dünastia teleekraanil / Heli Mägar

    Index Scriptorium Estoniae

    Mägar, Heli

    2005-01-01

    Lühiseriaal Mannide kirjanikedünastia saatusest 1930-1940-ndail aastail "Mannide perekond" ("Die Manns") : stsenaristid Heinrich Breloer ja Horst Königstein : režissöör Heinrich Breloer : Saksamaa 2001

  18. Uurida või mitte uurida, selles on küsimus ... / Heli Müristaja

    Index Scriptorium Estoniae

    Müristaja, Heli

    2011-01-01

    MTÜ Eesti Turismihariduse Liidu 25.-26. mail toimunud turismiettevõtjate, -õpetajate ja -õppurite ühisseminarist, kus arutati , millist rolli kannavad uuringud kvaliteetsete ja jätkusuutlike turismitoodete ja -teenuste arendamisel. Välisesinejateks olid Tony Harrison Glasgow Caledonia Ülikooli Moffat Centre for Travel & Tourism Business Development vanemkonsultant Šotimaalt ja Soomest Eva Holmberg ning Kaija Lindroth Haaga-Kelia Porvoo üksusest

  19. Berliini kunstielu : aktuaalne, sõltumatu, internatsionaalne... ja vastuoluline / Heli Meisterson

    Index Scriptorium Estoniae

    Meisterson, Heli

    2004-01-01

    IX rahvusvahelisest kaasaegse kunsti messist "Art Forum Berlin", selle raames toimunud Zdenek Felixi kureeritud erinäitusest "Made in Berlin". Eesti kunstnikest olid messil esindatud Ene-Liis Semper ("Oasis", "Uks", esindas Hamburgi galerii Art Agents) ja Jaan Toomik (esindas IBID Projects). New Yorgi moodsa kunsti muuseumi väljapanekust Berliini uues rahvusgaleriis. Friedrich Christian Flicki kollektsiooni väljapanekust Hamburger Bahnhofis

  20. HeliLAINED - puitrütmid ja algoritmid Tallinna muusikanädalal / Siim Tuksam

    Index Scriptorium Estoniae

    Tuksam, Siim, 1986-

    2016-01-01

    2016.a. märtsi lõpus toimunud muusikafestival Tallinn Music Week tõi festivali kontserdisaalidest välja ja hõivas linnaruumi. Eesti Kunstiakadeemia sisearhitektuuri osakonna teise kursuse tudengid kavandasid ja ehitasid linnaruumiinstallatsioonid

  1. Kui hästi või halvasti ... / Jaak Aaviksoo, Piret Hartman, Heli Aru

    Index Scriptorium Estoniae

    Aaviksoo, Jaak, 1954-

    2003-01-01

    TÜ rektor J. Aaviksoo, Üliõpilaskondade Liidu juhatuse esimees P. Hartman ja Haridus- ja Teadusministeeriumi kõrghariduse talituse juhataja H. Aru vastavad küsimusele, kui hästi või halvasti on end õigustanud kõrghariduses aasta toiminud 3+2 süsteem

  2. Peterson pandi lõuendile / Aate-Heli Õun

    Index Scriptorium Estoniae

    Õun, Aate-Heli, 1940-

    2001-01-01

    31. märtsini Viljandi kunstisaalis avatud näitusel "Eesti arhitektuur ja tarbevara minevikust tulevikku" on vaadata ka Urve Sunny-Dzidzaria Johann Köleri Fondi 2001. aasta kunstnikupreemia pälvinud portreemaalide sari Johann Kölerist, Mart Saarest, Lydia Koidulast ja Kristjan Jaak Petersonist (viimase annetas kunstnik Johann Köleri Fondile)

  3. Millised on miljööväärtuslikud alad / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2003-01-01

    Miljööväärtuslikud alad võivad olla terved linnaosad, mis on ühel ajajärgul ehitatud ja mõjuvad terviklikult. Nende alade säilitamiseks koostatakse Kuressaare teemaplaneerigut, mis märatleb reeglid ühe või teise piirkonna ehituse või säilitamise kohta. Kommenteerib Lilian Hansar

  4. Kallis väetis kurnab põllumehi / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2008-01-01

    Alates mullu sügisest on Eestis väetiste hinnad kerkinud poole võrra ja on nüüd kõrgemad kui mujal Euroopas. Vt. samas: NPK väetiste keskmised hinnad veebruaris; Eesti väetiste hinnad aprilli lõpuni või kuni kaupa jätkub (koos km-ga)

  5. Eelmine aasta andis palju häid uusehitisi / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2003-01-01

    Analüüsitakse Kuressaares aasta jooksul valminud ehitusi, sisekujundust ja reklaamisilte. Parimateks tunnistas žürii koosseisus Lilian Hansar, Urmas Sepp, Endla Tuutma, Vello Liiv, Ainar Viires, Tuuli Org, Terje Truumaa, Sulev Vahtre, Urmas Arike ja Rita Tamm ärihoone Ferrumi (Arhitektuuribüroo Alver Trummal Arhitektid), Kohvik-Veski laienduse (projekt Tuuli Org), eramu Tulika 5 (projekt Kiira Soosaar), pansionaadi Uus-Roomassaare 5 ruumikujunduse (kujundaja Vello Liiv) ja raamatukogu infokeskuse reklaamisildi (kujundaja AB Studio 3)

  6. Kunstisaali jõuavad ka meisterlikud akvarellid / Aate-Heli Õun

    Index Scriptorium Estoniae

    Õun, Aate-Heli, 1940-

    2006-01-01

    Viljandi kunstisaalis toimuvatest näitustest. 20. augustini Marko Kekishevi plakatinäitus "Make up". Järgmised väljapanekud on Valli Lember-Bogatkinalt, Vilja Prometilt sõpruskonnaga, Helle Käosaarelt oma õpilastega

  7. Strateegiat juba realiseeritakse / Inge Timoštšuk, Heli Mattisen

    Index Scriptorium Estoniae

    Timoštšuk, Inge, 1970-

    2002-01-01

    26.11.2002 kinnitas TPÜ nõukogu TPÜ õpetajakoolituse strateegia 2001-2005; kommentaarid strateegia koostajate töörühma kuulunud TPÜ akadeemiliselt prorektorilt H. Mattisenilt ja õpetajakoolituse osakonna juhatajalt I. Timoštšukilt, vahendas Anu Mõttus

  8. Alguses oli HELI ja PÄRT, siis Jalaka LAVASTUS / Riina Luik

    Index Scriptorium Estoniae

    Luik, Riina, 1962-

    2010-01-01

    Tõnu Kaljuste ja Peeter Jalaka lavastusest "Alguses oli", lavastuse aluseks Arvo Pärdi teosed "In Principio" ja "Miserere", 17. augustil Noblesse valukojas toimunud etendusest, muusikaline juht Tõnu Kaljuste. Arvo Pärdi pidunädalate ürituste loetelu

  9. PRIA ja MES teevad koostööd maaelu edendamiseks / Heli Raamets

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2004-01-01

    Ilmunud ka: Nädaline : Maakonna Talu Leht, 16. okt. 2004, lk. 1. Põllumajanduse Registrite ja Informatsiooni Amet (PRIA) ning Maaelu Edendamise Sihtasutus (MES) sõlmisid kokkuleppe, mille alusel külaelu arendajatel, kellele PRIA määras või määrab investeeringutoetuse, on võimalik saada omaosaluse rahastamiseks MES-ist laenu või tagatist pangalaenu jaoks

  10. Talutoidu tootjad tahavad varjusurmas "Eesti toidu" programmi ellu äratada / Heli Raamets ; kommenteerinud Karina Loi

    Index Scriptorium Estoniae

    Raamets, Heli, 1975-

    2011-01-01

    Talutootjad leidsid seminaril "Kohalik toit tarbijani 2020 - kuidas?", et nende toodangu paremaks tarbijani jõudmiseks on vaja teha koostööd ning kohaliku toidu strateegia ja tegevuskava oleks vaja kajastada uues maaelu arengukavas

  11. Viron kieli toisena kielenä - opetuksesta Tarton yliopistossa 1820-luvun lopulla / Heli Laanekask

    Index Scriptorium Estoniae

    Laanekask, Heli, 1950-

    2013-01-01

    Artiklis analüüsitakse Tartu Ülikooli eesti keele lektori Johann Samuel Friedrich Boubrigi õpetamise metoodikat, kasutatud allikaid ja loengute sisu. Puudutatakse ka sugulaskeelte - soome ja ungari keele õpetust

  12. Mööblifirmade trump a la carte-teenuses / Heli Lehtsaar

    Index Scriptorium Estoniae

    Lehtsaar, Heli, 1976-

    2008-01-01

    Mööblitootjad on muutuvas majandusolukorras hakanud seeriatootmise asemel pöörama rohkem tähelepanu eritellimustele. Vt. samas: Aktiivne müük ja likviidne käibevara aitavad madalseisu ajal elus püsida. Ain Alvela. Edule pürgiv mööblitootja peab moevooludega kaasa sörkima

  13. VocMat projekt - uudsed e-õppe võimalused turismiasjalistele / Heli Tooman

    Index Scriptorium Estoniae

    Tooman, Heli, 1949-

    2008-01-01

    Turismivaldkonna spetsialistidele mõeldud koolitusprojektist VocMat (Vocational Management Training for the Tourism Industry). Projekti partneriteks Eestis on Ettevõtluse Arendamise Sihtasutuse Turismiarenduskeskus ja Tartu Ülikooli Pärnu kolledzh. Lisa: Kokkuvõte

  14. Kaido Kaare: minu saavutusvajadus on hästi suur / Kaido Kaare ; intervjueerinud Heli Salong

    Index Scriptorium Estoniae

    Kaare, Kaido, 1972-

    2011-01-01

    Intervjuu Kalevi kommivabriku juhiga. Juttu on ka meedia tähelepanust seoses proua Evelin Ilvese tõstatatud transrasvade teemaga. Juuresoleval fotol Kaido Kaare koos proua E. Ilvesega 2010. a. novembris Kalevi valikkäsitöökommide osakonnas

  15. Kaali kraatritest tehtav film jõuab Discovery ekraanile / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2002-01-01

    Urma E. Liiv režissöörina, Riho Västrik Eesti-poolse produtsendina on Saaremaal filmimas populaarteaduslikku filmi "Päikese kodu", mis käsitleb Kaali meteoriidikraatriga seonduvat. Film valmib koostöös lätlastega ning tehakse eesti, läti ja inglise keeles.

  16. Film Kaali meteoriidiplahvatusest võib jõuda teaduskanalile Discovery / Heli Salong

    Index Scriptorium Estoniae

    Salong, Heli, 1958-

    2002-01-01

    Urmas E. Liiv režissöörina, Riho Västrik Eesti-poolse produtsendina on Saaremaal filmimas populaarteaduslikku filmi "Päikese kodu", mis käsitleb Kaali meteoriidikraatriga seonduvat. Film valmib koostöös lätlastega ning tehakse eesti, läti ja inglise keeles

  17. Hans Teiv : mina sellel kohal igavuse üle ei kurda / Hans Teiv ; interv. Heli Salong

    Index Scriptorium Estoniae

    Teiv, Hans

    2004-01-01

    Saare maavanema kohusetäitja ja kandidaat Hans Teiv hindab oma võimalusi saada ametisse kinnitatud, räägib oma tegevusest maavalitsuse osakonnajuhataja ja maakonna juhina ning tutvustab Saaremaa arenguvisioone

  18. Lutshshi film Jevropõ raskrõvajet sut Shtazi / Heli Meisterson

    Index Scriptorium Estoniae

    Meisterson, Heli

    2006-01-01

    Euroopa Filmiakadeemia andis Euroopa 2006.a. parima filmi auhinna sakslase Florian Henckel von Donnersmarcki filmile "Teiste elu" ("Das Leben der Anderen"), mille peaosaline Ulrich Mühe sai parima meesnäitleja auhinna. F. Henckel von Donnersmarck sai ka stsenaristi auhinna. Lisatud Euroopa 2006.a. filmiauhinna saajate nimekiri

  19. Euroopa parim film näitab punase võimu olemust / Heli Meisterson

    Index Scriptorium Estoniae

    Meisterson, Heli

    2006-01-01

    Euroopa Filmiakadeemia andis Euroopa 2006.a. parima filmi auhinna sakslase Florian Henckel von Donnersmarcki filmile "Teiste elu" ("Das Leben der Anderen"), mille peaosaline Ulrich Mühe sai parima meesnäitleja auhinna. F. Henckel von Donnersmarck sai ka stsenaristi auhinna

  20. 27. XI esitles Kanuti gildi saalis Mooste avatud ateljee MOKS video-, heli- ja tegevuskunstiprogrammi "Põhi silmab kagu"...

    Index Scriptorium Estoniae

    2003-01-01

    Esinesid MOKSiga seotud kunstnikud ja rühmitused: John Grzinich, OPA: Slobodanka Stevceska, Denis Saraginovski (Obsessive Possessive Aggression, Makedoonia), Kaarel Vulla, Irene Roos, Jane Remm, OMP: maalikunstnikud Maris Palgi, Eva Orav ja ajakirjanik Maia Möller, Pink Punk: Kristin Kalamees, Margus Tamm, Sandra Jõgeva

  1. Tan Silliksaar, Tõnu Ling : meie piltides ei ole mingit trikitamist ega skandaali / Tõnu Ling, Tan Silliksaar ; interv. Heli Salong

    Index Scriptorium Estoniae

    Ling, Tõnu

    2005-01-01

    Kuressaare kultuurikeskuses ja Saaremaa kunstistuudios avati Tõnu Lingi ja Tan Silliksaare fotonäitus-müük "Maameeste maastikud". Fotod on prinditud spetsiaalsele, kunsti reprodutseerimiseks mõeldud lõuendile. Autorid oma koostööst, fotodest, lõuenditehnikast

  2. Eesti kõrgharidus institutsionaalse akrediteerimise tulemuste taustal ehk Mida juhid peaksid teadma / Maiki Udam, Riin Seema, Heli Mattisen

    Index Scriptorium Estoniae

    Udam, Maiki

    2015-01-01

    2014. aastal Eesti Kõrghariduse Kvaliteediagentuuris tehtud kõrghariduse institutsionaalse akrediteerimise hindamisaruannete kvalitatiivsest analüüsist, millega selgitati välja kõrgkoolide peamised tugevad ja nõrgad küljed

  3. Läänemaa täiskasvanute koolitajad teevad koostööd / Mari Kerde, Heli Kaldas

    Index Scriptorium Estoniae

    Kerde, Mari

    2007-01-01

    Läänemaa Koolitajate Liidu tegevusest ning osalemisest Turu ülikooli Elukestva Õppe ja Hariduse Keskuse (CELE) ja Tallinna Ülikooli Haapsalu kolledži poolt koordineeritavas Varsinais-Soome ja Lääne maakondade täiskasvanute koolitusorganisatsioonide koostööprojektis (AiKo)

  4. Koos tööstusega tagame ohutuma elu- ja töökeskkonna / Kitty Kislenko, Heli Laarmann

    Index Scriptorium Estoniae

    Kislenko, Kitty

    2006-01-01

    Euroopa Liidus on käsil senise kemikaaliohutuse poliitika reform, mille eesmärgiks on paremini kaitsta inimese tervist ja keskkonda, säilitades samal ajal ELi tööstuse konkurentsivõime ja innovatsioon. Selleks on välja töötatud uus kemikaaliohutuse määruse eelnõu (REACH määrus). Sama ka Linnaleht : Tartu 18. aug. 2006, lk. 6; Põhjarannik 12. aug. 2006, lk. 2; Nädaline 22. aug. 2006, lk. 10 ; Pärnu Postimees 21. sep. 2006, lk. 11

  5. Eestimaa saksa tudengite silma läbi ehk Keelekümblus preisi moodi / koostanud Heli Mattisen, Ene Lokk

    Index Scriptorium Estoniae

    2001-01-01

    Vastavalt TPÜ Keelekeskuse ja Münsteri ülikooli vahel sõlmitud lepingule toimuvad TPÜ-s eesti keele kursused saksa tudengitele. Artikkel koosneb katkenditest, mis pärinevad saksa tudengite Hannes Böttcheri, Martina Meieri, Gerhard Locki, Anke Helbichi ja Karen Meieri kirjatöödest teemal "Kui ma teeksin tõetruu filmi Eestist, siis mida ma näeksin"

  6. Kaare Tammaru : Oleksime võinud jätkata Loodna vallana / Kaare Tammaru ; interv. Heli Talinurm

    Index Scriptorium Estoniae

    Tammaru, Kaare

    2008-01-01

    Loodna vallavanem on veendunud, et suure naabriga ühinemata oleks endine Loodna vald praegu paremas olukorras. Arvamust avaldavad Märjamaa vallavanem Eero Plamus ja endine Märjamaa vallavolikogu esimees Sulev Mölder. Lisa: Mõned väljavõtted ühinemiskokkuleppest, mille tekst pärineb 20. märtsist 2002

  7. Tarmo Sumberg : peab lahti saama mainest, et Saaremaa on lõbus peopanemise koht / Tarmo Sumberg ; interv. Heli Salong

    Index Scriptorium Estoniae

    Sumberg, Tarmo

    2004-01-01

    Saaremaal Georg Ots SPA hotelli avav Tarmo Sumberg leiab, et maa- ja omavalitsused peaksid andma väga selge sõnumi inimestele ja politseile, millised reeglid Saaremaal kehtivad ning nõudma nende täitmist. Georg Ots SPA hotelli kontseptsioonist

  8. DTM Cross Validation and Merging: Problems and Solutions for a Case Study Within the Heli-Dem Project

    Science.gov (United States)

    Biagi, L.; Carcano, L.; de Agostino, M.

    2012-07-01

    Almost all official national cartographic bases in Europe include Digital Terrain Models (DTMs). To perform analyses at the borders between countries, transnational geographic information is needed: a transnational DTM can be obtained by merging regional DTMs (usually at low resolution) and other typically local high resolution DTMs. To be used the different DTMs must be in the same three dimensional reference frame, they must not present biases and must be consistent at the nominal scale. The following preliminary actions are required: • 3D reference frame transformation of gridded data, • cross-validation of the regional DTMs, • cross-check of the regional LR DTMs and the local HR DTMs. The paper discusses the study, the implementation and the application of algorithms to solve these problems in the Alpine area between Italy and Switzerland. For this case study, the regional DTMs of Lombardy, Piedmont and Switzerland, respectively with a planimetric resolution of 20, 50 and 25 meters are available. In addition, a LiDAR DTM with a planimetric resolution of 1 meter for the Lombardy and Piedmont hydrographic basins is available. The different DTMs have been transformed to the same reference frame by applying the official national 3D transformations. The cross-validation and the cross-check of the elevation datasets have been performed. All these operations have required the implementation of novel approaches to interpolate and compare DTMs and to spatially analyze their differences.

  9. Shaken and Stirred: A Pilot Project in Arts and Special Education

    Science.gov (United States)

    Ponder, Carol; Kissinger, Lori

    2009-01-01

    In this article, the authors describe VSA arts Tennessee's pilot arts in education project and the many good questions that have arisen from it. From VSA's inception in 2002, Lori Kissinger, Executive Director of VSA Tennessee, planned to find a way to partner with the Tennessee Department of Education based on other state models. VSA arts…

  10. Tarvo Hanno Varres, Mari-Leen Kiipli / Merilin Talumaa, Hanno Soans, Tatjana Kozlova-Johannes

    Index Scriptorium Estoniae

    Talumaa, Merilin, 1986-

    2015-01-01

    Vaatluse alla on võetud Tarvo Hanno Varrese heli- ja videoinstallatsioon "Lindistav põrand" (2015) ja heli- ja videoteos "Betweenland" (2014) ning Mari-Leen Kiipli fotoseeria "The school of dreams" (2012-2015)

  11. Kogu elu tööliste keskel / Aarne Ruben

    Index Scriptorium Estoniae

    Ruben, Aarne, 1971-

    2003-01-01

    Portreefilm filmimees Semjon Shkolnikovist "Igaviku seisukohalt" : stsenarist Igor Ruus : režissöörid Igor Ruus ja Heli Speek : produtsent Igor Ruus : Estonia Film 2002. Lisatud andmed Igor Ruusi, Heli Speegi ja Aarne Rubeni kohta, lk. 114

  12. Sügisnäituse vahetavad välja Jüri Arraku maalid / Aate-Heli Õun ; interv. Tiina Sarv

    Index Scriptorium Estoniae

    Õun, Aate-Heli, 1940-

    2008-01-01

    Näituse korraldajaga XVIII sügiskunstinäitusest ja seda välja vahetavast XVIII jõulunäitusest Viljandi kunstisaalis. Jõulunäitusel on Jüri Arraku maalid Kumu, Tartu Kunstimuuseumi ja Tallinna Kunstihoone kogudest

  13. Uus kunst vanadesse kirikutesse : Kölni Püha Peetruse jesuiidikirik : Ruhri katel / Friedhelm Mennekes ; tõlk. Heli Meisterson

    Index Scriptorium Estoniae

    Mennekes, Friedhelm

    2007-01-01

    Jesuiidikirikule kuuluvast Peter Paul Rubensi maalist "Peetruse ristilöömine" (1638), kunstist kirikus, kunstijaamas eksponeeritud tööde autoreid, kunsti ja kiriku suhtest, endast, huvist kaasaegse kunsti vastu. Reet Varblane Kölni Püha Peetruse jesuiidikiriku õpetajast, kunstijaama initsiaatorist Friedhelm Mennekesest ja kiriku kunstijaamast

  14. Info- ja kommunikatsioonitehnoloogia sotsiaaltöö praktikas STARi infosüsteemi vaatenurgast / Katriin Kukk ; kommenteerinud Heli Joon, Eva Vau, Natalia Rahhinskaja ... [jt.

    Index Scriptorium Estoniae

    Kukk, Katriin

    2013-01-01

    Artikkel annab ülevaate autori Tallinna Ülikooli sotsiaaltöö instituudis 2013. a. kaitstud bakalaureusetööst "Info- ja kommunikatsioonitehnoloogia kasutamine ja mõju sotsiaaltöö praktikas sotsiaalteenuste ja toetuste andmeregistri näitel"

  15. Expression of Plasmodium falciparum erythrocyte membrane protein 1 in experimentally infected humans.

    NARCIS (Netherlands)

    Lavstsen, T.; Magistrado, P.; Hermsen, C.C.; Salanti, A.; Jensen, A.; Sauerwein, R.W.; Hviid, L.; Theander, T.G.; Staalsoe, T.

    2005-01-01

    BACKGROUND: Parasites causing severe malaria in non-immune patients express a restricted subset of variant surface antigens (VSA), which are better recognized by immune sera than VSA expressed during non-severe disease in semi-immune individuals. The most prominent VSA are the var gene-encoded

  16. Human pregnancy-associated malaria-specific B cells target polymorphic, conformational epitopes in VAR2CSA

    DEFF Research Database (Denmark)

    Barfod, L.; Bernasconi, N. L.; Dahlback, M.

    2007-01-01

    Pregnancy-associated malaria (PAM) is caused by Plasmodium falciparum-infected erythrocytes (IEs) that bind to chondroitin sulphate A (CSA) in the placenta by PAM-associated clonally variant surface antigens (VSA). Pregnancy-specific VSA (VSA(PAM)), which include the PfEMP1 variant VAR2CSA...

  17. Effects of pregnancy and intensity of Plasmodium falciparum transmission on immunoglobulin G subclass responses to variant surface antigens

    DEFF Research Database (Denmark)

    Megnekou, Rosette; Staalsoe, Trine; Taylor, Diane W

    2005-01-01

    , the levels of VSA(PAM)-specific antibodies either were very low or negative or were very high, whereas the levels of the antibodies specific for non-PAM type VSA were uniformly high. Interestingly, the levels of VSA(PAM)-specific IgG1 increased with increasing gestational age, while the levels...... status, parity, gestational age, and parasite transmission intensity, whereas only the parasite transmission intensity influenced the levels of IgG specific for non-PAM type VSA. For both types of VSA, the responses were dominated by the cytophilic subclass IgG1, followed by IgG3. In pregnant women...

  18. Plasmodium falciparum variant surface antigen expression varies between isolates causing severe and nonsevere malaria and is modified by acquired immunity

    DEFF Research Database (Denmark)

    Nielsen, Morten A; Staalsoe, Trine; Kurtzhals, Jørgen

    2002-01-01

    of immunity, as disease-causing parasites appear to be those not controlled by preexisting VSA-specific Abs. In this work we report that VSA expressed by parasites from young Ghanaian children with P. falciparum malaria were commonly and strongly recognized by plasma Abs from healthy children in the same area...... to limit the risk of severe disease by discriminating against the expression of VSA likely to cause life-threatening complications, such as cerebral malaria and severe anemia. Such VSA seem to be preferred by parasites infecting a nonimmune host, suggesting that VSA expression and switching are not random......In areas of endemic parasite transmission, protective immunity to Plasmodium falciparum malaria is acquired over several years with numerous disease episodes. Acquisition of Abs to parasite-encoded variant surface Ags (VSA) on the infected erythrocyte membrane is important in the development...

  19. Plasmodium falciparum associated with severe childhood malaria preferentially expresses PfEMP1 encoded by group A var genes

    DEFF Research Database (Denmark)

    Jensen, Anja T R; Magistrado, Pamela; Sharp, Sarah

    2004-01-01

    Parasite-encoded variant surface antigens (VSAs) like the var gene-encoded Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) family are responsible for antigenic variation and infected red blood cell (RBC) cytoadhesion in P. falciparum malaria. Parasites causing severe malaria...... in nonimmune patients tend to express a restricted subset of VSA (VSA(SM)) that differs from VSA associated with uncomplicated malaria and asymptomatic infection (VSA(UM)). We compared var gene transcription in unselected P. falciparum clone 3D7 expressing VSA(UM) to in vitro-selected sublines expressing VSA...... genes, such as PFD1235w/MAL7P1.1, appear to be involved in the pathogenesis of severe disease and are thus attractive candidates for a vaccine against life-threatening P. falciparum malaria....

  20. Homme algaval festivalil Eclectica esitletakse uusi raamatuid / Maarja Pehk

    Index Scriptorium Estoniae

    Pehk, Maarja

    2007-01-01

    Avangardkultuuri festivali "Eclectica 2007" raames on kavas ka Aare Pilve raamatu "Näoline" esitlus pildi-, heli- ja tekstietendusega ning Urmas Nimetu [Reisberg] novellikogumiku "Langemine alla nulli" esitlus

  1. How Spatial is a Whale? Places and Processes in Zoomusicology / Dario Martinelli

    Index Scriptorium Estoniae

    Martinelli, Dario

    2008-01-01

    Zoomusikoloogiast, mis uurib loomade muusikalist tegevust. Loomade muusikataoliste häälitsuste uurimisest. Heli kasutamisest loomadevahelises kommunikatsioonis, muusikast kui imitatsiooni vormist. Muusikast kui sotsiaalsest faktist

  2. Näitused / Katrin Kurik

    Index Scriptorium Estoniae

    Kurik, Katrin

    1998-01-01

    Linnagalerii Tallinnas: Anna Pauli tekstiilid ja Andras Huberi skulptuurid (Ungari); Kullo lastegalerii: Heli Männi ja Tondiraba keskkooli kunstiklasside õpilaste "Veneetsia maskid"; Tammsaare majamuuseum: Kersti Karu keraamika

  3. In vitro selection of Plasmodium falciparum 3D7 for expression of variant surface antigens associated with severe malaria in African children

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Nielsen, Morten A; Vestergaard, Lasse S

    2003-01-01

    . Parasites isolated from young children with severe malaria (SM) tend to express a limited and conserved set of VSA (VSASM) that are both stronger and more commonly recognized by IgG in the plasma of malaria-exposed individuals than VSA (VSAUM) expressed by parasites causing uncomplicated malaria (UM...... and epidemiologically diverse areas of endemic parasite transmission. The described selection method appears a useful tool in the identification of genes encoding VSA involved in severe and life-threatening P. falciparum malaria....

  4. Malaria-induced acquisition of antibodies to Plasmodium falciparum variant surface antigens

    DEFF Research Database (Denmark)

    Ofori, Michael F; Dodoo, Daniel; Staalsoe, Trine

    2002-01-01

    In areas of intense Plasmodium falciparum transmission, protective immunity is acquired during childhood in parallel with acquisition of agglutinating antibodies to parasite-encoded variant surface antigens (VSA) expressed on parasitized red blood cells. In a semi-immune child in such an area......, clinical disease is caused mainly by parasites expressing VSA not recognized by preexisting VSA-specific antibodies in that child. Such malaria episodes are known to cause an increase in agglutinating antibodies specifically recognizing VSA expressed by the parasite isolate causing the illness, whereas...

  5. Dicty_cDB: CFI277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nslated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxnxxxxxxkgxxxxxkxxxxkxyxxxxqxkx*cnxknrixtfn...NKTPVKPKLGEYG QKSIKTK Frame C: ---xxxxxxxxxxxxqxxxxxxxrxxxxxkxlxxqxixxxsxxqtxmq*xk*nxhfqslq ingsspxq*nis*vsa

  6. Insecticide-treated bed nets reduce plasma antibody levels and limit the repertoire of antibodies to Plasmodium falciparum variant surface antigens

    DEFF Research Database (Denmark)

    Askjaer, N; Maxwell, C; Chambo, W

    2001-01-01

    variant surface antigens (VSA) are important in the development of naturally acquired immunity to Plasmodium falciparum malaria and may thus be good indicators of immune status. We have compared the levels of VSA antibodies in plasma from children who have used ITN for 4 years to levels in plasma from...... children from a nearby village not using ITN. A total of 97 plasma samples were analyzed using 13 different P. falciparum isolates. We found that the children using ITN had significantly lower VSA antibody levels and recognized a smaller proportion of the VSA expressed by the tested parasite isolates than...... children not using ITN....

  7. Rapid acquisition of isolate-specific antibodies to chondroitin sulfate A-adherent Plasmodium falciparum isolates in Ghanaian primigravidae

    DEFF Research Database (Denmark)

    Cox, Sharon E; Staalsoe, Trine; Arthur, Paul

    2005-01-01

    vitamin A supplementation. Antibody responses to VSA(CSA) were detected within the first trimester of pregnancy and increased with increasing duration of pregnancy, and they seemed to be isolate specific, indicating that different CSA-adherent parasite lines express antigenically distinct VSA and thus may...... not be as antigenically conserved as has been previously suggested. Levels of anti-VSA(CSA) were not significantly associated with placental malarial infection determined by histology, indicating that primary immune responses to VSA(CSA) may not be sufficient to eradicate placental parasitemia in primigravidae....

  8. Vacuum Switches Arc Images Pre–processing Based on MATLAB

    Directory of Open Access Journals (Sweden)

    Huajun Dong

    2015-01-01

    Full Text Available In order to filter out the noise effects of Vacuum Switches Arc(VSAimages, enhance the characteristic details of the VSA images, and improve the visual effects of VSA images, in this paper, the VSA images were implemented pre-processing such as noise removal, edge detection, processing of image’s pseudo color and false color, and morphological processing by MATLAB software. Furthermore, the morphological characteristics of the VSA images were extracted, including isopleths of the gray value, arc area and perimeter.

  9. Individuaalsete töövaidluste lahendamine töövaidluskomisjonis ja selle õigusliku regulatsiooni vastavus Eesti Vabariigi põhiseadusele : [bakalaureusetöö] / Heli Raidve ; Õigusinstituut ; juhendaja: Heino Siigur

    Index Scriptorium Estoniae

    Raidve, Heli

    2002-01-01

    Individuaalse töövaidluse lahendamise korra õiguslik regulatsioon, töövaidluskomisjoni õiguslik seisund ja sõltumatus, individuaalse töövaidluse lahendamise seaduse kohaldamisest töövaidluskomisjonis tekkivad probleemid

  10. Applying Dynamic Wake Models to Induced Power Calculations for an Optimum Rotor

    Science.gov (United States)

    2009-08-01

    Garcia-Duffy, C., "Study of Root Inflow for a Propeller Blade of Infinite Length," Proceedings of the Heli Japan 2006, Aichi , Japan, November 15-17...Root Inflow for a Propeller Blade of Infinite Length," Proceedings of the Heli Japan 2006, Aichi , Japan, November 15-17, 2006. Peters, D.A., Garcia

  11. The Way It Was Montrealis / Ralf Kall ; fotod: Tõnu Sultson

    Index Scriptorium Estoniae

    Kall, Ralf

    2009-01-01

    dr. prof. Heli-Kristy Kultas-Ilinsky ja dr. prof. Igor Ilinsky külaskäigust Montreali Eesti Pensionäride Klubisse ja mälestusteose Kultas-Ilinsky, Heli-Kristy. The Way It Was: Trafford Publishing, 2008 esitlusest

  12. Variable stiffness actuators: the user’s point of view

    NARCIS (Netherlands)

    Grioli, Giorgio; Wolf, Sebastian; Garabini, Manolo; Catalano, Manuel; Burdet, Etienne; Caldwell, Darwin; Carloni, Raffaella; Friedl, Werner; Grebenstein, Markus; Laffranchi, Matteo; Lefeber, Dirk; Stramigioli, Stefano; Tsagarakis, Nikos; van Damme, Michael; Vanderborght, Bram; Albu-Shaeffer, Alin; Bicchi, Antonio

    Since their introduction in the early years of this century, variable stiffness actuators (VSA) witnessed a sustained growth of interest in the research community, as shown by the growing number of publications. While many consider VSA very interesting for applications, one of the factors hindering

  13. Hepatitis B-vaksien dit te kry? Wle behoort Acquired ...

    African Journals Online (AJOL)

    1983-01-22

    Jan 22, 1983 ... 'n Inaktiveerde hepatitis B-vaksien wat in die VSA as. Heptavax-B (Merck Sharp & Dohme) bekend sman, is in. November 1981 deur die Food and Drug Administration gelisensieer en verlede Junie wyd in die VSA beskikbaar gestel. Huidige inligring dui daarop dat hierdie vaksien binnekort ook in ...

  14. Plasmodium falciparum parasites expressing pregnancy-specific variant surface antigens adhere strongly to the choriocarcinoma cell line BeWo

    DEFF Research Database (Denmark)

    Haase, Rikke N; Megnekou, Rosette; Lundquist, Maja

    2006-01-01

    Placenta-sequestering Plasmodium falciparum parasites causing pregnancy-associated malaria express pregnancy-specific variant surface antigens (VSA(PAM)). We report here that VSA(PAM)-expressing patient isolates adhere strongly to the choriocarcinoma cell line BeWo and that the BeWo line can...

  15. Formant Centralization Ratio: A Proposal for a New Acoustic Measure of Dysarthric Speech

    Science.gov (United States)

    Sapir, Shimon; Ramig, Lorraine O.; Spielman, Jennifer L.; Fox, Cynthia

    2010-01-01

    Purpose: The vowel space area (VSA) has been used as an acoustic metric of dysarthric speech, but with varying degrees of success. In this study, the authors aimed to test an alternative metric to the VSA--the "formant centralization ratio" (FCR), which is hypothesized to more effectively differentiate dysarthric from healthy speech and register…

  16. Differential induction of immunoglobulin G to Plasmodium falciparum variant surface antigens during the transmission season in Daraweesh, Sudan

    DEFF Research Database (Denmark)

    Nielsen, Morten A; Grevstad, Berit; A-Elgadir, Thoraya M E

    2005-01-01

    with severe malaria (VSA(SM)) are frequently recognized by IgG. METHODS: We analyzed levels of anti-VSA IgG in 57 individuals in Daraweesh, Sudan, before and after the transmission season. IgG responses to 79 Plasmodium falciparum isolates from children with defined malaria syndromes and exposed to high...

  17. Variant surface antigen-specific IgG and protection against clinical consequences of pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Shulman, Caroline E; Bulmer, Judith N

    2004-01-01

    BACKGROUND: Pregnancy-associated malaria caused by Plasmodium falciparum adherence to chondroitin sulfate A in the placental intervillous space is a major cause of low birthweight and maternal anaemia in areas of endemic P falciparum transmission. Adhesion-blocking antibodies that specifically...... recognise parasite-encoded variant surface antigens (VSA) are associated with resistance to pregnancy-associated malaria. We looked for a possible relation between VSA-specific antibody concentrations, placental infection, and protection from low birthweight and maternal anaemia. METHODS: We used flow...... selected or not selected for chondroitin sulfate A adhesiveness in-vitro. FINDINGS: Concentrations of plasma IgG specific for VSA, expressed by chondroitin sulfate A-adhering parasites (VSA in pregnancy-associated malaria or vsa-pam), increased with gravidity and were associated with placental histological...

  18. Determinants of variant surface antigen antibody response in severe Plasmodium falciparum malaria in an area of low and unstable malaria transmission

    DEFF Research Database (Denmark)

    A-Elgadir, T M E; Theander, T G; Elghazali, G

    2006-01-01

    The variant surface antigens (VSA) of infected erythrocytes are important pathogenic markers, a set of variants (VSA(SM)), were assumed to be associated with severe malaria (SM), while SM constitutes clinically diverse forms, such as, severe malarial anemia (SMA) and cerebral malaria (CM). This s......The variant surface antigens (VSA) of infected erythrocytes are important pathogenic markers, a set of variants (VSA(SM)), were assumed to be associated with severe malaria (SM), while SM constitutes clinically diverse forms, such as, severe malarial anemia (SMA) and cerebral malaria (CM...... range of isolates had a higher level of VSA Ab against the recognized isolates (correlation coefficient, 0.727, PSMA (P....001). Parasites obtained from patients with SMA or from children were better recognized than isolates obtained from patients with uncomplicated malaria or from adults, P

  19. Reducing door-to-needle times using Toyota's lean manufacturing principles and value stream analysis.

    Science.gov (United States)

    Ford, Andria L; Williams, Jennifer A; Spencer, Mary; McCammon, Craig; Khoury, Naim; Sampson, Tomoko R; Panagos, Peter; Lee, Jin-Moo

    2012-12-01

    Earlier tissue-type plasminogen activator (tPA) treatment for acute ischemic stroke increases efficacy, prompting national efforts to reduce door-to-needle times. We used lean process improvement methodology to develop a streamlined intravenous tPA protocol. In early 2011, a multidisciplinary team analyzed the steps required to treat patients with acute ischemic stroke with intravenous tPA using value stream analysis (VSA). We directly compared the tPA-treated patients in the "pre-VSA" epoch with the "post-VSA" epoch with regard to baseline characteristics, protocol metrics, and clinical outcomes. The VSA revealed several tPA protocol inefficiencies: routing of patients to room, then to CT, then back to the room; serial processing of workflow; and delays in waiting for laboratory results. On March 1, 2011, a new protocol incorporated changes to minimize delays: routing patients directly to head CT before the patient room, using parallel process workflow, and implementing point-of-care laboratories. In the pre and post-VSA epochs, 132 and 87 patients were treated with intravenous tPA, respectively. Compared with pre-VSA, door-to-needle times and percent of patients treated ≤60 minutes from hospital arrival were improved in the post-VSA epoch: 60 minutes versus 39 minutes (PLean process improvement methodology can expedite time-dependent stroke care without compromising safety.

  20. Geographical and temporal conservation of antibody recognition of Plasmodium falciparum variant surface antigens

    DEFF Research Database (Denmark)

    Nielsen, Morten A; Vestergaard, Lasse S; Lusingu, John

    2004-01-01

    The slow acquisition of protection against Plasmodium falciparum malaria probably reflects the extensive diversity of important antigens. The variant surface antigens (VSA) that mediate parasite adhesion to a range of host molecules are regarded as important targets of acquired protective immunity...... (VSASM) that were better recognized by plasma IgG than VSA expressed by other parasites, but importantly, VSASM-type antigens also appeared to show substantial antigenic homogeneity. Our finding that the repertoire of immunologically distinct VSA in general, and in particular that of VSASM...

  1. Research of Video Steganalysis Algorithm Based on H265 Protocol

    Directory of Open Access Journals (Sweden)

    Wu Kaicheng

    2015-01-01

    This paper researches LSB matching VSA based on H265 protocol with the research background of 26 original Video sequences, it firstly extracts classification features out from training samples as input of SVM, and trains in SVM to obtain high-quality category classification model, and then tests whether there is suspicious information in the video sample. The experimental results show that VSA algorithm based on LSB matching can be more practical to obtain all frame embedded secret information and carrier and video of local frame embedded. In addition, VSA adopts the method of frame by frame with a strong robustness in resisting attack in the corresponding time domain.

  2. Drug: D10245 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10245 Mixture ... Drug Bismuth subcitrate - tetracycline - metronidazole mixt; Heli...dac (TN); Pylera (TN) (Bismuth subcitrate [DR:D07587] | Bismuth subcitrate potassium [DR:D09739]), Tetracycl

  3. Valitsus peaks noortebändi Bedwetters autasustama

    Index Scriptorium Estoniae

    2007-01-01

    Rahvaliidu noored peavad vajalikuks, et valitsus autasustaks esimese Eesti bändina MTV Europe Music Awards 2007 galal Saksamaal Münchenis auhinnakategoorias "Euroopa uue heli" tiitli võitnud pop-punkansamblit Bedwetters

  4. Lasva veetorn-galerii = Lasva water tower-gallery / Veronika Valk

    Index Scriptorium Estoniae

    Valk, Veronika, 1976-

    2010-01-01

    Lasva veetorni rekonstrueerimisest klavertrepiga kunstigaleriiks-vaatetorniks. Projekteerija: Zizi & Yoyo. Autorid: arhitekt Veronika Valk, arhitekti abiline Kadri Klementi, kunstnik Peeter Laurits, skulptor Kalle-Priit Pruuden, Kalle Tikas (heli elektroonika). Projekt: 2006-2008, valmis: 2009

  5. Hamletid Krahli proovisaalis - remixed and revisited / Margit Tõnson

    Index Scriptorium Estoniae

    Tõnson, Margit, 1978-

    2006-01-01

    "Hamletid" William Shakespeare'i ainetel Von Krahli Teatri väikeses saalis. Kontseptsioon, lavastus, koreograafia, kujundus, valgus Sasha Pepeljajev, video, heli, elektroonika Taavet Jansen. Esitaja Juhan Ulfsak. Esietendus 3. okt

  6. Kõlakoda - muusika tundeline vägi / Tiit Kändler

    Index Scriptorium Estoniae

    Kändler, Tiit, 1948-

    2008-01-01

    Teaduslikust muusikast - muusika seostest matemaatikaga, süsteemsest lähenemisest muusikale. Heli salvestamisest ja heliteadusest. Leiutajate Thomas Alva Edisoni ja Edouard-Leon Scott de Martinville'i loodud maailma esimestest helitaasesitusseadmetest ja helisalvestustest

  7. Inimesed ostavad kinnisvara asemel üha rohkem teemante / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2005-01-01

    Eesti gemmoloogid Karin Eensaar ja Heli Kuulmann teemantidest kui investeeringust. Kommenteerib Karin Eensaar. Lisad: Maapõu peidab ülivanu kivikesi. Kultusehe number kaks: pärlikee; De Beers. Alrosa. BHP Billiton, Rio Tinto

  8. Aastapreemiad 2004 : Meie nominendid

    Index Scriptorium Estoniae

    2005-01-01

    Areeni kultuuripreemia nominentidest, teiste seas: festivali Hea Uus Heli korraldaja muusik ja DJ Aivar Tõnso, popansambli Pia Fraus laulja Rein Fuks (heliplaadiga "Mooie Island"), popansambel Toe Tag kogumikuga "Legendaarne"

  9. Mitmekesine, mitmel viisil kesine / Ly Lestberg

    Index Scriptorium Estoniae

    Lestberg, Ly, 1965-

    2004-01-01

    Arvustus: Robbe-Grillet, Alain. Džinn : punane auk ebaühtlaste sillutuskivide vahel : moodsa aja lugemik = Djinn : un trou rouge entre les pavés disjoints / Heli Alliku tõlge. [Tallinn] : Valgus, 2004. (Homo ludens)

  10. [Raamat] / Tarmo Rajamets

    Index Scriptorium Estoniae

    Rajamets, Tarmo, 1969-

    2004-01-01

    Tutvustus: Robbe-Grillet, Alain. Džinn : punane auk ebaühtlaste sillutuskivide vahel : moodsa aja lugemik = Djinn : un trou rouge entre les pavés disjoints / Heli Alliku tõlge. [Tallinn] : Valgus, 2004. (Homo ludens)

  11. Very Complicated, indeed! / Jürgen Rooste

    Index Scriptorium Estoniae

    Rooste, Jürgen, 1979-

    2005-01-01

    Marco Laimre ja Killu Sukmiti näitus "Very Complicated Rock'n'Roll" Kunstihoone galeriis kuni 22. V. Heli: Indrek Pinsel, Andres Lõo, Riho Sibul, Erkki-Sven Tüür, Rainer Jancis (heliinstallatsiooni seadmine)

  12. Haiglad võistlevad tulusa ravi pärast / Sigrid Laev

    Index Scriptorium Estoniae

    Laev, Sigrid

    2006-01-01

    Ida-Tallinna keskhaigla taotleb peale vähiravi kõrgema etapi ka lastehaiguste ning veresoontekirurgia ambulatoorse ja statsionaarse ravi litsentse, see tõstaks haigla mitmel erialal Eesti kahe kõrgema piirkonnahaigla tasemele. Kommenteerib Heli Paluste

  13. Eramu Viimsis : Mäekünka 8, Harjumaa = Private home in Viimsi : Mäekünka 8, Harju County / Liina Jänes

    Index Scriptorium Estoniae

    Jänes, Liina, 1977-

    2008-01-01

    Hoone on suures osas valatud monoliitbetoonist ning puhas betoonpind kujundab maja väljast ja seest. Arhitekt Eero Palm. Sisearhitektid: Kadi Kõpper, Heli Aade. I ja II korruse plaan, värv. välisvaade, sisevaade

  14. Mis on sinu pensioniplaan? / Helina Piip ; kommenteerinud Julia Segerkrantz, Liidia Soontak

    Index Scriptorium Estoniae

    Piip, Helina, 1970-

    2012-01-01

    Dotsent Ingrid Allik, ettevõtja Aavo Kokk, majandusteadlane Andres Arrak, laulja Heli Vahing, õpetaja Birgy Lorenz ja taluperenaine Mare Veersalu räägivad pensioniks valmistumisest. Pensionifondidest, investeerimisvõimalustest, pensioni arvestamisest ja õigusest vanaduspensionile

  15. Panustamine töötaja teadmiste testimisse tasub ära / Maio Rannamägi, Kreet Aun, Mari Krumm

    Index Scriptorium Estoniae

    Rannamägi, Maio

    2006-01-01

    If Eesti Kindlustus lõi töötajate teadmiste testimise süsteemi, et omada parimate kindlustusalaste teadmistega personali Eestis. Vt. samas: Teste täiustati pidevalt. Kommenteerivad Heli Kauber ja Annika Jung

  16. Eredamaid helielamusi Helsingi "Avanto'lt" / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2003-01-01

    Helsingi meediakunsti festival 21.-24. 2002. Põhitähelepanu oli koondunud helile. Franz Pomassli heliinstallatsioonist, Briti loomingulise kollektiivi Semiconductor heli- ja pildiperformance'itest, inglise kunstniku Lis Rhodesi videotest jm.

