49 CFR 217.3 - Application.

Science.gov (United States)

2010-10-01

... general railroad system of transportation; or (2) Rapid transit operations in an urban area that are not... 49 Transportation 4 2010-10-01 2010-10-01 false Application. 217.3 Section 217.3 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF...

48 CFR 217.7404-2 - Price ceiling.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Price ceiling. 217.7404-2 Section 217.7404-2 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM... Contract Actions 217.7404-2 Price ceiling. UCAs shall include a not-to-exceed price. ...

48 CFR 252.217-7016 - Plant protection.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Plant protection. 252.217... Clauses 252.217-7016 Plant protection. As prescribed in 217.7104(a), use the following clause: Plant Protection (DEC 1991) (a) The Contractor shall provide, for the plant and work in process, reasonable...

25 CFR 217.6 - Method of casting votes.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Method of casting votes. 217.6 Section 217.6 Indians.... § 217.6 Method of casting votes. Within 30 days after an issue and any analysis provided for in §§ 217.4... superintendent in writing of the number of votes cast for and against the proposed or alternative solutions. If...

48 CFR 217.202 - Use of options.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Use of options. 217.202... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.202 Use of options. (1) See PGI 217.202 for guidance on the use of options. (2) See 234.005-1 for limitations on the...

48 CFR 252.217-7001 - Surge option.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Surge option. 252.217-7001... Clauses 252.217-7001 Surge option. As prescribed in 217.208-70(b), use the following clause: Surge Option (AUG 1992) (a) General. The Government has the option to— (1) Increase the quantity of supplies or...

48 CFR 252.217-7002 - Offering property for exchange.

Science.gov (United States)

2010-10-01

... exchange. 252.217-7002 Section 252.217-7002 Federal Acquisition Regulations System DEFENSE ACQUISITION... of Provisions And Clauses 252.217-7002 Offering property for exchange. As prescribed in 217.7005, use the following provision: Offering Property for Exchange (DEC 1991) (a) The property described in item...

33 CFR 136.217 - Compensation allowable.

Science.gov (United States)

2010-07-01

...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.217 Compensation... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Compensation allowable. 136.217...

22 CFR 217.21 - Discrimination prohibited.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.21 Section 217... Discrimination prohibited. No qualified handicapped person shall, because a recipient's facilities within the... excluded from participation in, or otherwise be subjected to discrimination under any program or activity...

14 CFR 145.217 - Contract maintenance.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Contract maintenance. 145.217 Section 145...) SCHOOLS AND OTHER CERTIFICATED AGENCIES REPAIR STATIONS Operating Rules § 145.217 Contract maintenance. (a) A certificated repair station may contract a maintenance function pertaining to an article to an...

40 CFR 86.217-94 - [Reserved

Science.gov (United States)

2010-07-01

... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.217-94 Section 86.217-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

36 CFR 2.17 - Aircraft and air delivery.

Science.gov (United States)

2010-07-01

... 36 Parks, Forests, and Public Property 1 2010-07-01 2010-07-01 false Aircraft and air delivery. 2.17 Section 2.17 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR RESOURCE PROTECTION, PUBLIC USE AND RECREATION § 2.17 Aircraft and air delivery. (a) The following are...

22 CFR 217.11 - Discrimination prohibited.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Discrimination prohibited. 217.11 Section 217... Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any program or activity to which this part applies. (2) A...

22 CFR 217.14 - Preemployment inquiries.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Preemployment inquiries. 217.14 Section 217.14 Foreign Relations AGENCY FOR INTERNATIONAL DEVELOPMENT NONDISCRIMINATION ON THE BASIS OF HANDICAP IN... inquiries. (a) Except as provided in paragraphs (b) and (c) of this section, a recipient may not conduct a...

48 CFR 1552.217-70 - Evaluation of contract options.

Science.gov (United States)

2010-10-01

... options. 1552.217-70 Section 1552.217-70 Federal Acquisition Regulations System ENVIRONMENTAL PROTECTION... 1552.217-70 Evaluation of contract options. As prescribed in 1517.208(a), insert the following solicitation provision in Requests for Proposals when the solicitation contains options. Evaluation of Contract...

48 CFR 52.217-3 - Evaluation Exclusive of Options.

Science.gov (United States)

2010-10-01

... Options. 52.217-3 Section 52.217-3 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION....217-3 Evaluation Exclusive of Options. As prescribed in 17.208(a), insert a provision substantially the same as the following in solicitations when the solicitation includes an option clause and does...

47 CFR 25.217 - Default service rules.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 2 2010-10-01 2010-10-01 false Default service rules. 25.217 Section 25.217 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... licenses to operate a satellite system in a frequency band granted after a domestic frequency allocation...

49 CFR 1544.217 - Law enforcement personnel.

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1544.217 Section 1544... AND COMMERCIAL OPERATORS Operations § 1544.217 Law enforcement personnel. (a) The following applies to... for law enforcement personnel meeting the qualifications and standards specified in §§ 1542.215 and...

20 CFR 217.25 - Who may cancel an application.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Who may cancel an application. 217.25 Section... APPLICATION FOR ANNUITY OR LUMP SUM Cancellation of Application § 217.25 Who may cancel an application. An application may be cancelled by the claimant or a person described in § 217.17. If the claimant is deceased...

31 CFR 31.217 - Confidentiality of information.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Confidentiality of information. 31.217 Section 31.217 Money and Finance: Treasury Office of the Secretary of the Treasury TROUBLED ASSET... from a source other than the retained entity. (b) Prohibitions. The retained entity shall not: (1...

20 CFR 725.217 - Determination of dependency; surviving divorced spouse.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; surviving divorced spouse. 725.217 Section 725.217 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION... Benefits) § 725.217 Determination of dependency; surviving divorced spouse. An individual who is the miner...

48 CFR 217.7506 - Spare parts breakout program.

Science.gov (United States)

2010-10-01

..., DoD Supply Chain Materiel Management Regulation, Chapter 8, Section C8.3, for spare parts breakout... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Spare parts breakout program. 217.7506 Section 217.7506 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS...

5 CFR 532.217 - Appropriated fund survey jobs.

Science.gov (United States)

2010-01-01

... Laundry Worker 1 Food Service Worker 2 Cook 8 (e) A lead agency must obtain prior approval of OPM to add a... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Appropriated fund survey jobs. 532.217 Section 532.217 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS...

Requirement of histidine 217 for ubiquinone reductase activity (Qi site) in the cytochrome bc1 complex.

Science.gov (United States)

Gray, K A; Dutton, P L; Daldal, F

1994-01-25

Folding models suggest that the highly conserved histidine 217 of the cytochrome b subunit from the cytochrome bc1 complex is close to the quinone reductase (Qi) site. This histidine (bH217) in the cytochrome b polypeptide of the photosynthetic bacterium Rhodobacter capsulatus has been replaced with three other residues, aspartate (D), arginine (R), and leucine (L). bH217D and bH217R are able to grow photoheterotrophically and contain active cytochrome bc1 complexes (60% of wild-type activity), whereas the bH217L mutant is photosynthetically incompetent and contains a cytochrome bc1 complex that has only 10% of the wild-type activity. Single-turnover flash-activated electron transfer experiments show that cytochrome bH is reduced via the Qo site with near native rates in the mutant strains but that electron transfer between cytochrome bH and quinone bound at the Qi site is greatly slowed. These results are consistent with redox midpoint potential (Em) measurements of the cytochrome b subunit hemes and the Qi site quinone. The Em values of cyt bL and bH are approximately the same in the mutants and wild type, although the mutant strains have a larger relative concentration of what may be the high-potential form of cytochrome bH, called cytochrome b150. However, the redox properties of the semiquinone at the Qi site are altered significantly. The Qi site semiquinone stability constant of bH217R is 10 times higher than in the wild type, while in the other two strains (bH217D and bH217L) the stability constant is much lower than in the wild type. Thus H217 appears to have major effects on the redox properties of the quinone bound at the Qi site. These data are incorporated into a suggestion that H217 forms part of the binding pocket of the Qi site in a manner reminiscent of the interaction between quinone bound at the Qb site and H190 of the L subunit of the bacterial photosynthetic reaction center.

20 CFR 217.10 - Application filed after death.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Application filed after death. 217.10 Section... APPLICATION FOR ANNUITY OR LUMP SUM Applications § 217.10 Application filed after death. (a) A survivor... expenses dies before applying for the lump-sum death payment under part 234 of this chapter. The...

Pt.2. Charge and mass analysis at 217MeV bombarding energy

International Nuclear Information System (INIS)

Galin, J.; Gatty, B.; Guerreau, D.; Lefort, M.; Tarrago, X.; Agarwal, S.; Babinet, R.; Cauvin, B.; Girard, J.; Nifenecker, H.

1977-01-01

Atomic numbers and masses have been identified for the fragments (12 40 Ar (217MeV) + 197 Au. Even for such a large mass asymmetry in the entrance channel it is shown how difficult it is, for some part of the cross section, to distinguish between a classical deep inelastic phenomenon and the formation of a true compound nucleus followed by symmetric fission. The two reaction mechanisms are then studied separately in a critical way comparing with existing models

20 CFR 217.26 - How to cancel an application.

Science.gov (United States)

2010-04-01

... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false How to cancel an application. 217.26 Section... APPLICATION FOR ANNUITY OR LUMP SUM Cancellation of Application § 217.26 How to cancel an application. An application may be cancelled under the following conditions: (a) Before an annuity is awarded. The application...

18 CFR 2.17 - Price discrimination and anticompetitive effect (price squeeze issue).

Science.gov (United States)

2010-04-01

... INTERPRETATIONS Statements of General Policy and Interpretations Under the Federal Power Act § 2.17 Price... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Price discrimination and anticompetitive effect (price squeeze issue). 2.17 Section 2.17 Conservation of Power and Water...

Investigation of octupole deformations in the Fr217 nucleus by yrast spectroscopy

International Nuclear Information System (INIS)

Hulne, S.

1988-01-01

The spectroscopic characteristics of the yrast levels of Fr217 are determined. The level scheme up to a value of J = (39/2 + ) for angular momentum and parity is established. The production of the Fr217 nucleus in a heavy ion collision reaction was only possible by using a radioactive Pb210 target. The method for preparing the target is described. The Fr217 nucleus belongs to the category of nuclei showing octupole effects. Mass A = 217 seems to be the lower limit of the region where these effects occur [fr

31 CFR 800.217 - Hold.

Science.gov (United States)

2010-07-01

... and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF INVESTMENT... FOREIGN PERSONS Definitions § 800.217 Hold. The terms hold(s) and holding mean legal or beneficial ownership, whether direct or indirect, whether through fiduciaries, agents, or other means. ...

49 CFR 397.217 - Waiver processing.

Science.gov (United States)

2010-10-01

... MATERIALS; DRIVING AND PARKING RULES Preemption Procedures § 397.217 Waiver processing. (a) The... application without prejudice if: (1) he or she determines that there is insufficient information upon which...

9 CFR 93.217 - Import permit and declaration for poultry.

Science.gov (United States)

2010-01-01

... poultry. 93.217 Section 93.217 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE EXPORTATION AND IMPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS...

14 CFR 217.1 - Definitions.

Science.gov (United States)

2010-01-01

... passengers when traveling free or pursuant to token charges: (1) Directors, officers, employees, and others authorized by the air carrier operating the aircraft; (2) Directors, officers, employees, and others... remuneration. (This definition is for 14 CFR part 217 traffic reporting purposes and may differ from the...

MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

International Nuclear Information System (INIS)

Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming

2016-01-01

MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

MiR-217 is down-regulated in psoriasis and promotes keratinocyte differentiation via targeting GRHL2

Energy Technology Data Exchange (ETDEWEB)

Zhu, Haigang; Hou, Liyue; Liu, Jingjing; Li, Zhiming, E-mail: lizm_1001@sina.com

2016-02-26

MiR-217 is a well-known tumor suppressor, and its down-regulation has been shown in a wide range of solid and leukaemic cancers. However, the biological role of miR-217 in psoriasis pathogenesis, especially in keratinocyte hyperproliferation and differentiation, is not clearly understood. In this study, we found the expression of miR-217 was markedly down-regulated in psoriasis keratinocytes of psoriatic patients. In addition, overexpression of miR-217 inhibited the proliferation and promoted the differentiation of primary human keratinocytes. On the contrary, inhibition of endogenous miR-217 increased cell proliferation and delayed differentiation. Furthermore, Grainyhead-like 2 (GRHL2) was identified as a direct target of miR-217 by luciferase reporter assay. The expression of miR-217 and GRHL2 was inversely correlated in both transfected keratinocytes and in psoriasis lesional skin. Moreover, knocking down GRHL2 expression by siRNA enhanced keratinocyte differentiation. Taken together, our results demonstrate a role for miR-217 in the regulation of keratinocyte differentiation, partially through the regulation of GRHL2. - Highlights: • miR-217 is down-regulated in psoriasis skin lesions. • miR-217 inhibits the proliferation and promotes differentiation of keratinocytes. • GRHL2 is a novel target of miR-217 in keratinocytes. • GRHL2 is up-regulated and inversely correlated with miR-217 in psoriasis skin lesions.

42 CFR 413.217 - Items and services included in the ESRD prospective payment system.

Science.gov (United States)

2010-10-01

... payment system. 413.217 Section 413.217 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT....217 Items and services included in the ESRD prospective payment system. The following items and services are included in the ESRD prospective payment system effective January 1, 2011: (a) Renal dialysis...

miR-217 regulates ethanol-induced hepatic inflammation by disrupting sirtuin 1-lipin-1 signaling.

Science.gov (United States)

Yin, Huquan; Liang, Xiaomei; Jogasuria, Alvin; Davidson, Nicholas O; You, Min

2015-05-01

Ethanol-mediated injury, combined with gut-derived lipopolysaccharide (LPS), provokes generation of proinflammatory cytokines in Kupffer cells, causing hepatic inflammation. Among the mediators of these effects, miR-217 aggravates ethanol-induced steatosis in hepatocytes. However, the role of miR-217 in ethanol-induced liver inflammation process is unknown. Here, we examined the role of miR-217 in the responses to ethanol, LPS, or a combination of ethanol and LPS in RAW 264.7 macrophages and in primary Kupffer cells. In macrophages, ethanol substantially exacerbated LPS-mediated induction of miR-217 and production of proinflammatory cytokines compared with LPS or ethanol alone. Consistently, ethanol administration to mice led to increases in miR-217 abundance and increased production of inflammatory cytokines in isolated primary Kupffer cells exposed to the combination of ethanol and LPS. miR-217 promoted combined ethanol and LPS-mediated inhibition of sirtuin 1 expression and activity in macrophages. Moreover, miR-217-mediated sirtuin 1 inhibition was accompanied by increased activities of two vital inflammatory regulators, NF-κB and the nuclear factor of activated T cells c4. Finally, adenovirus-mediated overexpression of miR-217 led to steatosis and inflammation in mice. These findings suggest that miR-217 is a pivotal regulator involved in ethanol-induced hepatic inflammation. Strategies to inhibit hepatic miR-217 could be a viable approach in attenuating alcoholic hepatitis. Copyright © 2015 American Society for Investigative Pathology. Published by Elsevier Inc. All rights reserved.

48 CFR 1552.217-74 - Option for increased quantity-cost-plus-award-fee contract.

Science.gov (United States)

2010-10-01

... quantity-cost-plus-award-fee contract. 1552.217-74 Section 1552.217-74 Federal Acquisition Regulations... Texts of Provisions and Clauses 1552.217-74 Option for increased quantity—cost-plus-award-fee contract. As prescribed in 1517.208(e), insert this contract clause in cost-plus-award-fee term contracts when...

Microstructure, magnetic properties and magnetic hardening in 2:17 Sm-Co magnets

International Nuclear Information System (INIS)

Tang, W.; Zhang, Y.; Hadjipanayis, G.C.

2002-01-01

A comprehensive and systematic study has been made on Sm(Co,Fe,M,L) z magnets (M=Cu or Ni, and L=Zr or Ti) to completely understand the effects of composition and processing on the microstructure and magnetic properties of magnets. Ti-containing magnets do not have a lamellar phase but exhibit only a cellular microstructure, resulting in a much lower coercivity (below 10 kOe). Ni-containing magnets exhibit a perfect cellular/lamellar microstructure, but without a large domain wall energy gradient at the interface of the 2:17 and 1:5 phases, leading to a low coercivity. Only in the magnets containing both Cu and Zr, a uniform and stable cellular/lamellar microstructure with a high domain wall energy gradient across the 1:5 phase is formed, resulting in high coercivity. These results indicate that the conditions for effective magnetic hardening are: (1) Formation of a cellular/lamellar microstructure, and (2) establishment of a domain wall energy gradient at the cell boundaries. Based on all of these experimental results, the magnetization reversal mechanism of 2:17 Sm-Co magnets can be explained by both the domain wall pinning and nucleation models. The nucleation mechanism holds at any temperature in the Cu-rich magnets, and only above the Curie temperature of the 1:5 phase in the alloys with the lower Cu content. In these cases, the 2:17 cells become magnetically decoupled. (orig.)

48 CFR 1252.217-80 - Department of Labor Safety and Health Regulations for Ship Repairing.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Department of Labor Safety and Health Regulations for Ship Repairing. 1252.217-80 Section 1252.217-80 Federal Acquisition Regulations System DEPARTMENT OF TRANSPORTATION CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1252.217-80...

33 CFR 148.217 - How can a State be designated as an adjacent coastal State?

Science.gov (United States)

2010-07-01

... an adjacent coastal State? 148.217 Section 148.217 Navigation and Navigable Waters COAST GUARD... General § 148.217 How can a State be designated as an adjacent coastal State? (a) Adjacent coastal States... as an adjacent coastal State in the notice may request to be designated as one if the environmental...

48 CFR 217.175 - Multiyear contracts for electricity from renewable energy sources.

Science.gov (United States)

2010-10-01

... electricity from renewable energy sources. 217.175 Section 217.175 Federal Acquisition Regulations System... renewable energy sources. (a) The head of the contracting activity may enter into a contract for a period not to exceed 10 years for the purchase of electricity from sources of renewable energy, as that term...

27 CFR 28.217 - Consignment, shipment, and delivery.

Science.gov (United States)

2010-04-01

... BUREAU, DEPARTMENT OF THE TREASURY LIQUORS EXPORTATION OF ALCOHOL Exportation of Wine With Benefit of Drawback § 28.217 Consignment, shipment, and delivery. The consignment, shipment, and delivery of wines...

49 CFR 1542.217 - Law enforcement personnel.

Science.gov (United States)

2010-10-01

... 49 Transportation 9 2010-10-01 2010-10-01 false Law enforcement personnel. 1542.217 Section 1542... Law enforcement personnel. (a) Each airport operator must ensure that law enforcement personnel used... the criminal laws of the State and local jurisdictions in which the airport is located— (1) A crime...

28 CFR 2.17 - Original jurisdiction cases.

Science.gov (United States)

2010-07-01

... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Original jurisdiction cases. 2.17 Section... Original jurisdiction cases. (a) Following any hearing conducted pursuant to these rules, the Regional Commissioner may designate that a case should be decided as an original jurisdiction case. If the Regional...