  17. Siim Nestor soovitab : DJ Muggs. Odessa Pop : HUHi soojendus / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2007-01-01

    Üritusest "HipHop Café" 27. sept. Tallinnas Club Hollywoodis, heliplaadi "The Legend of the Mask and the Assassin" esitlusest. Üritusest "Odessa Pop" festivali "Hea Uus Heli" raames 29. sept. Tallinnas Von Krahlis

  18. RadioMentale teritab sotsiaalset närvi / Berk Vaher ; interv. Andres Keil

    Index Scriptorium Estoniae

    Vaher, Berk, 1975-

    2007-01-01

    Tartu Eclectica festivali peakorraldaja prantsuse muusikute tandemist RadioMentale (Eric Pajot, Jean-Yves Leloup), kes miksivad filmidele uut heli peale, tehes seda festivalil Veiko Õunpuu filmile "Tühirand"

  19. Siim Nestor soovitab : HUH : energiaöö. Bad Apples / Siim Nestor

    Index Scriptorium Estoniae

    Nestor, Siim, 1974-

    2006-01-01

    Festivali "Hea Uus Heli" hooaja lõpetamisest 15. dets. Von Krahlis Tallinnas. Ansambli Bad Apples heliplaadi "When Colours Become Day and Night" esitlusest 19. dets. Tallinnas teatri NO99 majas Jazziklubis

  20. Lähiminevik Kinomajas

    Index Scriptorium Estoniae

    2003-01-01

    Homme näidatakse Kinomajas portreefilmi filmimees Semjon Shkolnikovist "Igaviku seisukohalt" : stsenarist Igor Ruus : režissöörid Igor Ruus ja Heli Speek : produtsent Igor Ruus : Estonia Film 2002

  1. Käi oma loomaga tervisekontrollis! / Kadri Kääramees, Angela Sarapuu, Veiko Meus-Salk ... [jt.] ; intervjueerinud Ille Grün-Ots

    Index Scriptorium Estoniae

    2012-01-01

    Vestlusest loomaarstide Kadri Kääramehe, Angela Sarapuu, Veiko Meus-Salki, Andrus Joosti ja Austrias töötava loomaanestesioloogi Heli Särega kui tihti tuleks käia lemmikloomaga tervisekontrollis

  2. Kunstnikud käivad katuseid mööda / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2010-01-01

    Näitus "Linna kohal" Tallinna Linnagaleriis 19. septembrini 2010. Osalevad Anu Vahtra, Johnson & Johnson, Timo Toots, Claudia Doms, Mikk Heinsoo, Urmo Mets, Marit Ilison. Kuraatorid Kadri Klementi ja Helis Teiter. Näituse teemaks on linnamajade kasutamata katusepinnad

  3. Zhemtshuzhina arhitekturõ na mõze Kalvi / Harri Treial

    Index Scriptorium Estoniae

    Treial, Harri

    2003-01-01

    Kalvi mõisa omanikest, peahoone restaureerimisest, pargi korrastamisest ja kujundamisest. Projekteerija: AS Restor, arhitekt Mart Keskküla, sisearhitekt Heli Eensalu, juurdeehituse arhitekt Elo Raukas, pargiarhitekt Kersti Lootus. Restaureerimistööd: OÜ Sado Kaubahoov. 3 ill

  4. Dicty_cDB: Contig-U06303-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available t1= VSA725Z ,1,198 Translated Amino Acid sequence ksvs*KIISIICYISHCRKKKLMISLFYLKIRILKTIKKNCKLFFFFI*kkkklinci...kkinklyii cklif Frame C: ksvs*KIISIICYISHCRKKKLMISLFYLKIRILKTIKKNCKLFFFFI*kkkklincily vn*yf own update 2004.

  5. PRODUKSIE VAN WOL IN MARGINALE STREKE PJ de Wet

    African Journals Online (AJOL)

    Die vleisverbruik per hoof in Suid-Afrika gedurende i,978179 (voorlopig) in vergelyking met die van die Verenigde KoninkTyk, V.S.A. en Australii (1975) kg / per hoof. Skaap. Vark. Hoender. Totaal. Suid-Afrika *. Verenigde Koninkryk **. v.s.A. **. Australid **. 242. 19,6. 50,5. 3e3. 7,0. 7,6. 1,2. 33,4. 3,2. 21,3. 27,9. 14,B. 7,59.

  6. Strains of Lentinula edodes suppress growth of phytopathogenic fungi and inhibit Alagoas serotype of vesicular stomatitis virus Linhagens de Lentinula edodes inibem fungos fitopatogênicos e o vírus da estomatite vesicular, sorotipo Alagoas

    OpenAIRE

    Sasaki, Selma H.; Rosa E.C. Linhares; Nozawa,Carlos M.; Ricardo Montalván; Paccola-Meirelles,Luzia D.

    2001-01-01

    Four Lentinula edodes strains (Le10, 46, K2, Assai) were assessed for their antagonistic effect on four filamentous fungus species of agricultural importance (Helminthosporium euphorbiae, Helminthosporium sp, Fusarium solani and Phomopsis sojae) and on Alagoas serotype of Vesicular Stomatitis Virus (VSA). The L. edodes strains studied had variable effects on the filamentous fungi and on VSA. The K2 and Le10 strains were antagonistic on the fungi assessed and the 46 and K2 strains were efficie...

  7. In Touch with Industry. ICAF Industry Studies 1999

    Science.gov (United States)

    1999-01-01

    de Janeiro, Brazil Petroleos de Venezuela S.A. (PdVSA), Lake Maracaibo, Venezuela PdVSA INTEVEP, Caracas, Venezuela Secretaria de Energia , Buenos...Providing approximately 11 percent of the nation’s electricity, renewable energy falls largely into three basic categories: water, wind, and solar . The...could provide about 500,000 megawatts of electricity.29 8-10 The solar renewable energy market—composed of photovoltaics and solar thermal—though

  8. Hely- és személynevek a magyar internetes gasztronómiai blogok és receptgyűjtemények ételneveiben [Place and personal names in the names of dishes on Hungarian gastronomy blogs and recipes on the Internet

    Directory of Open Access Journals (Sweden)

    Török, Katalin

    2016-12-01

    Full Text Available The paper examines the names of dishes on Hungarian gastronomy blogs from a linguistic point of view. The author has collected 1380 names from one hundred blogs and collections of recipes on the Internet. The collected names include a Hungarian or a foreign place or personal name and were analysed with respect to their semantics and grammar. Place names in the names of dishes include the Hungarian names of settlements, regions, mountains, rivers; also the foreign names of countries, cities, regions, islands; and even the name of a continent. The names of famous people, politicians, historic figures, well-known chefs, TV stars and fictional characters, e.g. film or fairy tale characters can be found among the personal names listed. The examined names of dishes are most often qualifying, possessive or adverbial syntactic units. In many cases, the names include the blogger’s own name or that of the person from whom the blogger borrowed the recipe, or to whom the blogger dedicated the dish.

  9. Hydraulic forces contribute to left ventricular diastolic filling

    Science.gov (United States)

    Maksuti, Elira; Carlsson, Marcus; Arheden, Håkan; Kovács, Sándor J.; Broomé, Michael; Ugander, Martin

    2017-01-01

    Myocardial active relaxation and restoring forces are known determinants of left ventricular (LV) diastolic function. We hypothesize the existence of an additional mechanism involved in LV filling, namely, a hydraulic force contributing to the longitudinal motion of the atrioventricular (AV) plane. A prerequisite for the presence of a net hydraulic force during diastole is that the atrial short-axis area (ASA) is smaller than the ventricular short-axis area (VSA). We aimed (a) to illustrate this mechanism in an analogous physical model, (b) to measure the ASA and VSA throughout the cardiac cycle in healthy volunteers using cardiovascular magnetic resonance imaging, and (c) to calculate the magnitude of the hydraulic force. The physical model illustrated that the anatomical difference between ASA and VSA provides the basis for generating a hydraulic force during diastole. In volunteers, VSA was greater than ASA during 75–100% of diastole. The hydraulic force was estimated to be 10–60% of the peak driving force of LV filling (1–3 N vs 5–10 N). Hydraulic forces are a consequence of left heart anatomy and aid LV diastolic filling. These findings suggest that the relationship between ASA and VSA, and the associated hydraulic force, should be considered when characterizing diastolic function and dysfunction. PMID:28256604

  10. Reducing Door-to-Needle Times using Toyota’s Lean Manufacturing Principles and Value Stream Analysis

    Science.gov (United States)

    Ford, Andria L.; Williams, Jennifer A.; Spencer, Mary; McCammon, Craig; Khoury, Naim; Sampson, Tomoko; Panagos, Peter; Lee, Jin-Moo

    2012-01-01

    Background Earlier tPA treatment for acute ischemic stroke increases efficacy, prompting national efforts to reduce door-to-needle times (DNTs). We utilized lean process improvement methodology to develop a streamlined IV tPA protocol. Methods In early 2011, a multi-disciplinary team analyzed the steps required to treat acute ischemic stroke patients with IV tPA, utilizing value stream analysis (VSA). We directly compared the tPA-treated patients in the “pre-VSA” epoch to the “post-VSA” epoch with regard to baseline characteristics, protocol metrics, and clinical outcomes. Results The VSA revealed several tPA protocol inefficiencies: routing of patients to room, then to CT, then back to room; serial processing of work flow; and delays in waiting for lab results. On 3/1/2011, a new protocol incorporated changes to minimize delays: routing patients directly to head CT prior to patient room, utilizing parallel process work-flow, and implementing point-of-care labs. In the pre-and post-VSA epochs, 132 and 87 patients were treated with IV tPA, respectively. Compared to pre-VSA, DNTs and percent of patients treated ≤60 minutes from hospital arrival were improved in the post-VSA epoch: 60 min vs. 39 min (pLean process improvement methodology can expedite time-dependent stroke care, without compromising safety. PMID:23138440

  11. Hydraulic forces contribute to left ventricular diastolic filling

    Science.gov (United States)

    Maksuti, Elira; Carlsson, Marcus; Arheden, Håkan; Kovács, Sándor J.; Broomé, Michael; Ugander, Martin

    2017-03-01

    Myocardial active relaxation and restoring forces are known determinants of left ventricular (LV) diastolic function. We hypothesize the existence of an additional mechanism involved in LV filling, namely, a hydraulic force contributing to the longitudinal motion of the atrioventricular (AV) plane. A prerequisite for the presence of a net hydraulic force during diastole is that the atrial short-axis area (ASA) is smaller than the ventricular short-axis area (VSA). We aimed (a) to illustrate this mechanism in an analogous physical model, (b) to measure the ASA and VSA throughout the cardiac cycle in healthy volunteers using cardiovascular magnetic resonance imaging, and (c) to calculate the magnitude of the hydraulic force. The physical model illustrated that the anatomical difference between ASA and VSA provides the basis for generating a hydraulic force during diastole. In volunteers, VSA was greater than ASA during 75-100% of diastole. The hydraulic force was estimated to be 10-60% of the peak driving force of LV filling (1-3 N vs 5-10 N). Hydraulic forces are a consequence of left heart anatomy and aid LV diastolic filling. These findings suggest that the relationship between ASA and VSA, and the associated hydraulic force, should be considered when characterizing diastolic function and dysfunction.

  12. Effect of process parameters on power requirements of vacuum swing adsorption technology for CO{sub 2} capture from flue gas

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Jun [Department of Chemical Engineering, P.O. Box 36, Monash University, Victoria 3800 (Australia); Webley, Paul A. [Department of Chemical Engineering, P.O. Box 36, Monash University, Victoria 3800 (Australia)], E-mail: paul.webley@eng.monash.edu.au; Xiao, Penny [Department of Chemical Engineering, P.O. Box 36, Monash University, Victoria 3800 (Australia)

    2008-02-15

    This study focuses on the effects of process and operating parameters - feed gas temperature, evacuation pressure and feed concentration - on the performance of carbon dioxide vacuum swing adsorption (CO{sub 2}VSA) processes for CO{sub 2} capture from gas, especially as it affects power consumption. To obtain reliable data on the VSA process, experimental work was conducted on a purposely built three bed CO{sub 2}VSA pilot plant using commercial 13X zeolite. Both 6 step and 9 step cycles were used to determine the influences of temperature, evacuation pressure and feed concentration on process performance (recovery, purity, power and corresponding capture cost). A simple economic model for CO{sub 2} capture was developed and employed herein. Through experiments and analysis, it is found that the feed gas temperature, evacuation pressure and feed concentration have significant effects on power consumption and CO{sub 2} capture cost. Our data demonstrate that the CO{sub 2}VSA process has good recovery (>70%), purity (>90%) and low power cost (4-10 kW/TPDc) when operating with 40 deg. C feed gas provided relatively deep vacuum is used. Enhanced performance is obtained when higher feed gas concentration is fed to the plant, as expected. Our data indicates large potential for application of CO{sub 2}VSA to CO{sub 2} capture from flue gas.

  13. Hyperventilation and cold-pressor stress echocardiography combined with automated functional imaging non-invasively detected vasospastic angina

    Science.gov (United States)

    Suzuki, Kengo; Akashi, Yoshihiro J; Mizukoshi, Kei; Kou, Seisyou; Takai, Manabu; Izumo, Masaki; Shimozato, Takashi; Hayashi, Akio; Ohtaki, Eiji; Nobuoka, Sachihiko; Miyake, Fumihiko

    2010-01-01

    A 47-year-old male presented with chest discomfort while sleeping. The patient was suspected of having vasospastic angina (VSA) and underwent hyperventilation and cold-pressor stress echocardiography. No chest pain, ECG changes or decreased wall motion was found. However, automated function imaging (AFI) showed decreased peak systolic strain at the apex and postsystolic shortening at both the apex and inferior wall, which was not found before the test. The provocation test revealed 99% stenosis in the right coronary artery #2 at a dose of 50 μg acetylcholine and 90% stenosis in the left coronary artery #8 at a dose of 100 μg. The patient was thus diagnosed as having VSA. The present case demonstrates the usefulness of AFI combined with hyperventilation and cold-pressor stress echocardiography as a screening examination for VSA. PMID:22798093

  14. Evidence for the involvement of VAR2CSA in pregnancy-associated malaria

    DEFF Research Database (Denmark)

    Salanti, Ali; Dahlbäck, Madeleine; Turner, Louise

    2004-01-01

    to chondroitin sulfate A (CSA). Parasites causing PAM express unique VSA types, VSAPAM, which can be serologically classified as sex specific and parity dependent. It is sex specific because men from malaria-endemic areas do not develop VSAPAM antibodies; it is parity dependent because women acquire anti......In Plasmodium falciparum-endemic areas, pregnancy-associated malaria (PAM) is an important health problem. The condition is precipitated by accumulation of parasite-infected erythrocytes (IEs) in the placenta, and this process is mediated by parasite-encoded variant surface antigens (VSA) binding...

  15. Of mice and women: rodent models of placental malaria

    DEFF Research Database (Denmark)

    Hviid, Lars; Marinho, Claudio R F; Staalsoe, Trine

    2010-01-01

    expressed in placental malaria (PM) and specific for chondroitin sulfate A (CSA). In Plasmodium falciparum, these VSA(PM) appear largely synonymous with the P. falciparum erythrocyte membrane protein 1 (PfEMP1) family variant VAR2CSA. As rodent malaria parasites do not possess PfEMP1 homologs......, the usefulness of experimental mouse PM models remains controversial. However, many features of murine and human PM are similar, including involvement of VSAs analogous to PfEMP1. It thus appears that rodent model studies can further the understanding of VSA-dependent malaria pathogenesis and immunity....

  16. Eesti maalikunst aastal 2009 / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2010-01-01

    Maalikunstist, eesti maalikunsti näitustest ja maalikunstnike loomingust, väliskunsti näitustest Eestis 2009. aastal. Samas avaldavad arvamust Jaan Elken, Mari Kartau, Rauno Thomas Moss, Kaido Ole, Anne Pamasto, Tiit Pääsuke, Tõnis Saadoja, Olga Temnikova, Markus Toompere, Heli Tuksam ja Gabriella Uhl

  17. EXAMINATION OF THE PROTEIN PROFILE OF HELICOBACTER PYLORI UNDER DIFFERENT GROWTH CONDITIONS USING MATRIX-ASSISTED LASER DESORPTION MASS SPECTROMETRY

    Science.gov (United States)

    US EPA currently has H. pylori on its Contaminant Candidate List 2 (CCL 2), methods are needed to detect the occurrence of viable H. pylori in drinking water. H. pyloi is an interesting microorganism because it can change from a cultural and metabolically active state with a heli...

  18. Skaalanihe : kunstnikud räägivad / Hanno Soans

    Index Scriptorium Estoniae

    Soans, Hanno, 1974-

    2006-01-01

    Kunstnikud tutvustavad Kumus avanäitusel eksponeeritud kunstiteoseid: Anssi Kasitonni "Jah-monstrum", Chris Evans "Radikaalne lojaalsus", Neeme Külm "Betooni valatud lehm", Cevdet Erek "Teine sild", Heli Ryhänen "Ootus", Hans Hammert "Õhupallikabel", Veronica Brovall "Lahutus", Karsten Konrad "Supersuziseacat", Anders Krüger "Mis silma alt ära, see unustatud", Tommy Stockel "Tulevaste asjade kuju"

  19. Küla arengukava on külaarengu toetuse saamiseks vajalik / Ain Lember

    Index Scriptorium Estoniae

    Lember, Ain

    2004-01-01

    Liikumine Kodukant kavatseb esitada põllumajandusministeeriumile protestikirja, kuna ei nõustu ministeeriumi infopäevadel levitatava tõlgendusega nagu võiks külade taastamise ja arendamise meetme toetust taotleda ka ilma küla arengukavata. Arvamust avaldavad: Maris Ode, Lemmi Maasik, Heli Raamets, Marek Raud ja Sille Rähn

  20. Muusika / Priit Kuusk

    Index Scriptorium Estoniae

    Kuusk, Priit, 1938-

    2005-01-01

    EFK salvestab Pärdi "Miserere", "Salve Regina", Nunc dimittis" ja "Littlemore tractus". Georg Otsa nimelise fondi moodustamisest. Pärimusmuusika Lõikuspeost. 24. - 29. IX esineb Eestis Kieli poistekoor. 15. IX avas peadirigent Olari Elts oma Läti Rahvusliku Sümfooniaorkestri uue hooaja. Heli Veskus on kutsutud esinema Läti Rahvusooperi galakontserdile

  1. Albu mõisa turvaline kelder võõrustab fantaasiamaali õõva / Ave Randviir

    Index Scriptorium Estoniae

    Randviir, Ave, 1981-

    2006-01-01

    Fantaasiamaali näitus "Allmaal" Albu mõisahoones 17.06.-17.07. 2006. Oma teoseid eksponeerivad Peeter Allik, Markus Kasemaa, Ilmar Kruusamäe, Ari Liimatainen, Rauno-Thomas Moss, Priit Pajos (näituse kuraator), Maris Palgi, Margus Rump, Heli Tuhkanen

  2. Üliõpilasteater toob lavale enesetapu / Merilyn Merisalu

    Index Scriptorium Estoniae

    Merisalu, Merilyn

    2008-01-01

    Sarah Kane'i näidendist "4.48. Psühhoos", mis 10. apr. esietendub Athena maja pööningusaalis Tartu Üliõpilasteatri esituses, lavastaja Kalev Kudu, heli-, video-, ja ruumikujunduse teinud kunstnik Kiwa

  3. Akadeemilised üksused : puhkpilliosakond / Toomas Vavilov

    Index Scriptorium Estoniae

    Vavilov, Toomas, 1969-

    2011-01-01

    Toimusid XXI trompetipäevad ja selle raames konverents "Trompetimängu õpetamise põhimõtted". Aavo Ots esitles raamatut "Tuulefantaasia: trompetiõpetaja käsiraamat" ning pälvis Eesti Kultuurkapitali helikunsti sihtkapitali aastapreemia. Con Brio konkursil saavutasid häid tulemusi Heili Rosin, Heli Ernits ja Helena Tuuling.

  4. Akadeemilised üksused : puhkpilliosakond / Toomas Vavilov

    Index Scriptorium Estoniae

    Vavilov, Toomas, 1969-

    2013-01-01

    Korraldati koos Eesti Puhkpilliühinguga Eesti puhk- ja löökpillimängijate konkurss. Toimusid XXIII trompetipäevad ja selle raames konverents "Trompetimängu õpetamise põhitõed III". Yamaha konkursi võitis Heli Ernits. Professor Hannes Altrov pälvis Valgetähe IV klassi teenetemärgi

  5. Tigutorn = The Snail Tower / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Tartus Väike-Turu 5 asuva Tigutorni arhitektuursest lahendusest. Maja alumisel korrusel on äriruumid, ülemistel korrustel korterid. Arhitektid Vilen Künnapu, Ain Padrik, kaasautorid Kristiina Hussar, Kerli Koolma (AB Künnapu & Padrik). Üldruumide kujundus: Heli Eensalu, Sulev Vahtra. Žürii liikme Kalle Komissarovi hinnang kultuurkapitali aastapreemiale esitatud hoonele

  6. Lasva veetorn = Lasva Water Tower / Margit Mutso

    Index Scriptorium Estoniae

    Mutso, Margit, 1966-

    2010-01-01

    Lasva veetorni rekonstrueerimisest klavertrepiga kunstigaleriiks-vaatetorniks. Arhitekt, idee autor Veronika Valk, kaasautor Kadri Klementi, klavertrepi teostus: Kalle-Priit Pruuden, trepi elektrooniline heli: Kalle Tikas, infostendid: Peeter Laurits. Žürii liige Kalle Komissarov žürii hinnangust EK arhitektuuri sihtkapitali 2009. a. väikeobjekti preemia pälvinud hoonele

  7. Tikutopsist teletornini / Mats Õun

    Index Scriptorium Estoniae

    Õun, Mats, 1964-

    2000-01-01

    Sisearhitekt Aate-Heli Õuna loometeest seoes tema Viljandi Kunstisaalis avatud näitusega "Kunstnikud minu elus" (19.07.-10.08.), kus on väljas maalid, tikutopsikavandid, lipud, fotod tema kujundatud ruumidest, objektidest, mälestuskividest ja memoriaalidest

  8. Õpetatud Eesti Selts 1988-1991 : [Ülevaade koosolekutest] / Tiit Rosenberg, Maris Pruuli

    Index Scriptorium Estoniae

    Rosenberg, Tiit, 1946-

    1995-01-01

    Lisa: Õpetatud Eesti Seltsi taasasutamise ürik : [26 apr. 1988]. Allakirjutanute hulgas Paul Ariste, Eduard Laugaste, Leo Metsar, Aino Põldmäe, Harald Peep, Juhan Peegel, Imbi Pelkonen, Heno Sarv, Arne Merilai, Margus Kasterpalu, Heli Laanekask, Eva Aaver, Paul Hagu, Hando Runnel

  9. Keila XVIII muinsuskaitsepäev

    Index Scriptorium Estoniae

    2003-01-01

    15. V Keila sotsiaalkeskuse saalis Keila XVIII muinsuskaitsepäeva puhul arhitektuurile pühendatud Harjumaa muuseumi konverents. Esinevad Kaspar Kuuse, Silja Konsa, Heli Kirikal, Silvi Lindmaa-Pihlak, Mart Kalm. Avatud Eesti Arhitektuurimuuseumi näitus "Eesti puitarhitektuur"

  10. Tunnuslause on leitud

    Index Scriptorium Estoniae

    2008-01-01

    2010 aasta kirikupäeva ja vaimuliku laulupeo sihtasutuse nõukogu kinnitas moto, milleks valiti murdekeelne kutse: "Mu mano tulge, latse". Moto konkursist (EELK kirikupäev ja vaimulik laulupidu toimuvad 11.-13. juunil 2010 Tartus, kunstiliseks juhiks Heli Jürgenson)

  11. Stuart Brisley etendused inimliku ja kunstipärase piiril / Andri Ksenofontov

    Index Scriptorium Estoniae

    Ksenofontov, Andri, 1962-

    2009-01-01

    Stuart Brisley näitus "Crossings" ("Ületamised") Tallinna Linnagaleriis 19- sept. - 4. oktoobrini. Heli- ja valgusinstallatsioonist "Touching Black Ice" Titanicu hukkumisest 1912. a. 15. aprillil. Videoinstallatsioonist "Blackout" Estonia hukkumisest 1994. a. 28. septembril. Näitusega kaasnevast kataloogist. Stuart Brisley loomingust

  12. Enhanced FAA-Hybrid III dummy for aircraft occupant safety assessment

    NARCIS (Netherlands)

    Waagmeester, C.D.; Ratingen, M.R. van; Giavotto, V.; Notarnicola, L.; Goldner, S.

    2002-01-01

    Following an integral approach unique in aircraft safety, the European HeliSafe project aims to improve the survivability of helicopter crashes and to reduce the risk at injuries for occupants in cockpit and cabin. In the project, a modified FAA-Hybrid III is used for the baseline-, design- and

  13. Enhanced FAA-hybrid III numerical dummy model in Madymo for aircraft occupant safety assessment

    NARCIS (Netherlands)

    Boucher, H.; Waagmeester, C.D.

    2003-01-01

    To improve survivability and to minimize the risk of injury to occupants in helicopter crash events, a complete Cabin Safety System concept including safety features and an enhanced FAA-Hybrid III dummy were developed within the HeliSafe project. A numerical tool was also created and validated to

  14. HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation - FANTOM5 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us FANTOM5 HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation Data detail Data name Heliscope...thod - Data analysis method HeliScopeCAGE ( http://fantom.gsc.riken.jp/protocols/heliscope.html ) Delve (Ali...Database Description Download License Update History of This Database Site Policy | Contact Us HeliscopeCAGE

  15. Noor Eesti muusika plahvatab! / Andres Lõo

    Index Scriptorium Estoniae

    Lõo, Andres

    2004-01-01

    Popmuusikaüritustest muusikafestivali Hea Uus Heli raames: "1öö%" Von Krahlis ja "Viva la HUH!" kultuuritehases Polymer 8. ja 9. okt.. Jaapanlase Emi Maeda kontserdist Kanuti Gildi saalis 8. okt.ja elektroonilise muusika esitajatest Von Krahlis

  16. Priit Pärna vanad hitid jõuavad taastatuna kinno / Tiit Tuumalu

    Index Scriptorium Estoniae

    Tuumalu, Tiit, 1971-

    2008-01-01

    Priit Pärna kuus joonisfilmi on digitaalselt taastatud Nkufilmi stuudios Saksa TrickWILK tehnikaga (restauraator Tõnu Talivee) ja heli osas Ants Andrease juhtimisel firmas Film Audio. Sõpruse kinos toimub eriseanss "Priit Pärn revisited" lühifilmide festivali raames 29. augustil

  17. Workshop Polli Talu Loomingulises Keskuses

    Index Scriptorium Estoniae

    2004-01-01

    MAP Intermedia Performance Collaboration'i (USA) workshop. Brendan McCall (liikumine), N. B. Aldrich (heli) ja Zach Poff (video) workshop tutvustab kolme kunstniku koostööd. Näidatakse ka multimeedia etendust, mis on külaliskunstnikel valminud Polli talus

  18. Kas kooliraamatukogus on hea raamatuvalik? / Inga Paaskivi, Anna Elise Rohtmets, Piia Selge ... [jt.

    Index Scriptorium Estoniae

    2011-01-01

    Küsimusele vastasid: Muhu põhikooli raamatukoguhoidja Inga Paaskivi, Mustamäe gümnaasiumi abiturient Anna Elise Rohtmets, Tallinna Arte gümnaasiumi raamatukoguhoidja Piia Selge, Saue gümnaasiumi emakeeleõpetaja Piret Uulma, Mõisaküla kooli raamatukoguhoidja Airi Allikivi, Loksa gümnaasiumi emakeeleõpetaja Urve Toompuu, lapsevanem Heli Kilter

  19. Elada vabana või surra = To live free or to die / Raul Keller

    Index Scriptorium Estoniae

    Keller, Raul, 1973-

    2015-01-01

    Näitusest "Vaikus on kuldne. Ilmar Laaban ja eksperimendid helis ning keeles" Kumu kunstimuuseumis. Näitus annab ülevaate keelega ja heliga-häälega tehtud kunstilistest eksperimentidest 20. sajandi algusest tänapäevani. Esindatud on kõlaluule rahvusvahelised pioneerid (nende hulgas Ilmar Laaban) ning Eesti kaasaegsed kõlapoeedid Jaan Malin ja Roomet Jakapi

  20. Understanding the effects of fire management practices on forest health: Implications for weeds and vegetation structure (Project INT-F-04-01) [Chapter 14

    Science.gov (United States)

    Anne E. Black; Peter Landres

    2011-01-01

    Current fire policy to restore ecosystem function and resiliency and reduce buildup of hazardous fuels implies a larger future role for fire (both natural and human ignitions) (USDA and USDOI 2000). Yet some fire management (such as building fire line, spike camps, or heli-spots) potentially causes both short- and long-term impacts to forest health. In the short run,...

  1. Kiberataki pridjotsja otrazhat samostojatelno / Roman Starapopov

    Index Scriptorium Estoniae

    Starapopov, Roman

    2008-01-01

    Valitsuse kinnitatud Eesti küberjulgeoleku strateegia üks olulisi põhimõtteid on igaühe vastutus kasutuses oleva süsteemi julgeoleku eest. Kaitseministeeriumi töötaja Heli Tiirmaa-Klaari selgitusi strateegia kohta

  2. Ilves viskas koos Bedwettersiga näppu. President Ilves kohtus õpilaste ja kaitseliitlastega / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters ja president Toomas Hendrik Ilvese Pärnu Sütevaka humanitaargümnaasiumi ja Kaitseliidu Pärnumaa maleva külastusest 9. novembril

  3. Sille Pihlaku ja Siim Tuksami arhitektuuritegevus = Activities of Sille Pihlak and Siim Tuksam in the Field of Architecture / Sille Pihlak, Siim Tuksam

    Index Scriptorium Estoniae

    Pihlak, Sille

    2016-01-01

    Installatsioon "Keha ehitus" Rotermanni Soolalao ees (2015), Eleringi disainimast "Soorebane" (konkursi võidutöö, 2016), Tallinn Music Week installatsioonid "HeliLained" (2016), näituse "Keha ehitus" kureerimine Eesti Arhitektuurimuuseumis (2015). Kultuurkapitali Arhitektuuri sihtkapitali aastapreemia nominent 2016

  4. Moodsad ajad vanas majas : Raekoja 1975. aasta sisekujundus = Modern Times at an Old Building : 1975 Interior Design of Tallinn Town Hall / Kai Lobjakas

    Index Scriptorium Estoniae

    Lobjakas, Kai, 1975-

    2004-01-01

    1973. a. Tallinna Raekojale uue sisekujunduslahenduse saamiseks korraldatud kutsutud konkursi võitis töö Annunciation, mille põhiautoriks oli Leila Pärtelpoeg, kaasautoriteks Aate-Heli Õun, Anu Raud, Ilme-Anu Neemre. Tööd jätkas Leila Pärtelpoeg koos Udo Umbergiga. Rippvaipade galerii autor Valve Ilveste

  5. Kuidas Adolf Hitler vahetult enne valimisi Püssirohukeldrisse jõuab / Agni Lass

    Index Scriptorium Estoniae

    Lass, Agni

    2005-01-01

    10. sept. esietendub Tartu Püssirohukeldris P. Uttoni "Adolf", mille M. Unt pidi lavastama. Kuid proovideni ta ei jõudnud. See etendub E. Õunapuu käe all, kes tegi M. Undi lavavariandi ümber. Heli- ja lavakujundus ning kostüümid on samuti E. Õunapuult

  6. Local genes for local bacteria: Evidence of allopatry in the genomes of transatlantic Campylobacter populations

    Science.gov (United States)

    The genetic structure of bacterial populations can be related to the geographical isolation source. In some species, there is a strong correlation between geographical distances and genetic distances, which can be caused by different evolutionary mechanisms. The patterns of ancient admixture in Heli...

  7. Juba teine "1+1 = 1"

    Index Scriptorium Estoniae

    2004-01-01

    15. III Okupatsioonimuuseumis toimuva "1+1=1" teise ürituse kavast. Presentatsioonide õhtu keskendub konkreetse ruumikogemuse vahendamisele kunstis (helis, slaidi-installatsioonis, tänava-aktsioonis, skulptuuris, videos, filmis). Esinevad Cevdet Erek, Andres Lõo, Andres Kurg (arhitektuur ja interjöörid Marko Raadi filmis "Agent Sinikael") jt.

  8. Алиса в Заэстонье / Николай Караев

    Index Scriptorium Estoniae

    Караев, Николай, 1978-

    2010-01-01

    „Alice" on omanäoline live perfomance, mis koosneb kaasaegsest koreograafiast, originaalsest autorimuusikast, kunstilisest videost, traditsioonilisest animatsioonist, VJ setist ja varjude teatrietendusest. Lavastuse autoriteks on MTÜ Fat Snail, MTÜ Vastik Sipsik, MTÜ HeliTelg, Olga Privis ja Aleksandr Žedeljov. Lavastus põhineb Lewis Carrolli teosel „Alice Imedemaal", kuid pole otseselt autori tekstide ümberjutustus

  9. Ainult kaks küsimust / Aleksandr Žedeljov

    Index Scriptorium Estoniae

    Žedeljov, Aleksandr

    2010-01-01

    Vene Teatris juunis 2011 esietenduvast live performance'ist "Alice", mis koosneb kaasaegsest koreograafiast, originaalsest autorimuusikast. videost, animatsioonist ja varjuteatrist. Lewis Carroll'i teosel "Alice Imedemaal" põhineva lavastuse autorid on Olga Privis, Aleksandr Žedeljov, MTÜ Fat Snail, MTÜ Vastik Sipsik, MTÜ HeliTelg

  10. Tänane Tartu - naerud, nutud ja hernetondid = Tartu today - laughter, tears and scarecrows / Berk Vaher

    Index Scriptorium Estoniae

    Vaher, Berk, 1975-

    2006-01-01

    Tartu linnaruumist, selle teisenemistest. Eduard Tubina mälestusmärgist (skulptor Aili Vahtrapuu, arhitekt Veronika Valk, heli: Louis Dandrel), Tartu Kaubamajast (arhitekt Raivo Puusepp), Rüütli tänava kujundusest (Rene Valner, Ott Kadarik), Ülikooli tänavast. 5 värv. ill

  11. Kognitiivsete pädevuste määramisest toimetulekukoolis / Age Mägi, Imbi Aosaar

    Index Scriptorium Estoniae

    Mägi, Age

    2008-01-01

    Imbi Aosaare, Terje Kundla, Age Mägi, Agnes Mürgi ja Heli Volteri osavõtul valminud Tallinna Ülikooli täienduskoolituse lõputööst "Õpilase lähtetaseme määramine toimetulekuõppe I, II ja III kooliastmes"

  12. Koolitusfirmade TOP aastal 2007

    Index Scriptorium Estoniae

    2008-01-01

    Koolitusfirmade TOP. Vt. samas: Käibe TOP 10; Käibekasvu TOP 10; Kasumi TOP 10; Kasumi kasvu TOP 10; Rentaabluse TOP 10; Omakapitali tootlikkuse TOP 10; Signe Sillasoo. Invicta tahab lähiaastail laieneda Eestis ja mujalgi; Ketlin Priilinn. Addenda kasutas ära majanduse soodsa seisu. Kommenteerib Heli Sõmer. Juhtide hoiakute muutmisega tõus esikolmikusse

  13. Noorkotkad tegid algust oskuste võistlusega / Teele Võime

    Index Scriptorium Estoniae

    Võime, Teele

    2008-01-01

    28.-29. märtsil peeti Valgamaal Karula vallas Lüllemäel esimene üle-eestiline Noorte Kotkaste oskuste võistlus. Lisa: Oskuste võistluse tulemused. Vt. samas: Taive Kuuse. Noorkotkad hakkavad kandma erialamärke; Heli Esko. "Valgel laeval" seiklesid ka noored; Kodutütarde oskuste võistlus

  14. Bedwetters esineb tänutuuri raames Rakveres

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontsert 30. nov. Rakveres, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  15. Sensible branding / Martin Lindström ; interv. Alina Lisina

    Index Scriptorium Estoniae

    Lindström, Martin

    2006-01-01

    Autori juhitud ühe tähtsaima tootearendusalase uurimuse järelduseks on, et tootearenduses on oluline kasutada kõiki viit meelt. See tähendab, et hea toode eristub teistest nii lõhna, heli, välimuse, maitse kui ka kombatavuse poolest

  16. Kalle Hamburg lõi kartulirekordi / Silja Lättemäe

    Index Scriptorium Estoniae

    Lättemäe, Silja, 1952-

    2008-01-01

    Jäneda talupäevadel kuulutati välja konkursi "Eesti parim talu 2008 võitjad. Vt. samas: Heli Raamets. Tsiklivennast põllumees hakkas laevnikuks; Pealinnast maale mahelehmi pidama; Oma tarbeks peetud mahetalu toodangul on nõudlust

  17. Kontseptsioonid ja persoonid / Mari Sobolev

    Index Scriptorium Estoniae

    Sobolev, Mari, 1968-

    2003-01-01

    Heli Sarapuu näitus "Isale" Hobusepea galeriis. Valeri Vinogradovi "Design Jet 5001" Viviann Napi Galeriis. Eve Kiileri "Progressi arhitektoonika" Tallinna Linnagaleriis. Jan Van Imschooti maalinäitus "Müstilised patud ja kaasaegsed värvid. Ümberhindamise asupaik"

  18. OS CONTOS DE HELIÔNIA CERES: INQUIETAÇÕES ECOLÓGICAS

    National Research Council Canada - National Science Library

    Izabel Brandão

    2015-01-01

    ..., entrelaçando pessoas e elementosda natureza numa busca de harmonização. Palavras-chave Heliônia Ceres; ecocrítica; contos contemporâneos;interconexão.  Izabel Brandão Professora Associada de Literaturas...

  19. Eesti Raamatukoguhoidjate Ühing tähistas 90 aasta möödumist asutamisest / Reet Olevsoo

    Index Scriptorium Estoniae

    Olevsoo, Reet, 1956-

    2013-01-01

    Ülevaade aasta- ja kõnekoosolekust ning 2012. a preemiate võitjatest. Teadusraamatukogude aasta teona tunnustati uudsel RFID-tehnoloogial põhineva teavikute laenutamis- ja tagastamissüsteemi rakendamist TLÜ Akadeemilises Raamatukogus. Süsteemi rakendamist koordineerisid IT-teenistuse juhataja Peeter Kondratjev ja teenindusosakonna juhataja Heli Sirotkin

  20. Deceptive pictures and revealing sounds / Anu Allas

    Index Scriptorium Estoniae

    Allas, Anu, 1977-

    2009-01-01

    2009. aasta Ars Fennica kunstipreemia pälvinud eesti kunstniku ja fotograafi Mark Raidpere videokunstist, muusika ja heli tähtsast rollist tema videotes (videod "Pühendus/Dedication" (2008), "5 Guards" (2006), "Wailing Woman" (2007), "Majestoso Mystico" (2007), "Vekovka" (2008) jt.)

  1. Don Juan on manipulaator / Kai Ilustrumm

    Index Scriptorium Estoniae

    Ilustrumm, Kai

    2004-01-01

    Nüüdisaegne muusikalis-koreograafiline fantaasia "Don Juani pidusöök" Kanuti Gildi Saalis. Eesti tantsijate ja hollandi muusikute Holland Windplayers koostöös sündinud projekti tutvustab Tallinna Filharmoonia sarja "Diplomaadilised noodid" juht Heli Vaus-Tamm

  2. Tehnika murrab disaini rõivastesse / Kerli Nõu

    Index Scriptorium Estoniae

    Nõu, Kerli

    2006-01-01

    Itaalia moefirma Ermenegildo Zegna spordijakk koos firma Apple menutoote iPodiga ühendab innovatsiooni, tehnoloogia ning võimaluse muusikat nautida. Jope varrukale konstrueeritud pesemiskindlate nuppudega on võimalik muusikat sise ja välja lülitada, samuti reguleerida heli tugevust

  3. Художники ходят по крышам домов / Ханно Соанс

    Index Scriptorium Estoniae

    Соанс, Ханно, 1974-

    2010-01-01

    Näitusest "Linna kohal" Tallinna Linnagaleriis. Teemaks on linnamajade katusepindade kasutuselevõtt. Kuraatorid Kadri Klementi ja Helis Heiter. Töödest näitusel. Osalevad: Anu Vahtra — Tallinna Kunstihoone, Claudia Doms ja Mikk Heinsoo — Saku Suurhall, Timo Toots — Lennujaam, Marit Ilison — Telliskivi Loomelinnak, Johnson & Johnson — Postimaja

  4. Ülevaade tolli ja käibemaksu teabepäevast / Rait Kaarma, Mariliis Kannukene, Hiie Õunpuu

    Index Scriptorium Estoniae

    Kaarma, Rait

    2004-01-01

    30. märtsil toimunud teabepäevast tolli ja käibemaksu teemal. Ülevaade Heli Tariku, Ruth Paade, Lembar Kivistiku, Martin Hubergi ja Kaia Loobi sõnavõttudest. Lisad: kirjalik tollideklaratsioon (SAD) esitatakse, kui ; tollimaksumäärade, keeldude ja piirangutega saab tutvuda

  5. Kurtna keskusehoone renoveerimine = Renovation of the Kurtna center building / Epp Lankots

    Index Scriptorium Estoniae

    Lankots, Epp, 1976-

    2005-01-01

    Saku vallas Kurtna külas asuva Kurtna Linnukasvatuse Katsejaama peahoone (arhitekt Valve Pormeister, sisearhitektid Vello Asi ja Väino Tamm, 1965-66) pieteeditundelisest renoveerimisest hotelliks. Arhitektid: Heli Ernesaks, Katrin Rannik. Halvast ja odavast interjöörikujundusest. Ill.: 3 värv. välis- ja 3 sisevaadet

  6. Intermittent preventive sulfadoxine-pyrimethamine treatment of primigravidae reduces levels of plasma immunoglobulin G, which protects against pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Staalsoe, Trine; Shulman, Caroline E; Dorman, Edgar K

    2004-01-01

    Pregnancy-associated malaria (PAM) is an important cause of maternal and neonatal suffering. It is caused by Plasmodium falciparum capable of inhabiting the placenta through expression of particular variant surface antigens (VSA) with affinity for proteoglycans such as chondroitin sulfate A...

  7. Lack of gender-specific antibody recognition of products from domains of a var gene implicated in pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Jensen, Anja T R; Zornig, Hanne D; Buhmann, Caecilie

    2003-01-01

    Gender-specific and parity-dependent acquired antibody recognition is characteristic of variant surface antigens (VSA) expressed by chondroitin sulfate A (CSA)-adherent Plasmodium falciparum involved in pregnancy-associated malaria (PAM). However, antibody recognition of recombinant products of a...... regarding the molecular identity of the parasite ligand mediating adhesion to CSA in PAM....

  8. 33 CFR 104.400 - General.

    Science.gov (United States)

    2010-07-01

    ... developed; (3) Must address each vulnerability identified in the Vessel Security Assessment (VSA); (4) Must... Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MARITIME SECURITY MARITIME SECURITY: VESSELS Vessel Security Plan (VSP) § 104.400 General. (a) The Company Security Officer (CSO) must...

  9. 40 CFR 92.132 - Calculations.

    Science.gov (United States)

    2010-07-01

    ...)) CCH3CHOe=((2.774)(10−2) (CADE)(VAE)(Q)(TEF))/((VSE)(PB) CCH3CHOd=((2.774)(10−2) (CADA)(VAA)(Q)(TDF))/(VSA... concentration in dilution air, ppm. CADE=Concentration of DNPH derivative of acetaldehyde from dilute exhaust...

  10. Host erythrocyte polymorphisms and exposure to Plasmodium falciparum in Papua New Guinea

    Directory of Open Access Journals (Sweden)

    Imrie Heather J

    2008-01-01

    Full Text Available Abstract Background The protection afforded by human erythrocyte polymorphisms against the malaria parasite, Plasmodium falciparum, has been proposed to be due to reduced ability of the parasite to invade or develop in erythrocytes. If this were the case, variable levels of parasitaemia and rates of seroconversion to infected-erythrocyte variant surface antigens (VSA should be seen in different host genotypes. Methods To test this hypothesis, P. falciparum parasitaemia and anti-VSA antibody levels were measured in a cohort of 555 asymptomatic children from an area of intense malaria transmission in Papua New Guinea. Linear mixed models were used to investigate the effect of α+-thalassaemia, complement receptor-1 and south-east Asian ovalocytosis, as well as glucose-6-phosphate dehydrogenase deficiency and ABO blood group on parasitaemia and age-specific seroconversion to VSA. Results No host polymorphism showed a significant association with both parasite prevalence/density and age-specific seroconversion to VSA. Conclusion Host erythrocyte polymorphisms commonly found in Papua New Guinea do not effect exposure to blood stage P. falciparum infection. This contrasts with data for sickle cell trait and highlights that the above-mentioned polymorphisms may confer protection against malaria via distinct mechanisms.

  11. Variable stiffness actuated prosthetic knee to restore knee buckling during stance: a modeling study

    NARCIS (Netherlands)

    Wentink, E.C.; Koopman, Hubertus F.J.M.; Stramigioli, Stefano; Rietman, Johan Swanik; Veltink, Petrus H.

    Most modern intelligent knee prosthesis use dampers to modulate dynamic behavior and prevent excessive knee flexion, but they dissipate energy and do not assist in knee extension. Energy efficient variable stiffness control (VSA) can reduce the energy consumption yet effectively modulate the dynamic

  12. Boekbesprekings / Book Reviews THE ART OF WINNING WARS

    African Journals Online (AJOL)

    Daar is heelwat boeke geskryf oor hoe om oorloe te wen. Feitlik al hierdie boeke Ie strategiese en taktiese doktrines neer. Tenspyte van al hierdie boeke kon 'n magtige leer soos die van die VSA nie die stryd in Vietnam wen nie. Die geskiedenis is vol van oorloe en lesse daaruit te leer, lesse wat geboekstaaf is en as ...

  13. The impact of interactive manipulation on the recognition of objects

    Science.gov (United States)

    Meijer, Frank; van den Broek, Egon L.; Schouten, Theo

    2008-02-01

    A new application for VR has emerged: product development, in which several stakeholders (from engineers to end users) use the same VR for development and communicate purposes. Various characteristics among these stakeholders vary considerably, which imposes potential constraints to the VR. The current paper discusses the influence of three types of exploration of objects (i.e., none, passive, active) on one of these characteristics: the ability to form mental representations or visuo-spatial ability (VSA). Through an experiment we found that all users benefit from exploring objects. Moreover, people with low VSA (e.g., end users) benefit from an interactive exploration of objects opposed to people with a medium or high VSA (e.g. engineers), who are not sensitive for the type of exploration. Hence, for VR environments in which multiple stakeholders participate (e.g. for product development), differences among their cognitive abilities (e.g., VSA) have to be taken into account to enable an efficient usage of VR.

  14. Elastic energy storage in leaf springs for a lever-arm based variable stiffness actuator

    NARCIS (Netherlands)

    Barrett, Eamon; Fumagalli, Matteo; Carloni, Raffaella

    2016-01-01

    The increasing use of Variable Stiffness Actuators (VSAs) in robotic joints is helping robots to meet the demands of human-robot interaction, requiring high safety and adaptability. The key feature of a VSA is the ability to exploit internal elastic elements to obtain a variable output stiffness.

  15. Increased angiogenesis and FGFR protein expression indicate a favourable prognosis in bladder cancer.

    Science.gov (United States)

    Bertz, Simone; Abeé, Christine; Schwarz-Furlan, Stephan; Alfer, Joachim; Hofstädter, Ferdinand; Stoehr, Robert; Hartmann, Arndt; Gaumann, Andreas K A

    2014-12-01

    Compared to other members of the fibroblast growth factor receptor (FGFR) family, only few studies investigate FGFR3 in tumour angiogenesis. We investigated the connection between angiogenesis and FGF/FGFR expression including FGFR3 mutation status in urothelial carcinomas. Immunohistochemistry was performed in invasive and non-invasive urothelial cancers of 61 patients. Protein expression of CD31, factor VIII (FVIII), FGF-1/2, FGFR1, FGFR3 and FGFR4 and FGFR3 mutation status were evaluated. Morphometric assessment of angiogenesis including microvessel count (MVC) and vascular surface area (VSA) was analysed. Correlation and survival analyses (overall survival (OS) and disease-free survival (DFS)) with univariate and multivariate analyses were performed. CD31 values (MVC and VSA) significantly correlated with OS and DFS. OS and DFS were significantly better in patients with FGFR3 overexpression. Multivariate analysis revealed FGFR3 protein expression and tumour grading (WHO classification 2004) as independent prognostic factors of OS and VSA of CD31 and FGFR3 protein expression of DFS. FGFR3 mutation status was correlated with VSA measured by FVIII. FGFR3 may be able to induce a pro-angiogenic phenotype in urothelial carcinomas and significantly influence prognosis. Consequently, FGFR3 is a potential therapeutic target also from the angiogenesis perspective.

  16. Experimental Demonstration of Long-Range Underwater Acoustic Communication Using a Vertical Sensor Array.

    Science.gov (United States)

    Zhao, Anbang; Zeng, Caigao; Hui, Juan; Ma, Lin; Bi, Xuejie

    2017-06-27

    This paper proposes a composite channel virtual time reversal mirror (CCVTRM) for vertical sensor array (VSA) processing and applies it to long-range underwater acoustic (UWA) communication in shallow water. Because of weak signal-to-noise ratio (SNR), it is unable to accurately estimate the channel impulse response of each sensor of the VSA, thus the traditional passive time reversal mirror (PTRM) cannot perform well in long-range UWA communication in shallow water. However, CCVTRM only needs to estimate the composite channel of the VSA to accomplish time reversal mirror (TRM), which can effectively mitigate the inter-symbol interference (ISI) and reduce the bit error rate (BER). In addition, the calculation of CCVTRM is simpler than traditional PTRM. An UWA communication experiment using a VSA of 12 sensors was conducted in the South China Sea. The experiment achieves a very low BER communication at communication rate of 66.7 bit/s over an 80 km range. The results of the sea trial demonstrate that CCVTRM is feasible and can be applied to long-range UWA communication in shallow water.

  17. Maternal vitamin A supplementation and immunity to malaria in pregnancy in Ghanaian primigravids

    DEFF Research Database (Denmark)

    Cox, Sharon E; Staalsoe, Trine; Arthur, Paul

    2005-01-01

    . The pathological effects of malaria in pregnancy are believed to be due to the sequestration of parasites in the placenta mediated via binding of variant surface antigens (VSA) expressed on the surface of P. falciparum infected red blood cells to placental chondroitin sulphate A (CSA). METHODS: We conducted...

  18. The role of cognitive abilities in laparoscopic simulator training

    NARCIS (Netherlands)

    Groenier, M.; Schraagen, J.M.C.; Miedema, H.A.T.; Broeders, Ivo Adriaan Maria Johannes

    2014-01-01

    Learning minimally invasive surgery (MIS) differs substantially from learning open surgery and trainees differ in their ability to learn MIS. Previous studies mainly focused on the role of visuo-spatial ability (VSA) on the learning curve for MIS. In the current study, the relationship between

  19. The role of cognitive abilities in laparoscopic simulator training

    NARCIS (Netherlands)

    Groenier, Marleen; Schraagen, Johannes Martinus Cornelis; Miedema, Helene A.T.; Broeders, Ivo Adriaan Maria Johannes

    2013-01-01

    Learning minimally invasive surgery (MIS) differs substantially from learning open surgery and trainees differ in their ability to learn MIS. Previous studies mainly focused on the role of visuo-spatial ability (VSA) on the learning curve for MIS. In the current study, the relationship between

  20. The (un)usefulness of interactive exploration in building 3D- mental representations.

    NARCIS (Netherlands)

    Meijer, F.; van den Broek, Egon

    The generation of mental representations from visual images is crucial in 3-D object recognition. In two experiments, thirty-six participants were divided into a low, middle, and high visuospatial ability (VSA) group, which was determined by Vandenberg and Kuse's MRT-A test (1978 Perception and

  1. Kerkwees: Verleentheid of geleentheid?

    African Journals Online (AJOL)

    Test

    invloedryke Barna-groep, skryf byvoorbeeld 'Christianity has an image problem …' 'n Empiriese ondersoek deur die ...... en uiteenlopend gebruik word (kyk Browning. 1996; Healy 2000; Gay 2006; Heitink 2007; Hegstad 2013). ... what God wants his people to be: his image, his body. (bl. 1002). In die VSA en Brittanje het ...

  2. Expression of variant surface antigens by Plasmodium falciparum parasites in the peripheral blood of clinically immune pregnant women indicates ongoing placental infection

    DEFF Research Database (Denmark)

    Ofori, Michael F; Staalsoe, Trine; Bam, Victoria

    2003-01-01

    Placenta-sequestered Plasmodium falciparum parasites that cause pregnancy-associated malaria (PAM) in otherwise clinically immune women express distinct variant surface antigens (VSA(PAM)) not expressed by parasites in nonpregnant individuals. We report here that parasites from the peripheral blo...

  3. Aanbid die godsdienste dieselfde God?

    African Journals Online (AJOL)

    Aquinas se verstaan van die implisiete geloof. Erasmus se poging om die Chris- telike dogma tot 'n absolute minimum te reduseer en Servet se verwerping van die. Triniteitsleer, het dieselfde intensie (Galling 1961:1062). Die poging van Helena Petrofna Blavatsky se Teosofiese Vereniging wat in. 1875 in die VSA gestig is, ...

  4. Vectorised Spreading Activation algorithm for centrality measurement

    Directory of Open Access Journals (Sweden)

    Alexander Troussov

    2011-01-01

    Full Text Available Spreading Activation is a family of graph-based algorithms widely used in areas such as information retrieval, epidemic models, and recommender systems. In this paper we introduce a novel Spreading Activation (SA method that we call Vectorised Spreading Activation (VSA. VSA algorithms, like “traditional” SA algorithms, iteratively propagate the activation from the initially activated set of nodes to the other nodes in a network through outward links. The level of the node’s activation could be used as a centrality measurement in accordance with dynamic model-based view of centrality that focuses on the outcomes for nodes in a network where something is flowing from node to node across the edges. Representing the activation by vectors allows the use of the information about various dimensionalities of the flow and the dynamic of the flow. In this capacity, VSA algorithms can model multitude of complex multidimensional network flows. We present the results of numerical simulations on small synthetic social networks and multi­dimensional network models of folksonomies which show that the results of VSA propagation are more sensitive to the positions of the initial seed and to the community structure of the network than the results produced by traditional SA algorithms. We tentatively conclude that the VSA methods could be instrumental to develop scalable and computationally efficient algorithms which could achieve synergy between computation of centrality indexes with detection of community structures in networks. Based on our preliminary results and on improvements made over previous studies, we foresee advances and applications in the current state of the art of this family of algorithms and their applications to centrality measurement.

  5. Strains of Lentinula edodes suppress growth of phytopathogenic fungi and inhibit Alagoas serotype of vesicular stomatitis virus Linhagens de Lentinula edodes inibem fungos fitopatogênicos e o vírus da estomatite vesicular, sorotipo Alagoas

    Directory of Open Access Journals (Sweden)

    Selma H. Sasaki

    2001-03-01

    Full Text Available Four Lentinula edodes strains (Le10, 46, K2, Assai were assessed for their antagonistic effect on four filamentous fungus species of agricultural importance (Helminthosporium euphorbiae, Helminthosporium sp, Fusarium solani and Phomopsis sojae and on Alagoas serotype of Vesicular Stomatitis Virus (VSA. The L. edodes strains studied had variable effects on the filamentous fungi and on VSA. The K2 and Le10 strains were antagonistic on the fungi assessed and the 46 and K2 strains were efficient on the Vesicular Stomatitis Virus. The results widened the list of beneficial effects of L. edodes on the control and prevention of animal pathogenic virus and filamentous fungi.Quatro linhagens de Lentinula edodes (Le10, 46, K2, ASSAI foram avaliadas quanto ao seu efeito inibitório sobre quatro espécies de fungos filamentosos de importância agrícola (Helminthosporium euphorbiae, Helminthosporium sp., Fusarium solani, Phomopsis sojae e sobre o sorotipo Alagoas vírus da estomatite vesicular (VSA. Foi observado que as linhagens de L. edodes estudadas apresentaram variabilidade quanto ao seu efeito, tanto sobre os fungos filamentosos quanto sobre o vírus VSA. As linhagens K2 e Le10 apresentaram-se antagônicas sobre os fungos e as linhagens 46 e K2 foram eficientes na inibição do vírus VSA. Os resultados obtidos permitem ampliar a lista de efeitos benéficos de algumas linhagens de L. edodes no controle e prevenção de vírus patogênicos animais e de fungos filamentosos.

  6. HIV impairs opsonic phagocytic clearance of pregnancy-associated malaria parasites.

    Directory of Open Access Journals (Sweden)

    Jessica Keen

    2007-05-01

    Full Text Available BACKGROUND: Primigravid (PG women are at risk for pregnancy-associated malaria (PAM. Multigravid (MG women acquire protection against PAM; however, HIV infection impairs this protective response. Protection against PAM is associated with the production of IgG specific for variant surface antigens (VSA-PAM expressed by chondroitin sulfate A (CSA-adhering parasitized erythrocytes (PEs. We hypothesized that VSA-PAM-specific IgG confers protection by promoting opsonic phagocytosis of PAM isolates and that HIV infection impairs this response. METHODS AND FINDINGS: We assessed the ability of VSA-PAM-specific IgG to promote opsonic phagocytosis of CSA-adhering PEs and the impact of HIV infection on this process. Opsonic phagocytosis assays were performed using the CSA-adherent parasite line CS2 and human and murine macrophages. CS2 PEs were opsonized with plasma or purified IgG subclasses from HIV-negative or HIV-infected PG and MG Kenyan women or sympatric men. Levels of IgG subclasses specific for VSA-PAM were compared in HIV-negative and HIV-infected women by flow cytometry. Plasma from HIV-negative MG women, but not PG women or men, promoted the opsonic phagocytosis of CSA-binding PEs (p < 0.001. This function depended on VSA-PAM-specific plasma IgG1 and IgG3. HIV-infected MG women had significantly lower plasma opsonizing activity (median phagocytic index 46 [interquartile range (IQR 18-195] versus 251 [IQR 93-397], p = 0.006 and levels of VSA-PAM-specific IgG1 (mean fluorescence intensity [MFI] 13 [IQR 11-20] versus 30 [IQR 23-41], p < 0.001 and IgG3 (MFI 17 [IQR 14-23] versus 28 [IQR 23-37], p < 0.001 than their HIV-negative MG counterparts. CONCLUSIONS: Opsonic phagocytosis may represent a novel correlate of protection against PAM. HIV infection may increase the susceptibility of multigravid women to PAM by impairing this clearance mechanism.

  7. A vegetation sensitivity approximation for gross primary production in water limited conditions.

    Science.gov (United States)

    Claesson, Jonas; Nycander, Jonas

    2013-04-01

    The most severe impact of climate change on vegetation growth and agriculture is likely to occur under water-limited conditions. Under such conditions the plants optimize the inward flux of CO2 and the outward flux of water vapor (the transpiration) by regulating the size of the stomata openings. Higher temperature increases water loss through transpiration, forcing the plants to diminish the stomata openings, which decreases photosynthesis. This is counteracted by higher CO2 concentration, which allows plants to maintain the inward flux of CO2 through the smaller openings. These two counteracting effects, combined with the change in precipitation, determine the net change of biological productivity in a changed climate. Here, a vegetation sensitivity approximation (VSA) is introduced, in order to understand and estimate the combined effect of changed temperature, CO2-concentration and precipitation on gross primary production (GPP) to first order. According to the VSA, we have: ( ) ?CO2atm ν GP P = ?0 P Here ?CO2atm is the atmospheric CO2 concentration, ?0 is the baseline for atmospheric CO2 concentration, P is precipitation and ν is defined by: -s- ν = 1 - 11°C where s is the climate sensitivity i.e. the increase in temperature when atmospheric CO2 is doubled. The VSA is based on the physical laws of gas flux through the stomata openings, and is only valid under water-limited conditions. It assumes that the temperature depends logarithmically on the CO2 concentration with a given climate sensitivity. Transpiration is assumed to be a constant fraction of precipitation, which is reasonable under water-limited conditions. The VSA is compared to simulations with the dynamic vegetation model LPJ. The agreement is reasonable, and the deviations can be understood by comparison with Köppen's definition of arid climate: in an arid climate growth increases more according to LPJ than according to the VSA, and in non-arid conditions the reverse is true. Both the VSA and

  8. Uudised

    Index Scriptorium Estoniae

    2005-01-01

    Rokiajaloo tähtsaima briti raadiodiskori John Peeli (30.08.1939-25.10.2005) mälestuseks anti tema nimi punasele tulbile, mille mugulatest saadud raha suunatakse briti koolidesse kontsertide korraldamiseks. Festivalist "Hea Uus Heli" 5.-8. okt. Tallinnas ja eelnevast HUHi klubiõhtust "1öö%" soome külalisesinejatega 9. sept. Von Krahli teatris. Briti rockansambli Pink Floyd uuest kokkutulekust

  9. The New Russian Engagement with Latin America: Strategic Position, Commerce, and Dreams of the Past

    Science.gov (United States)

    2015-06-01

    Although Russia has sold the country attack heli- copters and air defense systems, the Brazilian market has not lived up to the importance that Russia has...With respect to other infrastructure projects, Rus- sia has also agreed to fund the construction of four 200 megawatt power stations to boost...while 41 percent were mining products.257 Peru and Russia have also collaborated in the space arena. In November 2013, Russia launched two Peru- vian

  10. Tähelepanu, rahuldus, tähendusetus = Attention, satisfaction, meaninglessness / Raivo Kelomees

    Index Scriptorium Estoniae

    Kelomees, Raivo, 1960-

    2015-01-01

    Rahvusvaheline rühmanäitus "TL;DR" Tallinna Kunstihoone galeriis. Kuraator Stacey May Koosel. Digitaalkeskkonna ja infoliiasuse teemat vaagisid Varvara Guljajeva & Mar Canet, Pille Riin Jaik ja Eva Sepping läbi videoinstallatsioonide, Erki Kasemets ja Maris Karjatse fotoinstallatsiooniga, Sten Saarits heliinstallatsiooniga, Andres Lõo läbi heli ja stereograafia, Kiwa läbi trükisõna, Jesus Maria Rodriguez Santos grafitiga galerii akendel

  11. Laureatõ konkursa "Strojenije goda - 2003"

    Index Scriptorium Estoniae

    2004-01-01

    Ajakirja "Ehitaja" aastaehitised 2003: uusehitis - Laulasmaa SPA & Konverentsihotell (arhitekt Priit Ehala, AB Ehala & Irik, projekteerija Projektbüroo Teinos, ehitaja FKSM), renoveeritud ehitis - korterelamu Tallinnas Piiskopi t. 2 (arhitekt Elmo Raukas, sisearhitekt Heli Eensalu, projekteerija ja ehitaja Restor), rajatis - Turu sild Tartus (arhitektuurne lahendus: Tartu Arhitektuuribüroo, vantsüsteemide arvutused: Ehituse & Tarkvara Inseneribüroo), eramu - Merirahu eramu (arhitekt Tarmo Piirmets, projekteerija Estkonsult, ehitaja E-Betoonelement). 4 ill

  12. Ehitaja Aastaehitised 2003 on selgunud

    Index Scriptorium Estoniae

    2004-01-01

    Aastaehitised 2003: uusehitis - Laulasmaa SPA & Konverentsihotell (arhitekt Priit Ehala, AB Ehala & Irik, projekteerija Projektbüroo Teinos, ehitaja FKSM), renoveeritud ehitis - korterelamu Tallinnas Piiskopi t. 2 (arhitekt Elmo Raukas, sisearhitekt Heli Eensalu, projektterija ja ehitaja Restor), rajatis - Turu sild Tartus (arhitektuurne lahendus: Tartu Arhitektuuribüroo, vantsüsteemide arvutused: Ehituse & Tarkvara Inseneribüroo), eramu - Merirahu eramu (arhitekt Tarmo Piirmets, projekteerija Estkonsult, ehitaja E-Betoonelement). 4 ill

  13. Real time computer controlled weld skate

    Science.gov (United States)

    Wall, W. A., Jr.

    1977-01-01

    A real time, adaptive control, automatic welding system was developed. This system utilizes the general case geometrical relationships between a weldment and a weld skate to precisely maintain constant weld speed and torch angle along a contoured workplace. The system is compatible with the gas tungsten arc weld process or can be adapted to other weld processes. Heli-arc cutting and machine tool routing operations are possible applications.

  14. Environmental Impact Study of The Northern Section of the Upper Mississippi River, Minnesota River Pool.

    Science.gov (United States)

    1973-11-01

    COMPOSITAE (Continued) IGrindelia qurrs Curlycup-gumweed Helianthus occidentczlisI Wes tern sunflower Heli- anthus petiolarus Petioled sunflower P He iopsis he...dichotomiftorm Spreading witch grass P Pania= virgatwn Switch grass P Phalaris arundinacea Canary grass Poa palustris Fowl meadow-grass P Poa pratensis Blue grass...Herbs Yellow jewelweed. Impatiens pillida Kentucky bluegrass Poa Nettle Urtica procera pratensis Sweet cicely 03z:ohiza sp. I A-44 Table 3. Vegetation of

  15. (reprocessed)HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation - FANTOM5 | LSDB Archive [Life Science Database Archive metadata

    Lifescience Database Archive (English)

    Full Text Available List Contact us FANTOM5 (reprocessed)HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation Data d...etail Data name (reprocessed)HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation DOI 10.18908/l...m5_rp_exp_details#en Data acquisition method HeliScopeCAGE ( http://fantom.gsc.riken.jp/protocols/heliscop...icy | Contact Us (reprocessed)HeliscopeCAGE sequencing, Delve mapping and CAGE TSS aggregation - FANTOM5 | LSDB Archive ...

  16. Hispaania suursaadiku visiit / Reet Kääni

    Index Scriptorium Estoniae

    Kääni, Reet

    2001-01-01

    13.02.2001 külastas Tallinna Pedagoogikaülikooli Helsingis resideeruv Hispaania suursaadik Fernando Carderera Soleri ja saatkonna I sekretär Tereza Lizaranzu Perinat. Külaliste visiidi üheks eesmärgiks oli uurida võimalusi hispaania keele ja kultuuri õpetamiseks TPÜs. Dekaan Heli Mattisen oli ette valmistanud omapoolse ettepaneku hispaania keele kõrvalaine avamiseks 1.09.2001

  17. Ergutavad, lohutavad ja ravivad värvid / Jana Rand

    Index Scriptorium Estoniae

    Rand, Jana, 1963-

    2005-01-01

    Altmõisa puhkemaja Läänemaal Tuuru külas. Hoone sisekujunduse on teinud Heli Tuksam, abiks olid kunstnikud Piret Veski ja Tuuli Puhvel ning Tartu Kõrgema Kunstikooli üliõpilased. Toad on kujundatud erinevates värvitoonides. Fuajees on mosaiikpõrand. Kasutatud ökoloogilisi ehitus- ja viimistlusmaterjale. Ill.: välisvaade 7 sisevaadet, värv.

  18. Muusika / Ia Remmel

    Index Scriptorium Estoniae

    Remmel, Ia, 1965-

    2005-01-01

    Prantsusmaal pianistide konkursil 2. koha pälvinud pianistist Irina Zahharenkovast. Klassikaraadio 10. sünnipäeva tähistamisest ERSO kontserdiga. Neeme Järvi lepingust Haagi Residentie Orkest'iga, Arvo Volmeri tööst Adelaide'i Sümfooniaorkestriga. Lihavõttesarja kontserdist Vaasa peakirikus. Eesti Richard Wagneri Ühingu stipendiumi määramisest Heli Veskusele. 1. apr. Tallinnas toimuvast kontserdist "Paganini & Jazz"

  19. Bedwetters kihutab Eesti tuurile

    Index Scriptorium Estoniae

    2007-01-01

    Münchenis MTV Euroopa muusikaauhindade jagamisel Uue Euroopa Heli kategoorias lauluga "Dramatic Letter to Conscience"esikoha võitnud Pärnu pop-punkbändist Bedwetters (kontserdid 29. nov. Tartus, 30. nov. Rakveres, 1. dets. Haapsalus ja 2. dets. Pärnus, soojendusbändiks Driven, koostöös MTVga korraldatavaid kontsertõhtuid juhivad MTV VJd Martin Veismann ja Piret Järvis)

  20. Wide Area UXO Screening with the Multi-Sensor Fixed-wing Airborne System MARS, Former Kirtland Precision Bombing Range, NM

    Science.gov (United States)

    2008-06-01

    6,175 988 Free 0 m 100 years: Military airfield Oranienburg Government 2,470 494 50% wooded 2 m 100 years: Air Force Base Trampe Germany...1 This is the altitude in the International Standard Atmosphere at which the air density would be equal to the actual... air density at the place of observation. x We compared the MARS and HeliMag anomaly density maps in two regions of the northern part of the

  1. Presidendi kultuurirahastu määras hariduspreemiaid

    Index Scriptorium Estoniae

    2009-01-01

    Vabariigi Presidendi Kultuurirahastu hariduspreemia pälvisid Tartu Ülikooli loodus- ja tehnoloogiateaduskonna loodusteadusliku hariduse keskuse bioloogia didaktika lektor ning Hugo Treffneri gümnaasiumi bioloogia ja keemia süvaõppega loodussuuna bioloogiaõpetaja Urmas Kokassaar, Kolga keskkooli eesti keele ja kirjanduseõpetaja Terje Varul ning Narva lasteaia "Päikene" juhataja Heli Adamovitš. Reaalteaduste eripreemia pälvis Tallinna Tõnismäe Reaalkooli matemaatikaõpetaja Mihhail Gusev

  2. Does timbre affect pitch?: Estimations by musicians and non-musicians / Allan Vurma, Marju Raju, Annika Kuuda

    Index Scriptorium Estoniae

    Vurma, Allan, 1955-

    2011-01-01

    Muusikutel ja mittemuusikutel lasti kuulata lindilt inimhääle, vioola ja trompetihelisid ning hinnata järgmisena kõlanud helikatket võrreldes eelmisega kas "madalaks", "kõrgeks" või "hääles". Leiti, et tämbrist mõjutatud helikõrguse muutused võivad tekitada konflikti subjektiivse tunnetamise ja fundamentaalsel võnkesagedusel põhineva heli hindamise vahel

  3. Tudengid otsivad abi õiguskantslerilt / Dannar Leitmaa

    Index Scriptorium Estoniae

    Leitmaa, Dannar, 1982-

    2007-01-01

    Õppemaksu tõstmisest Tallinna ja Tartu Ülikoolis ja ülikooliseaduse vastava regulatsiooni tõlgendamisest ning üliõpilaste märgukirjast õiguskantslerile. Lisatud advokaat Ramon Raski kommentaar. Seisukoha avaldavad ka Tallinna Ülikooli akadeemiline prorektor Heli Mattisen, Tartu Ülikooli prorektor Birute Klaas ja Eesti Üliõpilaskondade Liidu juhatuse esimees Eimar Veldre

  4. Krovavõje maltshiki / Ljudmila Pribõlskaja

    Index Scriptorium Estoniae

    Pribõlskaja, Ljudmila

    2006-01-01

    Non Grata üliõpilaste korraldatud näituse "Perfomance läheb galeriisse" ava-perfomance'st Pärnu Linnagaleriis. Linnagaleriis ja kontserdimaja kolmandal korrusel näidatakse raamitud pildimaterjali nii Eesti kui välismaa kunstnike teostatud performanceѫitest ning nende käigus kasutatud või sündinud objekte. Näitus toimub rahvusvahelise festivali "Diverse Universe II" raames. Kommenteerib galerii juhataja Heli Tambur

  5. Kuu kultuurikulgur

    Index Scriptorium Estoniae

    2008-01-01

    Üritusest "Bazaar" 18. okt. Tallinnas Mustpeade majas (peaesinejad Meissa Niang & Diambaar). Tartu sügispäevadest 13.-19. oktoobrini. Festivalist "Hea Uus Heli" Tallinnas (3. okt. avakontsert Tallinnas baaris Juuksur ja klubiõhtu "1ÖÖ%" Von Krahli teatris, "HUH 2008" 4. okt. Mustpeade majas). Üritustesarjast "Tallinn Underground" Depeche Mode baaris. Üritusest "Vennaskond 24" 24. okt. Tallinnas Kultuurikatlas

  6. Incidental Discovery of a Membranous Ventricular Septal Aneurysm in Two Dissimilar Patients

    Directory of Open Access Journals (Sweden)

    Abhishek Naidu

    2012-01-01

    Full Text Available A ventricular septal aneurysm (VSA is a rare cardiac anomaly, and an accurate statistic of its prevalence has not been reported in the literature. True incidence is likely underestimated as most patients are thought to be asymptomatic. As a result, most VSAs are discovered incidentally on echocardiography, during angiography, or at autopsy. Potential complications include rupture, bacterial endocarditis, right ventricular outflow tract obstruction, and thromboembolic disease. It has been proposed that VSAs occur in association with ventricular septal defects (VSDs and other congenital cardiac abnormalities. It is uncommon for a VSA to exist in the absence of a known prior ventricular septal defect. We present two cases, each highlighting an incidental intact aneurysm involving the membranous interventricular septum. We discuss the contrast in the two patients with regard to their age, accompanying cardiac anomalies and cardiovascular fitness. Clinical implications of the condition are reviewed.

  7. Dicty_cDB: SSF396 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSF396 (Link to dictyBase) - - - Contig-U16263-1 SSF396Z (Link... to Original site) - - SSF396Z 732 - - - - Show SSF396 Library SS (Link to library) Clone ID SSF396 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SS/SSF3-D/SSF396Q.Seq.d/ Representative seq. ID SSF39...6Z (Link to Original site) Representative DNA sequence >SSF396 (SSF396Q) /CSM/SS/SSF3-D/SSF396Q.Seq.d/ XXXXX...-A/SSK721Q.Seq.d/ 1304 0.0 SSF396 (SSF396Q) /CSM/SS/SSF3-D/SSF396Q.Seq.d/ 1304 0.0 VSA730 (VSA730Q) /CSM/VS/

  8. Vulnerabilidad socio-ambiental y dimensiones de la sustentabilidad en un sector del periurbano marplatense

    Directory of Open Access Journals (Sweden)

    Laura Zulaica

    2010-12-01

    Full Text Available El crecimiento de las ciudades sobre las áreas circundantes deriva en la conformación de un espacio de interfase (periurbano, que manifiesta altos niveles de vulnerabilidad socio-ambiental (VSA. Asumiendo el concepto de VSA, el presente trabajo caracteriza una de las dimensiones de la sustentabilidad ambiental (sustentabilidad social en el sector sur del periurbano de Mar del Plata a partir de la construcción de un índice (IVSA, y examina su distribución, mediante el procedimiento de autocorrelación espacial. El análisis del IVSA revela que el área dista mucho de aproximarse a los logros de equidad y bienestar acordes con los principios de sustentabilidad. La metodología utilizada favorece la detección de zonas críticas y conforma un porcedimiento útil para establecer diferenciaciones internas en áreas periurbanas.

  9. Differences in human antibody reactivity to Plasmodium falciparum variant surface antigens are dependent on age and malaria transmission intensity in northeastern Tanzania

    DEFF Research Database (Denmark)

    Vestergaard, Lasse S; Lusingu, John P; Nielsen, Morten A

    2008-01-01

    at population level, we conducted an immunoepidemiological study in nearby communities in northeastern Tanzania, situated at different altitudes and therefore exposed to different levels of P. falciparum transmission intensity. Samples of plasma and infected red blood cells (IRBC) were collected from 759......-VSA IgG response developed dramatically in individuals at 1 to 2 years of age in the high-transmission area, reaching a maximum level at around 10 years of age; only a modest further increase was observed among older children and adults. In contrast, at lower levels of malaria transmission, anti-VSA Ig...... and functional characteristics of the variant-specific antibody response, which is likely to be important for protection against malaria....

  10. Dicty_cDB: FC-AI13 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI13 (Link to dictyBase) - - - Contig-U16263-1 FC-AI13F (Li...nk to Original site) FC-AI13F 507 - - - - - - Show FC-AI13 Library FC (Link to library) Clone ID FC-AI13 (Li.../dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI13Q.Seq.d/ Representative seq. ID FC-AI...13F (Link to Original site) Representative DNA sequence >FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq....nificant alignments: (bits) Value FC-AI13 (FC-AI13Q) /CSM/FC/FC-AI/FC-AI13Q.Seq.d/ 963 0.0 VSA730 (VSA730Q)

  11. Immune selection and within-host competition can structure the repertoire of variant surface antigens in Plasmodium falciparum -a mathematical model

    DEFF Research Database (Denmark)

    van Noort, Sander P; Nunes, Marta C; Weedall, Gareth D

    2010-01-01

    BACKGROUND: The evolutionary mechanisms structuring the expression pattern of variant surface antigen (VSA) families that allow pathogens to evade immune responses and establish chronic and repeated infections pose major challenges to theoretical research. In Plasmodium falciparum, the best......-studied VSA family is erythrocyte membrane protein 1 (PfEMP1). Each parasite genome encodes about 60 PfEMP1 variants, which are important virulence factors and major targets of host antibody responses. Transcriptional switching is the basis of clonal PfEMP1 variation and immune evasion. A relatively conserved......-host and diverse blocks that are favoured by immune selection at the population level. CONCLUSIONS/SIGNIFICANCE: The application of a monotonic dominance profile to VSAs encoded by a gene family generates two opposing selective forces and, consequently, two distinct clusters of genes emerge in adaptation to naïve...

  12. Photoluminescence and reflectivity studies of high energy light ions irradiated polymethyl methacrylate films

    Science.gov (United States)

    Bharti, Madhu Lata; Singh, Fouran; Ramola, R. C.; Joshi, Veena

    2017-11-01

    The self-standing films of non-conducting polymethyl methacrylate (PMMA) were irradiated in vacuum using high energy light ions (HELIs) of 50 MeV Lithium (Li+3) and 80 MeV Carbon (C+5) at various ion dose to induce the optical changes in the films. Upon HELI irradiation, films exhibit a significant enhancement in optical reflectivity at the highest dose. Interestingly, the photoluminescence (PL) emission band with green light at (514.5 nm) shows a noticeable increase in the intensity with increasing ion dose for both ions. However, the rate of increase in PL intensity is different for both HELI and can be correlated with the linear energy transfer by these ions in the films. Origin of PL is attributed to the formation of carbon cluster and hydrogenated amorphous carbon in the polymer films. HAC clusters act as PL active centres with optical reflectivity. Most of the harmful radiation like UV are absorbed by the material and is becoming opaque after irradiation and this PL active material are useful in fabrication of optoelectronic devices, UV-filter, back-lit components in liquid crystal display systems, micro-components for integrate optical circuits, diffractive elements, advanced materials and are also applicable to the post irradiation laser treatment by means of ion irradiation.

  13. U. S. Naval Forces, Vietnam Monthly Historical Summary for July 1971

    Science.gov (United States)

    1971-09-01

    atthe NSAS Detach- ment Qui Nhon, SHZ Harold B. Flynn apparently attempted to commit suicide while lying on his bed in the berthing spaces. At IO00H he...LCDR J. LASWELL , USN (R) 4 .vSA ISB CAT LAI LT J.F. MAYER, USN SA ISB NAM CAN LCDR R. BLEDSOE, USN SA lSB CHO MOI LCDR B. BURGETT,. USN SAISBAMAULT D

  14. Haemoglobin C and S role in acquired immunity against Plasmodium falciparum malaria.

    Directory of Open Access Journals (Sweden)

    Federica Verra

    2007-10-01

    Full Text Available A recently proposed mechanism of protection for haemoglobin C (HbC; beta6Glu-->Lys links an abnormal display of PfEMP1, an antigen involved in malaria pathogenesis, on the surface of HbC infected erythrocytes together with the observation of reduced cytoadhesion of parasitized erythrocytes and impaired rosetting in vitro. We investigated the impact of this hypothesis on the development of acquired immunity against Plasmodium falciparum variant surface antigens (VSA encoding PfEMP1 in HbC in comparison with HbA and HbS carriers of Burkina Faso. We measured: i total IgG against a single VSA, A4U, and against a panel of VSA from severe malaria cases in human sera from urban and rural areas of Burkina Faso of different haemoglobin genotypes (CC, AC, AS, SC, SS; ii total IgG against recombinant proteins of P. falciparum asexual sporozoite, blood stage antigens, and parasite schizont extract; iii total IgG against tetanus toxoid. Results showed that the reported abnormal cell-surface display of PfEMP1 on HbC infected erythrocytes observed in vitro is not associated to lower anti- PfEMP1 response in vivo. Higher immune response against the VSA panel and malaria antigens were observed in all adaptive genotypes containing at least one allelic variant HbC or HbS in the low transmission urban area whereas no differences were detected in the high transmission rural area. In both contexts the response against tetanus toxoid was not influenced by the beta-globin genotype. These findings suggest that both HbC and HbS affect the early development of naturally acquired immunity against malaria. The enhanced immune reactivity in both HbC and HbS carriers supports the hypothesis that the protection against malaria of these adaptive genotypes might be at least partially mediated by acquired immunity against malaria.

  15. Beyond imperviousness: A statistical approach to identifying functional differences between development morphologies on variable source area-type response in urbanized watersheds

    Science.gov (United States)

    Lim, T. C.

    2016-12-01

    Empirical evidence has shown linkages between urbanization, hydrological regime change, and degradation of water quality and aquatic habitat. Percent imperviousness, has long been suggested as the dominant source of these negative changes. However, recent research identifying alternative pathways of runoff production at the watershed scale have called into question percent impervious surface area's primacy in urban runoff production compared to other aspects of urbanization including change in vegetative cover, imported water and water leakages, and the presence of drainage infrastructure. In this research I show how a robust statistical methodology can detect evidence of variable source area (VSA)-type hydrologic response associated with incremental hydraulic connectivity in watersheds. I then use logistic regression to explore how evidence of VSA-type response relates to the physical and meterological characteristics of the watershed. I find that impervious surface area is highly correlated with development, but does not add significant explanatory power beyond percent developed in predicting VSA-type response. Other aspects of development morphology, including percent developed open space and type of drainage infrastructure also do not add to the explanatory power of undeveloped land in predicting VSA-type response. Within only developed areas, the effect of developed open space was found to be more similar to that of total impervious area than to undeveloped land. These findings were consistent when tested across a national cross-section of urbanized watersheds, a higher resolution dataset of Baltimore Metropolitan Area watersheds, and a subsample of watersheds confirmed not to be served by combined sewer systems. These findings suggest that land development policies that focus on lot coverage should be revisited, and more focus should be placed on preserving native vegetation and soil conditions alongside development.

  16. El Fenomeno Chavez: Hugo Chavez of Venezuela, Modern Day Bolivar

    Science.gov (United States)

    2007-03-01

    Venezuela’s state owned oil company, Petroleos de Venezuela. Ever seeking opportunities to provoke the giant United States, Chavez agreed to provide...controlled joint “El Fenomeno Chavez” . . . 9 venture, Petroleos de Venezuela SA (PDVSA). Exxon Mobil Corporation decided to sell their stakes among...exploited. 9. Major oil companies in Venezuela: 1. Petroleos de Venezuela (PdVSA) – government-owned; generates 1/3 of national GDP; monopolized the

  17. Uric Acid Level Has a U-shaped Association with Clinical Outcomes in Patients with Vasospastic Angina.

    Science.gov (United States)

    Gwag, Hye Bin; Yang, Jeong Hoon; Park, Taek Kyu; Song, Young Bin; Hahn, Joo Yong; Choi, Jin Ho; Lee, Sang Hoon; Gwon, Hyeon Cheol; Choi, Seung Hyuk

    2017-08-01

    No data are available on the association of serum uric acid and vasospastic angina (VSA) which has endothelial dysfunction as a possible pathophysiologic mechanism. Low uric acid level might cause adverse outcomes in VSA in connection with endothelial dysfunction. We enrolled 818 VSA patients whose uric acid level was measured at admission. Patients were categorized according to tertiles of uric acid level: group I, ≤ 4.8 mg/dL; group II, 4.9-5.9 mg/dL; and group III, ≥ 6.0 mg/dL. Primary outcome was major adverse cardiac events (MACEs), defined as a composite of cardiac death, acute myocardial infarction (MI), ischemic stroke, coronary revascularization, and rehospitalization for angina. Median follow-up duration was 49.2 months. Median uric acid values were 4.1 mg/dL for group I, 5.4 mg/dL for group II, and 6.7 mg/dL for group III. In the overall population, group II had a significantly lower incidence of MACE compared to group I (47 [17.1%] vs. 66 [24.6%]; hazard ratio [HR], 1.52; 95% confidence interval [CI], 1.02-2.26; P = 0.040) and a tendency of lower incidence of MACEs compared to Group III (47 [17.1%] vs. 62 [22.5%]; HR, 1.44; 95% CI, 0.98-2.13; P = 0.067). Among group I patients, those who received nitrates had a higher incidence of MACEs than those without nitrate therapy (P uric acid level was associated with adverse clinical outcomes, while high uric acid level had a trend toward an increase in it. Use of nitrate in patients with low uric acid level might have adverse effects on clinical outcomes of VSA. © 2017 The Korean Academy of Medical Sciences.

  18. Volatile substance abuse and crime: data from U.K. press cuttings 1996-2007.

    Science.gov (United States)

    Flanagan, R J; Fisher, D S

    2008-10-01

    Volatile substance abuse (VSA, solvent abuse, 'glue sniffing'), carries a risk of sudden death (some 700 deaths in the UK, 1996-2006). However, mortality data take no account of the social cost of the habit. From press cuttings we have identified 508 instances (569 individuals: 507 male, median age 25 yr, range 8-51 yr and 62 female, median age 18 yr, range 11-36 yr) where VSA, either alone or together with alcohol/other drugs, was reported in association with criminal or antisocial behaviour that resulted in a criminal conviction or caution. The frequency of reports decreased from 84 per annum (1997 and 1998) to 20 (2007). The agents reported (17 individuals, two agents) were 'glue' (225), LPG/'butane'/aerosol propellants (176), 'solvents' (158), and petrol (gasoline) (27). The offences cited (most serious crime) were: homicide (35), rape or other sexual assault (34), arson (25), assault or serious threat of assault (192), child neglect/cruelty (6), attempting to pervert the course of justice (2), criminal damage (41), burglarylrobbery/theft/shoplifting (100), nuisance/ breach of the peace/breach of antisocial behaviour order (104), driving whilst impaired and other vehicle-related offence (22), and supply (non-retail) (8). Thirty offenders were given life sentences or detained indefinitely under mental health legislation. Reports came from all parts of the UK, although most were from Northern England, Northern Ireland, and Scotland. There were many reports of recidivists; one 34-year-old male had made 113 court appearances, and had spent approximately nine years in custody. Although there are severe limitations to data derived from press cuttings and notwithstanding that in some cases VSA may have been raised in mitigation, these data provide an additional insight into the problem posed by VSA in the U.K.

  19. Identification of gene clusters associated with host adaptation and antibiotic resistance in Chinese Staphylococcus aureus isolates by microarray-based comparative genomics.

    Science.gov (United States)

    Li, Henan; Zhao, Chunjiang; Chen, Hongbin; Zhang, Feifei; He, Wenqiang; Wang, Xiaojuan; Wang, Qi; Yang, Ruifu; Zhou, Dongsheng; Wang, Hui

    2013-01-01

    A comparative genomic microarray comprising 2,457 genes from two whole genomes of S. aureus was employed for the comparative genome hybridization analysis of 50 strains of divergent clonal lineages, including methicillin-resistant S. aureus (MRSA), methicillin-susceptible S. aureus (MSSA), and swine strains in China. Large-scale validation was confirmed via polymerase chain reaction in 160 representative clinical strains. All of the 50 strains were clustered into seven different complexes by phylogenetic tree analysis. Thirteen gene clusters were specific to different S. aureus clones. Ten gene clusters, including seven known (vSa3, vSa4, vSaα, vSaβ, Tn5801, and phage ϕSa3) and three novel (C8, C9, and C10) gene clusters, were specific to human MRSA. Notably, two global regulators, sarH2 and sarH3, at cluster C9 were specific to human MRSA, and plasmid pUB110 at cluster C10 was specific to swine MRSA. Three clusters known to be part of SCCmec, vSa4 or Tn5801, and vSaα as well as one novel gene cluster C12 with homology with Tn554 of S. epidermidis were identified as MRSA-specific gene clusters. The replacement of ST239-spa t037 with ST239-spa t030 in Beijing may be a result of its acquisition of vSa4, phage ϕSa1, and ϕSa3. In summary, thirteen critical gene clusters were identified to be contributors to the evolution of host specificity and antibiotic resistance in Chinese S. aureus.

  20. An educational VSAT system for Thailand

    OpenAIRE

    Kunchaicharoenkul, Kanokporn

    1996-01-01

    Very small aperture terminal (VSA T) networks offer great opportunities to combine satellite technology and the needs of education in Thailand. An educational VSAT network for Thailand needs a central hub station in Bangkok and seven remote sites with VSAT equipment. The network supports two way compressed video, voice and data links between the central hub and VSAT sites. This thesis examines rain margin, system availability, VSAT antenna size and transponder power util...

  1. Antibodies from malaria-exposed pregnant women recognize trypsin resistant epitopes on the surface of Plasmodium falciparum-infected erythrocytes selected for adhesion to chondroitin sulphate A

    Directory of Open Access Journals (Sweden)

    Staalsoe Trine

    2004-09-01

    Full Text Available Abstract Background The ability of Plasmodium falciparum-infected erythrocytes to adhere to the microvasculature endothelium is thought to play a causal role in malaria pathogenesis. Cytoadhesion to endothelial receptors is generally found to be highly sensitive to trypsinization of the infected erythrocyte surface. However, several studies have found that parasite adhesion to placental receptors can be markedly less sensitive to trypsin. This study investigates whether chondroitin sulphate A (CSA binding parasites express trypsin-resistant variant surface antigens (VSA that bind female-specific antibodies induced as a result of pregnancy associated malaria (PAM. Methods Fluorescence activated cell sorting (FACS was used to measure the levels of adult Scottish and Ghanaian male, and Ghanaian pregnant female plasma immunoglobulin G (IgG that bind to the surface of infected erythrocytes. P. falciparum clone FCR3 cultures were used to assay surface IgG binding before and after selection of the parasite for adhesion to CSA. The effect of proteolytic digestion of parasite erythrocyte surface antigens on surface IgG binding and adhesion to CSA and hyaluronic acid (HA was also studied. Results P. falciparum infected erythrocytes selected for adhesion to CSA were found to express trypsin-resistant VSA that are the target of naturally acquired antibodies from pregnant women living in a malaria endemic region of Ghana. However in vitro adhesion to CSA and HA was relatively trypsin sensitive. An improved labelling technique for the detection of VSA expressed by CSA binding isolates has also been described. Conclusion The VSA expressed by CSA binding P. falciparum isolates are currently considered potential targets for a vaccine against PAM. This study identifies discordance between the trypsin sensitivity of CSA binding and surface recognition of CSA selected parasites by serum IgG from malaria exposed pregnant women. Thus, the complete molecular

  2. Structural feature study of benzofuran derivatives as farnesyltransferase inhibitors.

    Science.gov (United States)

    Moorthy, N S Hari Narayana; Sousa, Sergio F; Ramos, Maria J; Fernandes, Pedro A

    2011-12-01

    Ras proteins are small GTPases (G-proteins) that play a key role in cell growth and cell proliferation in the mitogen-activated protein kinase signal transduction pathway. Farnesylation is a critical step for membrane binding and the biological function of G-proteins. In the present investigation, we have studied the structural features of some molecules that are acting on the farnesyltransferase (FTase) enzyme for the inhibition of the farnesylation step in G-proteins. The benzofuran derivatives have activity against FTase inhibition and antiproliferative activity on QG56 cell lines. The result obtained from the quantitative structure-activity relationship study of these compounds shows that the models have significant predictive power and stability, as shown by statistical parameters such as R(2), Q(2), R(2)(pred), R(2)(m), F-value, Durbin-Watson, variable inflation factor values, Mahalanobis, and Cook's distances. The contribution of each descriptor for the activities (β-coefficients) reveals that the P-VSA descriptors (van der Waals surface area descriptors) such as vsa_pol, vsa_acc and SMR_VSA3 are the major contributors for the activity, along with other descriptors such as the partition coefficient, the partial charge, the atom and bond count and the adjacency, and distance descriptors. Earlier study on the FTase enzyme in our laboratory reveals that the existence of positively-charged groups on the FTase active site is important for drug design. It is also showing that the presence of hydrogen bonding donor and acceptor groups, together with negatively charged substituents is critical for improved activity by this series of molecules. These results offer important clues for the development of novel FTase inhibitors.

  3. Haemoglobin C and S role in acquired immunity against Plasmodium falciparum malaria.

    Science.gov (United States)

    Verra, Federica; Simpore, Jacques; Warimwe, George M; Tetteh, Kevin K; Howard, Tevis; Osier, Faith H A; Bancone, Germana; Avellino, Pamela; Blot, Isa; Fegan, Greg; Bull, Peter C; Williams, Thomas N; Conway, David J; Marsh, Kevin; Modiano, David

    2007-10-03

    A recently proposed mechanism of protection for haemoglobin C (HbC; beta6Glu-->Lys) links an abnormal display of PfEMP1, an antigen involved in malaria pathogenesis, on the surface of HbC infected erythrocytes together with the observation of reduced cytoadhesion of parasitized erythrocytes and impaired rosetting in vitro. We investigated the impact of this hypothesis on the development of acquired immunity against Plasmodium falciparum variant surface antigens (VSA) encoding PfEMP1 in HbC in comparison with HbA and HbS carriers of Burkina Faso. We measured: i) total IgG against a single VSA, A4U, and against a panel of VSA from severe malaria cases in human sera from urban and rural areas of Burkina Faso of different haemoglobin genotypes (CC, AC, AS, SC, SS); ii) total IgG against recombinant proteins of P. falciparum asexual sporozoite, blood stage antigens, and parasite schizont extract; iii) total IgG against tetanus toxoid. Results showed that the reported abnormal cell-surface display of PfEMP1 on HbC infected erythrocytes observed in vitro is not associated to lower anti- PfEMP1 response in vivo. Higher immune response against the VSA panel and malaria antigens were observed in all adaptive genotypes containing at least one allelic variant HbC or HbS in the low transmission urban area whereas no differences were detected in the high transmission rural area. In both contexts the response against tetanus toxoid was not influenced by the beta-globin genotype. These findings suggest that both HbC and HbS affect the early development of naturally acquired immunity against malaria. The enhanced immune reactivity in both HbC and HbS carriers supports the hypothesis that the protection against malaria of these adaptive genotypes might be at least partially mediated by acquired immunity against malaria.

  4. Dissociable effects of reward on attentional learning: from passive associations to active monitoring.

    Science.gov (United States)

    Della Libera, Chiara; Perlato, Andrea; Chelazzi, Leonardo

    2011-04-29

    Visual selective attention (VSA) is the cognitive function that regulates ongoing processing of retinal input in order for selected representations to gain privileged access to perceptual awareness and guide behavior, facilitating analysis of currently relevant information while suppressing the less relevant input. Recent findings indicate that the deployment of VSA is shaped according to past outcomes. Targets whose selection has led to rewarding outcomes become relatively easier to select in the future, and distracters that have been ignored with higher gains are more easily discarded. Although outcomes (monetary rewards) were completely predetermined in our prior studies, participants were told that higher rewards would follow more efficient responses. In a new experiment we have eliminated the illusory link between performance and outcomes by informing subjects that rewards were randomly assigned. This trivial yet crucial manipulation led to strikingly different results. Items that were associated more frequently with higher gains became more difficult to ignore, regardless of the role (target or distracter) they played when differential rewards were delivered. Therefore, VSA is shaped by two distinct reward-related learning mechanisms: one requiring active monitoring of performance and outcome, and a second one detecting the sheer association between objects in the environment (whether attended or ignored) and the more-or-less rewarding events that accompany them.

  5. Dissociable effects of reward on attentional learning: from passive associations to active monitoring.

    Directory of Open Access Journals (Sweden)

    Chiara Della Libera

    Full Text Available Visual selective attention (VSA is the cognitive function that regulates ongoing processing of retinal input in order for selected representations to gain privileged access to perceptual awareness and guide behavior, facilitating analysis of currently relevant information while suppressing the less relevant input. Recent findings indicate that the deployment of VSA is shaped according to past outcomes. Targets whose selection has led to rewarding outcomes become relatively easier to select in the future, and distracters that have been ignored with higher gains are more easily discarded. Although outcomes (monetary rewards were completely predetermined in our prior studies, participants were told that higher rewards would follow more efficient responses. In a new experiment we have eliminated the illusory link between performance and outcomes by informing subjects that rewards were randomly assigned. This trivial yet crucial manipulation led to strikingly different results. Items that were associated more frequently with higher gains became more difficult to ignore, regardless of the role (target or distracter they played when differential rewards were delivered. Therefore, VSA is shaped by two distinct reward-related learning mechanisms: one requiring active monitoring of performance and outcome, and a second one detecting the sheer association between objects in the environment (whether attended or ignored and the more-or-less rewarding events that accompany them.

  6. EVALUATION OF SEAT VIBRATION SOURCES IN DRIVING CONDITION USING SPECTRAL ANALYSIS

    Directory of Open Access Journals (Sweden)

    AHMAD KAMAL

    2011-06-01

    Full Text Available Seat vibration is one of the major causes of discomfort in moving vehicle. Tyre, engine, drivetrain and aerodynamic forces excite the cabin and interior through various pathways. In this paper, the contributions of tyre and engine vibration to seat excitations are studied. Virtual Source Analysis (VSA is implemented to decompose the source signals into incoherent phenomena. Studying these phenomena (virtual sources shows the amount and frequency bands that physical sources affect the seat vibration as the response channel. Experiment is conducted while riding on smooth and bumpy roads. Road roughness is characterized using International Roughness Index (IRI. VSA technique approve that tyre is the main source of seat vibration for the moving vehicle. Seat vibration has significant values below 400 Hz and tyre is found to be the dominant source of excitations for both smooth and bumpy roads. For smooth road, strong engine harmonics below 200 Hz also has some involvements. But in bumpy road, tyre vibration rise up and become the dominant broadband source of excitations. Tyre damper and engine mount Frequency Response Function (FRF analysis show that these parts are designed to be highly efficient below 1400 Hz and 200 Hz, respectively. These ranges are identical with those that were found as the critical operational frequency spans in VSA.