37 CFR 2.17 - Recognition for representation.

Science.gov (United States)

2010-07-01

..., registrant, or party (e.g., a corporate officer or general partner of a partnership). In the case of joint..., DEPARTMENT OF COMMERCE RULES OF PRACTICE IN TRADEMARK CASES Representation by Attorneys Or Other Authorized Persons § 2.17 Recognition for representation. (a) Authority to practice in trademark cases. Only an...

12 CFR 217.101 - Premiums on deposits.

Science.gov (United States)

2010-01-01

... from paying interest on a demand deposit. Premiums, whether in the form of merchandise, credit, or cash... AGAINST THE PAYMENT OF INTEREST ON DEMAND DEPOSITS (REGULATION Q) Interpretations § 217.101 Premiums on... that is not, directly or indirectly, related to or dependent on the balance in a demand deposit account...

22 CFR 217.42 - Admissions and recruitment.

Science.gov (United States)

2010-04-01

... activity in question and (ii) alternate tests or criteria that have a less disproportionate, adverse effect... effects of past discrimination pursuant to § 217.6(a) or when a recipient is taking voluntary action to... base prediction equations on first year grades, but shall conduct periodic validity studies against the...

HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr−/− mice

International Nuclear Information System (INIS)

Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung; Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog; Lee, Yun Mi; Sohn, Eunjin; Kim, Jin Sook

2015-01-01

Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr −/− mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr −/− ) mice. In three-week-old male Vldlr −/− mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr −/− mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC 50 = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB

20 CFR 217.27 - Effect of cancellation.

Science.gov (United States)

2010-04-01

... ANNUITY OR LUMP SUM Cancellation of Application § 217.27 Effect of cancellation. When a person cancels an application the effect is the same as though an application was never filed. When an employee cancels his or her application, any application filed by the employee's spouse is also cancelled. However, a request...

miR-217 Regulates Ethanol-Induced Hepatic Inflammation by Disrupting Sirtuin 1–Lipin-1 Signaling

OpenAIRE

Yin, Huquan; Liang, Xiaomei; Jogasuria, Alvin; Davidson, Nicholas O.; You, Min

2015-01-01

Ethanol-mediated injury, combined with gut-derived lipopolysaccharide (LPS), provokes generation of proinflammatory cytokines in Kupffer cells, causing hepatic inflammation. Among the mediators of these effects, miR-217 aggravates ethanol-induced steatosis in hepatocytes. However, the role of miR-217 in ethanol-induced liver inflammation process is unknown. Here, we examined the role of miR-217 in the responses to ethanol, LPS, or a combination of ethanol and LPS in RAW 264.7 macrophages and ...

48 CFR 217.7505 - Limitations on price increases.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Limitations on price... Acquisition of Replenishment Parts 217.7505 Limitations on price increases. This section provides implementing... award, on a sole source basis, a contract for any centrally managed replenishment part when the price of...

48 CFR 217.172 - Multiyear contracts for supplies.

Science.gov (United States)

2010-10-01

... law. For additional policies that apply only to multiyear contracts for weapon systems, see 217.173... requirements of law are met and there are no other statutory restrictions on using a multiyear contract for the... provisions in the contract do not include consideration of recurring manufacturing costs of the contractor...

HL-217, a new topical anti-angiogenic agent, inhibits retinal vascular leakage and pathogenic subretinal neovascularization in Vldlr{sup −/−} mice

Energy Technology Data Exchange (ETDEWEB)

Kim, Junghyun; Kim, Chan-Sik; Jo, Kyuhyung [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Cho, Yun-Seok; Kim, Hyun-Gyu; Lee, Geun-Hyeog [Research and Development Center, Hanlim Pharm. Co. Ltd., 1656-10, Seocho-dong, Seocho-gu, Seoul (Korea, Republic of); Lee, Yun Mi; Sohn, Eunjin [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of); Kim, Jin Sook, E-mail: jskim@kiom.re.kr [Korean Medicine Based Herbal Drug Development Group, Herbal Medicine Research Division, Korea Institute of Oriental Medicine, Daejeon (Korea, Republic of)

2015-01-02

Highlights: • HL-217 is a new synthetic topical anti-angiogenic agent. • HL-217 attenuated subretinal neovascularization in Vldlr{sup −/−} mice. • HL-217 blocked the binding of PDGF-BB to PDGFRβ. - Abstract: HL-217 is a new synthetic angiogenesis inhibitor. Platelet derived growth factor (PDGF) is a vasoactive factor and has been implicated in proliferative retinopathies. In this study, we examined the mechanism of action and efficacy of topical application of HL-217 on subretinal neovascularization in very low-density lipoprotein receptor knockout (Vldlr{sup −/−}) mice. In three-week-old male Vldlr{sup −/−} mice, HL-217 (1.5 or 3 mg/ml) was administered twice per day for 4 weeks by topical eye drop instillation. Neovascular areas were then measured. We used a protein array to evaluate the expression levels of angiogenic factors. The inhibitory effect of HL-217 on the PDGF-BB/PDGFRβ interaction was evaluated in vitro. The neovascular area in the Vldlr{sup −/−} mice was significantly reduced by HL-217. Additionally, HL-217 decreased the expression levels of PDGF-BB protein and VEGF mRNA. Moreover, HL-217 dose-dependently inhibited the PDGF-BB/PDGFRβ interaction (IC{sub 50} = 38.9 ± 0.7 μM). These results suggest that HL-217 is a potent inhibitor of PDGF-BB. HL-217, when applied topically, is an effective inhibitor of subretinal neovascularization due to its ability to inhibit the pro-angiogenic effects of PDGF-BB.

48 CFR 52.217-5 - Evaluation of Options.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Evaluation of Options. 52....217-5 Evaluation of Options. As prescribed in 17.208(c), insert a provision substantially the same as the following: Evaluation of Options (JUL 1990) Except when it is determined in accordance with FAR 17...

Pre-eruptive conditions of dacitic magma erupted during the 21.7 ka Plinian event at Nevado de Toluca volcano, Central Mexico

Science.gov (United States)

Arce, J. L.; Gardner, J. E.; Macías, J. L.

2013-01-01

The Nevado de Toluca volcano in Central Mexico has been active over the last ca. 42 ka, during which tens of km3 of pyroclastic material were erupted and two important Plinian-type eruptions occurred at ca. 21.7 ka (Lower Toluca Pumice: LTP) and ca. 10.5 ka (Upper Toluca Pumice: UTP). Samples from both the LTP and UTP contain plagioclase, amphibole, iron-titanium oxides, and minor anhedral biotite, set in a vesicular, rhyolitic, glassy matrix. In addition, UTP dacites contain orthopyroxene. Analysis of melt inclusions in plagioclase phenocrysts yields H2O contents of 2-3.5 wt.% for LTP and 1.3-3.6 wt.% for UTP samples. Ilmenite-ulvospinel geothermometry yields an average temperature of ~ 868 °C for the LTP magma (hotter than the UTP magma, ~ 842 °C; Arce et al., 2006), whereas amphibole-plagioclase geothermometry yields a temperature of 825-859 °C for the LTP magma. Water-saturated experiments using LTP dacite suggest that: (i) amphibole is stable above 100 MPa and below 900 °C; (ii) plagioclase crystallizes below 250-100 MPa at temperatures of 850-900 °C; and (iii) pyroxene is stable only below pressures of 200-100 MPa and temperatures of 825-900 °C. Comparison of natural and experimental data suggests that the LTP dacitic magma was stored at 150-200 MPa (5.8-7.7 km below the volcano summit). No differences in pressure found between 21.7 ka and 10.5 ka suggest that these two magmas were stored at similar depths. Orthopyroxene produced in lower temperature LTP experiments is compositionally different to those found in UTP natural samples, suggesting that they originated in two different magma batches. Whole-rock chemistry, petrographic features, and mineral compositions suggest that magma mixing was responsible for the generation of the dacitic Plinian LTP eruption.

12 CFR 217.1 - Authority, purpose, and scope.

Science.gov (United States)

2010-01-01

...(t) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12 CFR 20.4). [Reg... 217.1 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM... Reserve Act (12 U.S.C. 371a, 461, 505), section 7 of the International Banking Act of 1978 (12 U.S.C. 3105...

48 CFR 217.7103 - Master agreements and job orders.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Master agreements and job... SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103 Master agreements and job orders. ...

49 CFR 40.217 - Where is other information on the role of STTs and BATs found in this regulation?

Science.gov (United States)

2010-10-01

... BATs found in this regulation? 40.217 Section 40.217 Transportation Office of the Secretary of... Personnel § 40.217 Where is other information on the role of STTs and BATs found in this regulation? You can find other information on the role and functions of STTs and BATs in the following sections of this...

48 CFR 217.7103-3 - Solicitations for job orders.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Solicitations for job... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and Alteration of Vessels 217.7103-3 Solicitations for job orders. (a) When a...

48 CFR 52.217-6 - Option for Increased Quantity.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option for Increased....217-6 Option for Increased Quantity. As prescribed in 17.208(d), insert a clause substantially the same as the following: Option for Increased Quantity (MAR 1989) The Government may increase the...

48 CFR 52.217-8 - Option To Extend Services.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Option To Extend Services....217-8 Option To Extend Services. As prescribed in 17.208(f), insert a clause substantially the same as the following: Option To Extend Services (NOV 1999) The Government may require continued performance...

EFSA CEF Panel (EFSA Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids), 2013. Scientific Opinion on Flavouring Group Evaluation 217, Revision 1 (FGE.217Rev1). Consideration of genotoxic potential for α,β-Unsaturated ketones and precursors from chemical subgroup 4.1 of FGE

DEFF Research Database (Denmark)

Beltoft, Vibe Meister; Binderup, Mona-Lise; Lund, Pia

The Panel on Food Contact Materials, Enzymes, Flavourings and Processing Aids of the European Food Safety Authority was requested to evaluate the genotoxic potential of 12 flavouring substances from subgroup 4.1 of FGE.19 in the Flavouring Group Evaluation 217 (FGE.217). In FGE.217, 6-methylcouma...

The eukaryotic translation elongation factor eEF1A2 induces neoplastic properties and mediates tumorigenic effects of ZNF217 in precursor cells of human ovarian carcinomas

Energy Technology Data Exchange (ETDEWEB)

Sun, Yu; Wong, Nicholas; Guan, Yinghui; Salamanca, Clara M.; Cheng, Jung Chien; Lee, Jonathan M.; Gray, Joe W.; Auersperg, Nelly

2008-04-25

Ovarian epithelial carcinomas (OEC) frequently exhibit amplifications at the 20q13 locus which is the site of several oncogenes, including the eukaryotic elongation factor EEF1A2 and the transcription factor ZNF217. We reported previously that overexpressed ZNF217 induces neoplastic characteristics in precursor cells of OEC. Unexpectedly, ZNF217, which is a transcriptional repressor, enhanced expression of eEF1A2. In this study, array comparative genomic hybridization, single nucleotide polymorphism and Affymetrix analysis of ZNF217-overexpressing cell lines confirmed consistently increased expression of eEF1A2 but not of other oncogenes, and revealed early changes in EEF1A2 gene copy numbers and increased expression at crisis during immortalization. We defined the influence of eEF1A2 overexpression on immortalized ovarian surface epithelial cells, and investigated interrelationships between effects of ZNF217 and eEF1A2 on cellular phenotypes. Lentivirally induced eEF1A2 overexpression caused delayed crisis, apoptosis resistance and increases in serum-independence, saturation densities, and anchorage independence. siRNA to eEF1A2 reversed apoptosis resistance and reduced anchorage independence in eEF1A2-overexpressing lines. Remarkably, siRNA to eEF1A2 was equally efficient in inhibiting both anchorage independence and resistance to apoptosis conferred by ZNF217 overexpression. Our data define neoplastic properties that are caused by eEF1A2 in nontumorigenic ovarian cancer precursor cells, and suggest that eEF1A2 plays a role in mediating ZNF217-induced neoplastic progression.

Time-differential observation of α-particle perturbed angular distribution: g-factor measurements for 217Acsup(gs) and 217Acsup(m)

International Nuclear Information System (INIS)

Maier, K.H.; Decman, D.J.; Grawe, H.; Kluge, H.

1981-01-01

The g-factor measurements of the ground state and an isomeric level in 217 Ac using the DPAD method with α-decay are described in this work. The results of γ-ray g-factor measurements for the isomer and a tentative decay scheme produced by α-γ and γ-γ coincidence experiments are also presented. An analysis of the α-particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (orig.)

CULTIVAR RELEASE-BRS 217 Flora: Early-maturing soybean cultivar

Directory of Open Access Journals (Sweden)

Plínio Itamar de Mello de Souza

2008-01-01

Full Text Available The soybean (Glycine max L. Merr. cultivar BRS 217 Flora was developed by Embrapa and released forproduction in the states of Goiás, Minas Gerais, Bahia, Mato Grosso and the Distrito Federal, Brazil. It is resistant to stemcanker, frog-eye leaf spot, bacterial pustule, and partially resistant to powdery mildew.

Results of the independent verification of radiological remedial action at 217 South 2nd East Street, Monticello, Utah (MS00097)

International Nuclear Information System (INIS)

Crutcher, J.W.; Wilson, M.J.

1990-02-01

In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

Decay analysis of compound nuclei formed in reactions with exotic neutron-rich 9Li projectile and the synthesis of 217At* within the dynamical cluster-decay model

Science.gov (United States)

Kaur, Arshdeep; Kaushal, Pooja; Hemdeep; Gupta, Raj K.

2018-01-01

The decay of various compound nuclei formed via exotic neutron-rich 9Li projectile is studied within the dynamical cluster-decay model (DCM). Following the earlier work of one of us (RKG) and collaborators (M. Kaur et al. (2015) [1]), for an empirically fixed neck-length parameter ΔRemp, the only parameter in the DCM, at a given incident laboratory energy ELab, we are able to fit almost exactly the (total) fusion cross section σfus =∑x=16σxn for 9Li projectile on 208Pb and other targets, with σfus depending strongly on the target mass of the most abundant isotope and its (magic) shell structure. This result shows the predictable nature of the DCM. The neck-length parameter ΔRemp is fixed empirically for the decay of 217At* formed in 9Li + 208Pb reaction at a fixed laboratory energy ELab, and then the total fusion cross section σfus calculated for all other reactions using 9Li as a projectile on different targets. Apparently, this procedure could be used to predict σfus for 9Li-induced reactions where experimental data are not available. Furthermore, optimum choice of "cold" target-projectile combinations, forming "hot" compact configurations, are predicted for the synthesis of compound nucleus 217At* with 8Li + 209Pb as one of the target-projectile combination, or another (t , p) combination 48Ca + 169Tb, with a doubly magic 48Ca, as the best possibility.

48 CFR 1552.217-72 - Option to extend the term of the contract-cost-plus-award-fee contract.

Science.gov (United States)

2010-10-01

... of the contract-cost-plus-award-fee contract. 1552.217-72 Section 1552.217-72 Federal Acquisition...-award-fee contract. As prescribed in 1517.208(c), insert this contract clause in cost-plus-award-fee... Term of the Contract—Cost-Plus-Award-Fee Contract (APR 1984) (a) The Government has the option to...

50 CFR 226.217 - Critical habitat for the Gulf of Maine Distinct Population Segment of Atlantic Salmon (Salmo salar).

Science.gov (United States)

2010-10-01

... Distinct Population Segment of Atlantic Salmon (Salmo salar). 226.217 Section 226.217 Wildlife and... Distinct Population Segment of Atlantic Salmon (Salmo salar). Critical habitat is designated to include all... the Gulf of Maine Distinct Population Segment of Atlantic Salmon (GOM DPS), except for those...

Time-differential observation of alpha -particle perturbed angular distribution; g-factor measurements for /sup 217/Ac/sup gs/ and /sup 217/Ac/sup m/

CERN Document Server

Maier, K H; Grawe, H; Kluge, H

1981-01-01

The g-factor measurements of the ground state and an isomeric level in /sup 217/Ac using the DPAD method with alpha -decay are described. The results of gamma -ray g-factor measurements for the isomer and a tentative decay scheme produced by alpha - gamma and gamma - gamma coincidence experiments are also presented. An analysis of the alpha - particle angular distributions suggests that nuclear deformation affects the observed anisotropy. (13 refs).

5 CFR 531.217 - Special conversion rules for certain non-GS employees.

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Special conversion rules for certain non... SERVICE REGULATIONS PAY UNDER THE GENERAL SCHEDULE Determining Rate of Basic Pay Setting Pay When Appointment Or Position Changes § 531.217 Special conversion rules for certain non-GS employees. When an...

RANS based CFD methodology for a real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR

Energy Technology Data Exchange (ETDEWEB)

Jeong, Jae-Ho, E-mail: jhjeong@kaeri.re.kr [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of); Song, Min-Seop [Department of Nuclear Engineering, Seoul National University, 559 Gwanak-ro, Gwanak-gu, Seoul (Korea, Republic of); Lee, Kwi-Lim [Korea Atomic Energy Research Institute, 989-111 Daedeok-daero, Yuseoung-gu, Daejeon (Korea, Republic of)

2017-03-15

Highlights: • This paper presents a suitable way for a practical RANS based CFD methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI PGSFR. • A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI function in a general-purpose commercial CFD code, CFX. • The RANS based CFD methodology is implemented with high resolution scheme and SST turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC and JNC. Furthermore, the RANS based CFD methodology can be successfully extended to the real scale 217-pin wire-wrapped fuel bundles of KAERI PGSFR. • Three-dimensional thermal-hydraulic characteristics have been also investigated briefly. - Abstract: This paper presents a suitable way for a practical RANS (Reynolds Averaged Navier-Stokes simulation) based CFD (Computational Fluid Dynamics) methodology which is applicable to real scale 217-pin wire-wrapped fuel assembly of KAERI (Korea Atomic Energy Research Institute) PGSFR (Prototype Gen-IV Sodium-cooled Fast Reactor). The main purpose of the current study is to support license issue for the KAERI PGSFR core safety and to elucidate thermal-hydraulic characteristics in a 217-pin wire-wrapped fuel assembly of KAERI PGSFR. A key point of differentiation of the RANS based CFD methodology in this study is adapting an innovative grid generation method using a fortran based in-house code with a GGI (General Grid Interface) function in a general-purpose commercial CFD code, CFX. The innovative grid generation method with GGI function can achieve to simulate a real wire shape with minimizing cell skewness. The RANS based CFD methodology is implemented with high resolution scheme in convection term and SST (Shear Stress Transport) turbulence model in the 7-pin 37-pin, and 127-pin wire-wrapped fuel assembly of PNC (Power reactor and Nuclear fuel

Modification on C217 by auxiliary acceptor toward efficient sensitiser for dye-sensitised solar cells: a theoretical study

Science.gov (United States)

Zhao, Caibin; Jin, Lingxia; Ge, Hongguang; Guo, Xiaohua; Zhang, Qiang; Wang, Wenliang

2018-02-01

In this work, to develop efficient organic dye sensitisers, a series of novel donor-acceptor-π-acceptor metal-free dyes were designed based on the C217 dye by means of modifying different auxiliary acceptors, and their photovoltaic performances were theoretically investigated with systematic density functional theory calculations coupled with the incoherent charge-hopping model. Results showed that the designed dyes possess lower highest occupied molecular orbital (HOMO) and lowest unoccupied molecular orbital (LUMO) levels as well as narrower HOMO-LUMO gaps compared to C217, which indicate their higher light-harvesting efficiency. In addition, using the (TiO2)38 cluster and bidentate bridging model, we predicted that the photoelectric conversion efficiency (PCE) for the C217 dye is as high as 9.92% under air mass (AM) 1.5 illumination (100 mW.cm-2), which is in good agreement with its experimental value (9.60%-9.90%). More interestingly, the cell sensitised by the dye 7 designed in this work exhibits a middle-sized open-circuit voltage of 0.737 V, large short-circuit photocurrent density of 21.16 mAˑcm-2 and a fill factor of 0.801, corresponding to a quite high PCE of 12.49%, denoting the dye 7 is a more promising sensitiser candidate than the C217, and is worth further experimental study.