  7. In-straw cryoprotectant dilution of IVP bovine blastocysts vitrified in hand-pulled glass micropipettes.

    Science.gov (United States)

    Vieira, A D; Forell, F; Feltrin, C; Rodrigues, J L

    2007-06-01

    The aim of this study was to determine the influence of two ethylene glycol-based vitrification solutions on in vitro and in vivo survival after in-straw cryoprotectant dilution of vitrified in vitro-produced bovine embryos. Day-7 expanded blastocysts were selected according to diameter (> or = 180 microm) and osmotic characteristics and randomly assigned to one of three groups (i) VSa: vitrification in 40% EG+17.1% SUC+0.1% PVA; (ii) VSb: vitrification in 20% EG+20% DMSO; (iii) control: non-vitrified embryos. Vitrification was performed in hand-pulled glass micropipettes (GMP) and cryoprotectant dilution in 0.25 ml straws after warming in a plastic tube. Embryo viability was assessed by re-expansion and hatching rates after 72 h of IVC and by pregnancy rates after direct transfer of vitrified embryos. No differences in re-expansion rates were observed between vitrified groups after 24 h in culture (VSa=84.5%; VSb=94.8%). However, fewer VSa embryos (55.2%, Pstraw cryoprotectant dilution and direct embryo transfer.

  8. Accessing seismic data through geological interpretation: Challenges and solutions

    Science.gov (United States)

    Butler, R. W.; Clayton, S.; McCaffrey, B.

    2008-12-01

    Between them, the world's research programs, national institutions and corporations, especially oil and gas companies, have acquired substantial volumes of seismic reflection data. Although the vast majority are proprietary and confidential, significant data are released and available for research, including those in public data libraries. The challenge now is to maximise use of these data, by providing routes to seismic not simply on the basis of acquisition or processing attributes but via the geology they image. The Virtual Seismic Atlas (VSA: www.seismicatlas.org) meets this challenge by providing an independent, free-to-use community based internet resource that captures and shares the geological interpretation of seismic data globally. Images and associated documents are explicitly indexed by extensive metadata trees, using not only existing survey and geographical data but also the geology they portray. The solution uses a Documentum database interrogated through Endeca Guided Navigation, to search, discover and retrieve images. The VSA allows users to compare contrasting interpretations of clean data thereby exploring the ranges of uncertainty in the geometric interpretation of subsurface structure. The metadata structures can be used to link reports and published research together with other data types such as wells. And the VSA can link to existing data libraries. Searches can take different paths, revealing arrays of geological analogues, new datasets while providing entirely novel insights and genuine surprises. This can then drive new creative opportunities for research and training, and expose the contents of seismic data libraries to the world.

  9. Worsening of coronary spasm during the perioperative period: A case report

    Science.gov (United States)

    Teragawa, Hiroki; Nishioka, Kenji; Fujii, Yuichi; Idei, Naomi; Hata, Takaki; Kurushima, Shuji; Shokawa, Tomoki; Kihara, Yasuki

    2014-01-01

    We present the case of a 65-year-old male with vasospastic angina (VSA) whose condition worsened during the perioperative period. He had been diagnosed with VSA 10 years prior. He was treated with two types of vasodilators and had not experienced any chest symptoms for 5 years. At this juncture, he underwent surgery for relapsed maxillary sublingual carcinoma. He had taken two vasodilators one day prior to surgery. Intravenous infusion of nitroglycerin (NTG) was initiated immediately before the surgery and continued the following day. Instead of stopping NTG, a dermal isosorbide dinitrate tape was applied on post-operative day 1. Two days later, a complete atrioventricular block with pulseless electrical activity appeared. After cardiopulmonary resuscitation, emergent coronary angiography showed severe coronary spasm in both the left and right coronary arteries. Intracoronary infusion of nitroglycerin and epinephrine with percutaneous cardiopulmonary support relieved the coronary spasm. During the perioperative period, several factors can trigger coronary vasospasm, including the discontinuation of vasodilators. Thus, surgeons, anesthetists, and cardiologists should watch for coronary vasospasm during this period and for worsening coronary spasm when discontinuing vasodilators in patients at risk for VSA. PMID:25068030

  10. Impacts of soil moisture content on visual soil evaluation

    Science.gov (United States)

    Emmet-Booth, Jeremy; Forristal, Dermot; Fenton, Owen; Bondi, Giulia; Creamer, Rachel; Holden, Nick

    2017-04-01

    Visual Soil Examination and Evaluation (VSE) techniques offer tools for soil quality assessment. They involve the visual and tactile assessment of soil properties such as aggregate size and shape, porosity, redox morphology, soil colour and smell. An increasing body of research has demonstrated the reliability and utility of VSE techniques. However a number of limitations have been identified, including the potential impact of soil moisture variation during sampling. As part of a national survey of grassland soil quality in Ireland, an evaluation of the impact of soil moisture on two widely used VSE techniques was conducted. The techniques were Visual Evaluation of Soil Structure (VESS) (Guimarães et al., 2011) and Visual Soil Assessment (VSA) (Shepherd, 2009). Both generate summarising numeric scores that indicate soil structural quality, though employ different scoring mechanisms. The former requires the assessment of properties concurrently and the latter separately. Both methods were deployed on 20 sites across Ireland representing a range of soils. Additional samples were taken for soil volumetric water (θ) determination at 5-10 and 10-20 cm depth. No significant correlation was observed between θ 5-10 cm and either VSE technique. However, VESS scores were significantly related to θ 10-20 cm (rs = 0.40, sig = 0.02) while VSA scores were not (rs = -0.33, sig = 0.06). VESS and VSA scores can be grouped into quality classifications (good, moderate and poor). No significant mean difference was observed between θ 5-10 cm or θ 10-20 cm according to quality classification by either method. It was concluded that VESS scores may be affected by soil moisture variation while VSA appear unaffected. The different scoring mechanisms, where the separate assessment and scoring of individual properties employed by VSA, may limit soil moisture effects. However, moisture content appears not to affect overall structural quality classification by either method. References

  11. A REVIEW IN THE CONTEXT OF VALUES EDUCATION IN İBRAHİM ALÂETTİN GÖVSA’S POEMS, IN THE SCOPE OF CHILDREN’S LITERATURE - ÇOCUK EDEBİYATI KAPSAMINDA İBRAHİM ALÂETTİN GÖVSA’NIN ÇOCUK ŞİİRLERİ'NE DEĞERLER EĞİTİMİ BAĞLAMINDA BİR BAKIŞ

    Directory of Open Access Journals (Sweden)

    Kemal EROL

    2015-04-01

    Full Text Available The first literary works were being produced in Tanzimat period. In the II. Meşrutiyet period some important improvements can be observed after the written comments about the importance of children’s literature. The improvement in this period which had been begun by İbrahim Alâettin Gövsa was carried to the higher point with the contributions of so many writers. Çocuk Şiirleri (The Children’s Poems (1911 which was written by İbrahim Alâettin Gövsa is the first book In Turkish Literature for the children. The book has a great importance because of drawing the attention to the instant relationship between the literature and education. İbrahim Alâettin Gövsa’s writings in the scope of children's literature shows the way to his followers. He produces important works on the child education and psychology. In İbrahim Alâettin Gövsa’s Çocuk Şiirleri (The Children’s Poems (1911 consists so many articles about the attitudes of children and values which the children should have. İbrahim Alâettin Gövsa who thinks that literary works enlarge the children’s mind, complete the intellectual education, and feed dream land, reflects the national and universal values in Çocuk Şiirleri (The Children’s Poems (1911. İbrahim Alâettin Gövsa who believes that the childhood has a great importance about the forming of child’s character tries to explain the features which the children should have to be an independent individual. İbrahim Alâettin Gövsa to reach his aim uses so many values in his poems. The values are especially love such as pity and compassion, joy of living, working and producing value, concern books and reading, cultural values, ownership consciousness, courage, sincerity and friendliness, helpfulness, kindness, integrity, honesty and sensitivity.

  12. Inferior J waves in patients with vasospastic angina might be a risk factor for ventricular fibrillation.

    Science.gov (United States)

    Fumimoto, Tomoko; Ueyama, Takeshi; Shimizu, Akihiko; Yoshiga, Yasuhiro; Ono, Makoto; Kato, Takayoshi; Ishiguchi, Hironori; Okamura, Takayuki; Yamada, Jutaro; Yano, Masafumi

    2017-09-01

    There is little information about the relationship between J waves and the occurrence of ventricular fibrillation (VF) in patients with vasospastic angina (VSA). The present study aimed to assess the incidence of J waves and the occurrence of VF in patients with VSA. The subjects consisted of 62 patients with VSA diagnosed by acetylcholine provocation tests in our institution from 2002 to 2014. We investigated the VF events, prevalence of J waves, and relationship between the VF events and J waves. J waves were observed in 16 patients (26%) and VF events were documented in 11 (18%). The incidence of VF in the patients with J waves was significantly higher than that in those without J waves (38% vs 11%, p=0.026). J waves were observed in the inferior leads in 14 patients, lateral leads in 5, and anterior leads in 3. A univariate analysis indicated that the incidence of VF in the inferior leads of J wave positive patients (46%=6/14) was significantly (p=0.01) higher than that in the inferior leads of J wave negative patients (10%=5/48). The J waves in the anterior and/or lateral leads were not related to the incidence of VF. Notched type and slurred type J waves were not associated with VF. A multivariate analysis revealed that J waves in VSA patients were associated with VF [odds ratio (OR) 6.41, 95% confidence interval (CI) 1.37-29.93, p=0.02] and organic stenosis (OR 6.98, 95% CI 1.39-35.08, p=0.02). Further, J waves in the inferior leads were strongly correlated with VF (OR 11.85, 95% CI 2.05-68.42, p=0.006). The results suggest that the existence of J waves, especially in the inferior leads, might be a risk factor for VF in VSA patients. Copyright © 2016 Japanese College of Cardiology. Published by Elsevier Ltd. All rights reserved.

  13. Unustatuid eurolaulude tipp-10. Naine nagu Eurovisioon / Olavi Pihlamägi

    Index Scriptorium Estoniae

    Pihlamägi, Olavi, 1949-

    2008-01-01

    Eurovisiooni lauludest: Austria 1976 Waterloo & Robisnon "My Little Word" (5. koht), Suurbritannia 1972 The New Seekers "Beg, Steal or Borrow" (2. koht), Jugoslaavia 1983 Daniel "Dzuli (Julie)" (4. koht), Cliff Richard "Power To All Our Friends (3. koht)", Luksemburg 1967 Vicky Leandros "L'Amour Est Bleu" (4. koht), Holland 1974 Mouth & McNeal "I See A Star" (3. koht), Soome 1969 Jarkko & Laura "Kuin silloin ennen" (12. koht), Saksamaa 1981 Lena Valaitis "Johnny Blue", Saksamaa Katja Ebstein "Diese Welt" (3. koht), Luksemburg 1980 "Le Papa pinquin" (10. koht). Heli Läätsa lauldud eesti keelde kaverdatud eurolauludest

  14. In vitro anticancer screening of South African plants

    CSIR Research Space (South Africa)

    Fouché, Gerda

    2008-10-01

    Full Text Available , coughs, asthma and pneumonia (Van Wyk and Gericke, 2000). Vhavenda use leaf infusions as anthelmintics for respiratory d as A d roo r a decoctio Cadab powde The ro C d for ) C D E Go Heli Ipomoe K K Leucoside Kigeli Lippi Oncosipho P... Dryand. Leaf infusions ar in emetics taken chrysum nudifolium Less. Roots decoction reported to be u Africa roots are us 1996) a cairica (L.) Sweet Leaves are traditional crushed in a cup alanchoe paniculata Harv. Ash from leaves et al., 1996...

  15. Selgusid parimad noored luuletajad / Triin Kandi, Minni Saapar

    Index Scriptorium Estoniae

    Kandi, Triin

    2008-01-01

    Kuressaare noorte huvikeskuse korraldatud luulekonkursist "Noored poeedid 2008". Kuni 11aastaste hulgas sai I koha Karin Kreek, II koha Teele Tilts ja III koha Eerik Poopuu. Eripreemia sai Mikk Kärner. 12-15aastaste hulgas sai I koha Gerda-Liis Palmiste, II koha Kattre Adramees ja III koha Monika Turba. 16-aastaste ja vanemate vanuserühmas sai I koha Kaisa Kuusk, II koha Robert Vahter ja III koha Mona-Theresa Võlma. Eripreemia sai Heli Arnus. Artikkel sisaldab ka Kaisa Kuuse võiduluuletust

  16. Kas praegune triennaal õnnestus? : tarbekunst / Ketli Tiitsar ; interv. R[eet] V[arblane

    Index Scriptorium Estoniae

    Tiitsar, Ketli

    2006-01-01

    Tallinna IV rakenduskunsti triennaali töögrupi liige K. Tiitsar triennaalist, näituse kujundusest (3+1 Arhitektid), eesti tarbekunstist, seminarist ja esitluste päevast (Mecky van den Brinki, Heli Hietala, Marie-Louise Kristenseni, Outi Liusvaara esinemine), satelliitnäitustest (Anneli Porri ja Pille-Triin Männiku kuraatoriprojekt "Teadus ja tänapäev", Hollandi Gerrit Rietveldi akadeemia ehteosakonna üliõpilaste tööde näitus EKA galeriis)

  17. Estudo de variáveis demográficas, ocupacionais e co-carcinogenéticas no carcinoma espinocelular da base de língua nas mulheres

    OpenAIRE

    Amorim Filho Francisco S.; Andrade Sobrinho Josias de; Rapoport Abrão; Carvalho Marcos B.; Novo Neil F; Juliano Yara

    2003-01-01

    Avaliar a relação entre carcinógenos e o carcinoma espinocelular no sexo feminino. FORMA DE ESTUDO: Retrospectivo não randomizado. OBJETIVO: Determinar a relação entre carcinógenos (álcool e fumo) e o carcinoma espinocelular no sexo feminino na base da língua. MATERIAL E MÉTODOS: Estudo retrospectivo de 31 pacientes do sexo feminino realizado no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo (1977 a 2000). Foram analisados variáv...

  18. Graafikatriennaali grand prix Korea kunstnikule

    Index Scriptorium Estoniae

    1998-01-01

    Tallinna XI graafikatriennaali rahvusvaheline žürii andis grand prix korea kunstnikule Chung¡Sang-Gonile, kolm võrdset preemiat - soome kunstnikele Anita Jensenile ja Tapani Mikkonenile ning jaapani kunstnikule Estuko Obatale. Eesti Kunstimuuseumi preemia - Wendy Swallow. Tallinna linna preemia ja Ivar Luki sponsoripreemia - Walter Jule. Sponsoripreemiad : Paletti Eesti AS preemia - Inga Heamägi; Rannila Profiili preemia - Mojca Zlokarnik; UNDP preemia - Andrea Juan. Rotermanni soolalao arhitektuuri- ja kunstikeskuse diplom - Lis Ingram, Heli Päivikki Kurunsaari, Randi Strand, Wendy Swallow

  19. Dicty_cDB: CHD158 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ignments: (bits) Value N AW759959 |AW759959.1 sl56c07.y1 Gm-c1027 Glycine max cDNA clone GENOME SYSTEMS... CLONE ID:sequence. 56 7e-10 2 BF071471 |BF071471.1 st59b09.y1 Gm-c1053 Glycine max cDNA clone GENOME SYSTEMS...-c1065 Glycine max cDNA clone GENOME SYSTEMS CLONE ID: Gm-c1065-9068 5' similar to TR:Q9ZS06 Q9ZS06 RNA HELI

  20. Хели Сузи: "Пути Господни неисповедимы, но они привели Солженицына туда, где надо было писать "Архипелаг ГУЛАГ" / Ирина Токарева ; комменти

    Index Scriptorium Estoniae

    Токарева, Ирина

    2009-01-01

    Narvas avati Aleksandr Solženitsõni 90. sünniaastapäevale pühendatud näitus "Gulagi arhipelaag: eesti saar" ("Архипелаг ГУЛАГ: эстонский остров"). Näituse koostas ajakirja Вышгород peatoimetaja Ljudmila Gluškovskaja. Arnold Susi tütre Heli meenutused A. Solženitsenist. A.-L. Reimaa ja L. Gluškovskaja kommentaar

  1. Kariotakis : [luuletused] / Hasso Krull

    Index Scriptorium Estoniae

    Krull, Hasso, 1964-

    2002-01-01

    Tõlgitud H. Krulli luulekogudest "Kornukoopia" ja "Kaalud". Sisu: Kariotakis = Kariotakis ; Dorise välgumihkel = Doriksen sytkäri ; Kütioru päevalilled = Kütiorun auringonkukat ; Müre piim = Hapan maito / tlk. Heli Laaksonen. "kuu on seda nägu..." = "kuu näyttää siltä..." ; "olemine, ja tundmine, ja olemine, ja tundmine..." = "oleminen, ja tunteminen, ja oleminen, ja tunteminen..." ; Metamorfoosid : (aborigeenide lugu) = Metamorfoosit : (aboriginaalien tarina) ; Konnad : (aborigeenide lugu) = Sammakot (aboriginaalinen tarina) / tlk. Anu Laitila. "keset teleka ekraani..." = "keskellä kuvaruutua..." ; "mida me teeme..." = "mitä me teemme..." ; Nebenmensch = Nebenmensch ; "kuidagi peab..." = "pitäis jotenkin..." / tlk. Hannu Oitinen

  2. Riia, Euroopa ja euroopalik ruum / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2004-01-01

    Riia skulptuurikvadriennaal "Euroopa ruum" Riia Arsenalis, Läti raudteemuuseumis ja linnaruumis 4. VI-25. VII. Kuraatorid Kristaps Gulbis, Aigars Bikse. Preemia saanud ungari rühmituse Little Warsaw (Balint Havas, Andras Galik) tööst "Marmori tänav" ning Gints Gabransi (Läti), Tulay Schakiri (Soome), Eestit esindanud Daniela, Paul Rodgersi, Ekke Väli, Jüri Ojaveri jt. töödest. Tagasivaates 1950-ndate skulptuuri linnaruumi paigutatud fotode kaudu esindas Eestit Arseni Mölder. Heli Ryhäneni ja Anne Meskaneni näitusest "Skulptuurid" Tallinna Kunstihoone galeriis

  3. Läänemeresoome keelte õppetoolis : kevadseminaril esinejad / Maris Amon

    Index Scriptorium Estoniae

    Amon, Maris

    2000-01-01

    25.-26. veebr. 2000 Tallinna Pedagoogikaülikooli läänemeresoome keelte õppetooli poolt korraldatud Tallinna Pedagoogikaülikooli, Tartu Ülikooli, Joensuu Ülikooli ja Oulu Ülikooli VIRSU-projekti "Emakeele mõju soome ja eesti keele õppimisele ja õpetamisele" kevadseminaril esinesid Heli Laanekask (Oulu Ülikool), Annukka Kataja (TÜ), Leena Nissila (Oulu Ülikool), Jaan Õispuu (TPÜ), Natali Happonen (TÜ), Jüri Valge (TÜ), Annekatrin Kaivapalu (TPÜ), Pirkko Muikku-Werner (Joensuu Ülikool), Helen Sooväli (TPÜ-TÜ), Hannu Remes (Joensuu Ülikool), Ingrid Nikopensius (TÜ)

  4. Areeni aasta albumid 2004. Personaalsed tipud / Erkki Tero

    Index Scriptorium Estoniae

    Tero, Erkki

    2007-01-01

    Heliplaatidest: Vaiko Eplik ja Eliit "2: Aastaajad", LCD Soundsystem "Sound of Silver", Arcade Fire "Neon Bible", M.I.A "Kala", Burial "Untrue", Chalice "Taevas ja Perse", Panda Bear "Person Pitch", Ans. Andur "Topeltvikerkaar", Animal Collective "Strawberry Jam", PJ Harvey "White Chalk", Devendra Banhart "Smokey Rolls Down The Thunder Canyon", Kreatiivmootor "Irratsionaalne", Holy Fuck "LP", 3 Pead "Ilusaim heli", Throbbing Gristle "Part Two: The Endless Not", Battles "Mirrored", Kings Of Leon "Because of the Times", Robert Wyatt "Comicopera", National "Boxer", Simian Mobile Disco "Attack Decay Sustain Release"

  5. Punanahklusest: Majakovskist indiaanlasteni / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2011-01-01

    Tutvustus: Jangfeldt, Bengt. Mäng elu peale : Vladimir Majakovski ja tema lähikond / tõlkinud Anu Saluäär. Tallinn : Varrak, 2011 ; Céline, Louis-Ferdinand. Reis öö lõppu / tõlkinud Heli Allik. Tallinn : Varrak, 2010 ; Simone, Claude. Flandria tee / tõlkinud Leena Tomasberg. Tallinn : Eesti Raamat, 2011 ; Härm, Tiiu. Jää voolab : Eesti polaarränduri August Masiku maailm. Tallinn : Eesti Raamat, 2010 ; Page, Jake. Suure vaimu rüpes : Ameerika indiaanlaste 20 000-aastane ajalugu / tõlkinud Matti Piirimaa. Tallinn : Tänapäev, 2011

  6. President andis üle haridusauhinnad

    Index Scriptorium Estoniae

    2009-01-01

    Vabariigi Presidendi Kultuurirahastu hariduspreemia pälvisid Tartu Ülikooli loodus- ja tehnoloogiateaduskonna loodusteadusliku hariduse keskuse bioloogia didaktika lektor ning Hugo Treffneri gümnaasiumi bioloogia ja keemia süvaõppega loodussuuna bioloogiaõpetaja Urmas Kokassaar, Kolga keskkooli eesti keele ja kirjanduse õpetaja Terje Varul ning Narva lasteaia "Päikene" juhataja Heli Adamovitš. Reaalteaduste eripreemia pälvis Tallinna Tõnismäe Reaalkooli matemaatikaõpetaja Mihhail Gusev. Juuresoleval fotol president T.H. Ilves koos tütar Kadri Keiuga

  7. Tallinna ülikool jagab omainimestele viiendat korda kirjandusauhindu

    Index Scriptorium Estoniae

    2011-01-01

    Algupärase ilukirjanduse kategooria tunnistati võitjaks TLÜ slaavi keelte ja kultuuride instituudi vilistlane Andrei Ivanov Loomingu Raamatukogus ilmunud jutustuste "Minu Taani onuke" ja "Tuhk" eest. Lühiproosa või ilukirjandusliku tõlke kategooria laureaatideks nimetati ülikooli kirjastuse peatoimetaja Heli Allik, kes on tõlkinud Louis-Ferdinand Céline’i romaani "Reis öö lõppu", ning vilistlane Lauri Kitsnik, kes on tõlkinud Tanikawa Shuntaro luulekogu "Sõnade asjatu flirt" ning Fuji Sadakazu luulekogu "Titt maksab kätte"

  8. Magistritöö tõi kuulsad kosmonaudid Põltsamaale / Ülle Lätte

    Index Scriptorium Estoniae

    Lätte, Ülle, 1955-

    2011-01-01

    Põltsamaa Kunstiseltsi näitusest "Kosmos", mida käisid külastamas tuntud nõukogude kosmonaudid Aleksei Leonov ja Georgi Gretško. Näitus, kosmonautide külaskäik ja selle filmimine said teoks tänu Põltsamaalt pärit Balti Filmi- ja Meediakooli magistrandile Heli Tetlovile, kes läbi nende sündmuste teeb oma magistritööd. Maalimise, kunstinäituse ja kosmonautide külaskäigu jäädvustas filmilindile operaator ja fotograaf Tanel Tero

  9. Expression of Plasmodium falciparum erythrocyte membrane protein 1 in experimentally infected humans

    Directory of Open Access Journals (Sweden)

    Theander Thor G

    2005-04-01

    Full Text Available Abstract Background Parasites causing severe malaria in non-immune patients express a restricted subset of variant surface antigens (VSA, which are better recognized by immune sera than VSA expressed during non-severe disease in semi-immune individuals. The most prominent VSA are the var gene-encoded Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1 family, which is expressed on the surface of infected erythrocytes where it mediates binding to endothelial receptors. Thus, severe malaria may be caused by parasites expressing PfEMP1 variants that afford parasites optimal sequestration in immunologically naïve individuals and high effective multiplication rates. Methods var gene transcription was analysed using real time PCR and PfEMP1 expression by western blots as well as immune plasma recognition of parasite cultures established from non-immune volunteers shortly after infection with NF54 sporozoites. Results In cultures representing the first generation of parasites after hepatic release, all var genes were transcribed, but GroupA var genes were transcribed at the lowest levels. In cultures established from second or third generation blood stage parasites of volunteers with high in vivo parasite multiplication rates, the var gene transcription pattern differed markedly from the transcription pattern of the cultures representing first generation parasites. This indicated that parasites expressing specific var genes, mainly belonging to group A and B, had expanded more effectively in vivo compared to parasites expressing other var genes. The differential expression of PfEMP1 was confirmed at the protein level by immunoblot analysis. In addition, serological typing showed that immune sera more often recognized second and third generation parasites than first generation parasites. Conclusion In conclusion, the results presented here support the hypothesis that parasites causing severe malaria express a subset of PfEMP1, which bestows

  10. METEOR: A Tool for Evaluating Multi-Echelon Inventory Models and Material Readiness.

    Science.gov (United States)

    1983-03-01

    target is achieved prior to a specified number of missions, the system meets reliabiltiy require- ments, and execution is terminated. If the system does...not attain the lower confidence limit prior to the specified maximum number of missions, the system fails its reliability requirement, and execution ...the user in model ag the weapon system confiquretion. 37 .4W- 8 14 MANUFCTURE C4..4q4 Co, li -PL -VSA 14 -- EPOYD 1/0NLT TER~.4 DELOEDW/O4S 1 17 2 ~m

  11. VAR2CSA and protective immunity against pregnancy-associated Plasmodium falciparum malaria

    DEFF Research Database (Denmark)

    Hviid, L; Salanti, A

    2007-01-01

    that the selective placental accumulation of IEs that characterizes pregnancy-associated malaria (PAM) is caused by an immunologically and functionally unique subset of VSA (VSAPAM) that is only expressed by parasites infecting pregnant women, and that protective immunity to PAM is mediated by IgG with specificity......People living in areas with stable transmission of P. falciparum parasites acquire protective immunity to malaria over a number of years and following multiple disease episodes. Immunity acquired this way is mediated by IgG with specificity for parasite-encoded, clonally variant surface antigens...

  12. Van Bevrydingsteologie na Swart Teologie in Suid-Afrika

    Directory of Open Access Journals (Sweden)

    B. Spoelstra

    1988-06-01

    Full Text Available Die bevrydingsteologie reageer teen strukture en praktyke wat die menswaardigheid van die mens en persoon aantas. Die wortels daarvan lê in Suid-Amerika en die VSA. Tog het Hitler se filosofie van die Ariërs as Herrenvolk en vervolging van die Jode die Tweede Wereldoorlog gemotiveer. Reeds in die oorlog het Bonhoeffer aandag gevra vir die ander mens in nood. Jy moet God dien in wat jy aan die ander doen. Dr. C. F. Beyers Naudé trek reglynig ’n parallel tussen Naziisme van Hitler en “apartheid” in Suid-Afrika (Berkhof, 1985 : 168.

  13. STRES PRI ZAPOSLENIH V ORGANIZACIJI "x"

    OpenAIRE

    Slaček, Doris

    2014-01-01

    Diplomski seminar temelji na obravnavi aktualnega problema, to je stres oziroma stres na delovnem mestu, s katerim se v sodobnem času spopada vsa družba na vseh področjih svojega življenja. Podrobneje smo se osredotočili na stres na delovnem mestu v izbrani organizaciji »x«. Stres ne prinaša negativnih posledic samo posameznikom, ampak so tega deležne tudi same organizacije, kar se kaže v dodatnih stroških organizacije ali kot izguba prihodkov. Stresorji na delovnem mestu so največkrat čas...

  14. Highly Destructive Polymer-Contained Neutralizing Skin Protectants

    Science.gov (United States)

    1997-06-01

    VSA4AM Contract DAMD1 7-97-0-7017, FINAL REPORT page 78 DLC-6 Mg2Ni-Hydride Poly(ethylene glycol) methyl ether DLC-6., 40 Fe:04•..001 030 HETTLER ...sent to Army ICD M,.4ol-H,Mgc2N - HydrIdd FL/•::03031.-01 DSC HETTLER 20.400 rmg Rte:10.0 C/.’i.n Ident: 1.0 03n-Apr-g7 A X 242.06 C 100. 200. 300

  15. Design and development of multi-lane smart electromechanical actuators

    CERN Document Server

    Annaz, Fawaz Yahya

    2014-01-01

    Design and Development of Multi-Lane Smart Electromechanical Actuators presents the design of electromechanical actuators in two types of architectures, namely, Torque Summed Architecture (TSA) and Velocity Summed Architecture, (VSA). It examines them in: * Hardware redundancy, where the architecture is made up of 3 or 4 lanes. * Digital Math Model redundancy, where a more compact two lanes architectures will be presented. The book starts with the very basic concepts and introduces the design process logically so that an understanding of the smart multi-lane systems that drive an aileron

  16. Early warning system hypertension thresholds to predict adverse outcomes in pre-eclampsia: A prospective cohort study.

    Science.gov (United States)

    Nathan, Hannah L; Seed, Paul T; Hezelgrave, Natasha L; De Greeff, Annemarie; Lawley, Elodie; Anthony, John; Hall, David R; Steyn, Wilhelm; Chappell, Lucy C; Shennan, Andrew H

    2017-11-21

    To evaluate the association between blood pressure (BP) measurements and adverse outcomes in women with pre-eclampsia. A prospective cohort study of women with pre-eclampsia admitted to three South African tertiary facilities. BP was measured using the CRADLE Vital Signs Alert (VSA), incorporated with a traffic light early warning system; green: systolic BP warning system, can identify women who are hypertensive, at increased risk of severe pre-eclampsia complications and in need of escalation of care. Women who triggered a red light were at increased risk of kidney injury, magnesium sulfate use and CCU admission. Copyright © 2017. Published by Elsevier B.V.

  17. Secondary Flow in Cascades.

    Science.gov (United States)

    1984-06-01

    sIno to ormim. 71e numericlcompuatiosf ebs~~~~~a fa= of Dmdsl with sVsa Ab MS.ocit w caridoudto Ib doube rciio onu the tMDhL 7.:e ~--ralU bV, h~tesummnt...properties in the throughflow direction is set to zero. A varty component in the curvature plane 113, 141. The Poisson type equation with Neumann boundary... Poisson equations are derived, for the x streailke functions, with source tems representing the flow " three-dimensionallty. The source terms are dependent

  18. Primerjava različnih metod ugotavljanja živosti semen orhidej

    OpenAIRE

    Škorjanc, Martina

    2014-01-01

    Semena kukavičevk asimbiontsko kalijo samo, če so živa. Če niso, ne kalijo, kljub ustreznemu gojišču. Da si prihranimo dilemo, ali semena ne kalijo zato, ker niso živa oziroma ne kalijo zaradi neustreznega gojišča, je dobro vsa semena pred kalitvijo testirati, ali so sploh živa. Preverili smo učinkovitost štirih metod za ugotavljanje živosti semen orhidej: metodo s flouroscein diacetat-om (FDA), metodo s trifenil tetrazolijevim klorid-om (TTC), metodo z difenil tetrazolijevim bromidom (MTT) i...

  19. Analysis of IgG with specificity for variant surface antigens expressed by placental Plasmodium falciparum isolates

    DEFF Research Database (Denmark)

    Khattab, Ayman; Reinhardt, Christina; Staalsoe, Trine

    2004-01-01

    BACKGROUND: Pregnancy-associated malaria (PAM) is caused by Plasmodium falciparum-infected erythrocytes that can sequester in placental intervillous space by expressing particular variant surface antigens (VSA) that can mediate adhesion to chondroitin sulfate A (CSA) in vitro. IgG antibodies......: In the study cohort, primiparous as well as secundiparous women had the greatest risk of infection at delivery as well as during pregnancy. Primiparous women with infected placentas at delivery showed higher levels of VSAPAM-specific IgG compared to women who had no malaria infections at delivery. Placental...

  20. Primerjava naprednih konceptov organizacije proizvodnje

    OpenAIRE

    Kuharič, Jernej

    2012-01-01

    Dobra organizacija proizvodnje je v današnjem času ključ do uspešnosti proizvodnje in posledično ključ do uspešnosti podjetja. V ta namen so se skozi zgodovino razvili različni napredni koncepti organizacije proizvodnje. Večinoma vsa sodobna podjetja imajo proizvodnjo organizirano po izbranem naprednem konceptu. S pravilno uvedbo koncepta v proizvodnjo, ki mora zajemati vse predpisane korake uvajanja, si podjetje lahko obeta dobre rezultate. Odločitev, kateri napredni koncept je najboljši, je...

  1. Architecture of a System for Interactive Training and Testing in Algorithms and Data Structures

    Directory of Open Access Journals (Sweden)

    M. Tomašević

    2011-06-01

    Full Text Available In this paper we propose the architecture of a new software system for self-directed interactive learning and assessment in the domain of algorithms and data structures. The system extends Visual Simulator of Algorithms (VSA, a tool previously developed at the School of Electrical Engineering, University of Belgrade. The system provides control of trainee's independence level, flexible input data set assignment and configurable automatic assessment of test-taker's actions. The paper describes the architecture of the proposed system and gives relevant implementation details.

  2. Četrta industrijska revolucija

    OpenAIRE

    Slekovec, Tadea

    2017-01-01

    Diplomski projekt obravnava pojem industrijske revolucije, natančneje zadnje, četrte industrijske revolucije. Četrta industrijska revolucija obravnava tako napredek v tehnologiji kot napredek v programskih opremah. Pojem zajema vsa področja našega življenja, tako osebno kot poslovno. V sodobni zgodovini obstaja več industrijskih revolucij, ki so druga na drugo vplivale posredno in tudi neposredno, sem vsako obdobje posebej opredelila časovno, prostorsko ter tehnološko. Poudarek sem dala četrt...

  3. Modna industrija: odnos potrošnic do nakupovanja modnih torbic

    OpenAIRE

    Hren Špes, Tamara

    2017-01-01

    Modna industrija je danes več sto milijard dolarjev vredna globalna organizacija. Z njeno pomočjo nastajajo vsa naša oblačila, obutev in modni dodatki. Sestavljena je iz mnogo ljudi po celem svetu, kamor spadajo tudi prodajalci, kupci, modni oblikovalci, stilisti in mnogi drugi povezani z modo. Moda se spreminja iz meseca v mesec, zato mora modna industrija zvesto slediti novim trenom na trgu ter znova in znova poizkušati nove ideje. Če jim ne sledi, lahko kaj hitro zapade v negativne števil...

  4. Self-monitoring of blood pressure during pregnancy

    DEFF Research Database (Denmark)

    Lihme, Frederikke F; Madsen, Mette E; Lykke, Jacob A

    2017-01-01

    arterial blood pressure (MAP) and were compared using the paired sample t-test. Mean values and differences of systolic and diastolic pressure were plotted in Bland-Altman plots to test the agreement of the measurements. Finally, a mean evaluation score was calculated. RESULTS: One hundred pregnant women...... and MAP are within acceptable international standards. The semiautomatic device Microlife-VSA is well suited for self-measurement; however, safety studies on the use of home measurements in hypertensive pregnancies are still warranted....

  5. Flowers as a reservoir of yeast diversity: description of Wickerhamiella nectarea f.a. sp. nov., and Wickerhamiella natalensis f.a. sp. nov. from South African flowers and pollinators, and transfer of related Candida species to the genus Wickerhamiella as new combinations.

    Science.gov (United States)

    de Vega, Clara; Albaladejo, Rafael G; Guzmán, Beatriz; Steenhuisen, Sandy-Lynn; Johnson, Steven D; Herrera, Carlos M; Lachance, Marc-André

    2017-08-01

    Flowers offer favourable microenvironments for yeast growth, and are increasingly recognised as a rich source of novel yeast species. Independent surveys of yeasts associated with flowers and pollinators in South Africa led to the discovery of 38 strains of two new species. Physiological profiles and analysis of the internal transcribed spacer and the D1/D2 domains of the large subunit rRNA gene showed that they represent two novel species that belong to the Wickerhamiella clade. We describe the species as Wickerhamiella nectarea f.a. sp. nov. (type strain EBDCdVSA11-1T, CBS 14162T, NRRL Y-63791T) and W. natalensis f.a. sp. nov. (type strain EBDCdVSA7-1T, CBS 14161T, NRRL Y-63790T). We extend the known range of flower-associated Wickerhamiella species to South Africa and discuss the ecology and phylogenetic relationships of the clade in relation to its host species and biogeography. Examination of growth characteristics supports that the Wickerhamiella clade exhibits a high degree of evolutionary lability, and that specialisation to different niches may occur rapidly. We review the current status of floral yeast biodiversity and nectar as a reservoir of species diversity, and the importance of pollinators and biogeography. In addition, 18 species formerly assigned to the genus Candida are reassigned formally to the genus Wickerhamiella. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  6. Immunoglobulin G antibody reactivity to a group A Plasmodium falciparum erythrocyte membrane protein 1 and protection from P. falciparum malaria

    DEFF Research Database (Denmark)

    Magistrado, Pamela A; Lusingu, John; Vestergaard, Lasse S

    2007-01-01

    where P. falciparum is endemic, parasites causing severe malaria and malaria in young children with limited immunity tend to express semiconserved PfEMP1 molecules encoded by group A var genes. Here we investigated antibody responses of Tanzanians who were 0 to 19 years old to PF11_0008, a group A Pf......Variant surface antigens (VSA) on the surface of Plasmodium falciparum-infected red blood cells play a major role in the pathogenesis of malaria and are key targets for acquired immunity. The best-characterized VSA belong to the P. falciparum erythrocyte membrane protein 1 (PfEMP1) family. In areas...... of antibodies to the PF11_0008 CIDR2beta domain was associated with reduced numbers of malaria episodes. These results indicate that homologues of PF11_0008 are present in P. falciparum field isolates and suggest that PF11_0008 CIDR2beta-reactive antibodies might be involved in protection against malaria...

  7. Effect of narrowing the base of support on the gait, gaze and quiet eye of elite ballet dancers and controls.

    Science.gov (United States)

    Panchuk, Derek; Vickers, Joan N

    2011-08-01

    We determined the gaze and stepping behaviours of elite ballet dancers and controls as they walked normally and along progressively narrower 3-m lines (l0.0, 2.5 cm). The ballet dancers delayed the first step and then stepped more quickly through the approach area and onto the lines, which they exited more slowly than the controls, which stepped immediately but then slowed their gait to navigate the line, which they exited faster. Contrary to predictions, the ballet group did not step more precisely, perhaps due to the unique anatomical requirements of ballet dance and/or due to releasing the degrees of freedom under their feet as they fixated ahead more than the controls. The ballet group used significantly fewer fixations of longer duration, and their final quiet eye (QE) duration prior to stepping on the line was significantly longer (2,353.39 ms) than the controls (1,327.64 ms). The control group favoured a proximal gaze strategy allocating 73.33% of their QE fixations to the line/off the line and 26.66% to the exit/visual straight ahead (VSA), while the ballet group favoured a 'look-ahead' strategy allocating 55.49% of their QE fixations to the exit/VSA and 44.51% on the line/off the line. The results are discussed in the light of the development of expertise and the enhanced role of fixations and visual attention when more tasks become more constrained.

  8. Synthesis, screening and QSAR studies of 3-benzoyl-2-oxo/thioxo-1,2,3,4-tetrahydro-pyrimidine analogues as antibacterial agents

    Directory of Open Access Journals (Sweden)

    Ramesh L. Sawant

    2008-12-01

    Full Text Available The purpose of this study was to synthesize several 3-benzoyl-5-acyl-6-methyl-4-substituted-2-oxo/thioxo-1,2,3,4-tetrahydropyrimidines, evaluate them for their antibacterial activity and to establish correlation between the activity and physicochemical properties. 5-Acyl-6-methyl-4-substituted-2-oxo/thioxo-1,2,3,4-tetrahydropyrimidines (A were synthesized by cyclocondensation reaction between appropriate aldehyde, acetoacetate and urea/thiourea in presence of aluminium chloride and hydrochloric acid which upon treatment with benzoyl chloride in presence of pyridine in benzene furnish the title compounds (1-28. The structures of all title compounds have been confirmed on the basis of their analytical, IR and NMR spectral data. The title compounds have been tested for antibacterial activity against Staphylococcus aureus. The compounds were divided into training and test sets. A quantitative structure activity relationship study was made using various descriptors. Several statistical expressions were developed using stepwise multiple linear regression analysis. The best quantitative structure activity relationship model was further cross validated. The study revealed that total positive partial charge (PC+ and total polar negative Van der Waals surface area (Q_VSA_PNEG contributes negatively where as contribution of Van der Waals surface area to molar refractivity (SMR_VSA7 contributes positively to the antibacterial activity. The compounds with improved antibacterial potential can be successfully designed with selected quantitative structure activity relationship model.

  9. Reduced risk of uncomplicated malaria episodes in children with alpha+-thalassemia in northeastern Tanzania.

    Science.gov (United States)

    Enevold, Anders; Lusingu, John P; Mmbando, Bruno; Alifrangis, Michael; Lemnge, Martha M; Bygbjerg, Ib C; Theander, Thor G; Vestergaard, Lasse S

    2008-05-01

    The prevalence of human red blood cell (RBC) polymorphisms is high in areas of intense Plasmodium falciparum transmission, and individuals carrying these genetic traits are believed to be partially protected against severe malaria. However, it remains uncertain how RBC polymorphisms affect the susceptibility to uncomplicated malaria. We compared the risk of suffering from febrile, uncomplicated malaria between individuals carrying three common RBC polymorphisms (sickle cell trait, alpha(+)-thalassemia, and glucose-6-phosphate-dehydrogenase deficiency) and controls. The study was performed in an area of intense malaria transmission where 202 individuals 0-19 years of age were monitored clinically for a period of 6 months. RBC polymorphisms were assessed with molecular methods, and plasma antibodies to P. falciparum variant surface antigens (anti-VSA IgG) and glutamate-rich protein (anti-GLURP IgG) were measured with flow cytometry and ELISA assays, respectively. Regression analyses showed that alpha(+)-thalassemia was associated with a reduced risk of uncomplicated malaria episodes and that this advantageous effect seemed to be more predominant in children older than 5 years of age, but was independent of levels of antibodies to VSA and GLURP.

  10. The relationship between speech segment duration and vowel centralization in a group of older speakers.

    Science.gov (United States)

    Fletcher, Annalise R; McAuliffe, Megan J; Lansford, Kaitlin L; Liss, Julie M

    2015-10-01

    This study examined the relationship between average vowel duration and spectral vowel quality across a group of 149 New Zealand English speakers aged 65 to 90 yr. The primary intent was to determine whether participants who had a natural tendency to speak slowly would also produce more spectrally distinct vowel segments. As a secondary aim, this study investigated whether advancing age exhibited a measurable effect on vowel quality and vowel durations within the group. In examining vowel quality, both flexible and static formant extraction points were compared. Two formant measurements, from selected [ɐ:], [ i:], and [ o:] vowels, were extracted from a standard passage and used to calculate two measurements of vowel space area (VSA) for each speaker. Average vowel duration was calculated from segments across the passage. The study found a statistically significant relationship between speakers' average vowel durations and VSA measurements indicating that, on average, speakers with slower speech rates produced more acoustically distinct speech segments. As expected, increases in average vowel duration were found with advancing age. However, speakers' formant values remained unchanged. It is suggested that the use of a habitually slower speaking rate may assist speakers in maintaining acoustically distinct vowels.

  11. Internet roaming: a WLAN/3G integration system for enterprises

    Science.gov (United States)

    Luo, Hui; Jiang, Zhimei; Kim, Byoung J.; Shankar, Narendra K.; Henry, Paul

    2002-08-01

    This paper proposes an enterprise-oriented WLAN/3G network integration solution, called the Internet Roaming system. Differing from other operator-oriented WLAN/3G network integration solutions, the Internet Roaming system is a practical IP-based corporate network architecture that provides seamless internetworking across office WLAN, home WLAN, public WLAN, and 2.5G/3G cellular network for corporate wireless data users. An Internet Roaming system may have four building blocks. They are IRC (Internet Roaming Client), SMG (secure mobility gateway), SIA (Secure IP Access) gateway, and VSA (virtual single account) server. The IRC is a special client tool (software or hardware) installed on a wireless data device. It provides a secure mobile IP connection from the wireless data device to the corporate network transparent to the operating system of the wireless data devices. The SMG is a mobile IPsec gateway installed on the corporate core network facing the Internet. It works with the IRC to maintain a secure mobile IP connection when the wireless data device is connected on the Internet through a home WLAN, a public WLAN, or a cellular network. The SIA server is a special IPsec gateway installed on the corporate intranet where office WLAN is installed. It works with the IRC to assure the security of office WLAN while improving the routing efficiency for users computers. The VSA server manages the IRC, SMG, and SIA servers.

  12. INTERPRETATION OF AIRBORNE ELECTROMAGNETIC AND MAGNETIC DATA IN THE 600 AREA

    Energy Technology Data Exchange (ETDEWEB)

    CUMMINS GD

    2010-11-11

    As part of the 200-PO-1 Phase I geophysical surveys, Fugro Airborne Surveys was contracted to collect airborne electromagnetic (EM) and magnetic surveys of the Hanford Site 600 Area. Two helicopter survey systems were used with the HeliGEOTEM{reg_sign} time domain portion flown between June 19th and June 20th, 2008, and the RESOLVE{reg_sign} frequency domain portion was flown from June 29th to July 1st, 2008. Magnetic data were acquired contemporaneously with the electromagnetic surveys using a total-field cesium vapor magnetometer. Approximately 925 line kilometers (km) were flown using the HeliGEOTEM{reg_sign} II system and 412 line kilometers were flown using the RESOLVE{reg_sign} system. The HeliGEOTEM system has an effective penetration of roughly 250 meters into the ground and the RESOLVE system has an effective penetration of roughly 60 meters. Acquisition parameters and preliminary results are provided in SGW-39674, Airborne Electromagnetic Survey Report, 200-PO-1 Groundwater Operable Unit, 600 Area, Hanford Site. Airborne data are interpreted in this report in an attempt to identify areas of likely preferential groundwater flow within the aquifer system based on the presence of paleochannels or fault zones. The premise for the interpretation is that coarser-grained intervals have filled in scour channels created by episodic catastrophic flood events during the late Pleistocene. The interpretation strategy used the magnetic field anomaly data and existing bedrock maps to identify likely fault or lineament zones. Combined analysis of the magnetic, 60-Hz noise monitor, and flight-altitude (radar) data were used to identify zones where EM response is more likely due to cultural interference and or bedrock structures. Cross-sectional and map view presentations of the EM data were used to identify more electrically resistive zones that likely correlate with coarser-grained intervals. The resulting interpretation identifies one major northwest-southeast trending

  13. [Curing mode of universal adhesives affects the bond strength of resin cements to dentin].

    Science.gov (United States)

    Fu, Z R; Tian, F C; Zhang, L; Han, B; Wang, X Y

    2017-02-18

    To determine the effects of curing mode of one-step and two-step universal adhesives on the micro-tensile bond strength (μTBS) of different dual-cure resin cements to dentin. One-step universal adhesive Single Bond Universal (SBU), and two-step universal adhesive OptiBond Versa (VSA) were chosen as the subjects, one-step self-etching adhesive OptiBond All in One (AIO) and two-step self-etching adhesive Clearfil SE Bond (SEB) were control groups, and two dual-cure resin cements RelyX Ultimate (RLX) and Nexus 3 Universal (NX3) were used in this study. In this study, 80 extracted human molars were selected and the dentin surface was exposed using diamond saw. The teeth were divided into 16 groups according to the adhesives (AIO, SBU, SEB, VSA), cure modes of adhesives (light cure, non-light cure) and resin cements (RLX, NX3). The adhesives were applied on the dentin surface following the instruction and whether light cured or not, then the resin cements were applied on the adhesives with 1 mm thickness and light cured (650 mW/cm(2) for 20 s. A resin was built up (5 mm) on the cements and light cured layer by layer. After water storage for 24 h, the specimens were cut into resin-cement-dentin strips with a cross sectional area of 1 mm×1 mm and the μTBS was measured. Regarding one-step universal adhesive (SBU) light cured, the μTBS with RLX [(35.45±7.04) MPa] or NX3 [(26.84±10.39) MPa] were higher than SBU non-light cured with RLX [(17.93±8.93) MPa)] or NX3 [(10.07±5.89) MPa, Padhesive (VSA) and control adhesive (SEB), curing mode did not affect the μTBS when used with either RLX or NX3 (25.98-32.24 MPa, P>0.05). Curing mode of one-step universal adhesive may affect the μTBS between dual-cure resin cements and dentin, while for two-step universal adhesive, the curing mode and the type of resin cements did not influence the μTBS.