Validation of the Konsung QD217A for clinical use and self-measurement according to the European Society of Hypertension International Protocol.

Science.gov (United States)

Wu, Ning; Zhang, Xuezhong; Wang, Wen; Zhang, Hongye

2015-08-01

This study aimed to evaluate the accuracy of the automated oscillometric upper arm blood pressure (BP) monitor Konsung QD217A for home BP monitoring according to the European Society of Hypertension International Protocol revision 2010. Three trained observers validated the performance of these devices by comparing the measurements obtained from these devices with those taken using a standard mercury sphygmomanometer. Systolic blood pressure (SBP) and diastolic blood pressure (DBP) were sequentially measured in 33 participants using a standard mercury sphygmomanometer and the Konsung QD217A device. A total of 99 pairs of comparisons were obtained from 33 participants. The QD217A device achieved the targets in part 1 of the validation study. The number of absolute differences between the device and the observers within a range of 5, 10 and 15 mmHg was 70/99, 92/99 and 96/99, respectively, for SBP and 80/99, 94/99 and 99/99, respectively, for DBP. The device also achieved the targets in part 2 of the validation study. A total of 27 and 31 participants for SBP and DBP, respectively, showed at least two of the three device-observers differences within 5 mmHg (required≥24). The number of participants without device-observer difference within 5 mmHg was one for SBP and one for DBP (required≤3). The Konsung upper arm BP monitor QD217A has passed the International Protocol requirements and it can be recommended for clinical use and self-measurement in adults. Copyright © 2015 Wolters Kluwer Health, Inc. All rights reserved.

Use of a genetically enhanced, pediocin-producing starter culture, Lactococcus lactis subsp. lactis MM217, to control Listeria monocytogenes in cheddar cheese

NARCIS (Netherlands)

Buyong, N; Kok, J; Luchansky, JB

1998-01-01

Cheddar cheese was prepared with Lactococcus lactis subsp, lactis MM217, a starter culture which contains pMC117 coding for pediocin PA-1, About 75 liters of pasteurized milk (containing ca, 3.6% fat) was inoculated with strain MM217 (ca, 10(6) CFU per ml) and a mixture of three Listeria

Yeast Interacting Proteins Database: YHR114W, YDL217C [Yeast Interacting Proteins Database

Lifescience Database Archive (English)

Full Text Available y (0) YDL217C TIM22 Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopi...rey gene name TIM22 Prey description Component of the mitochondrial Tim54p-Tim22p complex involved in insertion of polytopic

9 CFR 381.217 - Authority for condemnation or seizure under other provisions of law.

Science.gov (United States)

2010-01-01

... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Authority for condemnation or seizure... Detention; Seizure and Condemnation; Criminal Offenses § 381.217 Authority for condemnation or seizure under other provisions of law. The provisions of this subpart relating to detention, seizure, condemnation and...

Microstructural changes during the slow-cooling annealing of nanocrystalline SmCo 2:17 type magnets

International Nuclear Information System (INIS)

Romero, S.A.; Campos, M.F. de; Castro, J.A. de; Moreira, A.J.; Landgraf, F.J.G.

2013-01-01

Highlights: ► Use of the Stoner-Wohlfarth Callen Liu Cullen model in 2:17 type magnets. ► Data suggest exchange coupling between Sm2(CoFe)17 and Sm(CoCu)5 phases. ► It is given structural data for phase Sm0.33Zr0.67TM3, with TM=Co,Fe,Cu. ► The beneficial effect of the slow cooling treatment is explained. - Abstract: The microstructure and magnetic properties of 2:17 type isotropic magnets were investigated. The slow cooling heat treatment (cooling at 1 °C/min from 820 to 400 °C, and isothermal treatment during 24 h) was interrupted after the temperatures of 820, 700, 600 and 500 °C and their hysteresis were measured with fields up to 9 T. The fully heat treated sample presented coercivity (μ 0 H) of 3.32 T, after 24 h at 400 °C. The microstructure was investigated with SEM–FEG (Scanning Electron Microscope with Field Emission Gun) and X-ray Diffraction Rietveld analysis. The application of the Stoner–Wohlfarth–Callen–Liu–Cullen (SW–CLC) model points out exchange coupling between ferromagnetic Sm 2 (CoFe) 17 nanocells and ferromagnetic Sm(CoCu) 5 present at the cell boundary phase. The results are interpreted with the double shell model: first-a cobalt-rich ferromagnetic Sm(CoCu) 5 shell originates exchange coupling and second-a copper-rich paramagnetic Sm(CuCo) 5 shell produces magnetic decoupling. This double shell helps to maximize coercivity and remanence. The anisotropy field of the Sm 2 (CoFe) 17 cell phase was estimated in 7 T with the SW–CLC model.

Hormone withdrawal-associated symptoms with ethinylestradiol 20 µg/drospirenone 3 mg (24/4 regimen versus ethinylestradiol 20 µg/desogestrel 150 µg (21/7 regimen

Directory of Open Access Journals (Sweden)

Bitzer J

2015-05-01

Full Text Available Johannes Bitzer,1 Maria Jesusa Banal-Silao,2 Hans-Joachim Ahrendt,3 Jaime Restrepo,4 Marion Hardtke,5 Ulrike Wissinger-Graefenhahn,6 Dietmar Trummer7 1Department of Obstetrics and Gynecology, University Hospital of Basel, Basel, Switzerland; 2University of the Philippines College of Medicine, Manila, Philippines; 3Praxis für Frauenheilkunde, Klinische Forschung und Weiterbildung (Clinical Research and Further Education, Magdeburg, Germany; 4Centro de Investigación Clínica, Clinica Medellin Poblado, Medellin, Colombia; 5Global Clinical Development Operations, Bayer Pharma AG, Berlin, Germany; 6Global Medical Affairs Women’s Healthcare, Bayer Pharma AG, Berlin, Germany; 7Clinical Statistics Europe, Bayer Pharma AG, Berlin, Germany Objective: To assess whether the combined oral contraceptive (COC ethinylestradiol (EE 20 µg/drospirenone 3 mg taken in a 24/4-day regimen (ie, 4-day hormone-free interval is more effective than an EE 20 µg/desogestrel (DSG 150 µg COC taken in a 21/7-day regimen (ie, 7-day hormone-free interval in reducing hormone withdrawal-associated symptoms (HWAS.Methods: This double-blind, randomized study (NLM identifier: NCT01076582 was conducted at 34 centers in 12 countries. Otherwise healthy women who experienced ≥2 HWAS of headache, pelvic pain, and/or bloating when using their current COCs in a 21/7-day regimen were recruited. Subjects rated the severity of their HWAS daily on a seven-point Likert scale during a baseline cycle and during four 28-day cycles with EE/drospirenone 24/4 (n=290 or EE/DSG 21/7 (n=304. The primary variable was the mean change from baseline to cycle 4 in the composite HWAS score (sum of scores for all three symptoms during cycle days 22–28.Results: In the EE/drospirenone 24/4 group, the mean (standard deviation composite HWAS score during cycle days 22–28 was reduced from 42.2 (24.8 at baseline to 12.8 (13.4 at cycle 4 (change from baseline: -30.3 [22.9]. In the EE/DSG 21/7 group, the

Production and identification of an isomeric state in 217Pa and the new isotope 218Pa

International Nuclear Information System (INIS)

Schmidt, K.H.; Faust, W.; Muenzenberg, G.; Ewald, H.; Guettner, K.; Clerc, H.G.; Lang, W.; Wohlfarth, H.; Pielenz, K.

1977-02-01

Evaporation residues produced in the reaction 40Ar(176 MeV) + 181Ta were separated from the primary beam by the velocity filter SHIP and detected by a ΔE-E counter telescope. The technique of delayed coincidences was applied to individually identify the reaction products implanted into a Si-surface barrier detector by their subsequent alpha decays. The previously unknown nucleus 218Pa was identified by its known daughter decays. 218Pa was found to decay with Esub(α) = (9.614 +- 0.015) MeV, T(1/2) = (140 +- 50) μs and probably also with Esub(α) = (9.535 +- 0.020) MeV, T(1/2) = (150 + 100 - 50) μs. The half-life of the 8.33 MeV alpha decay of 217Pa was determined to be (o.2 +- 0.4) ms. Anew isomer in 217 Pa was found which decays with Esub(α) = (10.16 +- 0.02) MeV and T(1/2) = (1.8 +- 0.5) ms. (orig./BJ) [de

Radial cracks and fracture mechanism of radially oriented ring 2:17 type SmCo magnets

International Nuclear Information System (INIS)

Tian Jianjun; Pan Dean; Zhou Hao; Yin Fuzheng; Tao Siwu; Zhang Shengen; Qu Xuanhui

2009-01-01

Radially oriented ring 2:17 type SmCo magnets have different microstructure in the radial direction (easy magnetization) and axial direction (hard magnetization). The structure of the cross-section in radial direction is close-packed atomic plane, which shows cellular microstructure. The microstructure of the cross-section in axial direction consists of a mixture of rhombic microstructure and parallel lamella phases. So the magnets have obvious anisotropy of thermal expansion in different directions. The difference of the thermal expansion coefficients reaches the maximum value at 830-860 deg. C, which leads to radial cracks during quenching. The magnets have high brittlement because there are fewer slip systems in crystal structure. The fracture is brittle cleavage fracture.

5 CFR 792.217 - Are part-time Federal employees eligible for the child care subsidy program?

Science.gov (United States)

2010-01-01

... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Are part-time Federal employees eligible... the Child Care Subsidy Program Legislation and to Whom Does It Apply? § 792.217 Are part-time Federal employees eligible for the child care subsidy program? Federal employees who work part-time are eligible for...

Health and relationships with leisure time activities in Swedish children aged 2-17 years.

Science.gov (United States)

Berntsson, Leeni T; Ringsberg, Karin C

2014-09-01

Three cross-sectional time series studies, randomised and stratified for age and gender, were performed on children aged 2-17, studying their health and well-being. The studies were performed in the Nordic countries in 1984, 1996 and 2011. Long-term illness (LTI) and psychosomatic complaints (PSC) increased during the period. Data were collected from mailed questionnaires. Data of 1461 Swedish children from 2011 were used and compared with data from 1984 and 1996. Relationships between the health indicators (the absence of LTI, 13 diagnoses, the absence of PSC, six symptoms, six items of well-being) and 12 activities were analysed. A total of 83.2% of the children were healthy and 16.8% had at least one LTI, boys 19.1% and girls 14.5%. PSC increased from 18.6% in 1996 to 23.1% in 2011. The distribution was higher in girls. Girls were more active than boys during leisure time. 'Reading books', 'visiting friends', 'listening to music' and 'activity in organisations' were related to an absence of PSC, LTI and well-being. 'Surfing/blogging on the Internet' was negatively related to LTI, PSC and well-being. Multiple regression showed that that 'visits or is visited by friends' was related with a low probability for LTI and also with a high probability for well-being. In the logistic regression analyses, the following variables were seen as promoting health most: 'visits or is visited by friends' and 'is active in organizations' for children aged 2-17 years, especially for boys and well-being. The health of Swedish children declined between 1984 and 2011. Positive relationships were found between some activities and health as well as other activities related to ill health. The results suggest an increased focus on the activities that have positive relationships with health in order to promote health among children. © 2013 Nordic College of Caring Science.

Posttranscriptional silencing of the lncRNA MALAT1 by miR-217 inhibits the epithelial–mesenchymal transition via enhancer of zeste homolog 2 in the malignant transformation of HBE cells induced by cigarette smoke extract

International Nuclear Information System (INIS)

Lu, Lu; Luo, Fei; Liu, Yi; Liu, Xinlu; Shi, Le; Lu, Xiaolin; Liu, Qizhan

2015-01-01

Lung cancer is regarded as the leading cause of cancer-related deaths, and cigarette smoking is one of the strongest risk factors for the development of lung cancer. However, the mechanisms for cigarette smoke-induced lung carcinogenesis remain unclear. The present study investigated the effects of an miRNA (miR-217) on levels of an lncRNA (MALAT1) and examined the role of these factors in the epithelial–mesenchymal transition (EMT) induced by cigarette smoke extract (CSE) in human bronchial epithelial (HBE) cells. In these cells, CSE caused decreases of miR-217 levels and increases in lncRNA MALAT1 levels. Over-expression of miR-217 with a mimic attenuated the CSE-induced increase of MALAT1 levels, and reduction of miR-217 levels by an inhibitor enhanced expression of MALAT1. Moreover, the CSE-induced increase of MALAT1 expression was blocked by an miR-217 mimic, indicating that miR-217 negatively regulates MALAT1 expression. Knockdown of MALAT1 reversed CSE-induced increases of EZH2 (enhancer of zeste homolog 2) and H3K27me3 levels. In addition to the alteration from epithelial to spindle-like mesenchymal morphology, chronic exposure of HBE cells to CSE increased the levels of EZH2, H3K27me3, vimentin, and N-cadherin and decreased E-cadherin levels, effects that were reversed by MALAT1 siRNA or EZH2 siRNA. The results indicate that miR-217 regulation of EZH2/H3K27me3 via MALAT1 is involved in CSE-induced EMT and malignant transformation of HBE cells. The posttranscriptional silencing of MALAT1 by miR-217 provides a link, through EZH2, between ncRNAs and the EMT and establishes a mechanism for CSE-induced lung carcinogenesis. - Highlights: • CSE exposure decreases miR-217 levels and increases MALAT1 levels. • miR-217 negatively regulates MALAT1 expression. • MALAT1, via EZH2, is involved in the EMT of CSE-transformed HBE cells.

The Effect of 217 Hz Magnetic Field of Cell Phone with Different Intensities on Apoptosis of Normal and Cancerous Cells Treated with Chemotherapy Drug

Directory of Open Access Journals (Sweden)

Mahsa Mansourian

2012-03-01

Full Text Available Background: According to the increasing development of home and business electronic equipment in today's world, the biological effects of ELF magnetic fields have been studied at two molecular-cellular and animal- human levels. Considering the therapeutic viewpoint of this study regarding the effects of low-frequency fields of mobile phone, the effect of acute exposure to this field on chemotherapy will be studied.Materials and Methods: In this experimental study, based on measurement of the intensity of the magnetic fields from mobile phones in another research, flux densities of magnetic field of 159.44, 93.25 and 120µ tesla with frequency of 217Hz was generated in magnetic field generator system, and the apoptosis level in K562 cancer cells and healthy cells of lymphocytes was assessed after exposure to field using flow cytometry method. This evaluation method was also performed for the cells treated with bleomycin after exposure to this field.Results: 217 Hz magnetic field exposure significantly increases the rate of apoptosis percentage (p > 0.05 in K562 cancer cells and in two intensities of 120 and 159.44µ tesla compared to the control group, but such effect is not observed in lymphocyte cells. Bleomycin-induced apoptosis percentage following exposure to the mentioned magnetic field shows no significant difference compared to the group of treatment with drug and without field exposure. This lack of significant difference is observed between the groups of drug after field exposure and field alone as well as between groups exposed to field and groups treated with bleomycin.Conclusion: Study results showed that 217 Hz magnetic field of mobile phone can induce apoptosis on cancer cells, but it has no effect on healthy cells. Thus, in order to use mobile phone as an effective factor in their treatment, some studies should be conducted at animal-human level.

Aging method for electronic components and systems based on MIL-HDBK 217

International Nuclear Information System (INIS)

Declercq, M.; Simoens, F.

1984-01-01

Accelerated aging tests as requested to comply IEEE Std 323-1974, rise the question of the availability of an adequate aging model. After getting through the usual models, the authors describe an aging methodology based on MIL-HDBK 217. The method, taking into account several stress factors, is shown to yield on acceptable acceleration of time, while reducing the relative importance of temperature. Practical implementation of acceleration testing is discussed, and a summary of the gained experience is made and discussed in the scope of the philosophy of IEEE Std 650. Only natural thermal aging and functional aging, excluding irradiation or thermal shocks, are considered [fr

MicroRNA and cellular targets profiling reveal miR-217 and miR-576-3p as proviral factors during Oropouche infection.

Directory of Open Access Journals (Sweden)

Victor Emmanuel Viana Geddes

2018-05-01

Full Text Available Oropouche Virus is the etiological agent of an arbovirus febrile disease that affects thousands of people and is widespread throughout Central and South American countries. Although isolated in 1950's, still there is scarce information regarding the virus biology and its prevalence is likely underestimated. In order to identify and elucidate interactions with host cells factors and increase the understanding about the Oropouche Virus biology, we performed microRNA (miRNA and target genes screening in human hepatocarcinoma cell line HuH-7. Cellular miRNAs are short non-coding RNAs that regulates gene expression post-transcriptionally and play key roles in several steps of viral infections. The large scale RT-qPCR based screening found 13 differentially expressed miRNAs in Oropouche infected cells. Further validation confirmed that miR-217 and miR-576-3p were 5.5 fold up-regulated at early stages of virus infection (6 hours post-infection. Using bioinformatics and pathway enrichment analysis, we predicted the cellular targets genes for miR-217 and miR-576-3p. Differential expression analysis of RNA from 95 selected targets revealed genes involved in innate immunity modulation, viral release and neurological disorder outcomes. Further analysis revealed the gene of decapping protein 2 (DCP2, a previous known restriction factor for bunyaviruses transcription, as a miR-217 candidate target that is progressively down-regulated during Oropouche infection. Our analysis also showed that activators genes involved in innate immune response through IFN-β pathway, as STING (Stimulator of Interferon Genes and TRAF3 (TNF-Receptor Associated Factor 3, were down-regulated as the infection progress. Inhibition of miR-217 or miR-576-3p restricts OROV replication, decreasing viral RNA (up to 8.3 fold and virus titer (3 fold. Finally, we showed that virus escape IFN-β mediated immune response increasing the levels of cellular miR-576-3p resulting in a decreasing of

Knockdown of AMPKα decreases ATM expression and increases radiosensitivity under hypoxia and nutrient starvation in an SV40-transformed human fibroblast cell line, LM217.