  14. Testing the Visual Soil Assessment tool on Estonian farm fields

    Science.gov (United States)

    Reintam, Endla; Are, Mihkel; Selge, Are

    2017-04-01

    Soil quality estimation plays important role in decision making on farm as well on policy level. Sustaining the production ability and good health of the soil the chemical, physical and biological indicators should be taken into account. The system to use soil chemical parameters is usually quite well established in most European counties, including Estonia. However, measuring soil physical properties, such bulk density, porosity, penetration resistance, structural stability ect is time consuming, needs special tools and is highly weather dependent. In that reason these parameters are excluded from controllable quality parameters in policy in Estonia. Within the project "Interactive Soil Quality Assessment in Europe and China for Agricultural Productivity and Environmental Resilience" (iSQAPER) the visual soil assessment (VSA) tool was developed for easy detection of soil quality as well the different soil friendly agricultural management practices (AMP) were detected. The aim of current study was to test the VSA tool on Estonian farm fields under different management practices and compare the results with laboratory measurements. The main focus was set on soil physical parameters. Next to the VSA, the undisturbed soil samples were collected from the depth of 5-10 cm and 25-30 cm. The study revealed that results of a visually assessed soil physical parameters, such a soil structure, soil structural stability, soil porosity, presence of tillage pan, were confirmed by laboratory measurements in most cases. Soil water stable structure measurement on field (on 1 cm2 net in one 1 l box with 4-6 cm air dry clods for 5-10 min) underestimated very well structured soil on grassland and overestimated the structure aggregates stability of compacted soil. The slightly better soil quality was detected under no-tillage compared to ploughed soils. However, the ploughed soil got higher quality points compared with minimum tillage. The slurry application (organic manuring) had

  15. Teatri aastaauhindade laureaadid 2008

    Index Scriptorium Estoniae

    2008-01-01

    Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

  16. Eesti teatri aastaauhinnad 2007

    Index Scriptorium Estoniae

    2008-01-01

    Tiit Ojasoo - lavastajaauhind, Silver Vahtre, Krista Tool ja Margus Vaigur - kunstniku auhind, Piret Laurimaa - naisnäitleja auhind, Üllar Saaremäe - meesnäitleja auhind, Tiina Tauraite - naiskõrvalosa auhind, Taavi Teplenkov - meeskõrvalosa auhind, Mart Koldits - sõnalavastuse eriauhind, Dmitri Bertman ja Mart Madiste - muusikalavastuse auhind, Vitali Nikolajev - muusikalavastuse eriauhind, Marina Kesler - balletilavastuse auhind, Oksana Titova - tantsulavastuse auhind, Ivika Sillar - kriitikaauhind, Külli Teetamm ja Tambet Tuisk - Ants Lauteri näitlejaauhind, Heli Veskus - Georg Otsa auhind, Finn Poulsen - Salme Reegi auhind, Elo Soode - Natalie Mei auhind, Aarne Üksküla - Priit Põldroosi auhind, Maimu Berg - Aleksander Kurtna auhind, Laura Peterson - Kristallkingakese auhind, Liina Laigu, Kaido Päästel ja Juhan Rumm - teatritöötaja auhind

  17. Radiative decay of HeLi+(b3∑+)

    Science.gov (United States)

    Zámečníková, Martina; Soldán, Pavel

    2018-01-01

    Radiative lifetimes of the ro-vibrational bound states of HeLi+ (b3∑+) are calculated quantum-mechanically when both bound-bound and bound-free processes are taken into account. The calculations are restricted to the initial states with low rotational quantum numbers. For the rotationless molecular ion, the shortest lifetime is 1.30 ×10-6 s of the ground vibrational state. With increasing vibration excitations the radiative lifetimes slightly increase, but keep below 10-5 s for the next 17 vibrational states, then they start to increase more rapidly up to 2.41 ×10-2 s for the highest vibrational state. The radiative lifetimes also tend to slightly prolong with increasing rotational excitations but stay on the same magnitude for the low rotational quantum numbers.

  18. Kaitsmine

    Index Scriptorium Estoniae

    2005-01-01

    Einar Miksoni, Peedu Zeigeri, Reet Põldaru, Riina Miljani, Meelis Otsa, Maarika Alaru ja Lilita Ozola doktoriväitekirjade kaitsmisest Eesti Põllumajandusülikoolis; Eesti Põllumajandusülikooli üliõpilaste magistritööde kaitsmisest : Kristiina Kütt, Rein Kalle, Matis Luik, Kadrin Juhkam, Andres Elias, Taavi Võsa, Hille Laos, Heli Paasma; Janika Sanderi "Geodeetiline tihendusvõrk Eestis. Satelliidi-, vastuvõtja- ja keskkonnapõhiste veaallikate möju", Ina Melnikova "Tartu linna ortofotomosaiigi valmistamine (programmi PHOTOMOD näitel) ja tema geomeetriline kvaliteet"; Natalja Morozova "Gravimeetrilise geoidi NKG04 võrdlemine loodpinnaga Läänemerel"; Inno Kalbergi "Arvestuse infosüsteemide rakendamise aspektid Eestis"; Elina Leineri "Ammendatud freesturbatootmisalade taimestumist mõjutavad tegurid Pärnu ja Tartu maakonna jääksoode näitel"

  19. CO2 Capacity Sorbent Analysis Using Volumetric Measurement Approach

    Science.gov (United States)

    Huang, Roger; Richardson, Tra-My Justine; Belancik, Grace; Jan, Darrell; Knox, James; Cmarik, Gregory E.; Ebner, Armin; Ritter, James

    2017-01-01

    In support of air revitalization system sorbent selection for future space missions, Ames Research Center (ARC) has performed CO2 capacity tests on various solid sorbents to complement structural strength tests conducted at Marshall Space Flight Center (MSFC). The materials of interest are: Grace Davison Grade 544 13X, Honeywell UOP APG III, LiLSX VSA-10, BASF 13X, and Grace Davison Grade 522 5A. CO2 capacity was for all sorbent materials using a Micromeritics ASAP 2020 Physisorption Volumetric Analysis machine to produce 0 C, 10 C, 25 C, 50 C, and 75 C isotherms. These data are to be used for modeling data and to provide a basis for continued sorbent research. The volumetric analysis method proved to be effective in generating consistent and repeatable data for the 13X sorbents, but the method needs to be refined to tailor to different sorbents.

  20. Negative affectivity and educational attainment as predictors of newlyweds' problem solving communication and marital quality.

    Science.gov (United States)

    Woszidlo, Alesia; Segrin, Chris

    2013-01-01

    This investigation examines the role of negative affectivity and educational attainment in newlywed couples' mutual problem solving and marital quality (i.e., personal commitment and divorce proneness). The vulnerability-stress-adaptation (VSA) model of marital development was used as a framework to explain the relationships between enduring vulnerabilities, adaptive processes, and marital quality. Dyadic analyses and tests of indirect effects were performed on data from 186 couples who had been married on average for 1.5 years. Spouses' negative affectivity and educational attainment were significantly associated with their own and their partner's mutual problem solving, personal commitment, and propensity to divorce. In addition, there was evidence supporting the assumption that the relationships between enduring vulnerabilities and marital quality can be explained, in part, by mutual problem solving for husbands. This study highlights the important role that enduring vulnerabilities have on mutual problem solving communication and marital quality.

  1. Rapid and fully automated Measurement of Water Vapor Sorption Isotherms

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Tuller, Markus; Møldrup, Per

    2014-01-01

    Eminent environmental challenges such as remediation of contaminated sites, the establishment and maintenance of nuclear waste repositories, or the design of surface landfill covers all require accurate quantification of the soil water characteristic at low water contents. Furthermore, several...... and pesticide volatilization, toxic organic vapor sorption kinetics, and soil water repellency are illustrated. Several methods to quantify hysteresis effects and to derive soil clay content and specific surface area from VSA-measured isotherms are presented. Besides above mentioned applications, potential...... essential but difficult-to-measure soil properties such as clay content and specific surface area are intimately related to water vapor sorption. Until recently, it was a major challenge to accurately measure detailed water vapor sorption isotherms within an acceptable time frame. This priority...

  2. Izbor oblike vstopa na tuje tržišče z izdelki MLM Armal International GmbH

    OpenAIRE

    Brumen, Dragica

    2012-01-01

    Čas globalizacije, v katerem živimo, nas sili, da moramo biti zelo pazljivi in pozorno spremljati vsa dogajanja pri kupcih, kakor tudi dogajanja na njihovih tržiščih. Podjetje MLM bo še naprej v nenehni pripravljenosti in bo iskalo nova tržišča, saj se lahko hitro zgodi, da kateri kupec postane nelikviden oz. iz kateregakoli razloga ne posluje več in se tako izgubi določen del tržišča, ki ga je potrebno čim hitreje nadomestiti z novim. To je potrebno za doseganje ciljev, ki so načrtovani in z...

  3. Analysis of the Polarization Dependence of the Interaction between Human Frame Targets and Radio Frequency Sensor Fields.

    Science.gov (United States)

    1981-11-01

    34 I variables) and those that are calculated from the given variables ("derived" variables). Of those variables appearing in [MBo] or ( MoB ], eb and *b...MBo] (or [ MOB ]), and [MoLJ (or [MLo1 ), we form the matrix equations [from Eqs. (6.7a,b), (6.15a,b) and (6.17a,b)]: = MB]EOLE.I EMBLJE LJ (6.18) or...Cos y =Cos e Cos 6+ sin e sin e~ cos(o - OB) (11-7) and Vsa : ;(-Ph )]S-si ne acoso a 11-4 A:,.,nc t" I J: PLf.E-WAVE SPECTRAL R 1.’r 1 -M T[ . O THE

  4. Dicty_cDB: Contig-U06249-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 007) C... 46 1.3 1 ( AE016826 ) Buchnera aphidicola str. Bp (Baizongia pistaciae)... U06249 List of clone(s) est1= VSH409F ,1,437 est2= VSH409Z ,1,415 est3= VSA424Z ,104,540 Translated Amin...e) Anaeromyxobacter sp. K, complet... 34 2.1 EU480780_1( EU480780 |pid:none) Caenorhabditis remanei strain...t 956816 Strand (PLUS/MINUS) MINUS Number of clones 2 Number of EST 3 Link to clone list...S0125_O... 54 3e-06 FJ436341_1( FJ436341 |pid:none) Opisthorchis viverrini granulin mR... 53 6e-06 EU973371_1( EU973371 |pid:non

  5. Acoustic and kinematic analyses of Mandarin vowels in speakers with hearing impairment.

    Science.gov (United States)

    Xue, Peiyun; Zhang, Xueying; Bai, Jing; Wang, ZizhongJohn

    2017-12-21

    The central aim of this experiment was to compare acoustic parameters, formant frequencies and vowel space area (VSA), in adolescents with hearing-impaired (HI) and their normal-hearing (NH) peers; for kinematic parameters, the movements of vocal organs, especially the lips, jaw and tongue, during vowel production were analysed. The participants were 12 adolescents with different degrees of hearing impairment. The control group consisted of 12 age-matched NH adolescents. All participants were native Chinese speakers who were asked to produce the Mandarin vowels /a/, /i/ and /u/, with subsequent acoustic and kinematic analysis. There was significant difference between the two groups. Additionally, the HI group produced more exaggerated mouth and less tongue movements in all vowels, compared to their NH peers. Results were discussed regarding possible relationship between acoustic data, articulatory movements and degree of hearing loss to provide an integrative assessment of acoustic and kinematic characteristics of individuals with hearing loss.

  6. The role of Plasmodium falciparum variant surface antigens in protective immunity and vaccine development

    DEFF Research Database (Denmark)

    Hviid, Lars

    2010-01-01

    that development of PfEMP1-based vaccines to protect specifically against severe malaria syndromes-in particular PAM-is feasible. This review summarizes the evidence that VSAs are important targets of NAI, discusses why VSA-based vaccines might be feasible despite the extensive intra- and interclonal variation...... of VSAs, and how vaccines based on this type of antigens fit into the current global strategy to reduce, eliminate and eventually eradicate the burden of malaria.......There is substantial immuno-epidemiological evidence that the parasite-encoded, so-called variant surface antigens (VSAs), such as PfEMP1 on the surface of infected erythrocytes (IEs) are important-in some cases probably decisive determinants of clinical outcome of P. falciparum malaria...

  7. The role of Plasmodium falciparum variant surface antigens in protective immunity and vaccine development

    DEFF Research Database (Denmark)

    Hviid, Lars

    2010-01-01

    that development of PfEMP1-based vaccines to protect specifically against severe malaria syndromes-in particular PAM-is feasible. This review summarizes the evidence that VSAs are important targets of NAI, discusses why VSA-based vaccines might be feasible despite the extensive intra- and interclonal variation...... of VSAs, and how vaccines based on this type of antigens fit into the current global strategy to reduce, eliminate and eventually eradicate the burden of malaria.......There is substantial immuno-epidemiological evidence that the parasite-encoded, so-called variant surface antigens (VSAs) such as PfEMP1 on the surface of infected erythrocytes (IEs) are important-in some cases probably decisive-determinants of clinical outcome of P. falciparum malaria...

  8. Preferential transcription of conserved rif genes in two phenotypically distinct Plasmodium falciparum parasite lines

    DEFF Research Database (Denmark)

    Wang, Christian W; Magistrado, Pamela A; Nielsen, Morten A

    2009-01-01

    Plasmodium falciparum variant surface antigens (VSA) are targets of protective immunity to malaria. Plasmodium falciparum erythrocyte membrane protein 1 (PfEMP1) and repetitive interspersed family (RIFIN) proteins are encoded by the two variable multigene families, var and rif genes, respectively....... Whereas PfEMP1s are known to mediate cytoadhesion, the function of RIFINs is unknown. The sequence diversity and organisation of rif genes of the P. falciparum clones 3D7, HB3, DD2, and IT/FCR3 were investigated using a tree-building method which allowed sub-grouping of RIFINs into distinct groups. Two...... transcribed in the VAR2CSA-expressing parasite line. In addition, two rif genes were found transcribed at early and late intra-erythrocyte stages independently of var gene transcription. Rif genes are organised in groups and inter-genomic conserved gene families, suggesting that RIFIN sub-groups may have...

  9. Adult attachment and the perceived cost of housework and child care

    DEFF Research Database (Denmark)

    Trillingsgaard, Tea; Sommer, Dion; Mathias, Lasgaard

    2014-01-01

    Objective: This study examined the link between new mothers’ attachment orientation and the perceived cost of sole responsibility in housework and child care. Background: The transition to motherhood can be very stressful, and according to the Vulnerability Stress Adaptation Model (VSA model......), the way it affects the couple relationship is likely to depend on interacting factors from different domains of risk (e.g. individual and couple level). We expected interactions to appear between domains of attachment and labour division. The hypothesis was that sole responsibility in child care...... and housework would predict lower relationship satisfaction, particularly among mothers who were high on attachment insecurity. Methods: Data from self-report measures of adult attachment, child care, housework and relationship satisfaction were collected from 255 first-time mothers at six months postpartum...

  10. {epsilon}{sup '}/{epsilon} in the 1/N{sub c} expansion

    Energy Technology Data Exchange (ETDEWEB)

    Hambye, T. [Istituto Nazionale di Fisica Nucleare, Frascati, RM (Italy). Laboratori Nazionali di Frascati; Soldan, P.H. [Dortmund Univ., Dortmund (Germany). Inst. fuer Physik

    1999-07-01

    It is here presented a new analysis of the ratio {epsilon}{sup '}/{epsilon} which measures the direct CP violation in K {yields} {pi}{pi} decays. It is used the 1/N{sub c} expansion within the framework of the effective chiral lagrangian for pseudoscalar mesons. From general counting arguments it is showed that the matrix element of the operator Q{sub 6} is not protected from possible large 1/N{sub c} corrections beyond its large-N{sub c} or VSA value. Calculating the 1/N{sub c} corrections, it is explicity found that the they are large and positive. Our result indicates that a {delta}I = 1/2 enhancement is amplitude. This enhances {epsilon}{sup '}/{epsilon} and can bring the standard model prediction close to the measured value for central values of the parameters.

  11. The Real Implementation of NLMS Channel Equalizer into the System of Software Defined Radio

    Directory of Open Access Journals (Sweden)

    Radek Martinek

    2012-01-01

    Full Text Available This paper deals with modern wireless transmission systems. It focusses on real implementation of NLMS channel equalizer into the system of software defined radio. The authors aimed to conduct a real measurement (BER vs. Eb/No using modern modular PXI measuring apparatus. This sophisticated measuring system is built by vector-signal generator RF VSG NI PXI-5670 and vector-signal analyzer RF VSA NI PXI-5660. The results of experiments suggest that the channel equalizer with implemented NLMS algorithm has better results (balance between simplicity and performance than conventionally most used LMS algorithm. This holds true if feasible computational complexity with respect to real time processes is assumed.

  12. Estomatite Vesicular Alagoas: estudo da transmissão entre tilápias nilóticas (Oreochromis niloticus) experimentalmente inoculadas e cobaios (Cavia porcellus) através da água e desenvolvimento de um método diagnóstico

    OpenAIRE

    Carlos Henrique de Azeredo Lima

    2003-01-01

    Diante da necessidade de responder algumas indagações relacionadas a epidemiologia da Estomatite Vesicular, principalmente aquelas que dizem respeito a ocorrência de surtos em locais onde existem coleções d\\'água, foi desenvolvido um modelo de transmissão do VSA utilizando a água como via de transmissão, a tilápia nilótica, inoculada intraperitonealmente, como fonte de infecção e o cobaio como hospedeiro susceptível. O objetivo da utilização deste modelo biológico de transmissão do Vírus da E...

  13. Evaluation of a Fully Automated Analyzer for Rapid Measurement of Water Vapor Sorption Isotherms for Applications in Soil Science

    DEFF Research Database (Denmark)

    Arthur, Emmanuel; Tuller, Markus; Moldrup, Per

    2014-01-01

    The characterization and description of important soil processes such as water vapor transport, volatilization of pesticides, and hysteresis require accurate means for measuring the soil water characteristic (SWC) at low water potentials. Until recently, measurement of the SWC at low water...... sorption isotherms. In this technical note we present a comprehensive evaluation of the VSA instrument for a wide range of differently textured soils and discuss optimal measurement settings. The effects of operation mode, air-flow rate, sample pretreatment, test temperature, sample mass, and mass trigger...... point on resultant sorption isotherms were evaluated for a relative humidity range from 0.10 to 0.90. Both adsorption and desorption branches were measured for all soils within a reasonable time period (10 – 50 h). Sample masses larger than 3.5 g resulted in incomplete adsorption and desorption, while...

  14. [Laparoscopic findings in endometriosis in women with dysmenorrhea, pelvic pain and sterility. Preliminary note].

    Science.gov (United States)

    Rosales Delgado, J A; González-Sicilia Cotter, E; Aedo Ocaña, O

    1994-12-01

    Laparoscopy was performed on patients with dysmenorrhea, sterility and pelvic pain in order to evaluate the prevalence of endometriosis in our environment therefore considering the population of female beneficiary patients of reproductive age of the ISSSTE hospital in the city of Veracruz, Ver. in México. The percentages of endometriosis were similar to the reports published in the international journals with the exception of the dysmenorrhea where our results were higher. In all the cases the same variables were analyzed; age, active sexual life (V.S.A.), birth control method, menarche (men), menstrual cycle, childbirths and abortions, as well as other laparoscopic detections. Each of the endometriosis cases were classified according to the revised American Fertility Society classification of 1985 (R.A.F.S.) for endometriosis.

  15. NAČRTOVANJE TRŽNEGA KOMUNICIRANJA V MIKRO DRUŽINSKEM PODJETJU SOHA D.O.O.

    OpenAIRE

    Šoštarić, Tino

    2010-01-01

    Tržno komuniciranje je veščina, ki bi jo za lastno poslovno uspešnost morala obvladovati vsa podjetja. To velja za podjetja vseh velikosti in dejavnosti. Razpolagati s kakovostnimi izdelki ob konkurenčni ceni še ne pomeni gotovega uspeha. Trgu je potrebno te izdelke tudi prodati in temu služi tržno komuniciranje. Tržno komuniciranje je mnogokrat pogojeno s finančnimi sredstvi. Več teh sredstev pomeni boljše izhodišče pri planiranju celovitega tržnega komuniciranja in lahko vključuje več ...

  16. Is it worth carrying out determination of N-butane in postmortem samples? A case report and a comprehensive review of the literature.

    Science.gov (United States)

    El Balkhi, Souleiman; Coutaz-Fluck, Caroline; Moreau, Fanny; Paraf, François; Gaulier, Jean-Michel

    2016-09-01

    The aim of this article is to illustrate the importance of N-butane determination in postmortem samples through a case report and to propose actions and precautions to be taken into consideration when butane is suspected to be involved in cases of death. The case concerns a 15-year-old boy found dead after sniffing a cigarette lighter refill. Toxicological investigation revealed the presence of butane in the heart and femoral blood (1280 and 1170 μg/L, respectively), in the gastric contents (326 μg/L), and in the liver (1010 μg/kg) and lung tissues (210 μg/kg). Propane was present only in the blood samples at concentrations tenfolds lower.Butane can be involved in three kinds of fatalities: deliberate inhalations including volatile substance abuse (VSA), involuntary exposure, and homicides. A fatal outcome of butane inhalation can be caused by asphyxia and/or cardiac arrhythmia. In the context where butane exposure is evidenced by non-toxicological investigations, the usefulness of the determination of butane in postmortem samples is often questionable. However, it is admitted that butane-related deaths are generally underreported. Several difficulties including sample handling and storage, substantial variation in tissue concentrations, and lack of a lethal threshold make the interpretation of butane results challenging. In our opinion, systematic toxicological methods should be developed in order to analyze butane, at least when it concerns a typical VSA victim, even when butane is not actually suspected to be the cause of death.

  17. A Novel Integrating Virtual Reality Approach for the Assessment of the Attachment Behavioral System

    Directory of Open Access Journals (Sweden)

    Irene Alice Chicchi Giglioli

    2017-06-01

    Full Text Available Virtual reality (VR technology represents a novel and powerful tool for behavioral research in psychological assessment. VR provides simulated experiences able to create the sensation of undergoing real situations. Users become active participants in the virtual environment seeing, hearing, feeling, and actuating as if they were in the real world. Currently, the most psychological VR applications concern the treatment of various mental disorders but not the assessment, that it is mainly based on paper and pencil tests. The observation of behaviors is costly, labor-intensive, and it is hard to create social situations in laboratory settings, even if the observation of actual behaviors could be particularly informative. In this framework, social stressful experiences can activate various behaviors of attachment for a significant person that can help to control and soothe them to promote individual’s well-being. Social support seeking, physical proximity, and positive and negative behaviors represent the main attachment behaviors that people can carry out during experiences of distress. We proposed VR as a novel integrating approach to measure real attachment behaviors. The first studies on attachment behavioral system by VR showed the potentiality of this approach. To improve the assessment during the VR experience, we proposed virtual stealth assessment (VSA as a new method. VSA could represent a valid and novel technique to measure various psychological attributes in real-time during the virtual experience. The possible use of this method in psychology could be to generate a more complete, exhaustive, and accurate individual’s psychological evaluation.

  18. An Acoustic Study of Vowels Produced by Alaryngeal Speakers in Taiwan.

    Science.gov (United States)

    Liao, Jia-Shiou

    2016-11-01

    This study investigated the acoustic properties of 6 Taiwan Southern Min vowels produced by 10 laryngeal speakers (LA), 10 speakers with a pneumatic artificial larynx (PA), and 8 esophageal speakers (ES). Each of the 6 monophthongs of Taiwan Southern Min (/i, e, a, ɔ, u, ə/) was represented by a Taiwan Southern Min character and appeared randomly on a list 3 times (6 Taiwan Southern Min characters × 3 repetitions = 18 tokens). Each Taiwan Southern Min character in this study has the same syllable structure, /V/, and all were read with tone 1 (high and level). Acoustic measurements of the 1st formant, 2nd formant, and 3rd formant were taken for each vowel. Then, vowel space areas (VSAs) enclosed by /i, a, u/ were calculated for each group of speakers. The Euclidean distance between vowels in the pairs /i, a/, /i, u/, and /a, u/ was also calculated and compared across the groups. PA and ES have higher 1st or 2nd formant values than LA for each vowel. The distance is significantly shorter between vowels in the corner vowel pairs /i, a/ and /i, u/. PA and ES have a significantly smaller VSA compared with LA. In accordance with previous studies, alaryngeal speakers have higher formant frequency values than LA because they have a shortened vocal tract as a result of their total laryngectomy. Furthermore, the resonance frequencies are inversely related to the length of the vocal tract (on the basis of the assumption of the source filter theory). PA and ES have a smaller VSA and shorter distances between corner vowels compared with LA, which may be related to speech intelligibility. This hypothesis needs further support from future study.

  19. Severity of myocardial fatty acid dysmetabolism induced by coronary spasm does not differ with Thrombolysis in Myocardial Infarction (TIMI) grade during intracoronary acetylcholine provocation tests.

    Science.gov (United States)

    Yoneyama, Kihei; Akashi, Yoshihiro J; Ashikaga, Kohei; Kida, Keisuke; Sato, Yukio; Tsukahara, Maya; Yamada, Marika; Takagi, Yasushi; Kamijima, Ryo; Suzuki, Kengo; Musha, Haruki; Harada, Tomoo

    2014-01-01

    Whether additional intracoronary acetylcholine (ACH) injections are required for severe coronary spasm without limited coronary flow in the ACH provocation test remains unclear. We used (123)I-β-methyl-iodophenyl pentadecanoic acid ((123)I-BMIPP) to identify myocardial ischemic memory to compare the severity of myocardial fatty acid dysmetabolism among Thrombolysis in Myocardial Infarction (TIMI) grade flow.Thirteen hypertensive volunteers (mean age, 69.5 years) and 37 patients with VSA (mean age, 62.8 years) were enrolled. The patients with VSA were stratified according to TIMI flow grades of 3 (90% luminal narrowing; n = 12) or TIMI 0-2 (≥ 99% or total occlusion; n = 25) during ACH provocation tests. Two weeks after cardiac catheterization, (123)I-BMIPP myocardial scintigraphic images were obtained at 15 minutes (early) and at 4 hours (delayed) after tracer injection. The heart-to-mediastinum (H/M) ratio and washout rates (WR) were calculated from planar images.The TIMI 3 and TIMI 0-2 groups had significantly lower early and delayed H/M ratios than controls but the difference did not reach significance between the two groups (Early: 2.7 ± 0.5 versus 2.3 ± 0.4 and 2.2 ± 0.3, P = 0.024; Delayed: 2.4 ± 0.4 versus 1.8 ± 0.3 and 1.8 ± 0.3, P = 0.001). The washout rate was greater for TIMI 0-2 than the controls.The severity of myocardial fatty acid dysmetabolism did not differ between TIMI 3 and TIMI 0-2 coronary spasms. Additional ACH might not be required considering safety and the severity of coronary spams with TIMI 3 grade flow.

  20. Intra-atrial re-entrant tachycardia in patients with congenital heart disease: factors associated with disease severity.

    Science.gov (United States)

    Roca-Luque, Ivo; Rivas Gándara, Nuria; Dos Subirà, Laura; Francisco Pascual, Jaume; Pérez-Rodon, Jordi; Pijuan Domenech, Antònia; Subirana, Ma Teresa; Miranda, Berta; Santos Ortega, Alba; Casaldàliga Ferrer, Jaume; García-Dorado García, David; Moya Mitjans, Angel

    2017-07-28

    Intra-atrial re-entrant tachycardia (IART) is a common complication in patients with congenital heart disease (CHD) and is related to increased morbidity and mortality. Few reports have been published about factors associated to IART severity. The aim of this study is to analyse factors associated to severe clinical presentation of IART. Observational study of all consecutive CHD patients who underwent a first IART ablation from January 2009 to December 2015 (94 patients, 39.4% female, and age: 36.55 ± 14.9 years). Severe clinical presentation was defined as heart failure, syncope, shock, electromechanical dissociation (EMD), or aborted sudden death. The majority of patients had moderately or highly complex cardiac defect (90.4%). Types of IART included cavotricuspid isthmus(CTI) dependent in 51% (48), non-CTI-related in 22.3% (20), and both types in 27.7% (26). In 38 patients (40.4%), a severe event occurred and in 16 (17%), the symptoms included shock, syncope, sudden death, or EMD. In 21 (22.3%), severe symptoms were the first manifestation of IART. In multivariate analysis, transposition of the great arteries (TGA) with right systemic ventricle (OR 5.32, 95% C.I. 1.6-7.02, P = 0.0005) and severe dilation of the venous atrium (VsA) (OR 4.17; 95% CI 1.4-8.12, P = 0.0009) were factors independently associated with severity. In our series of 94 CHD patients with a high proportion of moderately to highly complex cardiac defects, severe consequences of IART were frequent. Transposition of the great arteries with systemic right ventricle and severe dilation of VsA were independently associated to severity. Early invasive procedures should be considered for these high-risk patients.

  1. Resting state networks' corticotopy: the dual intertwined rings architecture.

    Directory of Open Access Journals (Sweden)

    Salma Mesmoudi

    Full Text Available How does the brain integrate multiple sources of information to support normal sensorimotor and cognitive functions? To investigate this question we present an overall brain architecture (called "the dual intertwined rings architecture" that relates the functional specialization of cortical networks to their spatial distribution over the cerebral cortex (or "corticotopy". Recent results suggest that the resting state networks (RSNs are organized into two large families: 1 a sensorimotor family that includes visual, somatic, and auditory areas and 2 a large association family that comprises parietal, temporal, and frontal regions and also includes the default mode network. We used two large databases of resting state fMRI data, from which we extracted 32 robust RSNs. We estimated: (1 the RSN functional roles by using a projection of the results on task based networks (TBNs as referenced in large databases of fMRI activation studies; and (2 relationship of the RSNs with the Brodmann Areas. In both classifications, the 32 RSNs are organized into a remarkable architecture of two intertwined rings per hemisphere and so four rings linked by homotopic connections. The first ring forms a continuous ensemble and includes visual, somatic, and auditory cortices, with interspersed bimodal cortices (auditory-visual, visual-somatic and auditory-somatic, abbreviated as VSA ring. The second ring integrates distant parietal, temporal and frontal regions (PTF ring through a network of association fiber tracts which closes the ring anatomically and ensures a functional continuity within the ring. The PTF ring relates association cortices specialized in attention, language and working memory, to the networks involved in motivation and biological regulation and rhythms. This "dual intertwined architecture" suggests a dual integrative process: the VSA ring performs fast real-time multimodal integration of sensorimotor information whereas the PTF ring performs multi

  2. A cross strain Plasmodium falciparum microarray optimized for the transcriptome analysis of Plasmodium falciparum patient derived isolates

    KAUST Repository

    Subudhi, Amit

    2016-07-20

    Malarial parasite P. falciparum, an apicomplexan protozoan has a 23.3 MB nuclear genome and encodes ~ 5600 transcripts. The genetic diversity of the parasite within and across geographical zones is a challenge to gene expression studies which are essential for understanding of disease process, outcome and developing markers for diagnostics and prognostics. Here, we describe the strategy involved in designing a custom P. falciparum 15K array using the Agilent platform and Genotypic\\'s Right Design methodology to study the transcriptome of Indian field isolates for which genome sequence information is limited. The array contains probes representing genome sequences of two distinct geographical isolates (i.e. 3D7 and HB3) and sub-telomeric var gene sequences of a third isolate (IT4) known to adhere in culture condition. Probes in the array have been selected based on their efficiency to detect transcripts through a 244K array experimentation. Array performance for the 15K array, was evaluated and validated using RNA materials from P. falciparum clinical isolates. A large percentage (91%) of the represented transcripts was detected from Indian P. falciparum patient isolates. Replicated probes and multiple probes representing the same gene showed perfect correlation between them suggesting good probe performance. Additional transcripts could be detected due to inclusion of unique probes representing HB3 strain transcripts. Variant surface antigen (VSA) transcripts were detected by optimized probes representing the VSA genes of three geographically distinct strains. The 15K cross strain P. falciparum array has shown good efficiency in detecting transcripts from P. falciparum parasite samples isolated from patients. The low parasite loads and presence of host RNA makes arrays a preferred platform for gene expression studies over RNA-Seq.

  3. Presença de agrotóxicos na atmosfera e risco à saúde humana: uma discussão para a Vigilância em Saúde Ambiental

    Directory of Open Access Journals (Sweden)

    Gustavo dos Santos Souza

    Full Text Available Resumo O Brasil é o principal consumidor de agrotóxicos do mundo. O uso em larga escala destes produtos é capaz de contaminar os principais compartimentos ambientais e expor um maior número de pessoas a seus efeitos tóxicos. Portanto, realizou-se esta revisão de literatura com o objetivo de buscar subsídios para uma discussão qualificada sobre a atuação da Vigilância em Saúde Ambiental (VSA no âmbito do Sistema Único de Saúde relacionada com a contaminação atmosférica por agrotóxicos e riscos à saúde. Doze artigos foram selecionados e analisados nesta revisão de literatura. Destes, apenas um foi publicado em periódico especializado na área da saúde pública. Apesar disso, dois estudos epidemiológicos publicados na área das ciências ambientais investigaram a associação entre o ar contaminado por agrotóxicos e desfechos específicos como, linfoma não Hodgkin (LNH e esclerose lateral amiotrófica (ELA. Nossos achados refletem a carência de estudos abordando o tema pela saúde pública. A discussão sobre a contaminação atmosférica por agrotóxicos e riscos potenciais à saúde humana deve ser ampliada pela ciência brasileira, a fim de aprofundar o conhecimento sobre o assunto e respaldar a capacidade de atuação da VSA.

  4. Qualidade de vida de pessoas colostomizadas com e sem uso de métodos de controle intestinal Calidad de vida de personas colostomizadas con o sin uso de métodos de control intestinal Quality of life of the colostomized person with or without use of methods of bowel control

    Directory of Open Access Journals (Sweden)

    Isabel Umbelina Ribeiro Cesaretti

    2010-02-01

    Full Text Available OBJETIVO: Avaliar e comparar a qualidade de vida (QV de pessoas colostomizadas que utilizam e não utilizam os métodos de controle intestinal (MCI, ou seja, a irrigação e o sistema oclusor da colostomia, considerando a hipótese de que aquelas que os utilizam têm melhor QV. Método: O estudo foi desenvolvido no Ambulatório do Hospital Heliópolis, após a aprovação do projeto pelo Comitê de Ética, usando o WHOQoL-abreviado. A amostra foi constituída de dois grupos: 50 pessoas colostomizadas usando os dois MCI e 50, sem os MCI. Resultados: A QV do Grupo com MCI foi significativamente melhor em todos os Domínios e na QV Geral do que daquelas do Grupo sem MCI. Conclusão: O estudo confirmou a hipótese de que a QV do Grupo com MCI é melhor do que a do Grupo sem MCI.OBJETIVO: Evaluar y comparar la calidad de vida (CV de las personas colostomizadas, con y sin el uso de los métodos de control intestinal (MCI, es decir, la irrigación y el sistema obturador de la colostomia, teniendo en cuenta la hipótesis de que aquellas que los utilizan tienen mejor CV. Método: El estudio fue llevado a cabo en el Ambulatorio del Hospital Heliópolis después de la aprobación del proyecto por lo Comité de Ética, usando el WHOQoL-bref. La muestra fue constituida de dos grupos: 50 personas colostomizadas usando los dos MCI y 50, sin los MCI. Resultados: Las personas del Grupo con MCI tenían CV perceptiblemente mejor, siendo eso observado en todos los Dominios y en la CV General, que aquellas del Grupo sin MCI. Conclusión: El estudio confirmo la hipótesis que la CV del Grupo con MCI es mejor que la del Grupo sin MCI.OBJECTIVE: To evaluate and to compare the quality of life (QoL of colostomy people, using or not using the bowel control methods (BCM, in other words, the colostomy irrigation and the plug system, considering the hypothesis that people who used them had better QoL. Method: This study was carried out in the Heliópolis Hospital Outpatient

  5. Predictors of early aortic neck dilatation after endovascular aneurysm repair with EndoAnchors.

    Science.gov (United States)

    Tassiopoulos, Apostolos K; Monastiriotis, Spyridon; Jordan, William D; Muhs, Bart E; Ouriel, Kenneth; De Vries, Jean Paul

    2017-07-01

    Dilatation of the aorta within the proximal neck after endovascular aneurysm repair (EVAR) can be associated with late endoleaks and migration. This study was designed to identify predictors of early neck dilation in patients undergoing EVAR with Heli-FX EndoAnchors (Medtronic, Santa Rosa, Calif) measured perioperatively to 1 year at different longitudinal levels of neck length. The study group of Aneurysm Treatment Using the Heli-FX Aortic Securement System (ANCHOR) comprises 257 consecutive patients prospectively enrolled between April 2012 and September 2014 undergoing EVAR with Heli-FX EndoAnchor implantation at 38 investigational sites. Only patients undergoing EndoAnchor implantation at the time of the initial EVAR were included (primary treatment arm). Aortic diameter was measured at the suprarenal level and at three levels within the proximal neck. Neck dilatation was assessed in 209 patients with adequate computed tomography imaging at baseline and 1 month and in 62 patients at 1 month and 1 year (mean, 11.9 ± 4.0 months). Multivariable analyses were performed to identify independent predictors of perioperative (baseline to 1 month) and early postoperative (1 month to 1 year) aortic dilation at each level; analyses included 6 candidate variables, 6 clinical, and 14 anatomic run in eight models (one at each of the four aortic levels for both time frames). The mean aortic neck dilation at 1 month was 0.2 ± 1.7 mm, 0.7 ± 2.2 mm, and 0.9 ± 3.6 mm at 0 mm, 5 mm, and 10 mm below the lowest renal artery, and 0.0 ± 1.5 mm at the suprarenal level. From 1 month to 1 year, neck dilatation was 0.5 ± 1.6 mm, 0.4 ± 1.5 mm, 0.2 ± 1.8 mm, and -0.3 ± 1.1 mm at the same four levels, respectively. Dilatation of ≥3 mm at level 5 mm distal to the lowest renal artery was observed in 26 patients (12.5%) from preoperative to 1 month and in 5 patients (8.1%) between 1 month and 1 year. Multivariable regression identified several

  6. Low Cost, High Capacity Regenerable Sorbent for Carbon Dioxide Capture from Existing Coal-fired Power Plants

    Energy Technology Data Exchange (ETDEWEB)

    Alptekin, Gokhan [TDA Research, Inc., Wheat Ridge, CO (United States); Jayaraman, Ambalavanan [TDA Research, Inc., Wheat Ridge, CO (United States); Dietz, Steven [TDA Research, Inc., Wheat Ridge, CO (United States)

    2016-03-03

    In this project TDA Research, Inc (TDA) has developed a new post combustion carbon capture technology based on a vacuum swing adsorption system that uses a steam purge and demonstrated its technical feasibility and economic viability in laboratory-scale tests and tests in actual coal derived flue gas. TDA uses an advanced physical adsorbent to selectively remove CO2 from the flue gas. The sorbent exhibits a much higher affinity for CO2 than N2, H2O or O2, enabling effective CO2 separation from the flue gas. We also carried out a detailed process design and analysis of the new system as part of both sub-critical and super-critical pulverized coal fired power plants. The new technology uses a low cost, high capacity adsorbent that selectively removes CO2 in the presence of moisture at the flue gas temperature without a need for significant cooling of the flue gas or moisture removal. The sorbent is based on a TDA proprietary mesoporous carbon that consists of surface functionalized groups that remove CO2 via physical adsorption. The high surface area and favorable porosity of the sorbent also provides a unique platform to introduce additional functionality, such as active groups to remove trace metals (e.g., Hg, As). In collaboration with the Advanced Power and Energy Program of the University of California, Irvine (UCI), TDA developed system simulation models using Aspen PlusTM simulation software to assess the economic viability of TDA’s VSA-based post-combustion carbon capture technology. The levelized cost of electricity including the TS&M costs for CO2 is calculated as $116.71/MWh and $113.76/MWh for TDA system integrated with sub-critical and super-critical pulverized coal fired power plants; much lower than the $153.03/MWhand $147.44/MWh calculated for the corresponding amine based systems. The cost of CO2 captured for TDA’s VSA based system is $38

  7. Carcinoma de seio maxilar: análise de dez casos Maxillary sinus carcinoma: an analysis of ten cases

    Directory of Open Access Journals (Sweden)

    Ricardo Pires de Souza

    2006-12-01

    Full Text Available OBJETIVO: Avaliar o papel, principalmente da tomografia computadorizada, no estadiamento dos carcinomas dos seios maxilares. MATERIAIS E MÉTODOS: Foram analisados dez casos de carcinoma diagnosticados e tratados pelos Departamentos de Diagnóstico por Imagem e Cirurgia de Cabeça e Pescoço do Hospital Heliópolis, São Paulo, SP, entre 1988 e 2002. RESULTADOS: Nove pacientes tiveram extensão tumoral para a bochecha, oito para o espaço mastigador, sete para o assoalho da boca e palato duro, cinco para a fossa pterigóide, cinco para a órbita, três para o etmóide e um para a base do crânio. Três pacientes foram classificados como T3 e sete, como T4. Dois tinham metástases linfonodais no momento da apresentação inicial, os quais pertenciam ao estágio T4. Todos os casos foram confirmados com exame histopatológico. CONCLUSÃO: A análise precisa da extensão local e disseminação tumoral fornecida pela tomografia computadorizada e ressonância magnética desempenha papel importante no planejamento cirúrgico, influenciando, também, na conduta terapêutica e prognóstico.OBJECTIVE: To evaluate the role, especially of computed tomography, in the staging of maxillary sinus carcinomas. MATERIALS AND METHODS: Ten cases of carcinoma treated in Hospital Heliópolis Department of Diagnostic Imaging and Head and Neck Surgery, São Paulo, SP, Brazil, in the period between 1988 and 2002, were evaluated. RESULTS: Nine patients presented with tumor extension to the cheek, eight to the masticator space, seven to the mouth floor and hard palate, five to the pterygoid fossa, five to the orbit, three to the ethmoid bone, and one to the skull base. Three of the patients were staged T3, and seven T4. Two patients had lymph nodes metastases at their initial presentation, and were staged T4. All of the cases were histopathologically confirmed. CONCLUSION: The accurate analysis of the tumor local extent and dissemination by means of computed tomography and

  8. Carcinoma espinocelular do conduto auditivo externo: estudo por tomografia computadorizada de seis casos Squamous cell carcinoma of the external auditory canal: computed tomography findings in six cases

    Directory of Open Access Journals (Sweden)

    Fábio Mota Gonzalez

    2005-06-01

    Full Text Available OBJETIVO: Analisar a importância da avaliação tomográfica da extensão profunda dos carcinomas espinocelulares do conduto auditivo externo. MATERIAIS E MÉTODOS: Foram realizados exames tomográficos com cortes axiais e coronais com janelas para partes moles e óssea em seis pacientes com carcinoma espinocelular do conduto auditivo externo, com idade variando entre 55 e 71 anos, internados no Hospital Heliópolis, no período entre maio de 1995 e dezembro de 2003. RESULTADOS: Dos seis pacientes, todos apresentavam aumento de partes moles no conduto auditivo externo, cinco (83,3% tinham erosão óssea e invasão da orelha média, quatro (66,7% possuíam comprometimento da mastóide e da glândula parótida, três (50% apresentavam invasão da articulação temporomandibular, dois (33,3% tinham invasão da fossa média, do canal carotídeo e linfonodomegalia júgulo-carotídea alta ipisilateral. CONCLUSÃO: A avaliação da extensão tumoral profunda fornecida pela tomografia computadorizada é importante no estadiamento clínico, possibilitando um planejamento terapêutico mais eficaz.OBJECTIVE: To evaluate the role of computed tomography in the assessment of deep extension of squamous cell carcinoma of the external auditory canal. MATERIALS AND METHODS: In the period between May 1995 and December 2003 six patients with squamous cell carcinoma of the external auditory canal were submitted to computed tomography scan at "Hospital Heliópolis", São Paulo, SP, Brazil, including axial and coronal slices with soft tissue and bone algorithms. RESULTS: Thickening of the soft tissue of the external auditory canal was seen in all patients, bone erosion and invasion of the middle ear in five (83.3%, invasion of the mastoid and parotid gland in four (66.7%, invasion of the temporomandibular joint in three (50%, and invasion of the middle cranial fossa, carotid canal and cervical lymph node enlargement in two (33.3% patients. CONCLUSION: Assessment of

  9. Recidiva de lesões associadas ao HPV em pacientes HIV positivos após tratamento cirúrgico Recurrence of HPV lesions after surgical treatment in HIV-positive patients

    Directory of Open Access Journals (Sweden)

    André Luigi Pincinato

    2009-06-01

    Full Text Available O HPV é a doença anal sexualmente transmissível mais diagnosticada em pacientes HIV positivos. Neste estudo investigamos a taxa de recidiva após tratamento cirúrgico do HPV em pacientes HIV positivos. Foi realizado um estudo retrospectivo em 74 pacientes que foram submetidos a tratamento cirúrgico de lesões remanescentes após tratamento clínico do HPV, no Hospital Heliópolis, São Paulo, Brasil, de julho de 2004 até junho de 2007. A maioria dos pacientes eram homens (91,9%, idade variando de 22 a 57 anos (média de 36 anos. Carga viral variou de indetectável até 488.000 cópias/mm³, células T CD4 de 19 a 900 céls/mm³. Observamos neoplasia intraepitelial de alto grau em 12,2% e recorrência das lesões em 58,1% dos pacientes. A recorrência foi significantemente menor em pacientes com células T CD4 =200 cells/mm³ e carga viral indetectável.HPV is the commonest anal disease in HIV-infected patients. In the present study we investigated the recurrence rates after surgical treatment of HPV in HIV-positive patients. A retrospective review was performed on 74 patients who underwent surgical intervention for medically intractable anal condyloma at Hospital Heliópolis, São Paulo, Brazil, from July 2004 to June 2007. The majority of the patients were male (91,9%, ranged in age from 22 to 57 years (mean 36 years. Viral load ranged from undetectable to 488.000 copies/mm³, T CD4 cells counts from 19 to 900 cells/mm³. We observed high grade anal squamous intraepithelial lesions in 12,2% and anal condyloma recurred in 58,1%. A significantly lower recurrence was observed in patients with T CD4 cells counts =200 cells/mm³ and viral load undetectable.

  10. Piomiosite tropical em paciente com lúpus eritematoso sistêmico e infecção por HTLV 1/2 Tropical pyomyositis in a patient with systemic lupus erythematosus and HTLV 1/2 infection

    Directory of Open Access Journals (Sweden)

    Hérica Cristiani Barra de Souza

    2011-02-01

    Full Text Available A piomiosite tropical (PT é uma doença infecciosa da musculatura esquelética, de etiologia bacteriana, incomum, e muitas vezes associada a situações de imunodeficiência. O envolvimento de musculatura pélvica profunda, como o músculo ilíaco, é uma condição ainda mais incomum. A associação de lúpus eritematoso sistêmico (LES e PT é pouco relatada na literatura. Como o LES é uma situação de imunodepressão tanto pela doença em si como pelas medicações utilizadas no seu tratamento, esses pacientes tornam-se grupo de risco para o desenvolvimento de infecções, como PT. A infecção pelo HTLV está cada vez sendo mais identificada e associada a patologias nas quais autoimunidade está implicada, como é o caso do LES. Os autores descrevem um caso de PT de localização no músculo ilíaco em paciente portadora de LES, insuficiência renal crônica, em hemodiálise, além de portadora do vírus HTLV 1/2, internada no Hospital Heliópolis, em São Paulo, BrasilTropical pyomyositis (TP is an unusual infectious disease of skeletal muscles, caused by bacteria, and often associated with immunodeficiency conditions. The involvement of deep pelvic muscles, such as the iliac muscle, is even rarer. The association of systemic lupus erythematosus (SLE and PT is seldom reported in the literature. Because SLE involves a state of immunosuppression resulting from both the disease itself and its medicamentous treatment, SLE patients are at higher risk for developing infections, such as PT. Infection by HTLV 1/2 is increasingly identified and associated with autoimmune diseases, such as SLE. This is a case report of PT in the pelvic muscles of a female patient with SLE, chronic kidney failure, on hemodialysis, and HTLV1/2 infection, admitted to the Hospital Heliópolis, in the city of São Paulo, Brazil

  11. Geração do deflúvio de uma microbacia com Mata Atlântica, Cunha, SP. Runoff generation in a small catchment with Atlantic Rainforest, Cunha, SP, Brazil.

    Directory of Open Access Journals (Sweden)

    Maurício RANZINI

    2011-12-01

    area (V.S.A.. In the other, an increasein precipitation resulted in an increase in peak flow, even during the heaviest rainstorms,suggesting that V.S.A. occupied a smaller part of the catchment, close to the channel.These results indicated that antecedent soil moisture was important for the response of runoffto rainfall.