Science.gov (United States)

Murata, Yasuhiko; Hashimoto, Takuma; Urushihara, Yusuke; Shiga, Soichiro; Takeda, Kazuya; Jingu, Keiichi; Hosoi, Yoshio

2018-01-22

Presence of unperfused regions containing cells under hypoxia and nutrient starvation contributes to radioresistance in solid human tumors. It is well known that hypoxia causes cellular radioresistance, but little is known about the effects of nutrient starvation on radiosensitivity. We have reported that nutrient starvation induced decrease of mTORC1 activity and decrease of radiosensitivity in an SV40-transformed human fibroblast cell line, LM217, and that nutrient starvation induced increase of mTORC1 activity and increase of radiosensitivity in human liver cancer cell lines, HepG2 and HuH6 (Murata et al., BBRC 2015). Knockdown of mTOR using small interfering RNA (siRNA) for mTOR suppressed radiosensitivity under nutrient starvation alone in HepG2 cells, which suggests that mTORC1 pathway regulates radiosensitivity under nutrient starvation alone. In the present study, effects of hypoxia and nutrient starvation on radiosensitivity were investigated using the same cell lines. LM217 and HepG2 cells were used to examine the effects of hypoxia and nutrient starvation on cellular radiosensitivity, mTORC1 pathway including AMPK, ATM, and HIF-1α, which are known as regulators of mTORC1 activity, and glycogen storage, which is induced by HIF-1 and HIF-2 under hypoxia and promotes cell survival. Under hypoxia and nutrient starvation, AMPK activity and ATM expression were increased in LM217 cells and decreased in HepG2 cells compared with AMPK activity under nutrient starvation alone or ATM expression under hypoxia alone. Under hypoxia and nutrient starvation, radiosensitivity was decreased in LM217 cells and increased in HepG2 cells compared with radiosensitivity under hypoxia alone. Under hypoxia and nutrient starvation, knockdown of AMPK decreased ATM activity and increased radiation sensitivity in LM217 cells. In both cell lines, mTORC1 activity was decreased under hypoxia and nutrient starvation. Under hypoxia alone, knockdown of mTOR slightly increased ATM

Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities In Support Marine and Hydrokinetic Energy Deployment: Task 2.1.7 Permitting and Planning Fiscal Year 2012 Year-End Report

Energy Technology Data Exchange (ETDEWEB)

Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Judd, Chaeli R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2012-09-01

This fiscal year 2012 year-end report summarizes activities carried out under DOE Water Power task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the MHK industry, including regulatory and resource management agencies, tribes, NGOs, and industry.

Swedish parents' activities together with their children and children's health: a study of children aged 2-17 years.

Science.gov (United States)

Berntsson, Leeni T; Ringsberg, Karin C

2014-11-01

Nordic children's health has declined. Studies show that parents' engagement in children's leisure-time activities might provide beneficial health outcomes for children. The aim of the present study was to examine the association between Swedish parents' activities together with their children, the parents' experiences of time pressure and their children's health. Data of 1461 Swedish children aged 2-17 years old that were collected in the NordChild study of 2011 were used. We analyzed physical health, diseases and disabilities, psychosomatic health and well-being, and the parents' experiences of time pressure; and we calculated the associations between parental activity together with the child and health indicators. Activities that were significantly and positively associated with children's health at ages 2-17 years of age were: playing and playing games; going to the cinema, theatre, and sporting events; reading books; playing musical instruments/singing; sports activities; watching TV/video/DVD. Playing video games or computer games, driving child to activities and going for walks were significantly and positively associated at age groups 7-12 years and 13-17 years. Activities that were negatively associated with health were: surfing/blogging on the Internet, going shopping and doing homework. Parents who were not experiencing time pressures had a higher level of activity together with their children. The parental experience of time pressure was associated with work time, with less homework activity and more symptoms in children. The family and home are important settings for the development of children's health we found eight parental activities together with their children that promoted the children's health parents' working time and their time pressure experiences affected their activities with their children there is a need for an increased focus on parental activities that are positively associated with children's health. © 2014 the Nordic Societies of

Snow hazard potential evaluation along G217 highway in Tianshan mountains by using GIS and RS

Science.gov (United States)

Tao, Jianwei

2007-11-01

Snow hazard especially avalanche potential along G217 national highway in Tianshan Mountains using remote sensing and GIS is evaluated and compared with actual site records of avalanche in a test area. Most places of the actual avalanche accidents are consistent with the places with the high snow hazard potential. But there are several places of the avalanche were not in the high hazard potential areas. The reason for this difference is discussed.

Hypoxia-inducible factors regulate pluripotency factor expression by ZNF217- and ALKBH5-mediated modulation of RNA methylation in breast cancer cells.

Science.gov (United States)

Zhang, Chuanzhao; Zhi, Wanqing Iris; Lu, Haiquan; Samanta, Debangshu; Chen, Ivan; Gabrielson, Edward; Semenza, Gregg L

2016-10-04

Exposure of breast cancer cells to hypoxia increases the percentage of breast cancer stem cells (BCSCs), which are required for tumor initiation and metastasis, and this response is dependent on the activity of hypoxia-inducible factors (HIFs). We previously reported that exposure of breast cancer cells to hypoxia induces the ALKBH5-mediated demethylation of N6-methyladenosine (m6A) in NANOG mRNA leading to increased expression of NANOG, which is a pluripotency factor that promotes BCSC specification. Here we report that exposure of breast cancer cells to hypoxia also induces ZNF217-dependent inhibition of m6A methylation of mRNAs encoding NANOG and KLF4, which is another pluripotency factor that mediates BCSC specification. Although hypoxia induced the BCSC phenotype in all breast-cancer cell lines analyzed, it did so through variable induction of pluripotency factors and ALKBH5 or ZNF217. However, in every breast cancer line, the hypoxic induction of pluripotency factor and ALKBH5 or ZNF217 expression was HIF-dependent. Immunohistochemistry revealed that expression of HIF-1α and ALKBH5 was concordant in all human breast cancer biopsies analyzed. ALKBH5 knockdown in MDA-MB-231 breast cancer cells significantly decreased metastasis from breast to lungs in immunodeficient mice. Thus, HIFs stimulate pluripotency factor expression and BCSC specification by negative regulation of RNA methylation.

Echomorphology of cardiomyopathy: review of 217 cases from 1999 to 2010

International Nuclear Information System (INIS)

Ilyas, S.; Ilyas, H.; Fawad, A.; Hameed, A.; Fazli, A.

2013-01-01

Objective: To study echocardiogram features of different types of cardiomyopathy presenting over a 12 year period at a single centre in Peshawar. Methods: The series comprised a retrospective review of 13,788 consecutive echocardiograms carried out at the Muhammadi Hospital International Medical Research Centre, Hayatabad, Peshawar, from January 1999 to December 2010. Patients were split into two: Group I with paediatric and adolescent cases (0-18 years) and Group II with adults (>18 years). In the adult group, women with peripartum cardiomyopathy were subdivided into two groups of 18-30 years and 30 to 44 years. Standard Echo B and M modes and Doppler parameters were recorded to ascertain the diagnoses of common primary and secondary cardiomyopathies. Patients with myocarditis with chambers dilatation and global dysfunction, and cardiopathy associated with major cardiovascular diseases were excluded. SPSS 14 was used for statistical analysis. Results: Cardiomyopathy was diagnosed in 217 (1.57%) cases. There were 144 (66%) cases of dilated cardiomyopathy with a mean age of 13+-14.8 years; 17 (8%) cases of hypertrophic cardiomyopathy with a mean age of 12+-11.5 years; and 7 (3%) cases of restrictive cardiomyopathy with a mean age of 31+-7.8 years. Primary cardiac amyloidosis was confirmed in 9 (4%) cases, and peripartum cardiomyopathy in 25 (11%) females. Rare subtypes were found in 15 (7%) cases. Conclusion: DCM was the most frequently diagnosed subtype of cardiomyopathy followed by HCM in both the adult and paediatric age groups. (author)

Fluid-mixing studies in a hexagonal 217-pin wire-wrapped rod bundle

International Nuclear Information System (INIS)

Symolon, P.D.; Todreas, N.E.

1981-02-01

Mixing, pressure drop, and flow split experiments were performed on a 217 pin LMFBR fuel bundle with a pitch to diameter ratio of 1.25 and a lead length of 12 inches. It was found that the turbulent flow data could best be characterized by the energy parameter C/sub 1L/=.106, which is 9% higher than the value from the correlation of Chiu et al. Chiu's correlation was developed on a data base of 61 and 91 pins. The spread of existing data about the correlation is +- 25%, but the error band on our data is expected to be less (approx. +- 10% since injection depth effects were not previously considered). This result is consistent with the concept of increased swirl flow in larger bundles

26 CFR 1.217-2 - Deduction for moving expenses paid or incurred in taxable years beginning after December 31, 1969.

Science.gov (United States)

2010-04-01

... chapter (Employment Tax Regulations). The term self-employed individual as used in this section is defined... within such period. (b) Definition of moving expenses—(1) In general. Section 217(b) defines the term... placement charges which are, in essence, prepayments of interest, or the purchase price of the residence...

Analysis the findings of chest radiograph and CT scan in 217 acute thoracic trauma

International Nuclear Information System (INIS)

Huang Shaoying

2005-01-01

Objective: To evaluate chest radiograph and CT scan in assessing acute thoracic trauma. Methods: Retrospectively analyzed the findings of chest radiograph and CT scan in 217 cases of acute thoracic trauma and positive rate of each modality was compared. Results: The positive rate of rib and clavicle fracture was higher in chest radiograph than these in CT scan. But the positive rate of chest wall hematoma, mediastinum and subcutaneous emphysema, pneumothorax, hydropneumothorax, damage of lung parenchyma and traumatic pulmonary atelectasis was higher in CT scan than those in chest radiograph. Conclusion: The application of the combined imaging modalities improves assessing of acute thoracic trauma, because the imaging manifestation of the lesion is various. (authors)

Recent extensions and use of the statistical model code EMPIRE-II - version: 2.17 Millesimo

International Nuclear Information System (INIS)

Herman, M.

2003-01-01

This lecture notes describe new features of the modular code EMPIRE-2.17 designed to perform comprehensive calculations of nuclear reactions using variety of nuclear reaction models. Compared to the version 2.13, the current release has been extended by including Coupled-Channel mechanism, exciton model, Monte Carlo approach to preequilibrium emission, use of microscopic level densities, widths fluctuation correction, detailed calculation of the recoil spectra, and powerful plotting capabilities provided by the ZVView package. The second part of this lecture concentrates on the use of the code in practical calculations, with emphasis on the aspects relevant to nuclear data evaluation. In particular, adjusting model parameters is discussed in details. (author)

VizieR Online Data Catalog: Catalog of Eq.Widths of Interstellar 217nm Band (Friedemann 1992)

Science.gov (United States)

Friedemann, C.

2005-03-01

(from CDS Inf. Bull. 40, 31) The main task of the catalogue consists in a comprehensive collection of equivalent widths of the 217nm band derived from both spectrophotometric and filterphotometric measurements obtained with TD-1, OAO-2 and ANS satellites. These data concern reddened O, B stars with color excesses E(B-V) >= 0.02 mag. The extinction curve is approximated by the empirical formula introduced by Guertler et al. (1982AN....303..105G) e({lambda}) = A(i/{lambda} - 1/{lambda}o)n + B + C {kappa}({lambda}) The relative errors amount to about {delta}A/A = +/- 0.10, {delta}B/B = +/- 0.02 and {delta}C/C = +/- 0.03. (1 data file).

[Physician Assisted Suicide - Survey on § 217 StGB in Germany].

Science.gov (United States)

Zenz, Julia; Rissing-van Saan, Ruth; Zenz, Michael

2017-03-01

Background  In late 2015, Germany passed a law (§ 217 StGB) prohibiting persons from aiding others in committing suicide on a regular, repetitive basis. Despite intensive societal debate and surveys about assisted dying, the present study was the first to examine attitudes towards the new legal regulation among professionals. Methods  In early 2016, all participants of a congress on palliative care received a one-page anonymous questionnaire to complete until the end of the conference. The questionnaire consisted of questions regarding assisted suicide and the new law. The participants were asked to express their agreement or disagreement on a 4 to 5-point Likert scale. Results  457 questionnaires (48 %) were completed, 138 from physicians, 318 from nurses, 1 non specified. More than 80 % knew about the new law. Only half of the respondents supported it. 54 % felt that the law did not sufficiently differentiate between an illegal form of assisted suicide and a form exempt from prosecution. For more than 40 % the new law made no sense. Conclusion  Professionals engaged in terminal care were reluctant to support a criminal liability of "business-like" physician-assisted suicide and suspected greater uncertainty among professionals in end of life care. © Georg Thieme Verlag KG Stuttgart · New York.

Molecular Evolution at a Meiosis Gene Mediates Species Differences in the Rate and Patterning of Recombination.

Science.gov (United States)

Brand, Cara L; Cattani, M Victoria; Kingan, Sarah B; Landeen, Emily L; Presgraves, Daven C

2018-04-23

Crossing over between homologous chromosomes during meiosis repairs programmed DNA double-strand breaks, ensures proper segregation at meiosis I [1], shapes the genomic distribution of nucleotide variability in populations, and enhances the efficacy of natural selection among genetically linked sites [2]. Between closely related Drosophila species, large differences exist in the rate and chromosomal distribution of crossing over. Little, however, is known about the molecular genetic changes or population genetic forces that mediate evolved differences in recombination between species [3, 4]. Here, we show that a meiosis gene with a history of rapid evolution acts as a trans-acting modifier of species differences in crossing over. In transgenic flies, the dicistronic gene, mei-217/mei-218, recapitulates a large part of the species differences in the rate and chromosomal distribution of crossing over. These phenotypic differences appear to result from changes in protein sequence not gene expression. Our population genetics analyses show that the protein-coding sequence of mei-218, but not mei-217, has a history of recurrent positive natural selection. By modulating the intensity of centromeric and telomeric suppression of crossing over, evolution at mei-217/-218 has incidentally shaped gross differences in the chromosomal distribution of nucleotide variability between species. We speculate that recurrent bouts of adaptive evolution at mei-217/-218 might reflect a history of coevolution with selfish genetic elements. Copyright © 2018 Elsevier Ltd. All rights reserved.

Bloodstream infection following 217 consecutive systemic-enteric drained pancreas transplants

Directory of Open Access Journals (Sweden)

Mark Walter

2006-08-01

Full Text Available Abstract Background Combined kidney pancreas transplantation (PTx evolved as excellent treatment for diabetic nephropathy. Infections remain common and serious complications. Methods 217 consecutive enteric drained PTxs performed from 1997 to 2004 were retrospectively analyzed with regard to bloodstream infection. Immunosuppression consisted of antithymocyteglobuline induction, tacrolimus, mycophenolic acid and steroids for the majority of cases. Standard perioperative antimicrobial prophylaxis consisted of pipercillin/tazobactam in combination with ciprofloxacin and fluconazole. Results One year patient, pancreas and kidney graft survival were 96.4%, 88.5% and 94.8%, surgical complication rate was 35%, rejection rate 30% and rate of infection 59%. In total 46 sepsis episodes were diagnosed in 35 patients (16% with a median onset on day 12 (range 1–45 post transplant. Sepsis source was intraabdominal infection (IAI (n = 21, a contaminated central venous line (n = 10, wound infection (n = 5, urinary tract infection (n = 2 and graft transmitted (n = 2. Nine patients (4% experienced multiple episodes of sepsis. Overall 65 pathogens (IAI sepsis 39, line sepsis 15, others 11 were isolated from blood. Gram positive cocci accounted for 50 isolates (77%: Coagulase negative staphylococci (n = 28, i.e. 43% (nine multi-resistant, Staphylococcus aureus (n = 11, i.e. 17% (four multi-resistant, enterococci (n = 9, i.e. 14% (one E. faecium. Gram negative rods were cultured in twelve cases (18%. Patients with blood borne infection had a two year pancreas graft survival of 76.5% versus 89.4% for those without sepsis (p = 0.036, patient survival was not affected. Conclusion Sepsis remains a serious complication after PTx with significantly reduced pancreas graft, but not patient survival. The most common source is IAI.

Search for Excited Leptons at LEP

CERN Document Server

Achard, P.; Aguilar-Benitez, M.; Alcaraz, J.; Alemanni, G.; Allaby, J.; Aloisio, A.; Alviggi, M.G.; Anderhub, H.; Andreev, Valery P.; Anselmo, F.; Arefev, A.; Azemoon, T.; Aziz, T.; Bagnaia, P.; Bajo, A.; Baksay, G.; Baksay, L.; Baldew, S.V.; Banerjee, S.; Banerjee, Sw.; Barczyk, A.; Barillere, R.; Bartalini, P.; Basile, M.; Batalova, N.; Battiston, R.; Bay, A.; Becattini, F.; Becker, U.; Behner, F.; Bellucci, L.; Berbeco, R.; Berdugo, J.; Berges, P.; Bertucci, B.; Betev, B.L.; Biasini, M.; Biglietti, M.; Biland, A.; Blaising, J.J.; Blyth, S.C.; Bobbink, G.J.; Bohm, A.; Boldizsar, L.; Borgia, B.; Bottai, S.; Bourilkov, D.; Bourquin, M.; Braccini, S.; Branson, J.G.; Brochu, F.; Burger, J.D.; Burger, W.J.; Cai, X.D.; Capell, M.; Cara Romeo, G.; Carlino, G.; Cartacci, A.; Casaus, J.; Cavallari, F.; Cavallo, N.; Cecchi, C.; Cerrada, M.; Chamizo, M.; Chang, Y.H.; Chemarin, M.; Chen, A.; Chen, G.; Chen, G.M.; Chen, H.F.; Chen, H.S.; Chiefari, G.; Cifarelli, L.; Cindolo, F.; Clare, I.; Clare, R.; Coignet, G.; Colino, N.; Costantini, S.; de la Cruz, B.; Cucciarelli, S.; van Dalen, J.A.; de Asmundis, R.; Deglon, P.; Debreczeni, J.; Degre, A.; Dehmelt, K.; Deiters, K.; della Volpe, D.; Delmeire, E.; Denes, P.; DeNotaristefani, F.; De Salvo, A.; Diemoz, M.; Dierckxsens, M.; Dionisi, C.; Dittmar, M.; Doria, A.; Dova, M.T.; Duchesneau, D.; Duda, M.; Echenard, B.; Eline, A.; El Hage, A.; El Mamouni, H.; Engler, A.; Eppling, F.J.; Extermann, P.; Falagan, M.A.; Falciano, S.; Favara, A.; Fay, J.; Fedin, O.; Felcini, M.; Ferguson, T.; Fesefeldt, H.; Fiandrini, E.; Field, J.H.; Filthaut, F.; Fisher, P.H.; Fisher, W.; Fisk, I.; Forconi, G.; Freudenreich, K.; Furetta, C.; Galaktionov, Iouri; Ganguli, S.N.; Garcia-Abia, Pablo; Gataullin, M.; Gentile, S.; Giagu, S.; Gong, Z.F.; Grenier, Gerald Jean; Grimm, O.; Gruenewald, M.W.; Guida, M.; van Gulik, R.; Gupta, V.K.; Gurtu, A.; Gutay, L.J.; Haas, D.; Hakobyan, R.S.; Hansen, J.M.; Hatzifotiadou, D.; Hebbeker, T.; Herve, Alain; Hirschfelder, J.; Hofer, H.; Hohlmann, M.; Holzner, G.; Hou, S.R.; Hu, Y.; Jin, B.N.; Jones, Lawrence W.; de Jong, P.; Josa-Mutuberria, I.; Kafer, D.; Kaur, M.; Kienzle-Focacci, M.N.; Kim, J.K.; Kirkby, Jasper; Kittel, W.; Klimentov, A.; Konig, A.C.; Kopal, M.; Koutsenko, V.; Kraber, M.; Kraemer, R.W.; Kruger, A.; Kunin, A.; Ladron de Guevara, P.; Laktineh, I.; Landi, G.; Lebeau, M.; Lebedev, A.; Lebrun, P.; Lecomte, P.; Lecoq, P.; Le Coultre, P.; Le Goff, J.M.; Leiste, R.; Levtchenko, M.; Levtchenko, P.; Li, C.; Likhoded, S.; Lin, C.H.; Lin, W.T.; Linde, F.L.; Lista, L.; Liu, Z.A.; Lohmann, W.; Longo, E.; Lu, Y.S.; Luci, C.; Luminari, L.; Lustermann, W.; Ma, W.G.; Malgeri, L.; Malinin, A.; Mana, C.; Mans, J.; Martin, J.P.; Marzano, F.; Mazumdar, K.; McNeil, R.R.; Mele, S.; Merola, L.; Meschini, M.; Metzger, W.J.; Mihul, A.; Milcent, H.; Mirabelli, G.; Mnich, J.; Mohanty, G.B.; Muanza, G.S.; Muijs, A.J.M.; Musicar, B.; Musy, M.; Nagy, S.; Natale, S.; Napolitano, M.; Nessi-Tedaldi, F.; Newman, H.; Nisati, A.; Kluge, Hannelies; Ofierzynski, R.; Organtini, G.; Pal, I.; Palomares, C.; Paolucci, P.; Paramatti, R.; Passaleva, G.; Patricelli, S.; Paul, Thomas Cantzon; Pauluzzi, M.; Paus, C.; Pauss, F.; Pedace, M.; Pensotti, S.; Perret-Gallix, D.; Petersen, B.; Piccolo, D.; Pierella, F.; Pioppi, M.; Piroue, P.A.; Pistolesi, E.; Plyaskin, V.; Pohl, M.; Pojidaev, V.; Pothier, J.; Prokofev, D.; Quartieri, J.; Rahal-Callot, G.; Rahaman, Mohammad Azizur; Raics, P.; Raja, N.; Ramelli, R.; Rancoita, P.G.; Ranieri, R.; Raspereza, A.; Razis, P.; Ren, D.; Rescigno, M.; Reucroft, S.; Riemann, S.; Riles, Keith; Roe, B.P.; Romero, L.; Rosca, A.; Rosier-Lees, S.; Roth, Stefan; Rosenbleck, C.; Rubio, J.A.; Ruggiero, G.; Rykaczewski, H.; Sakharov, A.; Saremi, S.; Sarkar, S.; Salicio, J.; Sanchez, E.; Schafer, C.; Schegelsky, V.; Schopper, H.; Schotanus, D.J.; Sciacca, C.; Servoli, L.; Shevchenko, S.; Shivarov, N.; Shoutko, V.; Shumilov, E.; Shvorob, A.; Son, D.; Souga, C.; Spillantini, P.; Steuer, M.; Stickland, D.P.; Stoyanov, B.; Straessner, A.; Sudhakar, K.; Sultanov, G.; Sun, L.Z.; Sushkov, S.; Suter, H.; Swain, J.D.; Szillasi, Z.; Tang, X.W.; Tarjan, P.; Tauscher, L.; Taylor, L.; Tellili, B.; Teyssier, D.; Timmermans, Charles; Ting, Samuel C.C.; Ting, S.M.; Tonwar, S.C.; Toth, J.; Tully, C.; Tung, K.L.; Ulbricht, J.; Valente, E.; Van de Walle, R.T.; Vasquez, R.; Veszpremi, V.; Vesztergombi, G.; Vetlitsky, I.; Vicinanza, D.; Viertel, G.; Villa, S.; Vivargent, M.; Vlachos, S.; Vodopianov, I.; Vogel, H.; Vogt, H.; Vorobev, I.; Vorobyov, A.A.; Wadhwa, M.; Wang, Q.; Wang, X.L.; Wang, Z.M.; Weber, M.; Wienemann, P.; Wilkens, H.; Wynhoff, S.; Xia, L.; Xu, Z.Z.; Yamamoto, J.; Yang, B.Z.; Yang, C.G.; Yang, H.J.; Yang, M.; Yeh, S.C.; Zalite, A.; Zalite, Yu.; Zhang, Z.P.; Zhao, J.; Zhu, G.Y.; Zhu, R.Y.; Zhuang, H.L.; Zichichi, A.; Zimmermann, B.; Zoller, M.

2003-01-01

A search for charged and neutral excited leptons is performed in 217 pb-1 of data collected with the L3 detector at LEP at centre-of-mass energies up to 209 GeV. The pair- and single-production mechanisms are investigated and no signals are detected. Combining with L3 results from searches at lower centre-of-mass energies, gives improved limits on the masses and couplings of excited leptons.

Increased risk of revision in patients with non-traumatic femoral head necrosis 11,589 cases compared to 416,217 cases with primary osteoarthritis in the NARA database, 1995–2011

DEFF Research Database (Denmark)

Bergh, C.; Fenstad, Ann M.; Furnes, O.

2014-01-01

. The relative risk of revision for any reason, for aseptic loosening, dislocation, deep infection, and periprosthetic fracture was studied before and after adjustment for covariates using Cox regression models. Results - 416,217 hips with POA (mean age 69 (SD 10), 59% females) and 11,589 with FHN (mean age 65...

[Usefulness of stratigraphy and computerized tomography in the initial staging of osteosarcoma of the extremities. Retrospective study of 217 cases].

Science.gov (United States)

Pelotti, P; Ciminari, R; Bacci, G; Avella, M; Briccoli, A

1988-01-01

The value of stratigraphy and pulmonary CT in the initial work-up of osteosarcoma of the extremities is assessed with reference to 217 patients encountered in the Bone Tumour Centre of Rizzoli Orthopaedic Institute in May 1983-May 1986. Stratigraphy revealed lung metastases not identified by standard radiography in 4 patients (1.8%), while CT revealed metastases not identified by either standard X-rays or stratigraphy in a further 6 cases (2.7%). It is concluded that the increase in the percentage of cures (about 30%) reported in the last 10 years in osteosarcoma cases given adjuvant chemotherapy cannot be explained by any difference in initial selection due to the use of these techniques that were not adopted in the historical series.

Readout and trigger for the AFP detector at the ATLAS experiment at LHC

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00097773; The ATLAS collaboration; Kocian, Martin; Lopez Paz, Ivan; Avoni, Giulio

2017-01-01

The ATLAS Forward Proton is a new detector system in ATLAS that allows study of events with protons scattered at very small angles. The final design assumes four stations at distances of 205 and 217 m from the ATLAS interaction point on both sides of the detector exploiting the Roman Pot technology. In 2016 two stations in one arm were installed; installation of the other two is planned for 2017. This article describes details of the installed hardware, firmware and software leading to the full integration with the ATLAS central trigger and data acquisition systems.

Biocontrol activity of surfactin A purified from Bacillus NH-100 and NH-217 against rice bakanae disease.

Science.gov (United States)

Sarwar, Ambrin; Hassan, Muhammad Nadeem; Imran, Muhammad; Iqbal, Mazhar; Majeed, Saima; Brader, Günter; Sessitsch, Angela; Hafeez, Fauzia Yusuf

2018-04-01

The potential of the Bacillus genus to antagonize phytopathogens is associated with the production of cyclic lipopeptides. Depending upon the type of lipopeptide, they may serve as biocontrol agents that are eco-friendly alternatives to chemical fertilizers. This study evaluates the biocontrol activity of surfactin-producing Bacillus (SPB) strains NH-100 and NH-217 and purified surfactin A from these strains against rice bakanae disease. Biologically active surfactin fractions were purified by HPLC, and surfactin A variants with chain lengths from C12 to C16 were confirmed by LCMS-ESI. In hemolytic assays, a positive correlation between surfactin A production and halo zone formation was observed. The purified surfactin A had strong antifungal activity against Fusarium oxysporum, F. moniliforme, F. solani, Trichoderma atroviride and T. reesei. Maximum fungal growth suppression (84%) was recorded at 2000 ppm against F. moniliforme. Surfactin A retained antifungal activity at different pH levels (5-9) and temperatures (20, 50 and 121 °C). Hydroponic and pot experiments were conducted to determine the biocontrol activity of SPB strains and the purified surfactin A from these strains on Super Basmati rice. Surfactin production in the rice rhizosphere was detected by LCMS-ESI at early growth stages in hydroponics experiments inoculated with SPB strains. However, the maximum yield was observed with a consortium of SPB strains (T4) and purified surfactin A (T5) treatments in the pot experiment. The outcomes of the present study revealed that surfactin A significantly reduced rice bakanae disease by up to 80%. These findings suggest that purified surfactin A could be an effective biocontrol agent against bakanae disease in rice and should be incorporated into strategies for disease management. Copyright © 2018 Elsevier GmbH. All rights reserved.

Thyroid cancer: experiences at Uttar Pradesh

International Nuclear Information System (INIS)

Varma, K.D.

1999-01-01

The highest incidence of goitre and also carcinoma of the thyroid was found to be in Terai. Although patients having thyroid carcinoma are being treated since 1964, because of the poor follow-up of the patients, only 1140 patients seen over 20 years (1978-1997) have been included in the study. Of the 217 cases of anaplastic carcinomas, surgery was feasible in only 19.4% (43/217) of cases. Even in these cases, the disease recurred within a short period to poor results. The main treatment has been external beam radiotherapy with doxorubicin as a radiosensitiser

In-Source Laser Spectroscopy with the Laser Ion Source and Trap: First Direct Study of the Ground-State Properties of ^{217,219}Po

Directory of Open Access Journals (Sweden)

D. A. Fink

2015-02-01

Full Text Available A Laser Ion Source and Trap (LIST for a thick-target, isotope-separation on-line facility has been implemented at CERN ISOLDE for the production of pure, laser-ionized, radioactive ion beams. It offers two modes of operation, either as an ion guide, which performs similarly to the standard ISOLDE resonance ionization laser ion source (RILIS, or as a more selective ion source, where surface-ionized ions from the hot ion-source cavity are repelled by an electrode, while laser ionization is done within a radio-frequency quadrupole ion guide. The first physics application of the LIST enables the suppression of francium contamination in ion beams of neutron-rich polonium isotopes at ISOLDE by more than 1000 with a reduction in laser-ionization efficiency of only 20. Resonance ionization spectroscopy is performed directly inside the LIST device, allowing the study of the hyperfine structure and isotope shift of ^{217}Po for the first time. Nuclear decay spectroscopy of ^{219}Po is performed for the first time, revealing its half-life, α-to-β-decay branching ratio, and α-particle energy. This experiment demonstrates the applicability of the LIST at radioactive ion-beam facilities for the production and study of pure beams of exotic isotopes.

A comparative CFD investigation of helical wire-wrapped 7, 19 and 37 fuel pin bundles and its extendibility to 217 pin bundle

International Nuclear Information System (INIS)

Gajapathy, R.; Velusamy, K.; Selvaraj, P.; Chellapandi, P.; Chetal, S.C.

2009-01-01

Preliminary investigations of sodium flow and temperature distributions in heat generating fuel pin bundles with helical spacer wires have been carried out. Towards this, the 3D conservation equations of mass, momentum and energy have been solved using a commercial computational fluid dynamics (CFD) code. Turbulence has been accounted through the use of high Reynolds number version of standard k-ε model, with uniform mesh density respecting wall function requirements. The geometric details of the bundle and the heat flux in are similar to that of the Indian Prototype Fast Breeder Reactor (PFBR) that is currently under construction. The mixing characteristics of the flow among the peripheral and central zones are compared for 7, 19 and 37 fuel pin bundles and the characteristics are extended to a 217 pin bundle. The friction factors of the pin bundles obtained from the present study is seen to agree well with the values derived from experimental correlations. It is found that the normalized outlet velocities in the peripheral and central zones are nearly equal to 1.1-0.9, respectively which is in good agreement with the published hydraulic experimental measurements of 1.1-0.85 for a 91 pin bundle. The axial velocity is the maximum in the peripheral zone where spacer wires are located and minimum in the zones which are diametrically opposite to the respective zone of maximum velocity. The sodium temperature is higher in the zones where the flow area and mass flow rates are less due to the presence of the spacer wires though the axial velocity is higher there. It is the minimum in the peripheral zones where the circumferential flow is larger. Based on the flow and temperature distributions obtained for 19 and 37 pin bundles, a preliminary extrapolation procedure has been established for estimating the temperatures of peripheral and central zones of 217 pin bundle.

Z Boson Pair-Production at LEP

CERN Document Server

Achard, P; Aguilar-Benítez, M; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alviggi, M G; Anderhub, H; Andreev, V P; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Bajo, A; Baksay, G; Baksay, L; Baldew, S V; Banerjee, S; Banerjee, Sw; Barczyk, A; Barillère, R; Bartalini, P; Basile, M; Batalova, N; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Bellucci, L; Berbeco, R; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Biasini, M; Biglietti, M; Biland, A; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böhm, A; Boldizsar, L; Borgia, B; Bottai, S; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brochu, F; Burger, J D; Burger, W J; Cai, X D; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada, M; Chamizo-Llatas, M; Chang, Y H; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chiefari, G; Cifarelli, Luisa; Cindolo, F; Clare, I; Clare, R; Coignet, G; Colino, N; Costantini, S; de la Cruz, B; Cucciarelli, S; van Dalen, J A; De Asmundis, R; Déglon, P L; Debreczeni, J; Degré, A; Dehmelt, K; Deiters, K; Della Volpe, D; Delmeire, E; Denes, P; De Notaristefani, F; De Salvo, A; Diemoz, M; Dierckxsens, M; Dionisi, C; Dittmar, M; Doria, A; Dova, M T; Duchesneau, D; Duda, M; Echenard, B; Eline, A; El-Hage, A; El-Mamouni, H; Engler, A; Eppling, F J; Extermann, P; Falagán, M A; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, M; Ferguson, T; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisher, W; Fisk, I; Forconi, G; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gataullin, M; Gentile, S; Giagu, S; Gong, Z F; Grenier, G; Grimm, O; Grünewald, M W; Guida, M; van Gulik, R; Gupta, V K; Gurtu, A; Gutay, L J; Haas, D; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Hirschfelder, J; Hofer, H; Hohlmann, M; Holzner, G; Hou, S R; Hu, Y; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Käfer, D; Kaur, M; Kienzle-Focacci, M N; Kim, J K; Kirkby, Jasper; Kittel, E W; Klimentov, A; König, A C; Kopal, M; Koutsenko, V F; Kräber, M H; Krämer, R W; Krüger, A; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Levtchenko, M; Levchenko, P M; Li, C; Likhoded, S; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lü, Y S; Luci, C; Luminari, L; Lustermann, W; Ma Wen Gan; Malgeri, L; Malinin, A; Maña, C; Mans, J; Martin, J P; Marzano, F; Mazumdar, K; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Mihul, A; Milcent, H; Mirabelli, G; Mnich, J; Mohanty, G B; Muanza, G S; Muijs, A J M; Musicar, B; Musy, M; Nagy, S; Natale, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Nisati, A; Novák, T; Nowak, H; Ofierzynski, R A; Organtini, G; Pal, I; Palomares, C; Paolucci, P; Paramatti, R; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Pedace, M; Pensotti, S; Perret-Gallix, D; Petersen, B; Piccolo, D; Pierella, F; Pioppi, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Pothier, J; Prokofev, D; Prokofiev, D O; Quartieri, J; Rahal-Callot, G; Rahaman, M A; Raics, P; Raja, N; Ramelli, R; Rancoita, P G; Ranieri, R; Raspereza, A V; Razis, P A; Ren, D; Rescigno, M; Reucroft, S; Riemann, S; Riles, K; Roe, B P; Romero, L; Rosca, A; Rosier-Lees, S; Roth, S; Rosenbleck, C; Roux, B; Rubio, J A; Ruggiero, G; Rykaczewski, H; Sakharov, A; Saremi, S; Sarkar, S; Salicio, J; Sánchez, E; Schäfer, C; Shchegelskii, V; Schopper, Herwig Franz; Schotanus, D J; Sciacca, C; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shumilov, E; Shvorob, A V; Son, D; Souga, C; Spillantini, P; Steuer, M; Stickland, D P; Stoyanov, B; Strässner, A; Sudhakar, K; Sultanov, G G; Sun, L Z; Sushkov, S; Suter, H; Swain, J D; Szillási, Z; Tang, X W; Tarjan, P; Tauscher, Ludwig; Taylor, L; Tellili, B; Teyssier, D; Timmermans, C; Ting, Samuel C C; Ting, S M; Tonwar, S C; Tóth, J; Tully, C; Tung, K L; Ulbricht, J; Valente, E; Van de Walle, R T; Vásquez, R; Veszpremi, V; Vesztergombi, G; Vetlitskii, I; Vicinanza, D; Viertel, Gert M; Villa, S; Vivargent, M; Vlachos, S; Vodopyanov, I; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Wadhwa, M; Wang, Q; Wang, X L; Wang, Z M; Weber, M; Wienemann, P; Wilkens, H; Wynhoff, S; Xia, L; Xu, Z Z; Yamamoto, J; Yang, B Z; Yang, C G; Yang, H J; Yang, M; Yeh, S C; Zalite, A; Zalite, Yu; Zhang, Z P; Zhao, J; Zhu, G Y; Zhu, R Y; Zhuang, H L; Zichichi, A; Zimmermann, B; Zöller, M

2003-01-01

Events stemming from the pair-production of Z bosons in e^+e^- collisions are studied using 217.4 pb^-1 of data collected with the L3 detector at centre-of-mass energies from 200 GeV up to 209 GeV. The special case of events with b quarks is also investigated. Combining these events with those collected at lower centre-of-mass energies, the Standard Model predictions for the production mechanism are verified. In addition, limits are set on anomalous couplings of neutral gauge bosons and on effects of extra space dimensions.