  12. Analysis of IgG with specificity for variant surface antigens expressed by placental Plasmodium falciparum isolates

    Directory of Open Access Journals (Sweden)

    Kremsner Peter G

    2004-07-01

    Full Text Available Abstract Background Pregnancy-associated malaria (PAM is caused by Plasmodium falciparum-infected erythrocytes that can sequester in placental intervillous space by expressing particular variant surface antigens (VSA that can mediate adhesion to chondroitin sulfate A (CSA in vitro. IgG antibodies with specificity for the VSA expressed by these parasites (VSAPAM are associated with protection from maternal anaemia, prematurity and low birth weight, which is the greatest risk factor for death in the first month of life. Methods In this study, the development of anti-VSAPAM antibodies in a group of 151 women who presented to the maternity ward of Albert Schweitzer Hospital in Lambaréné, Gabon for delivery was analysed using flow cytometry assays. Plasma samples from placenta infected primiparous women were also investigated for their capacity to inhibit parasite binding to CSA in vitro. Results In the study cohort, primiparous as well as secundiparous women had the greatest risk of infection at delivery as well as during pregnancy. Primiparous women with infected placentas at delivery showed higher levels of VSAPAM-specific IgG compared to women who had no malaria infections at delivery. Placental isolates of Gabonese and Senegalese origin tested on plasma samples from Gabon showed parity dependency and gender specificity patterns. There was a significant correlation of plasma reactivity as measured by flow cytometry between different placental isolates. In the plasma of infected primiparous women, VSAPAM-specific IgG measured by flow cytometry could be correlated with anti-adhesion antibodies measured by the inhibition of CSA binding. Conclusion Recognition of placental parasites shows a parity- and sex- dependent pattern, like that previously observed in laboratory strains selected to bind to CSA. Placental infections at delivery in primiparous women appear to be sufficient to induce functional antibodies which can both recognize the surface of

  13. The role of cyclooxygenase-1 and cyclooxygenase-2 in lipopolysaccharide and interleukin-1 stimulated enterocyte prostanoid formation

    Directory of Open Access Journals (Sweden)

    W. E. Longo

    1998-01-01

    Full Text Available Lipopolysaccharide is an inflammatory agent and interleukin-1 is a cytokine. Their pro-inflammatory effects may be mediated by prostanoids produced by inducible cyclooxygenase-2. The aim of this study was to determine the prostanoids produced by lipopolysaccharide and interleukin-1 stimulated enterocytes through the cyclooxygenase-1 and 2 pathways. Cultured enterocytes were stimulated with lipopolysaccharide or interleukin-1 β with and without cyclooxygenase inhibitors. Low concentrations of indomethacin and valerylsalicylic acid (VSA were evaluated as cyclooxygenase-1 inhibitors and their effects compared with the effects of a specific cyclooxygenase-2 inhibitor, SC-58125. Prostaglandin E2 , 6-keto prostaglandin F1α , prostaglandin D2 and leukotriene B4 levels were determined by radio immunoassay. Immunoblot analysis using isoformspecific antibodies showed that the inducible cyclooxygenase enzyme (COX-2 was expressed by 4 h in LPS and IL-1β treated cells while the constitutive COX-1 remained unaltered in its expression. Interleukin-1β and lipopolysaccharide stimulated the formation of all prostanoids compared with untreated cells, but failed to stimulate leukotriene B4. Indomethacin at 20 μ M concentration, and VSA inhibited lipopolysaccharide and interleukin 1β stimulated prostaglandin E2 , but not 6-keto prostaglandin F1α formation. SC-58125 inhibited lipopolysaccharide and interleukin-1β stimulated 6-keto prostaglandin F1α but not prostaglandin E2 release. The specific cyclooxygenase-2 inhibitor also inhibited lipopolysaccharide produced prostaglandin D2 but not interleukin-1β stimulated prostaglandin D2 While SC-58125 inhibited basal 6-keto prostaglandin-F1α formation it significantly increased basal prostaglandin E2 and prostaglandin D2 formation. As SC-58125 inhibited lipopolysaccharide and interleukin-1β induced 6-keto prostaglandin F1α production but not prostaglandin E2 production, it suggests that these agents stimulate

  14. The role of selective cyclooxygenase isoforms in human intestinal smooth muscle cell stimulated prostanoid formation and proliferation

    Directory of Open Access Journals (Sweden)

    Walter E. Longo

    1998-01-01

    Full Text Available Intestinal smooth muscle plays a major role in the repair of injured intestine and contributes to the prostanoid pool during intestinal inflammatory states. Cyclooxygenase (COX, which catalyzes the conversion of arachidonic acid to prostanoids exists in two isoforms, COX-1 and COX-2. The purpose of this study was to determine the relative contributions of COX-1 and COX-2 in the production of prostanoids by human intestinal smooth muscle (HISM cells when stimulated by interleukin-1β (IL-1β and lipopolsaccharide (LPS. Furthermore the effects of specific COX-1 and COX-2 inhibitors on the proliferation of smooth muscle cells was also evaluated. Confluent monolayer cultures of HISM cells were incubated with IL-1β or LPS for 0-24 h while control cells received medium alone. PGE2 and PGI2 as 6-keto-PGF1α and LTB4 were measured by a specific radioimmunoassay. COX enzymes were evaluated by Western immunoblotting. Unstimulated and stimulated cells were exposed to the specific COX-1 inhibitor valerylsalicylic acid (VSA and the COX-2 inhibitors NS-398 and SC-58125. The effects of serum on proliferation were then evaluated in the presence of each of the specific COX inhibitors by incorporation of 3H-thym idine into DNA. IL-1β and LPS increased both PGE2 and 6-ketoPGF1α in a dose dependent fashion with enhanced production detected two hours following exposure. Neither stimulus stimulated LTB4 release. Immunoblot analysis using isoform-specific antibodies showed that both COX-1 and COX-2 were present constitutively. Furthermore, COX-1 was upregulated by each inflammatory stimulus. In a separate set of experiments cells were pretreated with either the selective COX-1 inhibitor VSA or the selective COX-2 inhibitors NS-398 or SC-58125 prior to treatment with IL-1β or LPS. The COX-1 and COX-2 inhibitors decreased both basal and IL-1β and LPS stimulated prostanoid release. Spontaneous DNA synthesis was present and serum consistently increased proliferation

  15. Visual Resource Analysis for Solar Energy Zones in the San Luis Valley

    Energy Technology Data Exchange (ETDEWEB)

    Sullivan, Robert [Argonne National Laboratory (ANL), Argonne, IL (United States). Environmental Science Division; Abplanalp, Jennifer M. [Argonne National Laboratory (ANL), Argonne, IL (United States). Environmental Science Division; Zvolanek, Emily [Argonne National Laboratory (ANL), Argonne, IL (United States). Environmental Science Division; Brown, Jeffery [Bureau of Land Management, Washington, DC (United States). Dept. of the Interior

    2016-01-01

    This report summarizes the results of a study conducted by Argonne National Laboratory’s (Argonne’s) Environmental Science Division for the U.S. Department of the Interior Bureau of Land Management (BLM). The study analyzed the regional effects of potential visual impacts of solar energy development on three BLM-designated solar energy zones (SEZs) in the San Luis Valley (SLV) in Colorado, and, based on the analysis, made recommendations for or against regional compensatory mitigation to compensate residents and other stakeholders for the potential visual impacts to the SEZs. The analysis was conducted as part of the solar regional mitigation strategy (SRMS) task conducted by BLM Colorado with assistance from Argonne. Two separate analyses were performed. The first analysis, referred to as the VSA Analysis, analyzed the potential visual impacts of solar energy development in the SEZs on nearby visually sensitive areas (VSAs), and, based on the impact analyses, made recommendations for or against regional compensatory mitigation. VSAs are locations for which some type of visual sensitivity has been identified, either because the location is an area of high scenic value or because it is a location from which people view the surrounding landscape and attach some level of importance or sensitivity to what is seen from the location. The VSA analysis included both BLM-administered lands in Colorado and in the Taos FO in New Mexico. The second analysis, referred to as the SEZ Analysis, used BLM visual resource inventory (VRI) and other data on visual resources in the former Saguache and La Jara Field Offices (FOs), now contained within the San Luis Valley FO (SLFO), to determine whether the changes in scenic values that would result from the development of utility-scale solar energy facilities in the SEZs would affect the quality and quantity of valued scenic resources in the SLV region as a whole. If the regional effects were judged to be significant, regional

  16. Conceptual study on advanced PWR system

    Energy Technology Data Exchange (ETDEWEB)

    Bae, Yoon Young; Chang, M. H.; Yu, K. J.; Lee, D. J.; Cho, B. H.; Kim, H. Y.; Yoon, J. H.; Lee, Y. J.; Kim, J. P.; Park, C. T.; Seo, J. K.; Kang, H. S.; Kim, J. I.; Kim, Y. W.; Kim, Y. H.

    1997-07-01

    In this study, the adoptable essential technologies and reference design concept of the advanced reactor were developed and related basic experiments were performed. (1) Once-through Helical Steam Generator: a performance analysis computer code for heli-coiled steam generator was developed for thermal sizing of steam generator and determination of thermal-hydraulic parameters. (2) Self-pressurizing pressurizer : a performance analysis computer code for cold pressurizer was developed. (3) Control rod drive mechanism for fine control : type and function were surveyed. (4) CHF in passive PWR condition : development of the prediction model bundle CHF by introducing the correction factor from the data base. (5) Passive cooling concepts for concrete containment systems: development of the PCCS heat transfer coefficient. (6) Steam injector concepts: analysis and experiment were conducted. (7) Fluidic diode concepts : analysis and experiment were conducted. (8) Wet thermal insulator : tests for thin steel layers and assessment of materials. (9) Passive residual heat removal system : a performance analysis computer code for PRHRS was developed and the conformance to EPRI requirement was checked. (author). 18 refs., 55 tabs., 137 figs.

  17. Cambios en la medida de las horas de insolación: Análisis de su impacto en dos observatorios de las Islas Baleares (España

    Directory of Open Access Journals (Sweden)

    José A. Guijarro

    2007-12-01

    Full Text Available Se han comparado las medidas de horas de sol realizadas en paralelo con el heliógrafo Campbell-Stokes, utilizado tradicionalmente en los observatorios españoles, con las medidas de los nuevos instrumentos de Kipp&Zonen, basados en el umbral de irradiación directa de 120 Wm-2. La comparación se ha realizado con los datos de dos observatorios de Baleares, ubicados en los aeropuertos de Menorca e Ibiza, en los que las nuevas medidas son generalmente inferiores a las antiguas, con diferencias medias diarias de -0,97 y -0,58 horas respectivamente. En términos relativos, la disminución respecto al promedio anual del periodo 1971-2000 es de un 13,2% en Menorca y un 7,8% en Ibiza. Se han realizado ajustes por regresión lineal simple y múltiple que explican un 94% de la varianza de la insolación diaria. Las ecuaciones obtenidas pueden servir para homogeneizar las series de datos diarios de horas de sol, con errores típicos de 0,98 horas en el aeropuerto de Menorca y 0,86 en el de Ibiza, pero no son aplicables a otros observatorios.

  18. Internetikeele automaatne süntaktiline analüüs kitsenduste grammatikaga

    Directory of Open Access Journals (Sweden)

    Dage Särg

    2016-05-01

    Full Text Available "Syntactic analysis of Estonian netspeak using Constraint Grammar" The paper provides an overview of an attempt to adapt the Estonian Constraint Grammar rule set for netspeak. The rule set has been developed by Kaili Müürisep and Tiina Puolakainen for shallow and dependency parsing of Estonian literary language, and it has previously been adapted for shallow parsing of spoken Estonian by Kaili Müürisep and Heli Uibo. First, in order to adapt the rules, a chatroom corpus was parsed with the existing rule set. The corpus was manually revised and based on the errors that were found, changes were made to the rule set. The changes regarded detection of clause boundaries and particle verbs, as well as assignment of syntactic tags and dependency relations. Extensive use of discourse particles and direct addresses, short sentence length, and small percentage of attributes among the syntactic functions used in text appeared to be the most distinctive features of netspeak, as well as the large amount of elliptical sentences from which, in addition to other syntactic functions, a predicate can be left out. As a result of adapting the rule set, the results of both shallow and dependency parsing improved. The most error-prone syntactic functions were subjects, predicatives, and adverbials. In dependency parsing, the largest number of errors was made in determining the governors of adverbials.

  19. New drilling technologies battle marginal economics and conservative Canadian attitudes

    Energy Technology Data Exchange (ETDEWEB)

    Stastny, P.

    2009-02-15

    Drilling technology has progressed only incrementally since the introduction of horizontal drilling and multistage fracing which is now widely used to recover petroleum resources from tight unconventional plays. This article described other recent advancements in drilling technology, including improvements in underbalanced and managed-pressure drilling, and the incremental improvement in the design and performance of mud motors. Rig day costs have been reduced as a result of finding the right combination of bit, motor, directional drilling system and other innovations. This article highlighted the following technologies that have been embraced by the Canadian oilpatch: rotary steerable technology in directional drilling; the InSite ADR resistivity geosteering tool which effectively measures the distance to a bed boundary; the GABI at-bit azimuthal gamma ray and inclination tool that serves a similar geosteering role using gamma ray technology rather than resistivity to navigate the well; heli-portable drilling rigs which are configured so that they can be moved easily by helicopter for use in the shale plays of northeastern British Columbia; Halliburton's junction isolation tool (JIT) which provides a better way to stimulate multilateral wells; and the reverse circulation centre discharge (RCCD) drilling concept for low-pressure, water-sensitive formations. 1 fig.

  20. mini-b-roll : LHC Accelerator

    CERN Multimedia

    CERN Audiovisual Service

    2008-01-01

    How the LHC works The LHC, the world’s largest and most powerful particle accelerator, is the latest addition to CERN’s accelerator complex. It mainly consists of a 27 km ring of superconducting magnets with a number of accelerating structures to boost the energy of the particles along the way. Inside the accelerator, two beams of particles travel at close to the speed of light with very high energies before colliding with one another. The beams travel in opposite directions in separate beam pipes – two tubes kept at ultrahigh vacuum. They are guided around the accelerator ring by a strong magnetic field, achieved using superconducting electromagnets. These are built from coils of special electric cable that operates in a superconducting state, efficiently conducting electricity without resistance or loss of energy. This requires chilling the magnets to about ‑271°C – a temperature colder than outer space! For this reason, much of the accelerator is connected to a distribution system of liquid heli...

  1. The New Evolution for SIA Rotorcraft UAV Project

    Directory of Open Access Journals (Sweden)

    Juntong Qi

    2010-01-01

    Full Text Available This paper describes recent research on the design, implement, and testing of a new small-scaled rotorcraft Unmanned Aerial Vehicle (RUAV system—ServoHeli-40. A turbine-powered UAV weighted less than 15 kg was designed, and its major components were tested at the Shenyang Institute of Automation, Chinese Academy of Sciences in Shenyang, China. The aircraft was designed to reach a top speed of more than 20 mps, flying a distance of more than 10 kilometers, and it is going to be used as a test-bed for experimentally evaluating advanced control methodologies dedicated on improving the maneuverability, reliability, as well as autonomy of RUAV. Sensors and controller are all onboard. The full system has been tested successfully in the autonomous mode using the multichannel active modeling controller. The results show that in a real windy environment the rotorcraft UAV can follow the trajectory which was assigned by the ground control station exactly, and the new control method is obviously more effective than the one in the past year's research.

  2. PERUBAHAN KOMPOSISI VEGETASI DAN STRUKTUR POHON PADA PLOT MEIJER (1959-2009 DI GUNUNG GEDE, JAWA BARAT

    Directory of Open Access Journals (Sweden)

    Musyarofah Zuhri

    2011-01-01

    Full Text Available After Meijer had conducted ecological study on Mt. Gede Pangrango in 1959, the subsequent study did not monitor its d inamics. This study aimed to compare current vegetation composition and tree structure with past 50 years data based on Meijer publication. One hectare permanent plot reconstructed at submontane zone to identi fy vegetation changes during 50 years on August 2009. Vegetation analyses method was similar with 50 years ago include field tree identification, diameter at breast height (dbh, tree height, and first branch height. Result showed the species richness decreased from 233 to 166 species, diversity index (H' slightly changed from 3.39 to 3.29, and similarity index indicated the differentiation of both tree communities was 51%. Further r nore, from 63 tree species presented in 2009, 47 species was similar with 50 years ago and 16 species know n as new record. Moreover, 18 tree species recorded in 1959 had lost in 2009 i.e., Ehretia javanica, Heli( 7ia javanica, Mischocarpus frutescens, Saurauia bracteosa, Wedlandia glabrata, etc. The highest abundance oi I both studies was Villebrunea rubescens. The changes of vegetation composition and tree structure may have been caused by (1 wind disaster occurred on 1984; (2 human pressured from the nearest village; and (3 natural forest regeneration towards climax condition.

  3. Estimativa da distribuição da energia solar no Estado de São Paulo An estimative on the distribution of solar energy in the State of São Paulo

    Directory of Open Access Journals (Sweden)

    Admar Cervellini

    1966-01-01

    Full Text Available Os autores analisam a distribuição da energia solar no Estado de São Paulo, área limitada pelas latitudes de 20°S a 25°S. É apresentada uma equação média para determinação da radiação na superfície, partindo de dados de insolação para as condições da referida área. Utilizou-se o método clássico da correlação entre dados de actinógrafo e heliógrafo.The authors analyse the distribution of solar energy in the State of São Paulo, an area which is limited within 20° and 25° south. An average equation is presented for the determination of radiation on the surface, starting from insolation data for the conditions of the mentioned area. For this purpose the classic method was utilized of correlation between data from actinograph and heliograph.

  4. Tratamento cirúrgico do ameloblastoma com reconstrução de mandíbula com enxerto de crista ilíaca não vascularizado: estudo de sete casos

    Directory of Open Access Journals (Sweden)

    Daniela Venturoli Lunardi

    Full Text Available OBJETIVO: Determinar a validade do enxerto autólogo de crista ilíaca não vascularizado no tratamento cirúrgico do ameloblastoma de mandíbula. MÉTODO: Nos Serviços de Cirurgia de Cabeça e Pescoço e Semiologia Bucal do Complexo Hospitalar Heliópolis, de 1980 a 2000, foram tratados 31 pacientes com ameloblastoma de mandíbula, dos quais sete receberam enxerto de crista ilíaca autólogo, fixos com placa de titânio do sistema A-0 (quatro casos e aço inox (três casos, sendo portadores da variedade folicular (seis casos e plexiforme (um caso. RESULTADOS: Nesta análise, foi utilizado o Teste de Hipótese para a média populacional com a variança desconhecida, houve exposição da placa em três casos (40% quando a neoplasia ultrapassava a linha média e em quatro casos (60% não incidiu nenhuma complicação. CONCLUSÕES: Apesar da incidência de exposição de placa, o método é indicado na reconstrução da mandíbula de pacientes com ameloblastoma.

  5. A MOBIL INTERNET TECHNOLÓGIAI, GAZDASÃ GI ÉS TÃ RSADALMI HATÃ SAI AZ AGRÃ RGAZDASÃ GBAN

    OpenAIRE

    Szilagyi, Robert; Herdon, Miklos

    2005-01-01

    A mobil kommunikáció, ezen belül a mobil Internet az agrárgazdaság számá-ra a használat hely és idő függetlensége miatt fontos lehetőséget, gazdasági elő-nyöket, a vállalkozások, szervezetek számára hatékonyabb működést jelenthet. Széleskörű elterjedése, innovációs hatása és előnyei gazdaságosan csak a technológia és a szolgáltatások hatásrendszerének figyelembevételével érhető el. A technológiai, társadalmi és gazdasági komplex hatásrendszer befolyásolja a gazdasági alkalmazások terjedését. ...

  6. Comparison of Salivary and Serum Enzyme Immunoassays for the Diagnosis of Helicobacter pylori Infection

    Directory of Open Access Journals (Sweden)

    John M Embil

    1998-01-01

    Full Text Available Infection with Helicobacter pylori has been established as an important risk factor for the development of peptic ulcer disease, gastritis and gastric cancer. The diagnosis of H pylori infection can be established by invasive or noninvasive techniques. Two noninvasive enzyme immunoassays (EIAs for antibody detection – HeliSal and Pylori Stat – were compared with histology. Both assays detect immunoglobulin (Ig G directed against purified H pylori antigen. The test populations consisted of 104 consecutive patients scheduled for upper gastrointestinal endoscopy. Of these patients, 97 (93% had symptoms compatible with peptic ulcer disease. Saliva and serum were collected simultaneously at the time of endoscopy. Salivary EIA had a sensitivity of 66%, specificity of 67%, positive predictive value of 67% and negative predictive value of 66% compared with the serum EIA, where the results were 98%, 48%, 64% and 96%, respectively. Although the salivary EIA is an appealing noninvasive test, it was not a sensitive and specific assay. The serum EIA also lacked specificity, but was highly sensitive with a good negative predictive value. Although a negative serum EIA rules out H pylori infection, a positive result must be interpreted in the clinical context and confirmed with a more specific measure.

  7. Formation processes of sea ice floe size distribution in the interior pack and its relationship to the marginal ice zone off East Antarctica

    Science.gov (United States)

    Toyota, Takenobu; Kohout, Alison; Fraser, Alexander D.

    2016-09-01

    To understand the behavior of the Seasonal Ice Zone (SIZ), which is composed of sea-ice floes of various sizes, knowledge of the floe size distribution (FSD) is important. In particular, FSD in the Marginal Ice Zone (MIZ), controlled by wave-ice interaction, plays an important role in determining the retreating rates of sea-ice extent on a global scale because the cumulative perimeter of floes enhances melting. To improve the understanding of wave-ice interaction and subsequent effects on FSD in the MIZ, FSD measurements were conducted off East Antarctica during the second Sea Ice Physics and Ecosystems eXperiment (SIPEX-2) in late winter 2012. Since logistical reasons limited helicopter operations to two interior ice regions, FSD in the interior ice region was determined using a combination of heli-photos and MODIS satellite visible images. The possible effect of wave-ice interaction in the MIZ was examined by comparison with past results obtained in the same MIZ, with our analysis showing: (1) FSD in the interior ice region is basically scale invariant for both small- (1 km) scale regimes; (2) although fractal dimensions are quite different between these two regimes, they are both rather close to that in the MIZ; and (3) for floes pack.

  8. Relationship of Halitosis with Gastric Helicobacter Pylori Infection

    Directory of Open Access Journals (Sweden)

    Farnaz HajiFattahi

    2015-10-01

    Full Text Available Objectives: Gastric infection with Helicobacter pylori may be one of the main causes of halitosis. This study was performed to evaluate the relationship of Heli- cobacter pylori infection with halitosis.Materials and Methods: This case control study was performed on 44 dyspeptic patients with a mean age of 34.29±13.71 years (range 17 to 76 years. The case group included 22 patients with halitosis and no signs of diabetes mellitus, renal or liver failure, upper respiratory tract infection, malignancies, deep carious teeth, severe  periodontitis,  coated  tongue,  dry  mouth  or poor  oral  hygiene.  Control group included 22 patients without halitosis and the same age, sex, systemic and oral conditions as the case group. Halitosis was evaluated using organoleptic test (OLT and Helicobacter pylori infection was evaluated by Rapid Urease Test (RUT during endoscopy. The data were statistically analyzed using chi square, Mann Whitney and t-tests.Results: Helicobacter pylori infection was detected in 20 (91% out of 22 halitosis patients, and 7 control subjects (32% (P<0.001.Conclusion: Helicobacter pylori gastric infection can be a cause of bad breath. Dentists should pay more attention to this infection and refer these patients to in- ternists to prevent further gastrointestinal (GI complications and probable malig- nancies.

  9. Paragangliomas of the head and neck: clinical, morphological and immunohistochemical aspects

    Directory of Open Access Journals (Sweden)

    Pedro de Alcântara de Andrade Filho

    2001-05-01

    Full Text Available CONTEXT: Protein marker positivity can assist in the definition of the therapeutic approach towards head and neck paragangliomas. The establishment of the therapeutic approach should incorporate the results of such an investigation. OBJECTIVE: To establish criteria for benignancy and malignancy of vagal and jugular-tympanic paragangliomas, via the study of the relationships of sex, age, tumor size, duration of complaints, site, family history, presence of metastases, treatment, histological architecture and cell type with the immunohistochemical reactions to S100 protein, chromogranin and AgKi67. DESIGN: A retrospective study of histological and clinical records. SETTING: The Heliópolis and Oswaldo Cruz tertiary general hospitals, São Paulo. SAMPLE: 8 cases of head and neck paragangliomas. MAIN MEASUREMENTS: Determination of degree of positivity to paragangliomas via immunohistochemical reactions. RESULTS: 1. The protein markers for the principal cells (AgKi67 and chromogranin were sensitive in 100% of the tumors when used together. 2. S100 protein was well identified in the cytoplasm and nucleus of sustentacular cells and underwent reduction in the neoplasias. CONCLUSIONS: Chromogranin was proven to be a generic marker for neuroendocrine tumors; S100 protein was positive in all 8 cases and the AgKi67 had low positivity in all cases.

  10. Chemically Cross-Linked Poly(acrylic-co-vinylsulfonic Acid Hydrogel for the Delivery of Isosorbide Mononitrate

    Directory of Open Access Journals (Sweden)

    Talib Hussain

    2013-01-01

    Full Text Available We report synthesis, characterization, and drug release attributes of a series of novel pH-sensitive poly(acrylic-co-vinylsulfonic acid hydrogels. These hydrogels were prepared by employing free radical polymerization using ethylene glycol dimethacrylate (EGDMA and benzyl peroxide (BPO as cross-linker and initiator, respectively. Effect of acrylic acid (AA, polyvinylsulfonic acid (PVSA, and EGDMA on prepared hydrogels was investigated. All formulations showed higher swelling at high pHs and vice versa. Formulations containing higher content of AA and EGDMA show reduced swelling, but one with higher content of PVSA showed increased swelling. Hydrogel network was characterized by determining structural parameters and loaded with isosorbide mononitrate. FTIR confirmed absence of drug polymer interaction while DSC and TGA demonstrated molecular dispersion of drug in a thermally stable polymeric network. All the hydrogel formulations exhibited a pH dependent release of isosorbide mononitrate which was found to be directly proportional to pH of the medium and PVSA content and inversely proportional to the AA contents. Drug release data were fitted to various kinetics models. Results indicated that release of isosorbide mononitrate from poly(AA-co-VSA hydrogels was non-Fickian and that the mechanism was diffusion-controlled.

  11. High-Efficiency, High-Capacity, Low-NOx Aluminum Melting Using Oxygen-Enhanced Combustion

    Energy Technology Data Exchange (ETDEWEB)

    D' Agostini, M.D.

    2000-06-02

    This report describes the development and application of a novel oxygen enhanced combustion system with an integrated vacuum swing adsorption (VSA) oxygen supply providing efficient, low NOx melting in secondary aluminum furnaces. The mainstay of the combustion system is a novel air-oxy-natural gas burner that achieves high productivity and energy efficiency with low NOx emissions through advanced mixing concepts and the use of separate high- and low-purity oxidizer streams. The technology was installed on a reverberatory, secondary aluminum melting plant at the Wabash Aluminum Alloy's Syracuse, N.Y. plant, where it is currently in operation. Field testing gave evidence that the new burner technology meets the stringent NOx emissions target of 0.323 lb NO2/ton aluminum, thus complying with regulations promulgated by Southern California's South Coast Air Quality Management District (SCAQMD). Test results also indicated that the burner technology exceeded fuel efficiency and melting capacity goals. Economic modeling showed that the novel air-oxy-fuel (ADF) combustion technology provides a substantial increase in furnace profitability relative to air-fuel operation. Model results also suggest favorable economics for the air-oxy-fuel technology relative to a full oxy-fuel conversion of the furnace.

  12. Metalloprotease vsm is the major determinant of toxicity for extracellular products of Vibrio splendidus.

    Science.gov (United States)

    Binesse, Johan; Delsert, Claude; Saulnier, Denis; Champomier-Vergès, Marie-Christine; Zagorec, Monique; Munier-Lehmann, Hélène; Mazel, Didier; Le Roux, Frédérique

    2008-12-01

    Genomic data combined with reverse genetic approaches have contributed to the characterization of major virulence factors of Vibrio species; however, these studies have targeted primarily human pathogens. Here, we investigate virulence factors in the oyster pathogen Vibrio splendidus LGP32 and show that toxicity is correlated to the presence of a metalloprotease and its corresponding vsm gene. Comparative genomics showed that an avirulent strain closely related to LGP32 lacked the metalloprotease. The toxicity of LGP32 metalloprotease was confirmed by exposing mollusk and mouse fibroblastic cell lines to extracellular products (ECPs) of the wild type (wt) and a vsm deletion mutant (Deltavsm mutant). The ECPs of the wt induced a strong cytopathic effect whose severity was cell type dependent, while those of the Deltavsm mutant were much less toxic, and exposure to purified protein demonstrated the direct toxicity of the Vsm metalloprotease. Finally, to investigate Vsm molecular targets, a proteomic analysis of the ECPs of both LGP32 and the Deltavsm mutant was performed, revealing a number of differentially expressed and/or processed proteins. One of these, the VSA1062 metalloprotease, was found to have significant identity to the immune inhibitor A precursor, a virulence factor of Bacillus thuringiensis. Deletion mutants corresponding to several of the major proteins were constructed by allelic exchange, and the ECPs of these mutants proved to be toxic to both cell cultures and animals. Taken together, these data demonstrate that Vsm is the major toxicity factor in the ECPs of V. splendidus.

  13. The role of reward in word learning and its implications for language acquisition.

    Science.gov (United States)

    Ripollés, Pablo; Marco-Pallarés, Josep; Hielscher, Ulrike; Mestres-Missé, Anna; Tempelmann, Claus; Heinze, Hans-Jochen; Rodríguez-Fornells, Antoni; Noesselt, Toemme

    2014-11-03

    The exact neural processes behind humans' drive to acquire a new language--first as infants and later as second-language learners--are yet to be established. Recent theoretical models have proposed that during human evolution, emerging language-learning mechanisms might have been glued to phylogenetically older subcortical reward systems, reinforcing human motivation to learn a new language. Supporting this hypothesis, our results showed that adult participants exhibited robust fMRI activation in the ventral striatum (VS)--a core region of reward processing--when successfully learning the meaning of new words. This activation was similar to the VS recruitment elicited using an independent reward task. Moreover, the VS showed enhanced functional and structural connectivity with neocortical language areas during successful word learning. Together, our results provide evidence for the neural substrate of reward and motivation during word learning. We suggest that this strong functional and anatomical coupling between neocortical language regions and the subcortical reward system provided a crucial advantage in humans that eventually enabled our lineage to successfully acquire linguistic skills. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Computers in the writing processadvantage or disadvantage?

    Directory of Open Access Journals (Sweden)

    Jannie Botha

    2013-02-01

    Full Text Available This paper tries to find an answer to the question of whether the microcomputer could be put to meaningful .Jse in the teaching of writing techniques to students. Attention is drawn to the fact that microcomputers are text orientated and as such, suitable for writing. Various reasons for this phenomenon are put forward. Microcomputers as well as programmes have become consumer friendly in recent times. This enhances the usefulness of the micro for the teaching of writing. At present, different writing projects are being carried out in the USA. Although scientifically founded results are as yet not readily available, there are indications that students react favourably to this new method of writing instruction. Various writing instructors have warned against the dangers of taking the new approach by storm. In this paper their misgivings are discussed. Hierdie artikel bespreek die vraag of mikrorekenaars sinvol gebruik kan word vir die onderrig van skryftegnieke aan studente. Daar word gewys op die feit dat mikrorekenaars teksgeorienteerd is en dus geskik is vir skryfwerk. Verskeie redes word hiervoor aangegee. Mikrorekenaars sowel as programme het gebruikersvriendelik geword in die jongste tyd. Dit verhoog die bruikbaarheid van die mikro vir skryfonderrig. Verskeie skryfprojekte is tans in die VSA aan die gang. Alhoewel wetenskaplik gefundeerde resultate nog nie geredelik beskikbaar is nie, dui gegewens daarop dat studente positief reageer op hierdie nuwe metode van skryfonderrig. Daar is verskeie skryfinstrukteurs wat waarsku teen die gevare van instorm in die nuwe benadering in. Hulle waarskuwings word voorts aan die orde gestel.

  15. Inside Out: Organizations as Service Systems Equipped with Relational Boundaries

    Directory of Open Access Journals (Sweden)

    María Jimena Crespo Garrido

    2017-04-01

    Full Text Available Currently, literature on organizational boundaries is at the center of a heated debate, characterized by a shift from a transactional approach to a broader immaterial perspective centered on the concept of boundless organizations. However, the overestimation of the effects of contemporary dematerialization on business processes can lead to the progressive neglect of the existence of corporate borders. In light of this consideration, the present work aims at proposing a new type of criterion for defining organizational boundaries, halfway between the conception of the firm’s total openness and total closure. To this end, the authors envisage the use of a new interpretive logic defined as “relational”, resulting from the specification of the systemic view (and as the sum of the logic underlying the viable systems approach (VSA. This approach views the definition of boundaries. Therefore, in the large and intricate scenery of the studies dedicated to organizational boundaries, this work contributes to a better understanding of border selection as an interactive and changeable process capable of pushing organizations towards a greater awareness of their strategic dimension. This paper also offers some insights for future research, suggesting that both scholars and professionals investigate, firstly, new frontiers for the identification of organizational boundaries and, secondly, the possible positive repercussions that new organizational redesign modes could determine for a greater competitive success.

  16. Uvodnik

    Directory of Open Access Journals (Sweden)

    Meta Lah

    2009-12-01

    Full Text Available Po dvoletnem premoru in nekaj težavah, povezanih s financiranjem, je Vestnik za tuje jezike zdaj spet pred Vami; tokrat v nekoliko skromnejšem obsegu kot ponavadi. Z revijo imamo ambicioznejše načrte, ki jih bomo lahko uresničili le z avtorji kakovostnih prispevkov in ob podpori bralcev in naročnikov. Pred nekaj tedni sem ob pospravljanju polic v kabinetu naletela na izdajo Vestnika iz leta 1963. Prav ganljivo je bilo listati revijo, ki je izšla v letu, ko sem se rodila. Ciklostirana izdaja na skromnem papirju je že prinašala zanimive prispevke avtorjev, katerih večino poznam le po imenu, so pa bili med tistimi, ki so v slovenskem prostoru orali ledino na naših področjih. Zaradi njih in zaradi vseh ostalih, ki so vsa leta vztrajali, se mi zdi še toliko bolj potrebno, da revija obstane. Imen tistih, ki so v več kot štiridesetih letih izhajanja Vestnika pri njegovem nastajanju sodelovali, je veliko. Vsem njim gre velika zahvala. Posebej pa je treba omeniti mag. Nika Hudeljo, ki je v zadnjih letih vztrajno, natančno in potrpežljivo urejal revijo. S kolegom Gregorjem Perkom in člani uredniškega odbora upamo, da se čez leto dni spet beremo.

  17. Summer Student Report 2014: Schottky component qualification and RF filter characterization

    CERN Document Server

    Egidos Plaja, Nuria

    2014-01-01

    This Summer Student project has been developed in BE-BI-QP department under the supervision of Manfred Wendt. Main goals of the task to be performed are the following: 1)\tFilter characterization: the student will get familiar with the Vector Network Analizer (VNA), S-parameter measurement and PSPICE modelling of low-pass filters. 2)\tFilter response matching: an algorithm to compare and classify filter responses into best-matching pairs will be developed. 3)\tSchottky monitor filter qualification: S-parameter and time domain measurements will be carried out with filters related to Schottky monitor and results will be benchmarked. 4)\tSchottky monitor amplifier measurement: noise figure and gain at a given frequency will be measured for a set of Low Noise Amplifiers related to Schottky monitor. -1dB compression point and 3rd order interception point will be measured too for education purposes. For the development of this project, the student will get familiar with RF measure devices (VNA, VSA), theoretical concep...

  18. Svet bogov Vzhodnih Alp in Jadrana v stiku z rimsko civilizacijo

    Directory of Open Access Journals (Sweden)

    Marjeta Šašel Kos

    2000-12-01

    Full Text Available Med bralci naše nove revije, kijih zanimajo klasična filologija, posebej grška in rimska literatura ter vzporedno najrazličnejši vidiki naše preteklosti v antiki, bodo morda tudi takšni, ki jih zanimajo poganski kulti in božanstva, čaščena pri nas v dobi pred prevlado krščanstva. Zato sem se odločila, da vaje objavim v nadaljevanjih svoje besedilo o predrimskih kultih in božanstvih našega prostora in širše okolice. To besedilo je slovenska priredba angleške izdaje z naslovom Pre-RomanDivinities ojtheEasternAlps andAdriatic, ki je izšla spomladi leta 2000 kot monograftja serije Situla (št. 38, Ljubljana 1999. Ta muzejska serija je namenjena predvsem izmenjavi publikacij s tujino, zato je smiselno, da ni dvojezična. Slovensko besedilo začenjam s kratkim uvodnim sestavkom, sledili bosta dve nadaljevanji prvega poglavja (Od izvira Timava do Ekorne v Savariji: domača in uvožena božanstva , ter vsa nadaljna poglavja, ki doslej še niso dostopna v slovenščini (Boginje Histrije in Liburnye; Velike božanske matere v Saloni; Je Jupiter, ki odvrača zlo, noriško božanstvo?

  19. Application of biopartitioning micellar chromatography and QSRR modeling for prediction of gastrointestinal absorption and design of novel β-hydroxy-β-arylalkanoic acids.

    Science.gov (United States)

    Dobričić, Vladimir; Savić, Jelena; Nikolic, Katarina; Vladimirov, Sote; Vujić, Zorica; Brborić, Jasmina

    2017-03-30

    Gastrointestinal absorption of thirteen novel β-hydroxy-β-arylalkanoic acids (HAA) with anti-inflammatory activity was predicted by use of biopartitioning micellar chromatography and compared to ibuprofen. All tested HAA have lower retention factors (k) and lower expected gastrointestinal absorption than ibuprofen, whereas derivatives with the highest values of k are 1C, 2APTF and 2C. Quantitative structure-retention relationship (QSRR) analysis was performed in order to identify molecular descriptors with the highest influence on k and ANN(k) model was selected as optimal. Descriptors which form this model (nBM, P_VSA_LogP_8 and Eta_L) indicate that replacement of phenyl ring with a saturated or partially unsaturated one, as well as presence of halogens and nitro group should positively affect k values. On the basis of these conclusions, six novel HAA were designed and selected QSRR model was used for the prediction of their k values. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Differential evolution of anti-VAR2CSA- IgG3 in primigravidae and multigravidae pregnant women infected by Plasmodium falciparum

    Science.gov (United States)

    Guitard, Juliette; Cottrell, Gilles; Magnouha, Nellie Moulopo; Salanti, Ali; Li, Tengfei; Sow, Sokhna; Deloron, Philippe; Tuikue Ndam, Nicaise

    2008-01-01

    Background Pregnant women develop protective anti-VSA IgG1 and IgG3 when infected by Plasmodium falciparum. The major target of IgG from serum of infected pregnant women is VAR2CSA. Methods In this study, ELISA was used to compare the level of VAR2CSA DBL5ε- specific IgG subclasses at enrolment and at delivery in a cohort of pregnant women in Senegal. All antibody measures were analysed in relation to placental infection according to parity. Results The results show an interaction between immune response to placental malaria and parity. A higher level of anti- DBL5ε- IgG3 at enrolment and a higher increase between enrolment and delivery were found in primigravidae who presented with uninfected placenta at delivery in comparison to those who presented with an infection of the placenta. However, high antibody level at delivery was associated with the infection of the placenta in multigravidae. Conclusion This high level of IgG3 in uninfected primigravidae suggests a protective role of these antibodies in this susceptible group, highlighting the importance of VAR2CSA in general and of some of its variants still to be defined, in the induction of protective immunity to pregnancy malaria. PMID:18190692

  1. Valor prognóstico do Ki-67 no carcinoma indiferenciado de grandes células de glândula salivar maior: estudo de 11 casos Prognostic significance of Ki-67 in great cell undifferentiated carcinoma of the major salivary glands: study of 11 cases

    Directory of Open Access Journals (Sweden)

    Túlio V. Barbosa

    2003-10-01

    Full Text Available INTRODUÇÃO: Estabelecer a relação entre o comportamento biológico e o prognóstico nas neoplasias indiferenciadas das glândulas salivares maiores. OBJETIVO: Identificação de parâmetros clínicos, histopatológicos, imunohistoquímicos e de proliferação celular (Ki-67 no prognóstico destas neoplasias. FORMA DE ESTUDO: Análise de espécimes através de procedimentos histológicos e imunohistoquímicos e sua relação com o prognóstico destas neoplasias. MATERIAL E MÉTODO: Onze casos de carcinoma indiferenciado tipo grandes células das glândulas salivares maiores, diagnosticados e tratados no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo, no período de 1977 a 2000. Foram revistos e subclassicados por perfis de positividade para citoqueratinas de alto e/ou baixos pesos moleculares. RESULTADOS: Sinalizou-se com um padrão imunohistoquímico de diferenciação histogênica bidirecional (tipo mucoepidermóide, e unidirecionais do tipo epidermóide ou ductal/glandular, visando sobretudo identificar a influência de parâmetros demográficos, clínicos, anátomo-patológicos (índice mitótico, e do índice de imunoproliferação celular (ki-67 clone MIB-1. Os resultados mostraram significativa ocorrência em indivíduos na 5ª década de vida, brancos, na glândula parótida, ao mesmo tempo que não demostrou diferença estatística em relação ao critério gênero. O índice mitótico e o índice de imunoproliferação celular (Ki-67, apresentaram-se estatisticamente significativos (pINTRODUCTION: To establish the relation between the biologic behaviour and the prognosis of the undifferentatiated carcinoma of major salivary glands. OBJECTIVE: Identification of clinical histological, imunohistochemical parameters and its influence on the prognosis. STUDY DESIGN: Specimens analysis through histological and imunoihistochemical procedures. MATERIAL AND METHOD: Eleven

  2. Environmental Public Health Surveillance for Exposure to Respiratory Health Hazards: A Joint NASA/CDC Project to Use Remote Sensing Data for Estimating Airborne Particulate Matter Over the Atlanta, Georgia Metropolitan Area

    Science.gov (United States)

    Quattrochi, Dale A.; Al-Hamdan, Mohammad; Estes, Maurice; Crosson, William

    2007-01-01

    As part of the National Environmental Public Health Tracking Network (EPHTN) the National Center for Environmental Health (NCEH) at the Centers for Disease Control and Prevention (CDC) is leading a project called Health and Environment Linked for Information Exchange (HELiX-Atlanta). The goal of developing the National Environmental Public Health Tracking Network is to improve the health of communities. Currently, few systems exist at the state or national level to concurrently track many of the exposures and health effects that might be associated with environmental hazards. An additional challenge is estimating exposure to environmental hazards such as particulate matter whose aerodynamic diameter is less than or equal to 2.5 micrometers (PM2.5). HELIX-Atlanta's goal is to examine the feasibility of building an integrated electronic health and environmental data network in five counties of Metropolitan Atlanta, GA. NASA Marshall Space Flight Center (NASA/MSFC) is collaborating with CDC to combine NASA earth science satellite observations related to air quality and environmental monitoring data to model surface estimates of PM2.5 concentrations that can be linked with clinic visits for asthma. While use of the Air Quality System (AQS) PM2.5 data alone could meet HELIX-Atlanta specifications, there are only five AQS sites in the Atlanta area, thus the spatial coverage is not ideal. We are using NASA Moderate Resolution Imaging Spectroradiometer (MODIS) satellite Aerosol Optical Depth (AOD) data for estimating daily ground level PM2.5 at 10 km resolution over the metropolitan Atlanta area supplementing the AQS ground observations and filling their spatial and temporal gaps.

  3. Carcinoma espinocelular de gengiva: análise das imagens de sete casos

    Directory of Open Access Journals (Sweden)

    Souza Ricardo Pires de

    2003-01-01

    Full Text Available Os autores estudaram sete casos de carcinoma de gengiva atendidos no Serviço de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia e no Serviço de Diagnóstico por Imagem do Complexo Hospitalar Heliópolis, São Paulo, SP, entre 1985 e 1996. Todos os casos eram carcinomas do tipo espinocelular. Os sete pacientes eram do sexo masculino (100%, com idade variando entre 48 e 72 anos (média de 57 anos. Exame de tomografia computadorizada foi realizado em seis (85,6% dos sete pacientes. Quatro pacientes (57,1% eram não tratados na ocasião do exame de imagem e três pacientes (42,8% já tinham tido algum tipo de tratamento (cirurgia ou radioterapia. Além disso, os autores analisaram o local primário e as extensões locais para a mandíbula (5/7 casos; 71,4%, para o soalho da boca (3/7 casos; 42,8%, para o soalho do seio maxilar (1/7 casos; 14,2% e para o trígono retromolar (1/7 casos; 14,2%. Linfonodos metastáticos foram observados em cinco pacientes (71,4%. Biópsia e exame histopatológico confirmaram todos os casos. Confrontação com achados cirúrgicos foi possível em cinco casos (71,4%.

  4. Sleep Quality and Academic Progression among Students of Tabriz University of Medical Sciences, Northwest of Iran

    Directory of Open Access Journals (Sweden)

    Horyeh Sarbazvatan

    2017-06-01

    Full Text Available Background: Sleep deprivation and drowsiness are very common among university students. The aim of this study was to examine the sleep quality and academic achievement among university students across all medical disciplines in Northwest of Iran. Methods: This study was based on data from a longitudinal study, the "Health and Lifestyle of University Students" (HeLiS. The Pittsburgh Sleep Quality Index (PSQI, a self-administered questionnaire consisting of general information about sleep quality, was completed by students during the first eight weeks of the first semester and academic achievement was assessed via Grade Point Average (GPA in the two semesters following the administration of the PSQI. Results: The mean age of students was 19.16±1.04 and the majority were female (64%. The mean overall score on the PSQI was 6.87±2.25; the majority of students (70% had a global PSQI score greater than 5, indicating they were poor sleepers. Only 28% reported getting over 7 hours of sleep. Female students had higher scores than male students in subjective sleep quality, which was statistically significant (2.15 vs. 1.95 respectively, P = 0.01; however, there was no difference between males and females on other component scores or on the global score. Results of a multiple regression model showed that PSQI score was a predictor of academic achievement (β=-.07, P=0.035, which implies that GPA will be lower among students whose quality of sleep is lower. Conclusion: Based on our sleep quality should be considered and assessed, and sleep hygiene should be promoted among medical university students in order to improve academic achievement.

  5. Elizandra Souza: escrita periférica em diálogo transatlântico

    Directory of Open Access Journals (Sweden)

    Sílvia Regina Lorenso Castro

    2016-01-01

    Full Text Available En este artículo, se discuten las conexiones entre la vida y la obra de Elizandra de Souza, escritora asociada con la producción literaria de la periferia de São Paulo, en el contexto de las discusiones teóricas sobre la diáspora africana, el pensamiento feminista negro y el pensamiento decolonial latinoamericano. Argumento que Elizandra toma como punto de partida una formación identitataria espiralada/sampleada que atraviesa y expande las páginas del libro en su materialidad impresa con la intención de construir un puente entre la música (hip hop, la literatura (Punga e Águas da cabaça y la tecnología (la Radio Comunitaria de Heliópolis. De este modo, Elizandra establece una presencia política que borronea e impugna la percepción que la sociedad tiene respecto a los habitantes de la periferia como sujetos definidos por la falta. Sostengo además que no es posible entender la obra de Elizandra o la actual periferia brasileña si no se toman en cuenta una multiplicidad de elementos, tales como: los mecanismos alternativos de comunicación comunitaria, la cultura hip hop y los saraus. Mi argumento final es que su libro Águas da cabaça desafía una centralidad masculina que se ha tornado predominante en las narrativas sobre la periferia, mientras que señala una alianza transatlántica con otras escritoras de la diáspora africana.