Caracterização das fibras musculares do músculo Semitendinosus de bezerros mestiços Angus-Nelore recebendo somatotropina bovina recombinante (rbST até a desmama Characterization of Semitendinosus muscle fibers in pre-weaning Angus-Nellore crossbred calves receiving recombinant bovine somatotropin (rbST

Directory of Open Access Journals (Sweden)

Rafael da Costa Cervieri

2005-06-01

Full Text Available Objetivando-se estudar o efeito da somatotropina bovina recombinante (rbST sobre a freqüência de distribuição e o diâmetro das fibras musculares do músculo Semitendinosus, 36 bezerros mestiços ½Angus-Nelore, com idade inicial de 63 ± 17 dias e pesando 76,8 ± 14,7 kg, criados em pastagem de Brachiaria decumbens e suplementados em creep feeding, foram submetidos a dois tratamentos até a desmama (217 dias: 18 bezerros receberam 1,4 mg/kg de rbST (Boostin® a cada 14 dias e 18 receberam solução salina (controle. As amostras de músculo foram coletadas aos 117 (biópsia e aos 217 dias de idade, quando foram abatidos cinco animais por tratamento. Os animais suplementados apresentaram maior diâmetro para as fibras do tipo glicolítica de contração rápida (FG aos 117 dias e tendência de aumento aos 217 dias e não diferiram em relação ao grupo controle quanto ao diâmetro das fibras oxidativas-glicolíticas de contração rápida (FOG e oxidativas de contração lenta (SO e à frequência de FG, FOG e SO aos 117 e 217 dias de idade. Independentemente da aplicação de rbST, houve significativo aumento do diâmetro das fibras SO e FOG, tendência de aumento de diâmetro das fibras FG, maior frequência de SO e redução da frequência de FG entre 117 e 217 dias de idade. A utilização de somatotropina exógena possibilitou maior hipertrofia das fibras musculares brancas de contração rápida em bezerros suplementados em creep feeding durante a fase de cria, sem interferir na frequência de distribuição dos tipos de fibras no músculo Semitendinosus.The objective of this experiment was to study the effect of the recombinant bovine somatotropin (rbST on the percentage distribution and diameter of semitendinosus muscle fibers. Thirty-six ½ Angus-Nellore crossbred bull calves, 63 ± 17 days old and weighting 76.8 ± 14.7 kg, raised in Brachiaria decumbens pastures and creep fed, were assigned to one of two treatments until weaning

Polarized proton acceleration at the Brookhaven AGS

International Nuclear Information System (INIS)

Ahrens, L.A.

1986-01-01

At the conclusion of polarized proton commissioning in February 1986, protons with an average polarization of 45%, momentum of 21.7 GeV/c, and intensity of 2 x 10 10 protons per pulse, were extracted to an external polarimeter at the Brookhaven AGS. In order to maintain this polarization, five intrinsic and nearly forty imperfection depolarizing resonances had to be corrected. An apparent interaction between imperfection and intrinsic resonances occurring at very nearly the same energy was observed and the correction of imperfection resonances using ''beat'' magnetic harmonics discovered in the previous AGS commissioning run was further confirmed

Clinico-radiographic Studies on The Prevalent Distal Limb Affections in Working Equine at Luxor City

Directory of Open Access Journals (Sweden)

A. A.A. Abdel-Hady

2017-01-01

Full Text Available To illustrate the clinical and radiographic findings of some distal limbs affections in Ninety two animals (24 horses and 68 donkeys which were admitted to Animal Care Hospital in Luxor. Each animal was subjected to thorough clinical and radiographic examination; the grade of lameness was recorded and the best radiographic views were taken.  Fifteen types of distal limb affections were evident. The most prevalent affections in donkeys were high and low ring bone (29.35% and hoof abscess ( 9.78% followed by traumatic arthritis of the fetlock (6.52%, suspensory ligament desmitis (5.43%, fracture of first phalanx (5.43%, fracture of PII (4.35%, side bone (3.26%  whereas, fracture of metacarpal bone (1.09%, sesamoditis (1.09% and flexural deformities (1.09%  represented the lowest prevalent affections.On the other hand, side bone (4.35%, fracture of the metacarpal bone (4.35% represented the most prevalent affections in horses followed by high and low ring bone (3.26%, fractures of PI (2.17%, PII (2.17%, subluxation of coronopedal joint (2.17% and punctured wounds in of the hoof (2.17%, traumatic arthritis of the fetlock joint (2.17%. Whereas, navicular disease (1.09%, suspensory ligament desmitis (1.09% and hoof abscess (1.09% were the lowest prevalent affections in horses. Treatment was not recommended in certain cases. In conclusion, although the wide stride progress have made in diagnostic imaging in recent decades, the x ray still offers a satisfactory tool for diagnostic imaging in equine limb practice that is useful for equine practitioners.

Roflumilast: APTA 2217, B9302-107, BY 217, BYK 20869.

Science.gov (United States)

2004-01-01

Roflumilast [APTA 2217, B9302-107, BY 217, BYK 20869] is a selective phosphodiesterase IV inhibitor. It is being developed by Altana Pharma (formerly Byk Gulden), a subsidiary of Altana Group, as an orally administered therapy for asthma, chronic obstructive pulmonary disease (COPD), allergic rhinitis and psoriasis. The drug is awaiting regulatory approval in Europe for the treatment of asthma and COPD. Byk Gulden has stated that roflumilast relieves asthma symptoms through both an anti-inflammatory effect and a muscle relaxant effect. Roflumilast has potential as first-line long-term therapy in mild-to-moderate COPD and as additive long-term therapy in moderate-to-severe COPD. Altana has stated that roflumilast is to be marketed under the brand name Daxas. Altana Group and Pharmacia Corporation (now Pfizer) signed an agreement on 22 April 2002 to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory disorders, including asthma and COPD. The companies will jointly develop the drug for the US, Europe and other markets. Pharmacia will co-ordinate development in the US and Altana will co-ordinate development in Europe. After approval of the drug, Pharmacia and Altana will jointly launch and promote roflumilast in the US, Europe and elsewhere. Altana will receive an upfront payment and additional milestone payments. Altana additionally has the option to co-promote Pharmacia products in the US and elsewhere. On 16 April 2003, Pharmacia Corporation was acquired by, and merged into, Pfizer. In November 2002, Altana and Tanabe Seiyaku signed an agreement to collaborate on the development and commercialisation of roflumilast for the treatment of respiratory diseases, including asthma and COPD. Tanabe Seiyaku and Altana will develop roflumilast for asthma and COPD in Japan, and will jointly launch and co-promote roflumilast in Japan following regulatory approval. Roflumilast has been in multinational phase III clinical studies

Surface ablation with iris recognition and dynamic rotational eye tracking-based tissue saving treatment with the Technolas 217z excimer laser.

Science.gov (United States)

Prakash, Gaurav; Agarwal, Amar; Kumar, Dhivya Ashok; Jacob, Soosan; Agarwal, Athiya; Maity, Amrita

2011-03-01

To evaluate the visual and refractive outcomes and expected benefits of Tissue Saving Treatment algorithm-guided surface ablation with iris recognition and dynamic rotational eye tracking. This prospective, interventional case series comprised 122 eyes (70 patients). Pre- and postoperative assessment included uncorrected distance visual acuity (UDVA), corrected distance visual acuity (CDVA), refraction, and higher order aberrations. All patients underwent Tissue Saving Treatment algorithm-guided surface ablation with iris recognition and dynamic rotational eye tracking using the Technolas 217z 100-Hz excimer platform (Technolas Perfect Vision GmbH). Follow-up was performed up to 6 months postoperatively. Theoretical benefit analysis was performed to evaluate the algorithm's outcomes compared to others. Preoperative spherocylindrical power was sphere -3.62 ± 1.60 diopters (D) (range: 0 to -6.75 D), cylinder -1.15 ± 1.00 D (range: 0 to -3.50 D), and spherical equivalent -4.19 ± 1.60 D (range: -7.75 to -2.00 D). At 6 months, 91% (111/122) of eyes were within ± 0.50 D of attempted correction. Postoperative UDVA was comparable to preoperative CDVA at 1 month (P=.47) and progressively improved at 6 months (P=.004). Two eyes lost one line of CDVA at 6 months. Theoretical benefit analysis revealed that of 101 eyes with astigmatism, 29 would have had cyclotorsion-induced astigmatism of ≥ 10% if iris recognition and dynamic rotational eye tracking were not used. Furthermore, the mean percentage decrease in maximum depth of ablation by using the Tissue Saving Treatment was 11.8 ± 2.9% over Aspheric, 17.8 ± 6.2% over Personalized, and 18.2 ± 2.8% over Planoscan algorithms. Tissue saving surface ablation with iris recognition and dynamic rotational eye tracking was safe and effective in this series of eyes. Copyright 2011, SLACK Incorporated.

Molecular and genetic characterization of a radiation-induced structural rearrangement in mouse chromosome 2 causing mutations at the limb deformity and agouti loci

International Nuclear Information System (INIS)

Woychik, R.P.; Generoso, W.M.; Russell, L.B.; Cain, K.T.; Cacheiro, N.L.; Bultman, S.J.; Selby, P.B.; Dickinson, M.E.; Hogan, B.L.

1990-01-01

Molecular characterization of mutations in the mouse, particularly those involving agent-induced major structural alterations, is proving to be useful for correlating the structure and expression of individual genes with their function in the whole organism. Here we present the characterization of a radiation-induced mutation that simultaneously generated distinct alleles of both the limb deformity (ld) and agouti (a) loci, two developmentally important regions of chromosome 2 normally separated by 20 centimorgans. Cytogenetic analysis revealed that an interstitial segment of chromosome 17 (17B- 17C; or, possibly, 17A2-17B) had been translocated into the distal end of chromosome 2, resulting in a smaller-than-normal chromosome 17 (designated 17del) and a larger form of chromosome 2 designated 2(17). Additionally, a large interstitial segment of the 2(17) chromosome, immediately adjacent and proximal to the insertion site, did not match bands 2E4-2H1 at corresponding positions on a normal chromosome 2. Molecular analysis detected a DNA rearrangement in which a portion of the ld locus was joined to sequences normally tightly linked to the a locus. This result, along with the genetic and cytogenetic data, suggests that the alleles of ld and a in this radiation-induced mutation, designated ldIn2 and ajIn2, were associated with DNA breaks caused by an inversion of an interstitial segment in the 2(17) chromosome

Characterization of velocity and temperature fields in a 217 pin wire wrapped fuel bundle of sodium cooled fast reactor

International Nuclear Information System (INIS)

Naveen Raj, M.; Velusamy, K.

2016-01-01

Highlights: • We simulate flow and temperature fields in fuel subassembly of fast reactor. • We perform high fidelity computations for 217 pin bundle of 7 axial pitch lengths. • We investigate transverse and axial flows in different types of subchannels. • Correlations are proposed for transverse flow, which form input for subchannel analysis. • Periodic variations of large magnitude are observed in subchannel flow rates. - Abstract: RANS based computational fluid dynamic (CFD) simulation of flow and temperature fields in a fast reactor fuel subassembly has been carried out. The sodium cooled prototype subassembly consists of 217 pins with helical wire spacers. An axial length of seven helical wire pitches has been considered for the study adopting a structured mesh having 36 million points and 84 processors in parallel. The computational model has been validated against in-house and published experimental data for friction factor and Nusselt number. Also, the transverse flow in the central subchannel and swirl flow in the peripheral subchannel are compared against reported experimental data and those computed by subchannel models. The focus of the study is investigation of transverse and axial flows in different types of subchannels. Based on the 3-dimensional CFD study, correlations have been proposed for calculation of transverse flow, which forms an important input for development of subchannel analysis codes. Periodic variations have been observed in the subchannel axial flow rates. For the subchannels located in the central region, the peak to peak variation in the axial flow rate is ∼21% and it is found to be contributed by the changes in the flow area and hydraulic resistance due to frequent passage of helical wires through the subchannel. For the subchannels located in the periphery, this variation is as high as 50%. The transverse flow in the central subchannels follows a cosine profile, for all the faces. However, there is a phase lag of 120�

Properties of 15/2- states in 215Ra and 217Th; evaluation of the 15/2- to 9/2+ E3 strength in N=127 isotones

International Nuclear Information System (INIS)

Dracoulis, G.D.; Riess, R.; Stuchbery, A.E.; Bark, R.A.; Gupta, S.L.; Baxter, A.M.; Kruse, M.

1988-01-01

The lifetime of the yrast 15/2 - state in 215 Ra was measured using pulsed beams and γ-ray and electron techniques. Transition multipolarities were established from measured conversion coefficients. The B(E3) of the 15/2 - → 9/2 + transition is found to be considerably larger than previously reported. A candidate for the corresponding transition in 217 Th was also observed. The E3 strength of the 15/2 - → 9/2 + transition in the N=127 isotones is evaluated in the light of these and other recent results. Interpretation in the framework of particle-octupole vibration coupling requires a systematic lowering of the core 3 - vibration as proton pairs are added to 208 Pb

Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

Directory of Open Access Journals (Sweden)

Behera B.R.

2015-01-01

Full Text Available In this talk results of the evaporation residue (ER cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr and 16,18O+198Pt (forming compound nuclei 214,216Rn systems measured at Hybrid Recoil mass Analyzer (HYRA spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC, New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer’s fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

Recent results of measurements of evaporation residue excitation functions for 19F+194,196,198Pt and 16,18O+198Pt systems with HYRA spectrometer at IUAC

Science.gov (United States)

Behera, B. R.

2015-01-01

In this talk results of the evaporation residue (ER) cross sections for the 19F+194,196,198Pt (forming compound nuclei 213,215,217Fr) and 16,18O+198Pt (forming compound nuclei 214,216Rn) systems measured at Hybrid Recoil mass Analyzer (HYRA) spectrometer installed at the Pelletron+LINAC accelerator facility of the Inter University Accelerator Center (IUAC), New Delhi are reported. The survival probabilities of 215Fr and 217Fr with neutron numbers N = 126 are found to be lower than the survival probabilities of 215Fr and 217Fr with neutron numbers N = 128 and 130 respectively. Statistical model analysis of the ER cross sections show that an excitation energy dependent scaling factor of the finite-range rotating liquid drop model fission barrier is necessary to fit the experimental data. For the case of 214,216Rn, the experimental ER cross sections are compared with the predictions from the statistical model calculations of compound nuclear decay where Kramer's fission width is used. The strength of nuclear dissipation is treated as a free parameter in the calculations to fit the experimental data.

Chemical analysis of fogwater at Delhi, North India

Science.gov (United States)

Kapoor, R. K.; Tiwari, S.; Ali, K.; Singh, G.

Fogwater collected at Delhi (28° 35'N, 77°12'E, 217 m a.s.l.) during winter 1989-1990 was found to be acidic compared to pure water pH of 7. This was attributed to highway widening work in progress and an increase in vehicular traffic on the nearby road, apart from construction work in a residential complex and an increase in industrial activity within 6 km to the southwest. Results are compared with the earlier studies at Delhi and those with highly acidic fog data published for some regions of California in the United States of America.

pages 217 - 225.pmd

African Journals Online (AJOL)

Administrator

National Environmental Engineering Research Institute, CSIR-complex, Taramani, ... samples, suggesting its use in hospitals for preliminary assessment of indoor air quality and determine pathogenic ... especially in developing countries, where factors such .... Table 1: Ambient physical parameters at the sampling location.

TOTAL HIP REPLACEMENTS AT KIKUYU HOSPITAL, KENYA

African Journals Online (AJOL)

equipments, few trained personnel and the high cost of implants. It is mainly in the ..... function more affected than the sensory a day after. There was a foot drop. .... 60: Issue 2, 217-. 220. 13. NIH Consensus Development Panel on Total Hip.

Single Neurosurgeon Operative Experience at Craig Joint Theater Hospital During the Afghanistan Surge (November 2010 to April 2011), Part II: Humanitarian Cases.

Science.gov (United States)

Steele, John Joseph

2017-01-01

The Afghanistan Surge saw NATO troops working with their Afghan partners to remove Taliban governance and replace it with a more democratic model. As part of this endeavor, medical support for both trauma and humanitarian cases was needed. Identify and discuss disease trends to better prepare for future combat medical treatments. Retrospective review of operative experience from a neurosurgeon from November 2010 to April 2011. 63 cases were performed on 20 NATO and 43 Afghan patients. Combat-related neurotrauma represented 73% (46/63) of cases and humanitarian cases represented the remainder. The most common diseases among humanitarian cases were benign tumors (29%, 5/17), cranioplasty (23%, 4/17), obstructive hydrocephalus (11%, 2/17), nonobstructive hydrocephalus (11%, 2/17), hemifacial spasm (11%, 2/17), and cerebral angiography (11%, 2/17). There was 1 death from ventriculitis for a complication rate of 6%. In select well-nourished, patients with minimal risk of needing tracheostomy, humanitarian neurosurgery can be safely performed in theater with a complication rate (6%) no worse than patients operated on in the United States. Reprint & Copyright © 2017 Association of Military Surgeons of the U.S.

Adjunctive levetiracetam in children, adolescents, and adults with primary generalized seizures: Open-label, noncomparative, multicenter, long-term follow-up study.

LENUS (Irish Health Repository)

Delanty, Norman

2012-02-01

Purpose: To evaluate the long-term efficacy and tolerability of adjunctive levetiracetam (LEV) in patients with uncontrolled idiopathic generalized epilepsy (IGE). Methods: This phase III, open-label, long-term, follow-up study (N167; NCT00150748) enrolled patients (4 to <65 years) with primary generalized seizures (tonic-clonic, myoclonic, absence). Patients received adjunctive LEV at individualized doses (1,000-4,000 mg\\/day; 20-80 mg\\/kg\\/day for children\\/adolescents weighing <50 kg). Efficacy results are reported for all seizure types [intention-to-treat (ITT) population, N = 217] and subpopulations with tonic-clonic (n = 152), myoclonic (n = 121), and\\/or absence (n = 70) seizures at baseline. Key Findings: One hundred twenty-five (57.6%) of 217 patients were still receiving treatment at the end of the study. Mean (standard deviation, SD) LEV dose was 2,917.5 (562.9) mg\\/day. Median (Q1-Q3) exposure to LEV was 2.1 (1.5-2.8) years, and the maximum duration was 4.6 years. Most patients were taking one (124\\/217, 57.1%) or >\\/=2 (92\\/217, 42.4%) concomitant antiepileptic drugs (AEDs). Seizure freedom of >\\/=6 months (all seizure types; primary efficacy end point) was achieved by 122 (56.2%) of 217 patients, and 49 (22.6%) of 217 patients had complete seizure freedom. Seizure freedom of >\\/=6 months from tonic-clonic, myoclonic, and absence seizures was achieved by 95 (62.5%) of 152, 75 (62.0%) of 121, and 44 (62.9%) of 70 patients, respectively. Mean (SD) maximum seizure freedom duration was 371.7 (352.4) days. At least one treatment-emergent adverse event (TEAE) was reported by 165 (76%) of 217 patients; most TEAEs were mild\\/moderate in severity, with no indication of an increased incidence over time. Seventeen (7.8%) of 217 patients discontinued medication because of TEAEs. The most common psychiatric TEAEs were depression (16\\/217, 7.4%), insomnia (9\\/217, 4.1%), nervousness (8\\/217, 3.7%), and anxiety (7\\/217, 3.2%). Significance: Adjunctive

High thermoelectric figure of merit in nanocrystalline polyaniline at low temperatures

Energy Technology Data Exchange (ETDEWEB)

Nath, Chandrani; Kumar, Ashok, E-mail: ask@tezu.ernet.in, E-mail: okram@csr.res.in [Materials Research Laboratory, Department of Physics, Tezpur University, Tezpur 784 028 (India); Kuo, Yung-Kang [Department of Physics, National Dong-Hwa University, Hualien 974, Taiwan (China); Okram, Gunadhor Singh, E-mail: ask@tezu.ernet.in, E-mail: okram@csr.res.in [Electrical Transport Laboratory, UGC-DAE Consortium for Scientific Research, University Campus, Khandwa Road, Indore 452 017 (India)

2014-09-29

Thermoelectric coolers with figure of merit (ZT) close to unity at low temperatures are the need of the hour with new advances in high temperature superconductors, superconducting microelectronic circuits, quantum computers, and photonics. Here, we demonstrate that the conducting polymer polyaniline (Pani) doped with camphor sulfonic acid synthesized in semi-crystalline nanostructures, possesses a giant Seebeck effect at low temperatures. The resulting enormously large Seebeck coefficient (up to 0.6 V/K) combined with an intrinsically low electrical conductivity and thermal conductivity give rise to a ZT = 0.77 at 45 K and ZT = 2.17 at 17 K.

Readout and Trigger for the AFP Detector at the ATLAS Experiment

CERN Document Server

Kocian, Martin; The ATLAS collaboration

2018-01-01

AFP, the ATLAS Forward Proton consists of silicon detectors at 205 m and 217 m on each side of ATLAS. In 2016 two detectors in one side were installed. The FEI4 chips are read at 160 Mbps over the optical fibers. The DAQ system uses a FPGA board with Artix chip and a mezzanine card with RCE data processing module based on a Zynq chip with ARM processor running Linux. In this contribution we give an overview of the AFP detector with the commissioning steps taken to integrate with the ATLAS TDAQ. Furthermore first performance results are presented.

Digital Breast Tomosynthesis versus Supplemental Diagnostic Mammographic Views for Evaluation of Noncalcified Breast Lesions

Science.gov (United States)

Bandos, Andriy I.; Ganott, Marie A.; Sumkin, Jules H.; Kelly, Amy E.; Catullo, Victor J.; Rathfon, Grace Y.; Lu, Amy H.; Gur, David

2013-01-01

Purpose: To compare the diagnostic performance of breast tomosynthesis versus supplemental mammography views in classification of masses, distortions, and asymmetries. Materials and Methods: Eight radiologists who specialized in breast imaging retrospectively reviewed 217 consecutively accrued lesions by using protocols that were HIPAA compliant and institutional review board approved in 182 patients aged 31–60 years (mean, 50 years) who underwent diagnostic mammography and tomosynthesis. The lesions in the cohort included 33% (72 of 217) cancers and 67% (145 of 217) benign lesions. Eighty-four percent (182 of 217) of the lesions were masses, 11% (25 of 217) were asymmetries, and 5% (10 of 217) were distortions that were initially detected at clinical examination in 8% (17 of 217), at mammography in 80% (173 of 217), at ultrasonography (US) in 11% (25 of 217), or at magnetic resonance imaging in 1% (2 of 217). Histopathologic examination established truth in 191 lesions, US revealed a cyst in 12 lesions, and 14 lesions had a normal follow-up. Each lesion was interpreted once with tomosynthesis and once with supplemental mammographic views; both modes included the mediolateral oblique and craniocaudal views in a fully crossed and balanced design by using a five-category Breast Imaging Reporting and Data System (BI-RADS) assessment and a probability-of-malignancy score. Differences between modes were analyzed with a generalized linear mixed model for BI-RADS–based sensitivity and specificity and with modified Obuchowski-Rockette approach for probability-of-malignancy–based area under the receiver operating characteristic (ROC) curve. Results: Average probability-of-malignancy–based area under the ROC curve was 0.87 for tomosynthesis versus 0.83 for supplemental views (P tomosynthesis, the false-positive rate decreased from 85% (989 of 1160) to 74% (864 of 1160) (P tomosynthesis, more cancers were classified as BI-RADS category 5 (39% [226 of 576] vs 33% [188

The high squareness Sm-Co magnet having Hcb=10.6 kOe at 150°C

Directory of Open Access Journals (Sweden)

Hiroaki Machida

2017-05-01

Full Text Available The relationship between magnetic properties and magnetic domain structures of Sm(Fe, Cu, Zr, Co7.5 magnet was investigated. The developed Sm-Co magnet, which is conducted homogenization heat treatment at ingot state, high temperature short time sintering and long time solid solution heat treatment showed the maximum energy product, [BH]m of 34.0 MGOe and the coercivity, Hcb of 11.3 kOe at 20°C respectively. Moreover, Hcb of 10.6 kOe at 150°C was achieved. Heat treated ingot has clear 1-7 phase in mother phase from optical microscope observation. Kerr effect microscope with magnetic field applied was used to investigate magnetic domain structure. Reverse magnetic domains were generated evenly but generation of them from inside grain were not observed. Cell structure was observed by scanning transmission electron microscope and composition analysis was conducted by energy dispersive X-ray spectroscopy. Cell size was approximately 150 ∼ 300 nm, Fe and Cu were clearly separated and concentrated to 2-17 phase and 1-5 phase respectively. Moreover, Cu concentration went up to 40 at% in 1-5 phase. That means the gap of domain wall energy between 1-5 phase and 2-17 phase was increased due to microstructure control by conducting heat treatment for compositional homogeneity.

48 CFR 217.7102 - General.

Science.gov (United States)

2010-10-01

... DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for Repair and... contractors located outside the United States and its outlying areas. (c) Activities may issue job orders... government in the solicitation and job order. [56 FR 36345, July 31, 1991, as amended at 70 FR 35544, June 21...

Measurement of the differential and double-differential Drell-Yan cross sections in proton-proton collisions at sqrt{s} = 7 TeV

Energy Technology Data Exchange (ETDEWEB)

Chatrchyan, Serguei; et al.,

2013-12-01

Measurements of the differential and double-differential Drell-Yan cross sections are presented using an integrated luminosity of 4.5(4.8) inverse femtobarns in the dimuon (dielectron) channel of proton-proton collision data recorded with the CMS detector at the LHC at sqrt{s} = 7 TeV. The measured inclusive cross section in the Z-peak region (60-120 GeV) is \\sigma(\\ell \\ell) = 986.4 +/- 0.6 (stat.) +/- 5.9 (exp. syst.) +/- 21.7 (th. syst.) +/- 21.7 (lum.) pb for the combination of the dimuon and dielectron channels. Differential cross sections $d\\sigma/dm$ for the dimuon, dielectron, and combined channels are measured in the mass range 15 to 1500 GeV and corrected to the full phase space. Results are also presented for the measurement of the double-differential cross section d^2\\sigma/dm d |y| in the dimuon channel over the mass range 20 to 1500 GeV and absolute dimuon rapidity from 0 to 2.4. These measurements are compared to the predictions of perturbative QCD calculations at next-to-leading and next-to-next-to-leading orders using various sets of parton distribution functions.

Investigating the effects of 217 Hz frequency of cell phone on learning and spatial memory in rats

Directory of Open Access Journals (Sweden)

Kohzad S

2013-03-01

Full Text Available Background: Extremely low frequency (0-300 Hz fields from power lines, electronic equipment and medical devices, have been reported to produce various biological effects. Global system for mobile (GSM is most largely used in everybody's life. This system utilizes a low frequency band as well as a high frequency range of electromagnetic field. This study investigated the effects of 217 Hz electromagnetic field (the modulating signal in GSM on spatial learning and memory in rat.Methods: Twenty four male Wistar rat (200- 250 g were randomly divided in to three groups as: test, sham and control. Using a Helmholtz coil system, the test group was exposed to a uniform pulsed EMF of 200 µT (micro Tesla intensity for 4 h/day for 21 days (2 time in a day. This procedure was repeated for the sham group but with no field. All groups were trained prior to the day 21 on the 15th day for five days four trial per day in Morris Water-Maze system. Then the probe test was carried out for 60 seconds with no platform.Results: The ANOVA test revealed that no significant differences were found between control and exposed rats in all day of learning acquisition. Also, in probe test for investigating the memory, no significant differences observed. (P≤0.05 is accepted for significant level.Conclusion: This finding is in consistent with previous studies and indicates low frequency band of electromagnetic fields (EMF (200 µT intensity in cell phone may not have any effect on the learning acquisition and spatial memory in rat.

Age at weaning, immunocompetence and ectoparasite performance in a precocial desert rodent

Czech Academy of Sciences Publication Activity Database

Dlugosz, E. M.; Goüy de Bellocq, Joëlle; Khokhlova, I. S.; Degen, A. A.; Pinshow, B.; Krasnov, B. R.

2014-01-01

Roč. 217, č. 17 (2014), s. 3078-3084 ISSN 0022-0949 Institutional support: RVO:68081766 Keywords : Fleas * PHA response * Weaning * Spiny mouse Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

Malachi’s concern for social justice: Malachi 2:17 and 3:5 and its ethical imperatives for faith communities

Directory of Open Access Journals (Sweden)

Blessing O. Bọlọjẹ

2014-07-01

Full Text Available Any time humans in any culture consider primary ethical concepts, justice will be to the fore. Much seems to hinge upon it whether human society is to function with any semblance of civil order, security and harmony. When justice is pervasively trampled upon, the very fabric of liveable society crumbles. The apprehension for justice is clearly reflected in almost all of the Old Testament (OT. It is an important theological motif in the OT. This is found in such OT literature as historical, legal, prophetic and wisdom writings. This evidence thus reveals that the apprehension for the issue of justice was one of the many ways by which Israel’s multifaceted social life was knit together throughout its various ancient historical developments. No aspect of the life of Israel was excluded from this kind of apprehension for justice, and Yahweh was understood to be actively involved in its entire phase. This article examines Malachi’s fourth disputation in the light of the lawlessness alluded to in Malachi 2:17 and the corruption of personal and civil morality in Malachi 3:5. In the discussions that follow, this article examines the need for the justice of Yahweh; that is, Yahweh’s righting of past wrongs and the reversal of sinful societal order. The purpose is to enact a communal ethic for those who generously care for the neighbourhood and are firm in their devotion to Him, that is, God.

Passively mode-locked Nd:YVO4 laser operating at 1073 nm and 1085 nm

Science.gov (United States)

Waritanant, Tanant; Major, Arkady

2018-02-01

A passively mode-locked Nd:YVO4 laser operating at 1073 nm and 1085 nm was demonstrated with an intracavity birefringent filter as the wavelength selecting element. The average output powers achieved were 2.17 W and 2.18 W with optical-to-optical efficiency of 19.6% and 19.7%, respectively. The slope efficiencies were more than 31% at both output wavelengths. The pulse durations at the highest average output power were 10.3 ps and 8.4 ps, respectively. We believe that this is the first report of mode locking of a Nd:YVO4 laser operating at 1073 nm or 1085 nm lines.

Radioisotope space power generator annual report, July 1, 1974--June 30, 1975

International Nuclear Information System (INIS)

Elsner, N.B.; Chin, J.; Staley, H.G.

1976-01-01

The Isotec Technology Program for FY-75 concentrated on materials development efforts in two areas: TPM-217 P-type material and SiGe technology. TPM-217 P-type material is a 3M proprietary thermoelectric material whose principal components are Cu, Ag, and Se. The usefulness of TPM-217 P-type selenide in thermoelectric converters depends on its dimensional, electrical, and thermal stability at high temperature and its compatibility with other converter component materials in a low-pressure environment. Experimental efforts were directed toward determining (1) the vapor species above TPM-217 from 700 0 to 1100 0 C, (2) the weight loss rate for TPM-217 at 900 0 C in vacuo, and (3) the stability of TPM-217 material in contact with Mo, Fe, 316 stainless steel, and pyrocarbon. The Si-Ge program is a continuation of the experimental work performed during FY-74. The development of coatings to suppress the vaporization of SiMo and SiGe continued. Techniques for applying ion-plated and chemical-vapor-deposited coatings of Si 3 N 4 and (Si,Al)N alloys on SiMo were examined. Methods of controlling morphology and the chemical composition of these coatings were developed. Rates of vaporization for coated samples at 1100 0 C were measured

Melting-pressure and density equations of 3He at temperatures from 0.001 to 30 K

International Nuclear Information System (INIS)

Huang Yonghua; Chen Guobang

2005-01-01

Nonsegmented equations for melting pressure and density at temperatures from 0.001 K to 30 K have been developed to fit the reference data. The maximum and average deviations between the melting pressure equation and the totaling 298 reference data are 2.17% and 0.218%, respectively. For the density equations, the average deviations are 0.236% for the liquid side and 0.218% for the solid side. Both the melting pressure curve and melting density curves predicted by the submitted equations approach their minimums at about 0.315 K

75 FR 9103 - Approval and Promulgation of Air Quality Implementation Plans; Illinois; NOX

Science.gov (United States)

2010-03-01

... recommend that you telephone John Summerhays, Environmental Scientist, at (312) 886-6067, before visiting... 35 IAC 217 Subpart W. Illinois' revision would add 35 IAC 217.751, the full text of which is: The...

Assessing the Impact of In-Service Training on Staff Performance at ...

African Journals Online (AJOL)

performance in terms of knowledge and skills gained. It was recommended that more research is undertaken on all UEW campuses to add to both literature and knowledge of INSET. Keywords: Staff Performance, In-Service Training, Staff Development International Journal of Educational Research Vol. 3 (2) 2007 pp. 217- ...

14 CFR 120.217 - Tests required.

Science.gov (United States)

2010-01-01

... best available information at the time of the determination, that the covered employee's performance... involving the performance of safety-sensitive functions). (2) You must treat all safety-sensitive employees... employee for alcohol if that employee's performance of a safety-sensitive function either contributed to...

Publications | Page 217 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

IDRC works with developing-country researchers and institutions to build local capacity ... Through books, articles, research publications, and studies, we aim to widen the ... Case study : SIRCA; building evaluation capacity - a review of awarding, ... Behind the Scenes at a Climate Change Knowledge Sharing Network: IDS ...

48 CFR 252.217-7006 - Title.

Science.gov (United States)

2010-10-01

... performance of a job order shall vest in the Government upon delivery at the location specified for the performance of the work. (b) Upon completion of the job order, or with the approval of the Contracting Officer during performance of the job order, all Contractor-furnished materials and equipment not incorporated in...

Planck 2015 results: VII. High Frequency Instrument data processing: Time-ordered information and beams

DEFF Research Database (Denmark)

Adam, R.; Ade, P. A R; Aghanim, N.

2016-01-01

The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the d...

Increasing age and tear size reduce rotator cuff repair healing rate at 1 year.

Science.gov (United States)

Rashid, Mustafa S; Cooper, Cushla; Cook, Jonathan; Cooper, David; Dakin, Stephanie G; Snelling, Sarah; Carr, Andrew J

2017-12-01

Background and purpose - There is a need to understand the reasons why a high proportion of rotator cuff repairs fail to heal. Using data from a large randomized clinical trial, we evaluated age and tear size as risk factors for failure of rotator cuff repair. Patients and methods - Between 2007 and 2014, 65 surgeons from 47 hospitals in the National Health Service (NHS) recruited 447 patients with atraumatic rotator cuff tendon tears to the United Kingdom Rotator Cuff Trial (UKUFF) and 256 underwent rotator cuff repair. Cuff integrity was assessed by imaging in 217 patients, at 12 months post-operation. Logistic regression analysis was used to determine the influence of age and intra-operative tear size on healing. Hand dominance, sex, and previous steroid injections were controlled for. Results - The overall healing rate was 122/217 (56%) at 12 months. Healing rate decreased with increasing tear size (small tears 66%, medium tears 68%, large tears 47%, and massive tears 27% healed). The mean age of patients with a healed repair was 61 years compared with 64 years for those with a non-healed repair. Mean age increased with larger tear sizes (small tears 59 years, medium tears 62 years, large tears 64 years, and massive tears 66 years). Increasing age was an independent factor that negatively influenced healing, even after controlling for tear size. Only massive tears were an independent predictor of non-healing, after controlling for age. Interpretation - Although increasing age and larger tear size are both risks for failure of rotator cuff repair healing, age is the dominant risk factor.

Implications of geomorphological research for recent and prehistoric avalanches and related hazards at Huascaran, Peru

Czech Academy of Sciences Publication Activity Database

Klimeš, Jan; Vilímek, V.; Omelka, M.

2009-01-01

Roč. 50, č. 1 (2009), s. 193-209 ISSN 0921-030X Institutional research plan: CEZ:AV0Z30460519 Keywords : rock debris avalanches * natural hazards * Huascaran Subject RIV: DE - Earth Magnetism, Geodesy, Geography Impact factor: 1.217, year: 2009

Descriptive evaluation of holter recordings at a teaching hospital in ...

African Journals Online (AJOL)

Wide QRS complex tachycardia was detected in 20.4%, ST segment depression in 47.8% and atrial fibrillation in 28.7%. Asystole was seen in 18% of subjects with a mean duration of 2.17secs, arrest was recorded in 26.7% of those with asystole. The longest duration was 7.58secs. Premature atrial ectopics were seen in ...

Defects in SiO2 crystals after neutron irradiations at 20 K and 360 K

International Nuclear Information System (INIS)

Nakagawa, M.; Okada, M.; Kawabata, Y.; Atobe, K.; Itoh, H.; Nakanishi, S.

1994-01-01

The synthetic silicon dioxide (SiO 2 ), cut parallel (x-plate) or perpendicular (z-plate) to c-axis, are irradiated by reactor neutrons at 360 K (2.8x10 18 n/cm 2 ) or at 20 K (8.0x10 16 n/cm 2 ). After neutron irradiation at 360 K, the main absorption peak can be observed at 212 nm (5.84 eV) for z-plate and 217 nm (5.71 eV) for x-plate. After irradiation at 20 K a new band at 250 nm (4.96 eV) can be observed in addition to the band at about 220 nm. The 250 nm band having FWHM similar 0.44 eV disappears at 300-340 K. Thermoluminescences are also observed between 80 to 400 K; which show some difference between x-plate and z-plate. ((orig.))

THORS: a high-temperature sodium test facility rated at 2.0 MW

International Nuclear Information System (INIS)

Gnadt, P.A.; Anderson, A.H.; Clapp, N.E.; Montgomery, B.H.; Collins, C.W.; Stulting, R.D.