  6. True single-molecule DNA sequencing of a pleistocene horse bone

    Science.gov (United States)

    Orlando, Ludovic; Ginolhac, Aurelien; Raghavan, Maanasa; Vilstrup, Julia; Rasmussen, Morten; Magnussen, Kim; Steinmann, Kathleen E.; Kapranov, Philipp; Thompson, John F.; Zazula, Grant; Froese, Duane; Moltke, Ida; Shapiro, Beth; Hofreiter, Michael; Al-Rasheid, Khaled A.S.; Gilbert, M. Thomas P.; Willerslev, Eske

    2011-01-01

    Second-generation sequencing platforms have revolutionized the field of ancient DNA, opening access to complete genomes of past individuals and extinct species. However, these platforms are dependent on library construction and amplification steps that may result in sequences that do not reflect the original DNA template composition. This is particularly true for ancient DNA, where templates have undergone extensive damage post-mortem. Here, we report the results of the first “true single molecule sequencing” of ancient DNA. We generated 115.9 Mb and 76.9 Mb of DNA sequences from a permafrost-preserved Pleistocene horse bone using the Helicos HeliScope and Illumina GAIIx platforms, respectively. We find that the percentage of endogenous DNA sequences derived from the horse is higher among the Helicos data than Illumina data. This result indicates that the molecular biology tools used to generate sequencing libraries of ancient DNA molecules, as required for second-generation sequencing, introduce biases into the data that reduce the efficiency of the sequencing process and limit our ability to fully explore the molecular complexity of ancient DNA extracts. We demonstrate that simple modifications to the standard Helicos DNA template preparation protocol further increase the proportion of horse DNA for this sample by threefold. Comparison of Helicos-specific biases and sequence errors in modern DNA with those in ancient DNA also reveals extensive cytosine deamination damage at the 3′ ends of ancient templates, indicating the presence of 3′-sequence overhangs. Our results suggest that paleogenomes could be sequenced in an unprecedented manner by combining current second- and third-generation sequencing approaches. PMID:21803858

  7. Properties and decay modes of hot nuclei produced in the reaction: {sup 36}Ar on {sup 58}Ni and detected with INDRA device; Proprietes et modes de desexcitation des noyaux chauds observes dans la reaction {sup 36}Ar sur {sup 58}Ni avec le detecteur INDRA

    Energy Technology Data Exchange (ETDEWEB)

    Nalpas, L. [CEA Centre d`Etudes de Saclay, 91 - Gif-sur-Yvette (France). Dept. d`Astrophysique, de la Physique des Particules, de la Physique Nucleaire et de l`Instrumentation Associee]|[Paris-11 Univ., 91 - Orsay (France)

    1997-01-01

    Hot nuclei are formed in heavy ion collisions covering the Fermi energy domain. According to the excitation energy deposited into these nuclei, several de-excitation processes can be observed, in particular the emission of complex fragments (Z {>=} 3) which remains poorly understood. The GANIL facility offers the possibility to cover the excitation function for the Ar on Ni reaction over a broad energy range from 32 to 95 MeV/u where the hot nuclei evolve from classical `evaporation` to complete `vaporization` into light particles (neutrons, isotopes of H, He). The study of reaction mechanisms shows that from peripheral to central collisions the total cross section is dominated by binary dissipative collisions. Both partners coming from well-characterized events with the INDRA detector are reconstructed using the `Minimum Spanning Tree` method. Thus excitation energy up to 20 MeV/A are reached in the most violent collisions at the highest bombarding energy. The deposited energy is not shared in the mass ratio between the quasi-projectile and the quasi-target, the quasi-projectile being hotter. For total excitation energies ranging roughly from 2 to 8 MeV/A, the proportion of `multifragmentation` events increases to reach a plateau at about 10 MeV/A due to the rising probability to have complete `vaporization` of the system above 8 MeV/A. The steady increase of the temperature extracted from the double isotopic He-Li ratios with excitation energy for the quasi-projectile suggests a progressive evolution of the de-excitation processes as predicted by statistical models. No signal of first order liquid-gas phase transition is seen in our data. (author) 124 refs.

  8. THE USE OF CORRELATION ANALYSIS OF TWO-DIMENSION STOCHASTIC PROCESS FOR HELICOPTER MAINTENANCE WORKABILITY ESTIMATION

    Directory of Open Access Journals (Sweden)

    Yuriy Michaylovich Chinyuchin

    2017-01-01

    Full Text Available The new calculated program complex which main task is to find the optimal algorithm of stochastic helicopter de- sign and assembling in terms of maintenance efficiency is described. It is shown that the use of the developed calculated program complex allows to efficiently solve the problems of helicopter construction with high-rating maintenance worka- bility factors.It is shown that for efficient problem solving connected with Maintenance and Repair costs reduction while heli- copter engineering and assembling in design office it is appropriate to use correlated analysis for maintenance workability estimation with the use of CAD system. The calculated program complex is based on mathematical apparatus of linear cor-related dependence of two-dimension (stochastic process. The linear correlated dependence is considered as linear or anyconnection close to it between two variables for which the correlated analysis theorem is true.The algorithm of calculated program complex for helicopter maintenance workability estimation consists of five steps: choice of equipment that needs to be installed on the helicopter; correlation coefficient calculation for helicopters having this equipment and revealing of optimal variants of location; zone partition of the developed helicopter and analysis of possi- ble disposal of clusters in optimal order; disposal of clusters on the designed helicopter; correlation coefficient calculation, direct regression construction for the designed helicopter and comparison of these readings with helicopters-analogues. The calculation data of correlated analysis characteristics which indicate a possibility of increase of helicopter maintenance worka- bility level with a modicum of effort and time when working out the particular functional system is given.

  9. Efecto de la tala de Podocarpus glomeratus (Podocarpaceae sobre la estructura de un bosque de neblina en los Andes (Cochabamba, Bolivia

    Directory of Open Access Journals (Sweden)

    Ariel Isaías Ayma-Romay

    2011-07-01

    Full Text Available En el presente trabajo fueron analizados los efectos de la tala sobre la estructura, composición y la regeneración natural de un bosque andino de neblina. Se instalaron 40 parcelas de 707 m2 para medir individuos >10 cm DAP y sub-parcelas de 5 m2 para evaluar la regeneración de individuos <10 cm DAP y de 1 m2 para evaluar el banco de semillas. Se evaluó la densidad y cobertura de todos los árboles. Se realizó un análisis cluster para establecer las categorías de cobertura de dosel y un análisis de componentes principales para determinar su asociación con la densidad de diferentes especies de plántulas. La tala ha modificado la cobertura (p= <0,001 generando doseles de poco a fuertemente intervenidos. Los claros de dosel favorecen a las heliófitas (Myrsine pseudocrenata, Vallea stipularis, Nectandra sp., Trichilia hirta, Miconia theaezans, algunas esciófitas que requieren luz en clases avanzadas (Podocarpus glomeratus y Myrcianthes osteomeloides y otros arbustos (Solanaceae, Verbenaceae y otras. Por otra parte, algunas esciófitas reducen su densidad en doseles inter- venidos (Weinmannia microphylla, Condalia weberbaueri, Blepharocalix salicifolius y Styloceras columnare. El manejo del bosque debe mantener la cobertura de individuos > 60 cm DAP, la creación de reservas en bosques maduros y prácticas de facilitación para el crecimiento de especies de árboles claves.

  10. Conduta conservadora no carcinoma papilífero da glândula tireóide

    Directory of Open Access Journals (Sweden)

    Josias de Andrade Sobrinho

    Full Text Available OBJETIVO: Avaliar os resultados do tratamento do carcinoma papilífero limitado a um lobo da glândula tireóide, através de tireoidectomia parcial com seguimento superior a cinco anos. MÉTODO: Estudo retrospectivo de 105 prontuários de pacientes portadores de carcinoma diferenciado da glândula tireóidea operados no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo de 1977 a 1997 e selecionados 31 casos que apresentavam nódulos limitados a um lobo da glândula com seguimento superior a cinco anos e submetidos à lobectomia total mais istmectomia. RESULTADOS: Observamos somente um caso (3% de disfonia transitória com paresia de prega vocal unilateral que regrediu espontaneamente. Não houve casos de hipoparatireoidismo transitório ou definitivo. O seguimento médio foi de 12,6 anos, sendo todos com seguimento superior a cinco anos; 10 casos (32% com seguimento entre 10 e 15 anos e 10 casos (32% com seguimento além de 15 anos. Não foram observados casos com recorrência loco-regional ou metástase à distância, estando todos eles assintomáticos e sem doença. CONCLUSÃO: Nesta série, a tireoidectomia parcial para carcinoma papilífero limitado a um lobo, mostrou-se eficaz.

  11. a New Multi-Resolution Algorithm to Store and Transmit Compressed DTM

    Science.gov (United States)

    Biagi, L.; Brovelli, M.; Zamboni, G.

    2012-07-01

    WebGIS and virtual globes allow DTMs distribution and three dimensional representations to the Web users' community. In these applications, the database storage size represents a critical point. DTMs are obtained by some sampling or interpolation on the raw observations and typically are stored and distributed by data based models, like for example regular grids. A new approach to store and transmit DTMs is presented. The idea is to use multi-resolution bilinear spline functions to interpolate the observations and to model the terrain. More in detail, the algorithm performs the following actions. 1) The spatial distribution of the observations is investigated. Where few data are available, few levels of splines are activated while more levels are activated where the raw observations are denser: each new level corresponds to an halving of the spline support with respect to the previous level. 2) After the selection of the spline functions to be activated, the relevant coefficients are estimated by interpolating the observations. The interpolation is computed by batch least squares. 3) Finally, the estimated coefficients of the splines are stored. The model guarantees a local resolution consistent with the data density and can be defined analytical, because the coefficients of a given function are stored instead of a set of heights. The approach is discussed and compared with the traditional techniques to interpolate, store and transmit DTMs, considering accuracy and storage requirements. It is also compared with another multi-resolution technique. The research has been funded by the INTERREG HELI-DEM (Helvetia Italy Digital Elevation Model) project.

  12. Nutrient density of prestarter diets from one to ten days of age affects intestinal morphometry, enzyme activity, serum indices and performance of broiler chickens

    Directory of Open Access Journals (Sweden)

    Ficinine V. Ivanovich

    2017-09-01

    Full Text Available A total of 480 day-old Cobb 500 broilers were used to investigate the effects of different levels of digestible amino acids (DAA; 100%, 107% and 114% of Cobb recommendations and ME (3,000 or 2,900 kcal/kg of prestarter diet on mixed sex broilers performance, enzyme activity, small intestine morphology, and serum metabolites. Broilers were randomly allotted to 6 treatments, where each treatment applied to 4 pens with 20 birds in each. The birds were subjected to their respective treatment diets from 1 to 10 days of age. This was followed by feeding common starter and finisher diets for the last 29 days. The enzyme activity of the pancreas was measured at 10 days of age. Morphometric indexes of jejunum were measured at 10 days of age and the end of the feeding period. Our results showed that the body weight (BW increased as the DAA density of the prestarter diet increased from 100% to 114% over the first 10 days and the entire period of the study. Birds fed 114% DAA presented a better feed conversion ratio on day 10 (P  0.05; however, the activity of pancreatic protease increased as the DAA level increased from 100% to 114% (P < 0.05. The villus width and villus surface area (VSA increased as the DAA level increased from 100% to 114% on day 10 (P < 0.05. At 10 days of age, crypt depth was the lowest in the birds fed plenty DAA prestarter diets (P < 0.05. It was found that dietary treatments at 39 days of age did not affect intestinal morphology. The results of the present work indicate that DAA level of 114% of Cobb recommendations and energy level of 2,900 kcal/kg diet may be recommended for starting broiler chicks.

  13. Towards a New Linguistic Model for Detecting Political Lies

    Directory of Open Access Journals (Sweden)

    Амр М Эль-Завави

    2017-12-01

    Full Text Available The present study addresses the problem of how the two US presidential candidates Donald Trump and Hillary Clinton use statements judged to be false by the Politifact site while delivering their campaign speeches. Two corpora of Clinton’s and Trump’s alleged lies were compiled. Each corpus contained 16 statements judged to be false or ridiculously untrue (‘pants on fire’ by the Pulitzer Prize Winner site Politifact. Some statements were accompanied by the video recordings where they appeared; others had no video recordings affiliated because they are either tweets or their events had not been recorded on Youtube or elsewhere. The present research made use of CBCA (Criteria-based Content Analysis but as a stepping stone for building a new model of detecting lies in political discourse to suit the characteristics of campaign discourse. This furnished the qualitative dimension of the research. As for the quantitative dimension, data were analyzed using software, namely LIWC (Linguistic Inquiry & Word Count, and also focused on the content analysis of the deception cues that can be matched with the results obtained from computerized findings. When VSA (Voice Stress Analysis was required, Praat was used. Statistical analyses were occasionally applied to reach highly accurate results. The study concluded that the New Model (NM is not context-sensitive, being a quantitative one, and is thus numerically oriented in its decisions. Moreover, when qualitative analysis intervenes, especially in examining Politifact rulings, context plays a crucial role in passing judgements on deceptive vs. non-deceptive discourse.

  14. On simulating non-point source pollution with a fully coupled model in the agricultural watershed

    Science.gov (United States)

    Xiang, L.; Yu, Z.; Chen, L.

    2012-04-01

    The non-point source pollution is a major threat for water security in agricultural watersheds. The physically-based coupled hydrologic model is used in this study to examine the hydrologic and solute (N, P) budget for the Meilin watershed, east China with an area of 0.737km2, and to evaluate the solute (N, P) transport along various pathways at a watershed scale. With the past and ongoing field studies, different factors (i.e., soil texture, land-use/land-cover, and micro-topography) affecting hydrologic processes were observed and estimated. Based on those analyses, the model calibration was conducted by using a multi-objective approach while the objectives include streamflow, soil moisture, groundwater level, solute concentration, etc. Numerical experiments were designed to elucidate the dynamics of watershed hydrologic processes as well as the interactive relationship on variables in land surface, unsaturated zone, and groundwater. Several scenes of storm events were simulated to further discuss the water budget and non-source pollution drainage responding to land-use, micro-topography variety and surface/subsurface interaction processes. Arising from the simulations, the observed and calculated subsurface hydraulic heads, base flow discharge and the spatial and temporal patterns of the surface drainage network are quantified. The soil texture, land cover, and topography affecting different hydrologic processes and their inter-relationship are demonstrated. The overflow of various saturate areas (VSA) contributing to the stream flow, exchange fluxes between surface and subsurface hydrologic regimes and solute drainage responding different land-use are quantified. This work will help better understand physically-coupled flow and solute transport in the watershed and enhance the quality of watershed flow and solute simulations.

  15. Metalloprotease Vsm Is the Major Determinant of Toxicity for Extracellular Products of Vibrio splendidus▿ †

    Science.gov (United States)

    Binesse, Johan; Delsert, Claude; Saulnier, Denis; Champomier-Vergès, Marie-Christine; Zagorec, Monique; Munier-Lehmann, Hélène; Mazel, Didier; Le Roux, Frédérique

    2008-01-01

    Genomic data combined with reverse genetic approaches have contributed to the characterization of major virulence factors of Vibrio species; however, these studies have targeted primarily human pathogens. Here, we investigate virulence factors in the oyster pathogen Vibrio splendidus LGP32 and show that toxicity is correlated to the presence of a metalloprotease and its corresponding vsm gene. Comparative genomics showed that an avirulent strain closely related to LGP32 lacked the metalloprotease. The toxicity of LGP32 metalloprotease was confirmed by exposing mollusk and mouse fibroblastic cell lines to extracellular products (ECPs) of the wild type (wt) and a vsm deletion mutant (Δvsm mutant). The ECPs of the wt induced a strong cytopathic effect whose severity was cell type dependent, while those of the Δvsm mutant were much less toxic, and exposure to purified protein demonstrated the direct toxicity of the Vsm metalloprotease. Finally, to investigate Vsm molecular targets, a proteomic analysis of the ECPs of both LGP32 and the Δvsm mutant was performed, revealing a number of differentially expressed and/or processed proteins. One of these, the VSA1062 metalloprotease, was found to have significant identity to the immune inhibitor A precursor, a virulence factor of Bacillus thuringiensis. Deletion mutants corresponding to several of the major proteins were constructed by allelic exchange, and the ECPs of these mutants proved to be toxic to both cell cultures and animals. Taken together, these data demonstrate that Vsm is the major toxicity factor in the ECPs of V. splendidus. PMID:18836018

  16. Structural Investigation for Optimization of Anthranilic Acid Derivatives as Partial FXR Agonists by in Silico Approaches

    Directory of Open Access Journals (Sweden)

    Meimei Chen

    2016-04-01

    Full Text Available In this paper, a three level in silico approach was applied to investigate some important structural and physicochemical aspects of a series of anthranilic acid derivatives (AAD newly identified as potent partial farnesoid X receptor (FXR agonists. Initially, both two and three-dimensional quantitative structure activity relationship (2D- and 3D-QSAR studies were performed based on such AAD by a stepwise technology combined with multiple linear regression and comparative molecular field analysis. The obtained 2D-QSAR model gave a high predictive ability (R2train = 0.935, R2test = 0.902, Q2LOO = 0.899. It also uncovered that number of rotatable single bonds (b_rotN, relative negative partial charges (RPC−, oprea's lead-like (opr_leadlike, subdivided van der Waal’s surface area (SlogP_VSA2 and accessible surface area (ASA were important features in defining activity. Additionally, the derived3D-QSAR model presented a higher predictive ability (R2train = 0.944, R2test = 0.892, Q2LOO = 0.802. Meanwhile, the derived contour maps from the 3D-QSAR model revealed the significant structural features (steric and electronic effects required for improving FXR agonist activity. Finally, nine newly designed AAD with higher predicted EC50 values than the known template compound were docked into the FXR active site. The excellent molecular binding patterns of these molecules also suggested that they can be robust and potent partial FXR agonists in agreement with the QSAR results. Overall, these derived models may help to identify and design novel AAD with better FXR agonist activity.

  17. Different Age Groups’ Response To Employment Equity Practices

    Directory of Open Access Journals (Sweden)

    Ashley Walbrugh

    2003-11-01

    Full Text Available The focus of this article is on response differences with regard to employment equity practices within nine South African companies from different industries, as well as whether the Employment Equity Questionnaire is a reliable tool for measuring employment equity practices. A convenience sample of 4729 participants in the field survey provided the secondary data for this study. The Employment Equity Questionnaire yielded a high Alpha coefficient of 0,96. The main findings were that differences in responses between age categories do exist, but only a small percentage of the variance could be ascribed to differences in employment equity practices. In addition to this, the South African companies show the same trends, with regard to age discrimination, as other countries like the United States and Britain. This finding could therefore serve as a lead indicator for proactive measures – to ensure that the same mistakes from other countries are not repeated here. OpsommingDie fokus van hierdie artikel is op responsverskille met betrekking tot gelyke werkgeleentheidpraktyke binne nege Suid-Afrikaanse maatskappye in verskeie industrieë en ook of die Employment Equity Questionnaire ’n betroubare instrument is om gelyke werkgeleentheidpraktyke te meet. ’n Geleentheidsteekproef van 4729 deelnemers in die veldopname het die sekondêre data vir hierdie studie voorsien. Die Employment Equity Questionnaire het ’n hoë Alfakoëffisiënt van 0,96 opgelewer. Die hoofbevindinge is dat daar verskille in response tussen ouderdomsgroepe bestaan, maar dat slegs ’n klein proporsie van die variansie aan verskille in gelyke werkgeleenthede toegeskryf kan word. In aansluiting hiermee, wys Suid-Afrikaanse maatkappye dieselfde tendens met betrekking tot ouderdomsdiskriminasie as ander lande soos die VSA en Brittanje. Hierdie bevinding moet as ’n kernaanwyser vir proaktiewe maatstawwe beskou word – sodat dieselfde foute van ander lande nie hier herhaal word

  18. BEST PRACTICES IN NEW PRODUCT DEVELOPMENT: THE ZYRAY WIRELESS CASE STUDY

    Directory of Open Access Journals (Sweden)

    P. Koekemoer

    2012-01-01

    Full Text Available

    ENGLISH ABSTRACT: Successful high-tech start-up companies are rare. This case study investigates the New Product Development (NPD process of Zyray Wireless, a very successful startup 3G technology company that originated in South Africa but relocated to California in the USA. The research looked into the differences between generally accepted NPD best practices and those implemented by this start-up company. Zyray Wireless scored above the industry average in the following categories: customer involvement, project selection, product strategy, technological leadership, and product goal. The best practices for metrics, human resource development, documentation, and change control implemented by Zyray Wireless scored at or below the industry average. The best practice results showed that this very successful start-up company focused more on strategy and engineering and less on process control than average.

    AFRIKAANSE OPSOMMING: Suksesvolle nuwe hoë-tegnologie maatskappye is skaars. Hierdie gevallestudie het die Nuwe Produk Ontwikkelingproses (NPO ondersoek van Zyray Wireless, ʼn baie suksesvolle nuwe maatskappy wat in Suid-Afrika ontstaan het maar na Kalifornië in die VSA verskuif is. Die navorsing het na die verskille gekyk tussen algemeen aanvaarde NPO beste praktyke en dié wat deur hierdie maatskappy geïmplementeer is. Zyray Wireless het bo die industriegemiddelde gepresteer in die volgende kategorieë: kliëntbetrokkenheid, projekkeuse, produkstrategie, tegnologiese leierskap, en produkdoelwitte. Die beste praktyke vir maatstawwe, menslike hulpbronontwikkeling, dokumentasie, en veranderingsbeheer wat deur Zyray Wireless geïmplementeer is, het onder die industriegemiddeldes gepresteer. Die beste praktykresultate het getoon dat hierdie baie suksesvolle nuwe maatskappy meer gefokus het op strategie en ingenieurswese en minder op prosesbeheer as die gemiddelde.

  19. Emergence of Klebsiella variicola positive for NDM-9, a variant of New Delhi metallo-β-lactamase, in an urban river in South Korea.

    Science.gov (United States)

    Di, Doris Y W; Jang, Jeonghwan; Unno, Tatsuya; Hur, Hor-Gil

    2017-04-01

    To examine the presence of pathogenic bacteria carrying New Delhi metallo-β-lactamase in the environment and to characterize the genome structures of these strains. Phenotypic screening of antimicrobial susceptibility and WGS were conducted on three Klebsiella variicola strains possessing NDM-9 isolated from an urban river. Three carbapenem-resistant K. variicola isolated from Gwangju tributary were found to possess bla NDM-9 genes. Antimicrobial susceptibility testing indicated resistance of these strains to aminoglycosides, carbapenems, cephems, folate pathway inhibitors, fosfomycin and penicillins, but susceptibility to fluoroquinolones, phenicols, tetracyclines and miscellaneous agents. WGS revealed that the 108 kb IncFII(Y)-like plasmids carry bla NDM-9 sandwiched between IS 15 for the GJ1 strain, IS 26 for the GJ2 strain, IS 15D1 for the GJ3 strain and IS Vsa3 , and further bracketed by IS 26 and Tn AS3 along with the mercury resistance operon upstream and the class 1 integron composed of gene cassettes of aadA2 , dfrA12 and sul1 downstream. An aph(3')-Ia gene conferring resistance to aminoglycosides is located after the integrons. Chromosomally encoded bla LEN-13 , fosA , aqxA and oqxB genes, as well as plasmid-mediated bla TEM-1B and bla CTX-M-65 encoding ESBL, ant(3')-Ia and mph (A) genes, were also identified. The findings of the present study provide us with the information that NDM-9 has been spreading into the environment. Dissemination of NDM-9 in the environment has raised a health risk alarm as this variant of NDM carries MDR genes with highly transferable mobile genetic elements, increasing the possibility of resistance gene transfer among microorganisms in the environment.

  20. Calcite/aragonite-biocoated artificial coral reefs for marine parks

    Directory of Open Access Journals (Sweden)

    Volodymyr Ivanov

    2017-08-01

    Full Text Available Natural formation of the coral reefs is complicated by slow biomediated precipitation of calcium carbonate from seawater. Therefore, manufactured artificial coral reefs can be used for the formation of “underwater gardens” in marine parks for the recreational fishing and diving that will protect natural coral reefs from negative anthropogenic effects. Additionally, the coating of the concrete, plastic or wooden surfaces of artificial coral reef with calcium carbonate layer could promote attachment and growth of coral larvae and photosynthetic epibiota on these surfaces. Three methods of biotechnological coating of the artificial coral reefs have been tested: (1 microbially induced calcium carbonate precipitation from concentrated calcium chloride solution using live bacterial culture of Bacillus sp. VS1 or dead but urease-active cells of Yaniella sp. VS8; (2 precipitation from calcium bicarbonate solution; (3 precipitation using aerobic oxidation of calcium acetate by bacteria Bacillus ginsengi strain VSA1. The thickness of biotechnologically produced calcium carbonate coating layer was from 0.3 to 3 mm. Biocoating using calcium salt and urea produced calcite in fresh water and aragonite in seawater. The calcium carbonate-coated surfaces were colonized in aquarium with seawater and hard corals as inoculum or in aquarium with fresh water using cyanobacteria Chlorella sorokiana as inoculum. The biofilm on the light-exposed side of calcium carbonate-coated surfaces was formed after six weeks of incubation and developed up to the average thickness of 250 µm in seawater and about 150 µm in fresh water after six weeks of incubation. The biotechnological manufacturing of calcium carbonate-coated concrete, plastic, or wooden surfaces of the structures imitating natural coral reef is technologically feasible. It could be commercially attractive solution for the introduction of aesthetically pleasant artificial coral reefs in marine parks and

  1. Testing the Runoff Tool in Sicilian vineyards: adopting best management practices to prevent agricultural surface runoff

    Science.gov (United States)

    Singh, Manpriet; Dyson, Jeremy; Capri, Ettore

    2016-04-01

    Over the last decades rainfall has become more intense in Sicily, making large proportions of steeply sloping agricultural land more vulnerable to soil erosion, mainly orchards and vineyards (Diodato and Bellocchi 2010). The prevention of soil degradation is indirectly addressed in the European Union's Water Framework Directive (2000/60/EC) and Sustainable Use Directive (2009/128/EC). As a consequence, new EU compliance conditions for food producers requires them to have tools and solutions for on-farm implementation of sustainable practices (Singh et al. 2014). The Agricultural Runoff and Best Management Practice Tool has been developed by Syngenta to help farm advisers and managers diagnose the runoff potential from fields with visible signs of soil erosion. The tool consists of 4 steps including the assessment of three key landscape factors (slope, topsoil permeability and depth to restrictive horizon) and 9 mainly soil and crop management factors influencing the runoff potential. Based on the runoff potential score (ranging from 0 to 10), which is linked to a runoff potential class, the Runoff Tool uses in-field and edge-of-the-field Best Management Practices (BMPs) to mitigate runoff (aligned with advice from ECPA's TOPPS-prowadis project). The Runoff tool needs testing in different regions and crops to create a number of use scenarios with regional/crop specific advice on BMPs. For this purpose the Tool has been tested in vineyards of the Tasca d'Almerita and Planeta wineries, which are large family-owned estates with long-standing tradition in viticulture in Sicily. In addition to runoff potential scores, Visual Soil Assessment (VSA) scores have been calculated to allow for a comparison between different diagnostic tools. VSA allows for immediate diagnosis of soil quality (a higher score means a better soil quality) including many indicators of runoff (Shepherd 2008). Runoff potentials were moderate to high in all tested fields. Slopes were classified as

  2. In the Light of the Midnight Sun

    Directory of Open Access Journals (Sweden)

    Heli Ruokamu

    2015-11-01

    Full Text Available Media Education Conference (MEC 2015 “In the Light of the Midnight Sun” was organized in Sallatunturi, Finland in 15-17 of June 2015. Selected papers submitted by the conference participants are published in this special issue of seminar.net.MEC (former NBE is an informal and friendly conference which participants attend to exchange ideas and information dealing with media education, educational use of ICTs and learning environments. MEC is organized by the Centre for Media Pedagogy at the University of Lapland.Themes and topics of the sixth MEC conference were as follows: Playful and Game-based Learning; Media and Code Literacies; Empowerment through Media; Media and ICT in Teaching and Learning; Digital Story Telling; 3D, Virtual and Simulation-based Learning; and Internet and Social Media in Everyday Life.In the first article, Tuulikki Keskitalo and Heli Ruokamo of the University of Lapland present “A model for simulation-based learning in healthcare”. Simulations and virtual reality do have a major focus in current healthcare education. The authors designed the study in order to fill a gap about our knowledge the pedagogical models that underpin the present activities. They studied several cases involving facilitators and students, in order to find out when and how simulations should and could be used for the benefit of the students and their learning. They describe how a refined pedagogical was developed, a model that will provide a more holistic and meaningful approach to teaching and learning in health care.The second article is written by a group pf researchers from the university of Eastern Finland, Teemu Valtonen, Erkko T. Sointu and Jari Kukkonen of the department situated in Joensuu, while Kati Mäkitalo-Siegl is based in Savonlinna. The title of their paper is “Developing a TPACK measurement instrument for 21st century pre-service teachers”. The investigate how terms, such as “Future skills”, “21st century skills

  3. Factors associated with pastoral community knowledge and occurrence of mycobacterial infections in Human-Animal Interface areas of Nakasongola and Mubende districts, Uganda

    Directory of Open Access Journals (Sweden)

    Biffa Demelash

    2010-08-01

    Full Text Available Abstract Background Nontuberculous mycobacteria (NTM are emerging opportunistic pathogens whose role in human and animal disease is increasingly being recognized. Major concerns are their role as opportunistic pathogens in HIV/AIDS infections. The role of open natural water sources as source and livestock/wildlife as reservoirs of infections to man are well documented. This presents a health challenge to the pastoral systems in Africa that rely mostly on open natural water sources to meet livestock and human needs. Recent study in the pastoral areas of Uganda showed infections with same genotypes of NTM in pastoralists and their livestock. The aim of this study was to determine the environmental, animal husbandry and socio-demographic factors associated with occurrence and the pastoral community knowledge of mycobacterial infections at the human-environment-livestock/wildlife interface (HELI areas in pastoral ecosystems of Uganda. Methods Two hundred and fifty three (253 individuals were subjected to a questionnaire survey across the study districts of Nakasongola and Mubende. Data were analyzed using descriptive statistics and multivariable logistic regression analysis. Results Humans sharing of the water sources with wild animals from the forest compared to savannah ecosystem (OR = 3.3, the tribe of herding pastoral community (OR = 7.9, number of rooms present in household (3-5 vs. 1-2 rooms (OR = 3.3 were the socio-demographic factors that influenced the level of knowledge on mycobacterial infections among the pastoral communities. Tribe (OR = 6.4, use of spring vs. stream water for domestic use (OR = 4.5, presence of sediments in household water receptacle (OR = 2.32, non separation of water containers for drinking and domestic use (OR = 2.46, sharing of drinking water sources with wild animals (OR = 2.1, duration of involvement of >5 yrs in cattle keeping (OR = 3.7 and distance of household to animal night shelters (>20 meters (OR = 3

  4. Estudo de variáveis demográficas, ocupacionais e co-carcinogenéticas no carcinoma espinocelular da base de língua nas mulheres

    Directory of Open Access Journals (Sweden)

    Amorim Filho Francisco S.

    2003-01-01

    Full Text Available Avaliar a relação entre carcinógenos e o carcinoma espinocelular no sexo feminino. FORMA DE ESTUDO: Retrospectivo não randomizado. OBJETIVO: Determinar a relação entre carcinógenos (álcool e fumo e o carcinoma espinocelular no sexo feminino na base da língua. MATERIAL E MÉTODOS: Estudo retrospectivo de 31 pacientes do sexo feminino realizado no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo (1977 a 2000. Foram analisados variáveis como etnia, idade, profissão, tabagismo, etilismo, queixa principal, o intervalo de tempo entre o início da queixa e a procura do médico e o estadiamento clínico. Quanto ao tratamento estatístico, foram utilizados os Testes de Kappa e o de Mc Nemar. RESULTADOS: Houve predomínio da raça branca (58,1% sobre a negra (35,5% e a amarela (6,4%, bem como da 6feminine décadade vida; sendo profissionais do lar (83,9% trabalhadoras na agricultura 6,4%. Indústria (3,2%, comércio e liberais (3,2%. Houve mais consumo isolado do tabagismo (48,4%, ambos (45,2% e nenhum (6,4%. Quanto à sintomatologia, odinofagia (48,4%, nódulo no pescoço (19,3%, disfagia (12,9%; otalgia (9,7%, ferida na língua (6,4% e rouquidão (3,2%. Quanto ao estadiamento, T3-4 (74,1%, T1-2 (25,8%, N0 (29,0%, N1(29,0%, N2-3 (42,0%. CONCLUSÕES: O carcinoma espinocelular em mulheres predominou na 6feminine década, na raça branca, tendo como principais sintomas odinofagia e linfonodo cervical metastático. Houve predomínio do tabagismo sobre o etilismo, em paciente T3-4, sendo que a maioria já portador de metástase linfonodal à 1feminine consulta.

  5. Connectivity to computers and the Internet among patients with schizophrenia spectrum disorders: a cross-sectional study

    Directory of Open Access Journals (Sweden)

    Välimäki M

    2017-04-01

    Full Text Available Maritta Välimäki,1–3 Lauri Kuosmanen,1,4,5 Heli Hätönen,1 Marita Koivunen,1,6 Anneli Pitkänen,7 Christina Athanasopoulou,1 Minna Anttila1 1Department of Nursing Science, Faculty of Medicine, University of Turku, Finland; 2Development Unit, Turku University Hospital, Turku, Finland; 3School of Nursing, Hong Kong Polytechnic University, Kowloon, Hong Kong, SAR, China; 4University of Helsinki and Helsinki University Hospital, Helsinki, Finland; 5Social and Healthcare Department, City of Vantaa, Vantaa, Finland; 6Administrative Centre, Research and Development, Satakunta Hospital District, Pori, Finland; 7Administration Centre, Pirkanmaa Hospital District, Tampere, Finland Purpose: Information and communication technologies have been developed for a variety of health care applications and user groups in the field of health care. This study examined the connectivity to computers and the Internet among patients with schizophrenia spectrum disorders (SSDs.Patients and methods: A cross-sectional survey design was used to study 311 adults with SSDs from the inpatient units of two psychiatric hospitals in Finland. The data collection lasted for 20 months and was done through patients’ medical records and a self-reported, structured questionnaire. Data analysis included descriptive statistics.Results: In total, 297 patients were included in this study (response rate =96%. More than half of them (n=156; 55% had a computer and less than half of them (n=127; 44% had the Internet at home. Of those who generally had access to computers and the Internet, more than one-fourth (n=85; 29% used computers daily, and >30% (n=96; 33% never accessed the Internet. In total, approximately one-fourth of them (n=134; 25% learned to use computers, and less than one-third of them (n=143; 31% were known to use the Internet by themselves. Older people (aged 45–65 years and those with less years of education (primary school tended not to use the computers and the

  6. Tumores malignos de cabeça e pescoço em pacientes com menos de 18 anos de idade

    Directory of Open Access Journals (Sweden)

    Marcos Brasilino de Carvalho

    Full Text Available A conduta ideal para os pacientes menores de 18 anos portadores de tumores malignos da região de cabeça e pescoço não é uniforme nos escassos relatos de literatura. Com o objetivo de mostrar e discutir a experiência no atendimento de cinqüenta casos tratados no Serviço de Cirurgia de Cabeça e Pescoço do Complexo Hospitalar Heliópolis, no período de 1978 a 1994, os autores procederam a uma análise retrospectiva de sua casuística. Os tipos histológicos mais freqüentes foram os derivados da linhagem epitelial, 24 casos (48% e, entre eles, o carcinoma mucoepidermóide. Entre os tumores derivados do tecido mensequimal, os mais freqüentes foram o rabdomiossarcoma e os linfomas. A cavidade oral foi o sítio mais freqüentemente acometido (15 casos, 30%. Entre todos os pacientes, apenas 21 (42% estavam vivos e sem evidência de doença em atividade por um período que variou de seis meses a 18 anos. Quatorze (28% pacientes morreram em decorrência de doença não controlada após um período que variou de dez dias a dois anos a contar da data do final do tratamento. De quatorze (28% pacientes não pudemos obter informações atualizadas de suas condições e foram considerados perdidos de seguimento. Estes tumores não devem ser vistos como neoplasias de adultos localizadas em pacientes pediátricos; devem ser estudados e abordados como uma doença que apresenta características próprias e que exigem, como no adulto, que a primeira intervenção para o diagnóstico ou para o tratamento não seja intempestiva e, de fato, tenha resolubilidade.

  7. Blind Geothermal System Exploration in Active Volcanic Environments; Multi-phase Geophysical and Geochemical Surveys in Overt and Subtle Volcanic Systems, Hawai’i and Maui

    Energy Technology Data Exchange (ETDEWEB)

    Fercho, Steven [Ormat Nevada, Inc., Reno, NV (United States); Owens, Lara [Ormat Nevada, Inc., Reno, NV (United States); Walsh, Patrick [Ormat Nevada, Inc., Reno, NV (United States); Drakos, Peter [Ormat Nevada, Inc., Reno, NV (United States); Martini, Brigette [Corescan Inc., Ascot (Australia); Lewicki, Jennifer L. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Kennedy, Burton M. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2015-08-01

    Suites of new geophysical and geochemical exploration surveys were conducted to provide evidence for geothermal resource at the Haleakala Southwest Rift Zone (HSWRZ) on Maui Island, Hawai’i. Ground-based gravity (~400 stations) coupled with heli-bourne magnetics (~1500 line kilometers) define both deep and shallow fractures/faults, while also delineating potentially widespread subsurface hydrothermal alteration on the lower flanks (below approximately 1800 feet a.s.l.). Multi-level, upward continuation calculations and 2-D gravity and magnetic modeling provide information on source depths, but lack of lithologic information leaves ambiguity in the estimates. Additionally, several well-defined gravity lows (possibly vent zones) lie coincident with magnetic highs suggesting the presence of dike intrusions at depth which may represent a potentially young source of heat. Soil CO2 fluxes were measured along transects across geophysically-defined faults and fractures as well as young cinder cones along the HSWRZ. This survey generally did not detect CO2 levels above background, with the exception of a weak anomalous flux signal over one young cinder cone. The general lack of observed CO2 flux signals on the HSWRZ is likely due to a combination of lower magmatic CO2 fluxes and relatively high biogenic surface CO2 fluxes which mix with the magmatic signal. Similar surveys at the Puna geothermal field on the Kilauea Lower East Rift Zone (KLERZ) also showed a lack of surface CO2 flux signals, however aqueous geochemistry indicated contribution of magmatic CO2 and He to shallow groundwater here. As magma has been intercepted in geothermal drilling at the Puna field, the lack of measured surface CO2 flux indicative of upflow of magmatic fluids here is likely due to effective “scrubbing” by high groundwater and a mature hydrothermal system. Dissolved inorganic carbon (DIC) concentrations, δ13C compositions and 3He/4He values were sampled at Maui from several shallow

  8. Breeding Distribution and Nest Site Diversity of Barn Owl (Tyto Alba in the Context of Restoration of Agricultural Sector in Central South Bulgaria

    Directory of Open Access Journals (Sweden)

    Milchev Boyan

    2014-06-01

    Full Text Available A gyöngybagoly (Tyto alba a Kazanlak-völgy 15 UTM négyzetében költött (75%, n = 20 (Dél-Közép Bulgária 33 helyen (55% bizonyított, 12% valószínű és 33% lehetséges költés. Az elterjedési területe a völgyben ötször, állománynagysága pedig tízszer magasabb a korábbiakban véltnél. Minden elfoglalt UTM négyzetben 1-5 költőhelyet találtak (átlag: 2,2±1,3. A Közép-Európára jellemző költőállomány sűrűségéhez (4,1 pár/100 km2 közelít ez az érték. Jellemzően a fémszerkezeteken vagy azok belsejében és a szellőzőjáratokban épültek a fészkek, ezek a szerkezetek biztosítottak sikeres fészkelési lehetőséget a legtöbb gyöngybagoly lakta épületben. Elsősorban elhanyagolt vagy elhagyatott épületekben fészkeltek, ezek mennyisége nem csökkent jelentősen, mióta Bulgária csatlakozott az Európai Unióhoz, és EU támogatással megindult a mezőgazdaság intenzifikálása. Úgy tűnik, hogy a gyöngybagoly nem fog fészkelőhely-hiánnyal szembesülni a következő évtizedben.

  9. Seminar.net with special issue from Finland

    Directory of Open Access Journals (Sweden)

    Yngve Nordkvelle

    2016-11-01

    Full Text Available Most of the world has learned to ”see to Finland” over the last decade, beacuse of its reputation as a leading nation in educational achievement, as well as its many creative and diligent approaches in technology. Since 1990 Finnish researchers in media, technology and education have met annually to discuss research matters and further advances in the area. For the conference of 2016, held 13-15th April in Hämeenlinna, Finland, we were asked to have the best papers published in Seminar.net. After a rigourous review process we will print six papers, four in this issue and two in the next.Antti Syvänen, Jaana-Piia Mäkiniemi, Sannu Syrjä, Kirsi Heikkilä-Tammi and Jarmo Viteli, all of the University of Tampere, present the paper “When does the educational use of ICT become a source of technostress for Finnish teachers?» This interesting paper is based on the analysis of questionnaires filled in by 2741 Finnish teachers. It provides significant insight into what causes teachers to experience stress and alienation when using information and communication technologies (ICT in their classrooms.Tuulikki Keskitalo and Heli Ruokamo of Lapland University present a paper dealing with “Students’ Expectations and Experiences of Meaningful Simulation-Based Medical Education». Simulation in nursing education is a very rapidly developing area, and the students – as well as their teachers – have high expectation. This project is about student’s expectations and the very positive result from this study was that their experiences were even higher than their expectations.Hanna Vuojärvi, of the University of Lapland and Miikka Eriksson, of the University of Eastern Finland, have written the article «Using Mobile Tools to Support Meaningful Work-based Learning in Vocational Education» together. Their case study focused on meaningful work-based learning (WBL and the pedagogical use of mobile information and communication technologies (ICTs

  10. Significado prognóstico do linfonodo metastático N3 em carcinomas epidermóides de cabeça e pescoço

    Directory of Open Access Journals (Sweden)

    Ali Amar

    Full Text Available OBJETIVO: Avaliar os resultados do tratamento da doença metastática em estádio avançado (N3 e sua relação com o prognóstico do carcinoma espinocelular de cabeça e pescoço. MÉTODO: Foram revisados as informações de prontuários de 241 pacientes, com carcinoma espinocelular de boca, orofaringe, laringe e hipofaringe com metástases cervicais maiores que 6 cm (N3 submetidos à cirurgia e/ou radioterapia, no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo, de 1988 a 1998. Nos pacientes submetidos à cirurgia foi avaliada a radicalidade cirúrgica, macroscopicamente completa ou não, e naqueles tratados pela radioterapia, foi analisada a resposta do sítio primário e do pescoço imediatamente ao término do tratamento. A sobrevida livre de doença foi estimada pelo método de Kapplan Meier no grupo submetido à cirurgia. RESULTADOS: A irressecabilidade da lesão primária e metastática no pescoço justificou a indicação da radioterapia na dose média de 65 Gy, em 69 pacientes ocorrendo resposta completa no sítio primário em 24(36%, no pescoço em 12 (18%, e em ambos os sítios em 11 casos (16%. No grupo sumetido à cirurgia seguido de radioterapia, a dose média foi de 56 Gy. Dos 25 pacientes com ressecção macroscópica radical do pescoço, cinco (20% recidivaram, e dos cinco com ressecção incompleta e radioterapia, dois tiveram sobrevida de sete a 12 meses após o tratamento, quando foram perdidos de seguimento. A sobrevida livre de doença em dois anos neste grupo foi de 58%. CONCLUSÕES: Para pacientes com linfonodo metastático N3, o esvaziamento cervical seguido de radioterapia foi eficiente no controle regional da doença enquanto que nos inoperáveis, a radioterapia é um tratamento paliativo.

  11. Paradigma da disseminação linfática no carcinoma espinocelular da base da língua

    Directory of Open Access Journals (Sweden)

    Francisco S. Amorim Filho

    Full Text Available OBJETIVO: O carcinoma espinocelular CEC da base da língua tem um comportamento agressivo, disseminando-se precocemente para o pescoço uni ou bilateralmente. O objetivo deste trabalho é estabelecer critérios de tratamento eletivo ou terapêutico dos linfonodos cervicais metastáticos ou não para o CEC da base de língua. MÉTODO: Estudo retrospectivo de 290 pacientes com CEC de base de língua atendidos no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo, de 1997 a 2000. Após análise loco-regional, foram classificados segundo os níveis I, II, III, IV e V do estadiamento TNM da UICC (1998. Os resultados foram analisados segundo o teste do Qui-quadrado para o estudo da associação de sítios, tamanho do tumor, presença de metástases e invasão da linha média. RESULTADOS: Houve um predomínio do sexo masculino em relação ao feminino (9:1, da 6ª década, dos fumantes e etilistas (83,8%. Quanto à disseminação linfonodal, diagnosticamos N0 (21,0%, N1 (13,4%, N2 (43,1%, N3 (22,5% e níveis I(11,6%, II(69,0%, III (13,5%, IV (2,8% e V (3,1%. Quanto à invasão da linha média, não houve relação significante com o nível comprometido. CONCLUSÃO: O tratamento do CEC da base da língua deve envolver o sítio primário e os níveis de disseminação linfonodal, uni e bilateral.

  12. Recuperación post-fuego de la comunidad de líquenes epífitos en la provincia de Córdoba, Argentina Post-fire recovery of the epiphytic-lichen community in Cordoba province, Argentina

    Directory of Open Access Journals (Sweden)

    Juan Manuel Rodriguez

    2009-09-01

    Full Text Available Los líquenes son reconocidos bioindicadores de la calidad del ambiente. Estudios de comunidades de líquenes en relación a los incendios forestales, han demostrado como responden al fuego por encima de las variables microambientales que modelan la comunidad en ausencia de este disturbio. El objetivo de la presente contribución es reconocer el efecto del fuego en la comunidad de líquenes del Bosque Serrano en Córdoba. Se seleccionaron dos zonas, una testigo y otra sometida a fuego en 1996. A través de un muestreo sistemático y estandarizado se relevó la presencia y cobertura de especies de líquenes en árboles y arbustos en las dos áreas estudiadas. Entre el área testigo y el incendiado la diversidad y cobertura de líquenes es similar pero varia su composición. Las especies en la zona incendiadas corresponden a líquenes heliófilos y adaptados a situaciones de estrés. El fuego como disturbio frecuente favorece la presencia de pocas especies con importantes coberturas que resistan las condiciones que el disturbio impone. Los incendios de alta intensidad y frecuencia dejan a la comunidad de líquenes sin posibilidades de desarrollo, disminuyendo la diversidad general y la calidad de los sistemas forestales en los que viven.Lichens are recognized bioindicators of environmental quality. Studies of lichen communities in relation to forest fires have shown the response to fire over micro-environmental variables that shape the community in the absence of this disturbance. The aim of this contribution is to recognize the effect of fire on the lichen community of Sierra Chaco in Cordoba province. Two areas were selected, one without past fire and the other with fire in 1996. Coverage and presence of lichen species on trees and shrubs were recorded in the two areas using systematic, standardized sampling. Diversity and coverage of lichens is similar between the two areas but composition varies. The lichen species in the burned area are

  13. Regular use of traditional analgesics predicts major coronary events: A cohort study

    Directory of Open Access Journals (Sweden)

    Mikko Haara

    2008-12-01

    Full Text Available Mikko Haara1, Markku Heliövaara2, Jari PA Arokoski3, Paul Knekt2, Pirjo Manninen4, Arpo Aromaa2, Antti Reunanen2, Olli Impivaara2, Heikki Kröger51Bone and Cartilage Research Unit (BCRU, University of Kuopio, Kuopio, Finland; 2National Public Health Institute, Helsinki and Turku, Finland; 3Department of Physical and Rehabilitation Medicine, Kuopio University Hospital, Finland; 4Finnish Institute of Occupational Health, Kuopio, Finland; 5Department of Surgery/Orthopaedics and Traumatology, Kuopio University Hospital, Kuopio, FinlandAims: Serious concern has arisen about the cardiovascular safety of selective cyclo-oxygenase-2 (COX-2 inhibitors. However, recent studies have shown that the cardiovascular risks of regular use of traditional analgesics also deserve attention. We investigated the use of traditional analgesics for their prediction of major coronary events during 16 years of follow-up.Methods: A population sample of 8000 Finns aged 30 years and over was invited to a comprehensive health examination in 1978–1980; 7217 (90% complied, and 4824 of these had no diagnosed cardiovascular disease. The participants filled in a questionnaire eliciting information on the use of analgesics. Record linkage to the National Hospital Discharge Register and the mortality register of the Central Statistical Office of Finland identified 266 major coronary events (myocardial infarctions or coronary deaths by the end of 1994.Results: The risk of a major coronary event was significantly elevated among those reporting regular use of analgesics at baseline. Compared with nonusers and adjusted for known risk factors for coronary heart disease, the relative risk of an event during the whole follow-up period was 1.51 (95% confidence interval [CI] 1.08–2.10 among regular users of analgesics. The risk was as high as 5.27 (95% CI 2.13–13.11 during the first two years of the follow-up. Thereafter it leveled off.Conclusion: Based on sales statistics almost all

  14. Características clínico-epidemológicas do carcinoma epidermóide de cavidade oral no sexo feminino Clinical and epidemiological characteristics of oral squamous cell carcinoma in women

    Directory of Open Access Journals (Sweden)

    M.B. DE CARVALHO

    2001-09-01

    Full Text Available OBJETIVO: Este trabalho tem como objetivo identificar as principais diferenças clínico-epidemiológicas do carcinoma epidermóide de cavidade oral no sexo feminino quando comparado ao sexo masculino. MÉTODOS: Foram estudados retrospectivamente os prontuários de 228 pacientes do sexo feminino portadoras de carcinoma epidermóide de cavidade oral, atendidos no Serviço de Cirurgia de Cabeça e Pescoço do Hospital Heliópolis, no período entre 1977 e 1996. As características clínico-epidemiológicas destas pacientes foram comparadas com aquelas de 849 pacientes do sexo masculino. RESULTADOS: A idade das pacientes das mulheres variou de 2 a 100 anos, com uma média de 60,7 anos. Nos homens encontramos idade entre 17 e 88 anos com uma média de 55,6 (pBACKGROUND: Squamous cell carcinoma (SCC of the oral cavity occurs mainly in the male population. The objective of the study is to identify the main clinical and epidemiological differences of the oral SCC between men and women. METHODS: Retrospective analysis of the charts of 228 cases of SCC of the oral cavity in women treated at the Head & Neck Surgery Service, Heliopolis Hospital, São Paulo, Brazil from 1977 to 1996. The clinical and epidemiological characteristics of these cases were compared with those of 849 male patients. RESULTS: The mean age of women was 60.7 years (ranging 2 to 100 years and in the male group was 55.6 years (p<0.00001. In cases where the alcohol intake and tobacco use were absent, the tumors ocurred in older patients. The isolated tobacco use didn't affect the distribuction by age but for the alcohol intake (alone or combined with tobacco the patients were younger. On the alcohol intake, 71% of the women and 8% of the man used no alcohol. The most common sites of tumors were tongue and floor of the mouth but in the women group the incidence of tumors in these sites were 43% compared with 61% in the men. CONCLUSIONS: The highest incidence of SCC the of oral cavity

  15. HD gas purification for polarized HDice targets production at Jefferson Lab

    Energy Technology Data Exchange (ETDEWEB)

    Whisnant, Charles; D' Angelo, Annalisa; Colaneri, Luca; Devilbiss, J; Kageya, Tsuneo; Loving, D A; Lowry, Michael; Rizzo, Alessandro; Sandorfi, Andrew; Schaerf, Carlo; Storey, J D; Wallace, C M; Wei, Xiangdong; Zonta, Irene

    2014-06-01

    Solid, frozen-spin targets of molecular HD were rst developed for nuclear physics by a collaboration between Syracuse University and Brookhaven National Lab. They have been successfully used in measurements with photon beams, rst at the Laser-Electron-Gamma-Source [1] and most recently at Je erson Lab during the running of the E06-101 (g14) experiment [2]. Preparations are underway to utilize the targets in future electron experiments after the completion of the 12 GeV JLab upgrade [3]. HD is an attractive target since all of the material is polarizable, of low Z, and requires only modest holding elds. At the same time, the small contributions from the target cell can be subtracted from direct measurements. Reaching the frozen-spin state with both high polarization and a signi cant spin relaxation time requires careful control of H2 and D2 impurities. Commercially available HD contains 0.5 - 2% concentrations of H2 and D2. Low-temperature distillation is required to reduce these concentrations to the 104 level to enable useful target production. This distillation is done using a column lled with heli-pack C [4] to give good separation e ciency. Approximately 12 moles of commercial HD is condensed into the mechanically refrigerated system at the base temperature of 11K. The system is then isolated and the temperature stabilized at 18K producing liquid HD, which is boiled by a resistive heater. The circulation established by the boil-o condensing throughout the column then ltering back down produces a steady-state isotopic separation permitting the extraction of HD gas with very low H2 and D2 content. A residual gas analyzer initially monitors distillation. Once the H2 concentration falls below its useful operating range, samples are periodically collected for analysis using gas chromatography [5] and Raman scattering. Where the measurement techniques overlap, good agreement is obtained. The operation of the distillery and results of gas analysis will be discussed

  16. Estratificación vertical de briófitos epífitos encontrados en Quercus humboldtii (Fagaceae de Boyacá, Colombia

    Directory of Open Access Journals (Sweden)

    Jorge Enrique Gil Novoa

    2014-08-01

    Full Text Available Los bosques de roble representan una formación vegetal de importancia ecológica, debido a la cantidad de plantas epífitas que pueden llegar a albergar; estas han sido muy poco estudiadas en Colombia, especialmente las no vasculares. Para el país, uno de los robledales de mayor extensión es el Parque Natural Municipal “Robledaes de Tipacoque” (PNMRT, que se encuentra ubicado en Boyacá, en el municipio de Tipacoque. Se evaluó la brioflora epífita en Quercus humboldtii, mediante técnicas de ascenso a dosel y división de cada uno de los árboles (25 individuos muestreados en cinco estratos cada uno (base, tronco, dosel interno, dosel medio y dosel externo. Se recolectaron en total 365 muestras, 29% pertenecen a hepáticas y 71% a musgos. Las hepáticas se distribuyeron en 10 familias, 16 géneros y 26 especies, mientras que los musgos se distribuyeron en 11 familias, 26 géneros y 49 especies. La base del árbol es el estrato con mayor diversidad de especies (51, seguida del tronco (43, mientras que en el dosel, la parte interna fue la más diversa con 28 especies, seguida del dosel medio con 18 y el dosel externo con 15. Los análisis de similitud muestran una baja relación entre los estratos, donde la mayor afinidad esta entre el tronco y el dosel medio con el 0.42. Los resultados muestran que las plantas no vasculares prefieren los estratos inferiores (base y tronco, donde la diversidad es mayor, debido a las condiciones microclimáticas que éstas zonas presentan, como mayor humedad, menor intensidad lumínica y sombra; además, algunas especies se consideran como epífitas de sombra (hombrófilas al ser exclusivas de éstas zonas, como Bazzania gracilis y Taxilejeunea pterigonia, entre otras. El caso contrario, Jungermannia sp. Se considera epífita de sol (heliófila al encontrarse únicamente en el dosel externo. Se concluye que Q. humboldtii puede ser un hospedero potencial para la conservación de epífitas no vasculares en

  17. PROFILE OF CONGENITAL HEART DISEASE AS DIAGNOSED BY FETAL ECHOCARDIOGRAPHY, A TERTIARY CARE EXPERIENCE

    Directory of Open Access Journals (Sweden)

    Venkata Arunavalli

    2015-09-01

    Full Text Available BACKGROUND : The incidence of congenital heart disease is 0.8 in 1000 live births. Fetal echo cardiography offers a chance to detect most hemodynamically significant congenital heart disease in early pregnancy, so that their management prenatally, at birth and postnatally can be planned better. OBJECTIVES : To analyze the profile of congenital heart disease as diagnosed by fetal echocardiography, in pregnant women referred to a tertiary care centre. MATERIAL AND METHODS : The study design is retrospective, observational study. A total number of 583 fetal echo studies were performed at our C entre from January 1 st 2014 to June 30 th 2015. All studies were performed by a single operator. The main i ndications for the referral were: inability to visualize a clear four chamber view on obstetric scan, echogenic focus in LV cavity, maternal diabetes, family history of congenital heart disease, and maternal request. Statistical analysis was performed usin g statistical package for social sciences SPSS: CHICAGO, 3L VSA program. All the women with abnormal FE studies, except ones with complex CHDS were instructed to bring the new borns for 2D echo within 1 – 2 days after birth. RESULTS : Overall, significant C HD was found in 5.4% of FE studies (32 out of 583 cases . The most common indications for referral were: inability to visualize a clear four chamber view on obstetric scan, echogenic focus in LV cavity, maternal diabetes, family history of congenital heart disease, and maternal request. The risk factors with highest yield of CHD were poly hydroamnios and maternal diabetes. The commonest lesion found was ostium secundum ASD. There was a significant correlation between the presence of echogenic focus prenatal ly and small to moderate sized ostium secundum ASD after birth. CONCLUSION : Our data suggests that the risk factors with highest yield of CHD are polyhydromnios and meternal diabetes. Presence of echogenic focus in the LV in FE is associated

  18. QUANTITATIVE ASSESSMENT OF SOUTH AFRICA’S INVENTIVE OUTPUTS: INTERNATIONAL PATENT ANALYSIS

    Directory of Open Access Journals (Sweden)

    A. Pouris

    2012-01-01

    Full Text Available

    ENGLISH ABSTRACT: This article aims to identify and analyse the inventive activity of South Africans as it is manifested in the form of patents. Patents are used internationally as indicators of national and corporate inventive activity, but they rarely are reported in the context of the South African reality. Inventive activity is analysed in terms of patents awarded to South African inventors by the USA patent office (USPTO. South African inventors are identified to apply and receive approximately 110 patents per year from the USPTO. Analysis of the patents according to technological classes identifies classes that indicate the country’s strengths. South Africa is ranked fourth internationally in technological class “Chemistry: Fischer- Tropsch Processes; or Purification or Recovery of Products Thereof”; and twelfth in “Specialised Metallurgical Processes”. It is argued that government should support further innovation in the country’s strong inventive areas. Corporate patent analysis identifies the most inventive organisations in the country; co-inventive analysis identifies the countries with which South Africans cooperates; and international comparisons set South Africa in an international context. An important finding is that South Africa appears not to have participated in the international explosion of patents during the last twenty years. It is suggested that neither the policy environment nor factors determining technological fertility have changed in South Africa during the last two decades.

    AFRIKAANSE OPSOMMING: Hierdie artikel het ten doel om Suid-Afrika se innoverende aktiwiteite in die vorm van patente te identifiseer en te ontleed. Innoverende aktiwiteite word in terme van patente, wat aan Suid-Afrikaanse innoveerders deur die VSA se patente-kantoor ("US Patent Office – USPTO" toegeken word, ontleed. Suid-Afrikaanse uitvinders word genader om aansoek te doen en ongeveer 110 patente word jaarliks deur USPTO

  19. A moments' analysis of quasi-exactly solvable systems: a new perspective on the sextic potential gx^6+bx^4+mx^2 +{\\beta \\over {x^2}}

    Science.gov (United States)

    Handy, Carlos R.; Vrinceanu, Daniel; Gupta, Rahul

    2014-07-01

    symmetry as the QES states: their lower order ν-moments must be zero. We demonstrate our results in the context of the two sextic potentials: Vsa(x) = x6 + mx2 + bx4 and Vss(x) = x6 + mx2 + b/x2.

  20. The CRADLE vital signs alert: qualitative evaluation of a novel device designed for use in pregnancy by healthcare workers in low-resource settings.

    Science.gov (United States)

    Nathan, Hannah L; Boene, Helena; Munguambe, Khatia; Sevene, Esperança; Akeju, David; Adetoro, Olalekan O; Charanthimath, Umesh; Bellad, Mrutyunjaya B; de Greeff, Annemarie; Anthony, John; Hall, David R; Steyn, Wilhelm; Vidler, Marianne; von Dadelszen, Peter; Chappell, Lucy C; Sandall, Jane; Shennan, Andrew H

    2018-01-05

    Vital signs measurement can identify pregnant and postpartum women who require urgent treatment or referral. In low-resource settings, healthcare workers have limited access to accurate vital signs measuring devices suitable for their environment and training. The CRADLE Vital Signs Alert (VSA) is a novel device measuring blood pressure and pulse that is accurate in pregnancy and designed for low-resource settings. Its traffic light early warning system alerts healthcare workers to the need for escalation of care for women with hypertension, haemorrhage or sepsis. This study evaluated the usability and acceptability of the CRADLE VSA device. Evaluation was conducted in community and primary care settings in India, Mozambique and Nigeria and tertiary hospitals in South Africa. Purposeful sampling was used to convene 155 interviews and six focus groups with healthcare workers using the device (n = 205) and pregnant women and their family members (n = 41). Interviews and focus groups were conducted in the local language and audio-recorded, transcribed and translated into English for analysis. Thematic analysis was undertaken using an a priori thematic framework, as well as an inductive approach. Most healthcare workers perceived the CRADLE device to be easy to use and accurate. The traffic lights early warning system was unanimously reported positively, giving healthcare workers confidence with decision-making and a sense of professionalism. However, a minority in South Africa described manual inflation as tiring, particularly when measuring vital signs in obese and hypertensive women (n = 4) and a few South African healthcare workers distrusted the device's accuracy (n = 7). Unanimously, pregnant women liked the CRADLE device. The traffic light early warning system gave women and their families a better understanding of the importance of vital signs in pregnancy and during the postpartum period. The CRADLE device was well accepted by healthcare workers

  1. Prototyping and Testing a Wireless Sensor Network to Retrieve SWE at High Spatial Resolution

    Science.gov (United States)

    Kang, D.; Barros, A. P.

    2007-12-01

    A critical challenge in snow research from space is the ability to obtain measurements at the spatial and temporal resolution to characterize the statistical structure of the space-time variability of the physical properties of the snowpack within an area consistent with the pixel resolution in snow hydrology models or that expected from a future NASA mission dedicated to cold region processes. That is, observations of relevant snow dielectric properties are necessary at high spatial and temporal resolution during the accumulation and melt seasons. We present a new wireless sensor network prototype consisting of multiple antennas and buried low-power, multi- channel transmitters operating in L-band that communicate to a central pod equipped with a Vector Signal Analyzer (VSA) that receives, processes and manages the data. Only commercial off-the-shelf hard-ware parts were used to build the sensors. Because the sensors are very low cost and run autonomously, one envisions that self-organizing networks of large numbers of such sensors might be distributed over very large areas, therefore proving much needed data sets for scaling studies. The measurement strategy consists of placing the transmitters the land surface in the beginning of the snow season which are then run autonomously till the end of the spring and waken at pre-determined time-intervals to emit radio frequency signals and thus sample the snowpack. Along with the sensors, an important component of this work entails the development of an estimation algorithm to estimate snow dielectric properties, snow density, and volume fraction of snow (VF) from the time-of-travel, amplitude and phase modification of the multi-channel RF signals as they propagate through the snow-pack. Here, we present results from full system testing and evaluation of the sensors that were conducted at Duke University using ¢®¡Æsynthetic¢®¡¾ limited-area snowpacks (0.5 by 0.5 m2 and 1 by 2 m2) constructed of various

  2. Language transfer: First (Ll and second (L2 proficiency of bilingual adolescent students

    Directory of Open Access Journals (Sweden)

    Alejandro Brice

    2013-02-01

    Full Text Available This study was conducted in three middle schools located at a large urban school district in southeast Florida of the United States. The schools selected have programmes which are designed to draw students who require special instruction in English as a second language (ESL. A total of 89 ESL students in middle grades 6, 7, and 8 were tested with the Spanish and English versions of the Language Assessment Battery (LAB test, Level Ill (6-8 to measure differences in the level of first and second language achievement. Thirty-three students had been receiving ESL instruction for one year, 25 students had been in the programme for two years, and the remaining 31 students had been ESL students for three or more years. Quantitative results indicated that the higher grade level students performed better than the lower grade ~tudents. Test results did not demonstrate a strong relationship between achievement in L1 and L2. The only skill which seemed to transfer readily was reading. Qualitative results revealed a ~light trend toward increased English proficiency. Test results also indicated that Spanish language maintenance is occurring among subjects in this sample.Hierdie studie is in drie middelskole in 'n stedelike gebied in suidoos Florida, VSA, onderneem. Die skole hied programme aan vir studente wat spesiale instruksie in Engels Tweedetaal(ET2 benodig. Nege-en-tagtig ET2 studente in Graad 6, 7 en 8 is getoets met die gebruik van die 'Spaanse en Engelse weergawes van die "Language Assessment Battery"(LAB toets vir die vlakke om verskille in die vlak van eerste- en tweedetaa/prestasie te meet. Drie-en-dertig van die ~tudente het onderrig in ET2 vir een jaar ontvang, 25 het dit vir twee jaar ontvang en die orige 31 studente het ET2-onderrig vir drie ofmeer jaar ontvang. Kwantitatiewe data dui aan dat die "zoer vlak studente beter as die op laer vlak gevaar het. Die toetsuitslae het nie 'n sterk verhouding tussen T1 en T2 prestasie getoon nie. Die

  3. Planejamento de Recursos Humanos de Saúde e Ambiente - aspectos históricos, teóricos e reflexões para políticas públicas em Vigilância em Saúde Ambiental no Brasil

    Directory of Open Access Journals (Sweden)

    Juliana Wotzasek Rulli VILLARDI

    2015-09-01

    Full Text Available As relações entre a saúde e o ambiente no âmbito das atribuições do Sistema Único de Saúde é um desafio no cuidado coletivo na perspectiva da identificação, prevenção, controle e das recomendações de processos envolvidos na exposição humana às situações ambientais que possam gerar impacto e consequências negativas para a saúde humana. As reflexões sobre os caminhos da vigilância em saúde ambiental (VSA, seu histórico, conceito, teoria e alternativas metodológicas, que geram informação para tomada de decisão e inclui possibilidades de interpretação e transformação da realidade são os objetivos abordados neste ensaio. A partir de uma pesquisa exploratória sobre a Vigilância em Saúde Ambiental no Brasil, suas práticas e teorias, foi realizada uma revisão sobre a vigilância em saúde ambiental no Brasil, e seu contexto teórico e histórico. O objeto da Vigilância em Saúde Ambiental é a relação sócio ecológica do ambiente, da saúde e da sustentabilidade, e há que se avançar e pensar na análise de situação de saúde ambiental como eixo da discussão do seu objeto produzindo informação qualificada para a intervenção solidária e democrática tendo a saúde como valor que traz a discussão da sustentabilidade, da equidade, com a incorporação de uma política social que interaja condicionando o desenvolvimento econômico e social.

  4. Expressão de galectina-3 e citoqueratina 19 nas neoplasias epiteliais da glândula tireóidea e correlação histopatológica Expression of galectin-3 and cytokeratin 19 in the epithelial neoplasm of the thyroid gland and histopathological correlation

    Directory of Open Access Journals (Sweden)

    Marilene Paladino Rosa

    2005-02-01

    Full Text Available INTRODUÇÃO: O câncer da glândula tireóidea é caracterizado pela sua variedade clínica e patológica. O difícil diagnóstico pré-operatório das lesões foliculares induz a mais procedimentos cirúrgicos de caráter diagnóstico do que propriamente terapêutico. A proposta deste estudo foi identificar a expressão imuno-histoquímica das neoplasias epiteliais tireóideas utilizando anticorpos monoclonais para galectina-3 e citoqueratina 19 e correlacioná-la com variáveis histopatológicas. MATERIAL E MÉTODO: A expressão da galectina-3 e da citoqueratina 19 foi estudada imuno-histoquimicamente em 84 casos com diagnóstico de tecido normal (n = 10, bócio adenomatoso (n = 8, adenoma folicular (n = 12, adenoma de célula de Hürthle (n = 3, carcinoma papilífero (n = 29, carcinoma folicular (n = 8, carcinoma insular (n = 4, carcinoma de células de Hürthle (n = 4 e carcinoma indiferenciado (n = 6, selecionados a partir de pacientes operados no Serviço de Cirurgia de Cabeça e Pescoço do Hospital Heliópolis (HOSPHEL, no período de 1984 a 1995. RESULTADOS: A expressão da galectina-3 foi observada em bócio adenomatoso (12,5%, adenoma folicular (16,7%, carcinoma papilífero (96,6%, carcinoma folicular (12,5%, carcinoma insular (50%, carcinoma de célula de Hürthle (100% e carcinoma indiferenciado (50%. Nossos resultados confirmaram a expressão significativa da galectina-3 no grupo das neoplasias malignas, principalmente no carcinoma papilífero. O padrão de expressão da citoqueratina 19 foi diferente entre os tipos de lesão: enquanto nos bócios e adenomas mostrou-se fraco, nos carcinomas papilíferos foi forte e difuso. CONCLUSÃO: Associadas, a galectina-3 e a citoqueratina 19 auxiliam o diagnóstico histopatológico, principalmente nas lesões de interpretação duvidosa, além de evidenciarem atipias e, com isso, determinarem uma lesão suspeita.BACKGROUND: The cancer of the thyroid gland is characterized by its clinical and

  5. Simultaneous Effect Of Habitat And Age On Reproductive Success Of Imperial Eagles (Aquila Heliaca In Hungary

    Directory of Open Access Journals (Sweden)

    Horváth Márton

    2014-06-01

    Full Text Available A parlagi sas kelet-magyarországi elterjedési területe jelentős mértékben kiterjedt az Alföld irányába 1989-től 2006-ig, amely során az alföldi állomány 2-ről 59 párra emelkedett, míg a hegyvidéki állomány viszonylag stabil maradt, és 12-17 pár között változott. A terjeszkedési folyamat elején, a hegyvidéki élőhelyeken kisebb volt a párok közötti legközelebbi szomszéd távolság, mint síkvidéken, azonban ez 2006-ra kiegyenlítődött. Denzitásfüggő hatást egyelőre nem lehet megfigyelni az átlagos költési siker alakulásában. A vizsgálati időszakban, a síkvidéki territóriumokban magasabb volt az átszíneződő fiatal madarak aránya (49%, mint a hegyvidékiekben (22%. A költő madarak korának és az élőhelynek a költési sikerre gyakorolt együttes hatását vizsgáltuk. Azt találtuk, hogy a költő madarak kora inkább a költések sikerességi arányát (sikeres párok/összes költő pár befolyásolta, míg az élőhely inkább a kirepülési sikerre (kirepült fiókák száma/sikeres pár volt hatással. Összességében a produktivitást (kirepült fiókák száma/összes költő pár alapvetően a madarak kora befolyásolta, de a kor és az élőhely interakciója is szignifikáns hatással volt. Az adatok alátámasztják azt a predikciónkat, miszerint a síkvidéki területek jobb táplálkozási lehetőségei (közelebbi táplálkozó területek és nagyobb zsákmány-denzitás magasabb költési sikert eredményezhetnek. A másik predikciónk, miszerint a síkvidéki párok sikerességi aránya alacsonyabb a jelentősebb emberi zavarás miatt, csak részben igazolódott. Bár ez a trend megfigyelhető volt az adatokban, de csak a párok korával interakcióban volt szignifikáns a különbség. Ezért úgy gondoljuk, hogy a tapasztalt öreg madarak megfelelő mértékben hozzá tudnak szokni az emberi jelenléthez a fészkek közvetlen környezetében is.

  6. Paradigma da disseminação local do carcinoma epidermóide da base de língua Paradigm of local spreading in squamous cell carcinoma of the base of the tongue

    Directory of Open Access Journals (Sweden)

    Francisco S. Amorim Filho

    2004-08-01

    Full Text Available OBJETIVO: Analisar o padrão de disseminação local através da delimitação clínica da extensão da lesão primária assim como os subsítios invadidos. FORMA DE ESTUDO: Clínico retrospectivo. MATERIAL E MÉTODO: Foram analisados os prontuários de 290 pacientes com carcinoma epidermóide de base de língua no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis, Hosphel, São Paulo - Brasil, de 1977 a 2000, sendo estadiados pelo TNM da UICC, e os resultados analisados pelo teste do Quiquadrado para tabelas Z x N (Cochran para estudo da associação dos sítios e dimensão da neoplasia em relação à invasão da linha média. RESULTADOS: Com predomínio dos homens (8:1 e da 6ª década de vida (41,0%, 83,8% eram etilistas e tabagistas e em 4,7% os hábitos estavam ausentes. Quanto aos sintomas, odinofagia (37,6%, linfonodo (21,7% e a média de tempo entre o 1º sintoma e o diagnóstico de 6 meses (62,0%. Quanto ao estadiamento, tivemos T1-T2 (18,3%, T3 (32,4%, T4(50,7%. Quanto à disseminação local, em direção à valécula (25,3%, epiglote (18,7%, glote (2,7%, anteriormente para o v lingual em (22,4% e póstero lateralmente para a prega faringloepiglótica (6,6% e seio piriforme (2,2%. Quanto a ultrapassagem da linha média, isso ocorreu em 66,2% dos casos, sendo 42,2% (T2, 54,2% (T3 e 82,9% (T4. CONCLUSÃO: o carcinoma epidermóide no estádio T4 ultrapassa a linha média da base da língua em 82,9%.AIM: To analyse the local spreading pattern through clinical delimitation of primary lesion extension as well as subsites involvement. STUDY DESIGN: Chart review. MATERIAL AND METHOD: Files of 290 patients with squamous cell carcinoma (SCC of the base of the tongue from Department of Head Neck and Surgery and Otorhinolaryngology of Hospital Heliópolis, Hosphel, São Paulo, Brazil from 1977 to 2000, were analysed. They were staged through TNM from UICC, and then through thoygh K square text with Z x

  7. Variação morfológica e reprodutiva de Aechmea lindenii (E. Morren Baker var. lindenii (Bromeliaceae Morphological and reproductive variation of Aechmea lindenii (E. Morren Baker var. lindenii (Bromeliaceae

    Directory of Open Access Journals (Sweden)

    Maurício Lenzi

    2006-06-01

    Full Text Available Buscou-se determinar o efeito da intensidade luminosa sobre as características morfológicas e reprodutivas de A.lindenii, em ambientes de restinga herbácea (alta luminosidade e sub-bosque de restinga arbórea (baixa luminosidade, em Florianópolis, SC, onde os resultados indicam que a luminosidade pode influenciar no seu fenótipo, produção de néctar, fenologia e sucesso reprodutivo. As plantas esciófitas são maiores e apresentam um período de floração em torno de 120 dias, enquanto que as heliófitas são menores e florescem ao longo de todo o ano. A espécie apresenta atributos florais à ornitofilia, estando o volume (16,7 µL ± 4 e concentração (27,25% do néctar produzido pelas flores dentro do esperado para espécies polinizadas por beija-flores. A freqüente visitação de Amazilia fimbriata, Thalurania glaucopis e Thalurania sp. (Trochilidae confirma esta observação, porém abelhas e borboletas também foram consideradas potenciais polinizadores, sugerindo co-evolução de síndromes florais secundárias. Baseando-se nos resultados dos testes de polinizações manuais e no desenvolvimento dos tubos polínicos, pode-se concluir que a espécie não apresenta auto-incompatibilidade, formando frutos com sementes férteis, com germinação superior a 80%, oriundas tanto de fecundação cruzada quanto da autopolinização. A população heliófita apresentou elevadas taxas de partenocarpia (52, 95% e mostrou ser um método seguro e eficaz de se avaliar a fertilização das flores, podendo-se assim, relacionar a sua freqüência e abundância à ausência ou ineficiência dos visitantes florais. Os frutos e sementes foram dispersos por pássaros das famílias Thraupidae e Pipridae e predados por lagartas da borboleta Tecla sp. (Lycaenidae.The purpose of this study was to determine the effect of the luminosity on morphological and reproductive characteristics of A. lindenii, in environments of "restinga herbácea" (high

  8. Dinámica poblacional de la palma Euterpe oleracea (Arecaceae en bosques inundables del Chocó, Pacífico colombiano

    Directory of Open Access Journals (Sweden)

    Diego A Arango

    2010-03-01

    Full Text Available La palma Euterpe oleracea es una especie dominante y promisoria en el plano inundable del río Atrato, región del Chocó, Colombia. Nosotros evaluamos la dinámica poblacional de esta especie a través de las tasas de crecimiento, la mortalidad y los patrones de reclutamiento para un período de dos años y medio. La dinámica de las tasas fue comparada entre bosques de palma mixto y puro. Estos tipos de vegetación fueron asociados con diferentes regimenes de inundación. Árboles y palmas fueron cortados en una porción de cada tipo de bosque, el resto no fue alterado. Nosotros utilizamos proyecciones matriciales para determinar las tendencias de las poblaciones. Las cortas incrementaron las probabilidades de transición de individuos pequeños pero disminuyeron las de individuos grandes, como es típico de las especies heliófitas. Las cortas también incrementaron las tasas de mortalidad en casi todas las categorías de tamaño pero no afectaron las tasas de reclutamiento. Bajo condiciones naturales, las poblaciones de E. oleracea están en equilibrio en los bosques puro y mixto. Las cortas aumentaron el crecimiento poblacional en ambos tipos de bosque, lo que sugiere el rol desempeñado por procesos denso-dependientes sobre el tamaño poblacional de esta especie.Population dynamics of the palm Euterpe oleracea (Arecaceae from flooded forests in Choco, Colombian Pacific. The palm Euterpe oleracea is a dominant and promising species in flood plains of the Atrato river, Choco region of Colombia. We assessed the population dynamics of this species through growth rates, mortality and recruitment patterns for a period of two and a half years. Dynamic rates were compared among mixed and pure flood plain palm forests. These forests types were associated to different flooding regimes. Trees and palms were thinned in a portion for each forest type, the rest was left undisturbed. We used projection matrices to follow population trends. Thinning

  9. Larval fish distribution and their relationship with environmental factors in the southern Tyrrhenian Sea (central Mediterranean during two years of sampling

    Directory of Open Access Journals (Sweden)

    Adriana Profeta

    2014-06-01

    , Vi_a (Vinciguerria attenuata. Fig. 2. Results of CCA analysis for larval fish species and sampled stations during June 2006. Two first axes (CCA1 and CCA2 are represented . Species abbreviations in alphabetical order: Acto_ris (Arctozenus risso, Arno_tho (Arnoglossus thori, Boop_boo (Boops boops, Auxi_roc Cara_acu Cera_mad (Ceratoscopelus maderensis, Cyclo_bra (Cyclothone braueri, Diap_hol (Diaphus holti, Gobi_nig (Gobius niger, Heli_dac (Helicolenus dactylopterus, Hygo_hyg (Hygophum hygomii, Lamp_cro (Lampanyctus crocodilus, Lamp_pus (Lampanyctus pusillus, Lest_jay (Lestidiops jayakari, Myct_pun (Myctophum punctatum, Nezu_aeq (Nezumia aequalis Noto_bol (Notoscopelus bolini, Noto_elo (Notoscopelus elongatus, Para_spe (Paralepis speciosa, Sync_pha (Synchiropus phaeton Spic_sma (Spicara smaris, Trac_tra (Trachurus trachurus.

  10. Palynological evidence of the replacement of the hygrophilous forest by field vegetation during the last 7,000 years B.P. in the northern coast of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Cynthia F.P. da Luz

    2011-09-01

    abaixamento do nível do mar. O ressecamento e a progressão da planície costeira permitiram sua colonização pelas plantas herbáceas heliófitas. A análise palinológica não forneceu qualquer evidência que apoie as teorias do uso do fogo e da prática de atividades agrícolas por grupos indígenas durante esses períodos.

  11. Airborne imaging for heritage documentation using the Fotokite tethered flying camera

    Science.gov (United States)

    Verhoeven, Geert; Lupashin, Sergei; Briese, Christian; Doneus, Michael

    2014-05-01

    Since the beginning of aerial photography, researchers used all kinds of devices (from pigeons, kites, poles, and balloons to rockets) to take still cameras aloft and remotely gather aerial imagery. To date, many of these unmanned devices are still used for what has been referred to as Low-Altitude Aerial Photography or LAAP. In addition to these more traditional camera platforms, radio-controlled (multi-)copter platforms have recently added a new aspect to LAAP. Although model airplanes have been around for several decades, the decreasing cost, increasing functionality and stability of ready-to-fly multi-copter systems has proliferated their use among non-hobbyists. As such, they became a very popular tool for aerial imaging. The overwhelming amount of currently available brands and types (heli-, dual-, tri-, quad-, hexa-, octo-, dodeca-, deca-hexa and deca-octocopters), together with the wide variety of navigation options (e.g. altitude and position hold, waypoint flight) and camera mounts indicate that these platforms are here to stay for some time. Given the multitude of still camera types and the image quality they are currently capable of, endless combinations of low- and high-cost LAAP solutions are available. In addition, LAAP allows for the exploitation of new imaging techniques, as it is often only a matter of lifting the appropriate device (e.g. video cameras, thermal frame imagers, hyperspectral line sensors). Archaeologists were among the first to adopt this technology, as it provided them with a means to easily acquire essential data from a unique point of view, whether for simple illustration purposes of standing historic structures or to compute three-dimensional (3D) models and orthophotographs from excavation areas. However, even very cheap multi-copters models require certain skills to pilot them safely. Additionally, malfunction or overconfidence might lift these devices to altitudes where they can interfere with manned aircrafts. As such, the

  12. Hábitos orais de sucção: estudo piloto em população de baixa renda Suction oral habits: initial study in low income population

    Directory of Open Access Journals (Sweden)

    Valdinês G.S. Cavassani

    2003-01-01

    : Nine Brazilian children (8 girls and 1 boy were examined in "I Mutirão da Comunicação" at Heliópolis Hospital, Hosphel/São Paulo, Brazil, on October 27, 2001. RESULTS: The most common speech and voice disorder detected was articulation impairment (55.56%, followed by oral motor disorder (33.33%. Open bite was detected in eight cases (88.89%. In seven cases (77.78% we observed mouth breathing. CONCLUSIONS: Speech and articulation and dental disorders are normally detected in children with suction oral habits. The importance of interrelating dental, speech and otorhinolaryngology abnormalities in association with public health programs must be established for the low-income population.

  13. Prevalência de papilomavirus humano (HPV anal, genital e oral, em ambulatório geral de coloproctologia Prevalence of anal, genital and oral human papillomavirus (HPV in general ambulatory for diseases of colon and rectum

    Directory of Open Access Journals (Sweden)

    João Carlos Magi

    2006-09-01

    Full Text Available O Papilomavirus Humano (HPV anal tem alta prevalência e incidência na população. O objetivo deste trabalho é verificar a prevalência de HPV anal, bucal e genital em ambulatório público de Coloproctologia, com base no exame de captura hibrida. Foram estudados 64 pacientes atendidos no ambulatório geral de Coloproctologia do Hospital Heliópolis, no período de 22/11/2005 a 20/12/2005, onde foram levantados, de forma prospectiva, dados clínicos, pessoais e comportamentais, identificando o perfil do grupo como não sendo de risco para HPV. Nenhum paciente deste grupo veio à consulta com queixa ou apresentando sinais de HPV ou outra doença sexualmente transmissível. Foram colhidos para cada paciente um esfregaço com escova de boca, outro de vulva/pênis e outro do ânus. O resultado mostrou que 15,62% dos pacientes apresentaram HPV anal, bucal ou genital, sendo que 4,68% do total de pacientes apresentavam HPV anal, um paciente de alto risco associado ao HPV genital, outro misto e outro de baixo risco. Trinta por cento dos pacientes HPV+ apresentavam dor anal como queixa principal. A conclusão é que a prevalência de HPV anal, genital e bucal é elevada, sendo que 4,68% apresentavam HPV anal e daqueles HPV positivos 30% apresentavam dor anal na queixa principal.Anal Human Papilomavirus (HPV has a high prevalence and incidence in the population. The purpose of this project is to verify the prevalence of anal, oral and genital HPV at the Coloproctology Clinic, based on the hybrid capture exam. Sixty four patients were assisted at the clinic from November 22nd to December 20th 2005. Clinical, personal and behavioral data of the patients were set up in a prospective way. The group profile was identified as not being a risky one to HPV. No patient of this group, when was assisted, had complained of or had presented any symptoms of HPV or any other sexually transmitted disease (STD. From each patient it was collected a mouth sample, a vulva

  14. Fatores associados à prática de exercícios físicos em homens voluntários adultos e idosos residentes na Grande São Paulo, Brasil Factors associated to physical exercise in adults and elderly volunteer men living in S. Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Alex Antonio Florindo

    2001-08-01

    Full Text Available O objetivo deste estudo foi verificar os fatores associados à prática de exercícios físicos em homens adultos e idosos residentes na grande São Paulo. O estudo foi transversal e a população constou de 326 homens voluntários, avaliados no Hospital Heliópolis em São Paulo. As variáveis de estudo foram a prática de exercícios físicos (PEF dos últimos 12 meses (variável dependente, e idade, nível de escolaridade, prática de exercícios físicos no período de 10 a 30 anos, cor da pele, estado civil, tabagismo, ingestão de bebidas alcoólicas, ocupação e índice de massa corporal foram as variáveis independentes. A análise univariada foi realizada através do teste de chi2 e regressão logística simples e a análise conjunta através de regressão logística múltipla. A variável que melhor explicou a PEF foi o nível de escolaridade. Depois do ajuste por tabagismo, idade e IMC, os homens com ensino fundamental e médio completos mostraram maior chance de PEF (OR=4,56; IC95%=1,66-12,50, o mesmo acontecendo com homens com ensino superior (OR=8,39; IC95%=1,83-38,42, quando comparados com homens com escolaridade até ensino fundamental incompleto. Estes resultados são importantes para as políticas públicas de implantação e implementação de programas de exercícios físicos, mostrando ser de fundamental importância programas que objetivem atingir a população masculina de adultos e idosos com baixa escolaridade na grande São Paulo.The aim of the study was to analyze the factors associated to practicing physical exercise in adults and elderly men living in S. Paulo. It is a cross-sectional study that analyzes 326 volunteer men aged 50 years and older. The dependent variable was the practice of physical exercise (PPE in the last 12 months and the independent variables were age, education, practice of physical exercise in the period from 10 to 30 years of age, race, marital status, smoking habits, ingestion of alcoholic

  15. Desarrollo ontogénico de plántulas de Guazuma ulmifolia (Sterculiaceae

    Directory of Open Access Journals (Sweden)

    João Correia de Araújo Neto

    1999-12-01

    Full Text Available Se caracterizaran morfológicamente, frutos, semillas y plántulas, siendo realizados descripciones de la forma, tamaño y superficie de semillas, posición de micrópilo y forma y localización del embrión de Guazuma ulmifolia (un árbol heliófito, característico de los estádios iniciales de la sucesión. Para descripción morfológica de las plántulas, las semillas fueron inmersas en ácido sulfúrico por 50 min y colocadas para germinar en medio de cultura a temperatura de 30 ºC. El fruto es del tipo elipsoide, leñoso, pentacarpelar, polispérmico, con media de 22.6 mm de longitud y 24.9 mm de diámetro. Las semillas presentan formato heterogéneo, con 3.07 mm de longitud por 2.36 mm de ancho. Son bitegumentadas, tégmica, con embrión axilar y continuo. La germinación es epígea y las plántulas presentan caracteristicas fanerocotiledonares.Guazuma ulmifolia is as popular reforestation tree all over Latin America. It is characteristic of the initial stages of the secondary sucession and presents potential utility in the restoring of degraded areas. There is no information about fruit, seed and seedling morphology, which is of fundamental importance for identification, extraction, management and seed germination as well as for the characterization of post-seminal development and normal seedling pattern. To obtain such information, external fruit, and external and internal seed structures were studied considering shape, size, micropile and embryo localization, and tegumentar structures. All stages of this work were conduced in the Universidade Estadual Paulista (UNESP, Campus of Jaboticabal city. The fruits were collected in a mixed plantation in Jaboticabal city, State of São Paulo, Brazil. For the biometric study eight repetitions of ten fruits and eight repetitions of 100 seeds were utilized. For seed internal traits study, 50 seeds were drenched in a distiled water, cut, and observed with a scanning electron microscope and a

  16. Morfologia do fruto, da semente e morfo-anatomia da plântula de Vitex megapotamica (Spreng. Moldenke (Lamiaceae Fruit and seed morphology and morpho-anatomy of seedlings of Vitex megapotamica (Spreng. Moldenke (Lamiaceae

    Directory of Open Access Journals (Sweden)

    Nelson Luiz Cosmo

    2009-06-01

    Full Text Available Vitex megapotamica (tarumã é espécie arbórea, decídua, com ocorrência, no Brasil, desde Minas Gerais até o Rio Grande do Sul. Visando à caracterização morfológica do fruto, da semente e morfo-anatômica da plântula, frutos desta espécie foram coletados e as sementes postas para germinar em laboratório. As plântulas foram coletadas desde a protrusão da raiz até o desenvolvimento do primeiro par de eofilo. Foram realizadas medições e pesagem de frutos, e contagem do número de sementes por frutos. As características morfológicas do fruto e da semente são aqui descritas e ilustradas, assim como a morfo-anatomia da plântula. O fruto é drupóide, nuculânio, tetralocular, contendo apenas uma ou duas sementes com fina camada de endosperma e embrião axial, foliáceo. O diásporo (pirênio é constituído pelo endocarpo mais a semente. O endocarpo lenhoso parece exercer restrição sobre a germinação das sementes desta espécie. A plântula é epigea, fanerocotiledonar, com paracotilédones elípticos, com margem inteira, e eofilos opostos, simples, elípticos, com margem serreada, apresentando tricomas tectores. Tanto o paracotilédone quanto o eofilo apresentam mesofilo heterogêneo, dorsiventral, feixe colateral em forma de arco e estômatos anomocíticos. A raiz é poliarca, com córtex parênquimático; o hipocótilo possui tricomas glandulares e não-glandulares, colo distinto, e com cerca de 20 dias encontra-se em início de crescimento secundário. Diversas das características da plântula de Vitex megapotamica estão relacionadas à sua condição de espécie heliófila.Vitex Megapotamica (tarumã is a deciduous tree occurring in Brazil from Minas Gerais to Rio Grande do Sul States. In order to characterize fruit and seed morphology and morpho-anatomy of seedlings, fruits of this species were collected and seeds were germinated in the laboratory. Seedlings were collected from root protrusion to development of the

  17. Influência de diferentes meios de cultura sobre o crescimento de Pfaffia glomerata (Spreng. Pedersen (Amaranthaceae para conservação in vitro Influence of different culture media on the growth of Pfaffia glomerata (Spreng. Pendersen (Amaranthaceae for conservation in vitro

    Directory of Open Access Journals (Sweden)

    R.B.N. Alves

    2010-12-01

    Full Text Available Pfaffia glomerata ocorre em vários estados do Brasil e países limítrofes da região Sul às margens de rios e nas orlas das matas de galerias, é espécie hidrófita e heliófita. As raízes de espécies do gênero Pfaffia são usadas na medicina popular brasileira, especialmente como tônico, afrodisíaco e no controle do diabete. O objetivo deste trabalho foi estabelecer um banco de germoplasma in vitro de Pfaffia glomerata. O experimento em delineamento inteiramente casualizado foi conduzido com seis tratamentos: 1 MS + 2% de sacarose + 4% de sorbitol; 2 MS/2 + 2% de sacarose + 4% de sorbitol; 3 MS + 2% de sacarose + 4% de sorbitol + 2 mg L-1 de pantotenato de cálcio; 4 MS/2 + 2% de sacarose + 4% de sorbitol + 2 mg L-1de pantotenato de cálcio; 5 MS + 2% de sacarose + 3% de manitol + 2 mg L-1de pantotenato de cálcio; 6 MS/2 + 2% de sacarose + 3% de manitol + 2 mg L-1de pantotenato de cálcio. Os resultados obtidos foram submetidos à análise de variância e ao teste de separação de médias de Scott Knott. Os tratamentos um, três e quatro apresentaram, significativamente, o maior número de segmentos nodais por haste, quando comparados com os tratamentos dois, cinco e seis. O tratamento dois foi o mais indicado para a conservação in vitro da espécie por ter promovido menor crescimento das plantas (altura de 3,1±1,9 cm, alto índice de sobrevivência, 100% de explantes com brotação e o maior número de brotos por explante, após seis meses de cultivo. Todas as plântulas produziram raízes e não houve formação de calos, também não ocorreu hiperhidricidade nos tratamentos avaliados. As plantas aclimatizadas apresentaram 100% de sobrevivência no ambiente ex vitro. A manutenção de acessos de P. glomerata no banco de germoplasma in vitro é viável tanto do ponto de vista da conservação quanto economicamente.Pfaffia glomerata occurs in several states of Brazil and its neighboring countries in the south region at riverbanks

  18. Superação da dormência em sementes de faveira (Parkia platycephala Benth Dormancy breaking of faveira (Parkia platycephala Benth. seeds

    Directory of Open Access Journals (Sweden)

    Irinaldo Lima do Nascimento

    2009-02-01

    Full Text Available A faveira é planta semidecídua, heliófita, que ocorre em formações secundárias e áreas abertas de terreno elevado do agreste nordestino e campinas amazônicas. A madeira dessa espécie é empregada para caixotaria, compensados, brinquedos, lenha e carvão, as vagens maduras constituem-se em excelente forragem para todos os ruminantes e a árvore é recomendada para arborização paisagística. O primeiro problema encontrado foi a baixa germinação das sementes devido à impermeabilidade do tegumento à água. Dessa forma, este trabalho teve o objetivo de determinar a metodologia mais eficiente para superação da dormência de sementes de Parkia platycephala, as quais foram submetidas a 12 tratamentos: testemunha - sementes intactas (T1, escarificação mecânica com lixa d'água n. 80 (T2, imersão em ácido muriático concentrado (98% por 30 min e 1 h (T3 e T4, respectivamente, escarificação mecânica com brita por 5, 10 e 15 min (T5, T6 e T7, respectivamente e imersão em ácido sulfúrico concentrado (98% por 5, 15, 30, 45 e 60 min (T8, T9, T10, T11 e T12, respectivamente. Os efeitos dos tratamentos foram avaliados através da porcentagem, primeira contagem e índice de velocidade de emergência de plântulas, além de comprimento e massa seca da raiz e parte aérea. Utilizou-se o delineamento inteiramente casualizado com quatro repetições, e as médias foram comparadas pelo teste de Tukey a 5% de probabilidade. Houve diferença significativa entre os tratamentos em todas as variáveis. A causa mais evidente da dormência foi a impermeabilidade do tegumento, cujos tratamentos mais eficientes para superar a dormência das sementes foram a escarificação mecânica do tegumento com lixa e a imersão em ácido sulfúrico (15 a 45 min.The faveira (Parkia platycephala Benth. is a perennial, heliophyte, secondary plant that occurs in (non-flooded areas of the Amazon area. The wood of this species is used to make boxes, supports and

  19. Estudo funcional da voz e da deglutição na laringectomia supracricóide Functional study of the voice and swallowing following supracricoid laryngectomy

    Directory of Open Access Journals (Sweden)

    Nair Katia Nemr

    2007-04-01

    Full Text Available OBJETIVOS: Identificar o grau e evolução da disfagia e disfonia nos indivíduos submetidos à laringectomia supracricóide e verificar a existência de associação destes aspectos com variáveis clínicas e cirúrgicas. MÉTODOS: Foram estudados 22 casos submetidos a laringectomias supracricóides no Departamento de Cirurgia de Cabeça e Pescoço e Otorrinolaringologia do Hospital Heliópolis e encaminhados para fonoterapia. Os graus de disfagia e disfonia foram correlacionados com gênero, idade (menor ou igual a 50 anos, mais de 50 anos, estadiamento T (T1, T2, T3, T4, sítio da lesão (supraglote, glote, subglote, preservação de uma ou duas aritenóides, tipo de reconstrução (cricohioidopexia ou cricohioidoepiglotopexia, tempo de retirada da sonda nasoenteral e de fechamento da traqueostomia (em ambos: até um mês de pós-operatório ou mais de um mês. Os testes estatísticos utilizados foram Qui-Quadrado e/ou Teste Exato de Fischer. RESULTADOS: Observou-se associação do grau moderado de disfagia com a glote como sítio primário, com a cricohioidoepiglotopexia como tipo de reconstrução e com a retirada da sonda nasoenteral até um mês após a cirurgia; e associação do grau severo de disfagia com a supraglote como sítio primário. A disfagia e a disfonia apresentaram associação entre si quanto aos graus de severidade, porém um maior número de pacientes teve evolução melhor da disfagia comparativamente à evolução da disfonia. Não houve significância estatística nas demais associações. CONCLUSÃO: A melhora na deglutição é mais freqüente do que a melhora da disfonia. Há associação do grau moderado de disfagia com o sítio glote, cricohioidoepiglotopexia e retirada da sonda nasoenteral até um mês após a cirurgia.To identify the grade and evolution of dysphagia and dysphonia in patients undergoing supracricoid laringectomy, and to study the association of these findings with clinical and surgical variables

  20. Könyvszemle [Book reviews

    Directory of Open Access Journals (Sweden)

    Farkas, Tamás (ed.

    2015-12-01

    megye helységneveinek etimológiai szótára [Etymological dictionary of settlement names in Ung county] 13. Bárth M., János: István Hoffmann: Mikrotoponímiai vizsgálatok 1. Tapolcafő helynevei [Microtoponymic surveys 1. Place names in Tapolcafő] 14. Demjén, Izabella: János Pesti: Hosszúhetény nyelvi kincseiről. Névtani és dialektológiai tanulmányok [The linguistic treasures of Hosszúhetény. Onomastic and dialectological studies] 15. T. Somogyi, Magdolna: Erzsébet Erdélyi: Kincsvadászat Nagykőrösön. Helyneveink nyomában [Treasure hunt in Nagykőrös. Investigating local place names] 16. Balogh, Erna: Judit Szilvia Várnai: A fehér barátok földjén [In the land of the Pauline Fathers] 17. Publications on Hungarian onomastics received in 2015