1979-01-01

The Thermal--Hydraulic Out-of-Reactor Safety (THORS) facility at Oak Ridge Naitonal Laboratory (ORNL) is a high-temperature sodium test facility operated for the United States Breeder Reactor Safety Program. The facility is primarily used for testing large simulated Liquid-Metal Fast Breeder Reactor (LMFBR) fuel subassemblies. The facility has recently been upgraded to provide a 2.0-MW test bundle power input and heat removal capability. A new test section, which will be capable of operating at 980 0 C and which will accommodate a 217-pin bundle, has also been added. A 61-pin bundle is currently under test in the facility. A description of the test facility is presented, along with a brief summary of the 8-year operating history of this safety-related test facility

Planococcus salinus sp. nov., a moderately halophilic bacterium isolated from a saline-alkali soil.

Science.gov (United States)

Gan, Longzhan; Zhang, Heming; Tian, Jiewei; Li, Xiaoguang; Long, Xiufeng; Zhang, Yuqin; Dai, Yumei; Tian, Yongqiang

2018-02-01

A novel aerobic, Gram-stain-positive, motile, moderately halophilic and coccoid bacterial strain, designated LCB217 T , was isolated from a saline-alkali soil in north-western China and identified using a polyphasic taxonomic approach. Growth occurred with 3-15 % (w/v) NaCl (optimum 3-5 %), at 10-45 °C (optimum 30 °C) and at pH 7.0-9.0 (optimum pH 9.0). Strain LCB217 T contained MK-7 and MK-8 as the predominant menaquinones and anteiso-C15 : 0, iso-C14 : 0 and iso-C16 : 0 as the major fatty acids. The polar lipids from strain LCB217 T consisted of diphosphatidylglycerol, phosphatidylglycerol, phosphatidylethanolamine, phosphatidylcholine, one unidentified phospholipid, one unidentified aminophospholipid and one unidentified lipid. The peptidoglycan type was A4α (l-Lys-d-Glu). Phylogenetic analysis of the 16S rRNA gene sequence showed that strain LCB217 T belonged to the genus Planococcus and was closely related to the type strains Planococcus plakortidis AS/ASP6 (II) T (98.2 % similarity), Planococcus maitriensis S1 T (97.7 %) and Planococcus salinarum ISL-16 T (97.2 %). The G+C content of the genomic DNA was 49.4 mol%. DNA-DNA relatedness values between strain LCB217 T andPlanococcusplakortidis AS/ASP6 (II) T , Planococcusmaitriensis S1 T andPlanococcussalinarum ISL-16 T were 29.5, 38.1 and 39.5 %, respectively. On the basis of the phenotypic, phylogenetic and genomic data, strain LCB217 T represents a novel species of the genus Planococcus, for which the name Planococcus salinus sp. nov. is proposed. The type strain is LCB217 T (=CGMCC 1.15685 T =KCTC 33861 T ).

Immunogenicity, safety and reactogenicity of the pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV) in 2-17-year-old children with asplenia or splenic dysfunction: A phase 3 study.

Science.gov (United States)

Szenborn, L; Osipova, I V; Czajka, H; Kharit, S M; Jackowska, T; François, N; Habib, M A; Borys, D

2017-09-25

Immunization with pneumococcal vaccines is an important prophylactic strategy for children with asplenia or splenic dysfunction, who are at high risk of bacterial infections (including S. pneumoniae). This study aimed to assess immunogenicity and safety of pneumococcal non-typeable Haemophilus influenzae protein D conjugate vaccine (PHiD-CV, GSK) in this at-risk population. This phase III, multi-centre, open-label, controlled study, in which at-risk children with asplenia or splenic dysfunction were enrolled (age strata: 2-4, 5-10 and 11-17years), was conducted in Poland and the Russian Federation. For the 2-4years at-risk group, healthy age-matched children were enrolled as control. Unprimed children (not previously vaccinated with any pneumococcal vaccine) received 2 PHiD-CV doses (≥2months apart) and pneumococcal vaccine-primed children received 1 dose. Immune responses were assessed pre-vaccination and one month post-each dose. Solicited and unsolicited adverse events (AEs) were recorded for 4 and 31days post-vaccination, respectively, and serious AEs (SAEs) throughout the study. Of 52 vaccinated children (18 at-risk primed, 28 at-risk unprimed and 6 control unprimed), 45 (18, 23 and 4, respectively) were included in the according-to-protocol cohort for immunogenicity. Post-vaccination (post-dose 1 in primed and post-dose 2 in unprimed children), for each vaccine pneumococcal serotype and vaccine-related serotype 6A all at-risk children had antibody concentrations ≥0.2µg/mL, and for vaccine-related serotype 19A at least 94.4%. Increases in antibody geometric mean concentrations were observed. For most serotypes, all at-risk children had post-vaccination opsonophagocytic activity (OPA) titers ≥8 and increases in OPA geometric mean titers were observed. No safety concerns were raised. One non-fatal SAE (respiratory tract infection, considered not vaccine-related) was reported by one at-risk unprimed child. PHiD-CV was immunogenic and well tolerated in 2-17

76 FR 8620 - Airworthiness Directives; Pratt & Whitney JT8D-209, -217, -217A, -217C, and -219 Turbofan Engines

Science.gov (United States)

2011-02-15

... inspection AD 97-17-04R1, and to allow automatic eddy current inspection per engine manual Section 72-33-31.... That AD currently requires revisions to the engine manufacturer's time limits section (TLS) to include... modifies the TLS of the manufacturer's engine manual and an air carrier's approved continuous airworthiness...

Radioisotope space power generator. Annual report, July 1, 1975--September 30, 1976

International Nuclear Information System (INIS)

Elsner, N.B.; Chin, J.; Staley, H.G.; Steeger, E.J.; Gantzel, P.K.

1977-09-01

TPM-217 P-type selenide usefulness in thermoelectric converters depends on its dimensional, electrical and thermal stability at high temperature and its compatibility with other converter component materials in a low pressure environment. Experimental efforts have been directed at determining: the vaporization behavior at 900 0 C, the partial pressures of vaporizing species versus temperature, vapor suppression coatings, thermal expansion, dimensional stability, and the high temperature compatibility of TPM-217 with proposed end cap materials

48 CFR 217.7404-6 - Allowable profit.

Science.gov (United States)

2010-10-01

... ensure the profit allowed reflects— (a) Any reduced cost risk to the contractor for costs incurred during contract performance before negotiation of the final price; (b) The contractor's reduced cost risk for costs incurred during performance of the remainder of the contract; and (c) The requirements at 215.404...

NCBI nr-aa BLAST: CBRC-PABE-26-1117 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-26-1117 ref|ZP_01033920.1| hypothetical protein ROS217_18782 [Roseovarius... sp. 217] gb|EAQ26601.1| hypothetical protein ROS217_18782 [Roseovarius sp. 217] ZP_01033920.1 2.5 28% ...

A Suzaku Search for Nonthermal Emission at Hard X-Ray Energies in the Coma Cluster

Science.gov (United States)

2008-09-01

8.45 ± 0.07 0.217 ± 0.002 2.0 (2+12−2 ) × 10−4 1676.18/1688 2Te 8.0 0.17 10.1 0.05 1672.34/1687 Tmap · · · · · · . . . · · · 1684.35/1690 Notes. a See...the temperature map. The thermal model (“ Tmap ,” green) is nearly coincident with the data, though falling below it at higher energies. The other two...PIN spatial sensi- tivity and combined them. This resulting model was compared with the PIN spectrum (Table 2, row labeled “ Tmap ”). Note that only the

Improved Measurement of Electron-antineutrino Disappearance at Daya Bay

International Nuclear Information System (INIS)

Dwyer, D.A.

2013-01-01

With 2.5× the previously reported exposure, the Daya Bay experiment has improved the measurement of the neutrino mixing parameter sin 2 2θ 13 =0.089±0.010(stat)±0.005(syst). Reactor anti-neutrinos were produced by six 2.9 GW th commercial power reactors, and measured by six 20-ton target-mass detectors of identical design. A total of 234,217 anti-neutrino candidates were detected in 127 days of exposure. An anti-neutrino rate of 0.944±0.007(stat)±0.003(syst) was measured by three detectors at a flux-weighted average distance of1648 m from the reactors, relative to two detectors at 470 m and one detector at 576 m. Detector design and depth underground limited the background to 5±0.3% (far detectors) and 2±0.2% (near detectors) of the candidate signals. The improved precision confirms the initial measurement of reactor anti-neutrino disappearance, and continues to be the most precise measurement of θ 13

Improved Measurement of Electron-antineutrino Disappearance at Daya Bay

Energy Technology Data Exchange (ETDEWEB)

Dwyer, D.A. [Kellogg Radiation Laboratory, California Institute of Technology, Pasadena, CA (United States); Lawrence Berkeley National Laboratory, Berkeley, CA (United States)

2013-02-15

With 2.5× the previously reported exposure, the Daya Bay experiment has improved the measurement of the neutrino mixing parameter sin{sup 2}2θ{sub 13}=0.089±0.010(stat)±0.005(syst). Reactor anti-neutrinos were produced by six 2.9 GW{sub th} commercial power reactors, and measured by six 20-ton target-mass detectors of identical design. A total of 234,217 anti-neutrino candidates were detected in 127 days of exposure. An anti-neutrino rate of 0.944±0.007(stat)±0.003(syst) was measured by three detectors at a flux-weighted average distance of1648 m from the reactors, relative to two detectors at 470 m and one detector at 576 m. Detector design and depth underground limited the background to 5±0.3% (far detectors) and 2±0.2% (near detectors) of the candidate signals. The improved precision confirms the initial measurement of reactor anti-neutrino disappearance, and continues to be the most precise measurement of θ{sub 13}.

Antibacterial activities of coagulase-negative staphylococci from bovine teat apex skin and their inhibitory effect on mastitis-related pathogens.

Science.gov (United States)

Braem, G; Stijlemans, B; Van Haken, W; De Vliegher, S; De Vuyst, L; Leroy, F

2014-05-01

To explore antibacterial activities of coagulase-negative staphylococci (CoNS) from teat apices of dairy cows towards mastitis-causing pathogens. Of 254 CoNS, 38 displayed bacteriocin-like activity after a first screening. Seven of these strains displayed activity against at least one mastitis-related pathogen (Streptococcus uberis, Streptococcus dysgalactiae and Staphylococcus aureus). Staphylococcus chromogenes L217 displayed the strongest inhibitory effect, being active against all tested mastitis-related pathogens and most tested CoNS. Based on cation exchange and reversed-phase chromatography, in addition to N-terminal Edman degradation and PCR, the antibacterial peptide was identified as a nukacin-type bacteriocin and named nukacin L217. Although staphylococcal bacteriocins are generally found in the cell-free supernatants of liquid cultures, Staph. chromogenes L217 only led to detectable activity when grown on agar medium. Bacteriocin-like activities are not uncommon among CoNS from teat apices and may inhibit mastitis-causing pathogens, as found for nukacin L217 production by Staph. chromogenes L217. Nukacin L217 is the first identified bacteriocin of the species Staph. chromogenes and displays unusual production kinetics, that is, requiring surface growth of its producer. The fact that nukacins are produced by different CoNS species suggests a role in the teat skin ecosystem. © 2014 The Society for Applied Microbiology.

Minimal Representation and Decision Making for Networked Autonomous Agents

Science.gov (United States)

2015-08-27

University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 8. PERFORMING ORGANIZATION REPORT NUMBER 9. SPONSORING/MONITORING AGENCY NAME(S...Laboratory University of Illinois at Urbana Champaign 1308 W Main, Urbana , IL 61801 tel: 217-333-1368, fax: 217-244-1653 email: voulgari@illinois.edu...a mobile sensor network (MSN) when some of the nodes in the network fail. We posed the problem as a multi-stage decision process, and used forward

Long term storage of explosively erupted magma at Nevado de Toluca volcano, Mexico

Science.gov (United States)

Arce, J. L.; Gardner, J.; Macias, J. L.

2007-12-01

Dacitic magmas production is common in subduction-related volcanoes, occurring in those with a long period of activity as a result of the magmatic evolution. However, in this evolution many factors (i.e. crystal fractionation, assimilation, magma mixing) can interact to produce dacites. Nevado de Toluca volcano (4,680 masl; 19°09'N; 99°45'W) Central Mexico has recorded a long period of time producing dacites explosively, at least during 42 ka of activity, involving several km3 of magma, with two important Plinian-type eruptions occurred at ~21.7 ka (Lower Toluca Pumice) and ~10.5 ka (Upper Toluca Pumice). Questions like, what was the mechanism responsible to produce voluminous dacitic magma and how the volatiles and pressure changed in the Nevado de Toluca system, remain without answers. Dacites from the Lower Toluca Pumice (LTP) contain plagioclase, amphibole, iron-titanium oxides, and minor resorbed biotite, set in a glassy-vesicular matrix and the Upper Toluca Pumice (UTP) dacites contain the same mineral phases plus orthopyroxene. Ilmenite- ulvospinel geothermometry yielded a temperature of ~860°C for the LTP dacite, a little hotter than the UTP (~ 840°C). Based on hydrothermal experiments data, amphibole is stable above 100 MPa under 900°C, while plagioclase crystallizes up to 250-100 MPa at temperatures of 850-900°C. Pyroxene occurs only at pressures of 200-100 MPa with its respective temperatures of 825-900°C. Water contents in the LTP magma (2-3.5 wt %) are similar to that calculated for the UTP magma (1.3-3.6 wt %). So, there are only small changes in temperature and pressure from ~21.7 ka to 10.5 ka. It is noteworthy that orthopyroxene is absent in the LTP, however reaction-rimmed biotite (probably xenocrystic) is commonly observed in all dacites. Hence, almost all dacitic magmas seem to be stored at relatively similar pressures, water contents, and temperatures. All of these data could suggest repetitive basic magma injections producing the

Birth Defects in Newborns: Spina Bifida Index at Rio Grande Do Norte State in Brazil

Directory of Open Access Journals (Sweden)

Arnaldo CM Junior

2014-08-01

Conclusion: Northeast region is the one that has the major incidence of SB in Brazil country, but RN state has a number lower than others states from its region. It was made an update about therapeutic options to minimize the morbidity and mortality in newborn with SB congenital defects. [J Interdiscipl Histopathol 2014; 2(4.000: 217-223

Atti : programs 2-17

OpenAIRE

Grech, Sergio

1998-01-01

A series of programs where producer and presenter Sergio Grech explores the story of theatre in Malta and the contribution that various personalities gave to enrich it. Unfortunately, program 1 was lost.

Constitution, structure and magnetic properties of some rare-earth - cobalt-aluminium alloys

International Nuclear Information System (INIS)

Evans, J.; Harris, I.R.

1982-01-01

The constitution and structure of the alloys represented by the formulae Cesub(1-x)Alsub(x)Co 5 and Prsub(1-x)Alsub(x)Co 5 (where 0 = 5 produces a mixture of the 1:5 and 2:17 phases based on CeCo 5 and Ce 2 Co 17 ; there are two variations of the 2:17 phase which are isostructural with the hexagonal Th 2 Ni 17 -type and rhombohedral Th 2 Zn 17 -type phases. At the composition Cesub(0.76)Alsub(0.24)Co 5 (4 at % Al) the alloy consists only of the 2:17-type phases and metallographically the alloy is one phase in appearance. Further substitution of Al results in the precipitation of an fcc phase, based on the Co-Al solid solution, in the 2:17 matrix. The crystal structures of the Prsub(1-x)Alsub(x)Co 5 alloys are very similar to those of the equivalent cerium alloys. The metallographic structures of the Pr alloys in the composition range 1 to 3 at % Al show significant differences from the corresponding Ce alloys. Determination of the Curie temperatures of the Rsub(1-x)Alsub(x)Co 5 alloys (R = Ce and Pr) in the composition range 0 = 5 and PrCo 5 phases. (author)

Comparison of the effects of pretreatment with Veramix sponge (medroxyprogesterone acetate) or CIDR (natural progesterone) in combination with an injection of estradiol-17β on ovarian activity, endocrine profiles, and embryo yields in cyclic ewes superovulated in the multiple-dose Folltropin-V (porcine FSH) regimen.

Science.gov (United States)

Bartlewski, Pawel M; Seaton, Patricia; Szpila, Patrycja; Oliveira, Maria E F; Murawski, Maciej; Schwarz, Tomasz; Kridli, Rami T; Zieba, Dorota A

2015-10-15

Follicular wave status at the beginning of exogenous FSH administration is an important contributor to variability in superovulatory responses in ruminants. Studies in ewes have shown a decrease in the number of ovulations when superovulation is initiated in the presence of ostensibly ovulatory-sized ovarian follicles. Hormonal ablation of large antral follicles with the progestin-estradiol (E2-17β) treatment significantly reduces this variability in superovulated anestrous ewes, but the effects of the treatment in cycling ewes have not yet been assessed. Sixteen Rideau Arcott × Polled Dorset ewes (November-December) received either medroxyprogesterone acetate (MAP)-releasing intravaginal sponges (60 mg) or controlled internal drug release (CIDR) devices (containing 300 mg of natural progesterone) for 14 days (Days 0-14), with a single intramuscular injection of 350 μg of E2-17β on Day 6. The superovulatory treatment consisted of six injections of porcine FSH (Folltropin-V) given twice daily, followed by a bolus GnRH injection (50 μg intramuscular) on Day 15. There were no differences (P ewes. In both subsets of animals, the next follicular wave emerged ∼2.5 days after an E2-17β injection (P > 0.05). A decline in maximum follicle size after an E2-17β injection was more abrupt in CIDR- compared with MAP-treated animals, and the ewes pretreated with exogenous progesterone had significantly more 3-mm follicles at the start of the superovulatory treatment. The metabolic clearance rate of exogenous E2-17β appeared to be greater in MAP-treated ewes, but circulating concentrations of porcine FSH failed to increase significantly after each Folltropin-V injection in CIDR-treated animals. The CIDR-treated ewes exceeded (P ewes receiving E2-17β before ovarian superstimulation, there were no differences in superovulatory responses. Copyright © 2015 Elsevier Inc. All rights reserved.

Prognostic value of an electrocardiogram at rest and exercise test in patients admitted with suspected acute myocardial infarction, in whom the diagnosis is not confirmed

DEFF Research Database (Denmark)

Madsen, J K; Hommel, E; Hansen, J F

1987-01-01

. Impaired prognosis was found in patients with negative T waves or ST depression at rest or with ST--T abnormalities or angina pectoris during exercise. Patients with ST depression or elevation, Q wave or intraventricular block at rest. ST abnormalities during exercise or both constituted a high-risk group......The prognosis following discharge in 217 patients admitted with suspected acute myocardial infarction (AMI) due to chest pain, but in whom AMI was not confirmed, was related to the electrocardiogram (ECG) at rest and a symptom-limited exercise test. The patients were followed for 12 to 24 months...... in the ECG at rest and during exercise can be used to identify high and low risk patients....

A 21.7 kb DNA segment on the left arm of yeast chromosome XIV carries WHI3, GCR2, SPX18, SPX19, an homologue to the heat shock gene SSB1 and 8 new open reading frames of unknown function.

Science.gov (United States)

Jonniaux, J L; Coster, F; Purnelle, B; Goffeau, A

1994-12-01

We report the amino acid sequence of 13 open reading frames (ORF > 299 bp) located on a 21.7 kb DNA segment from the left arm of chromosome XIV of Saccharomyces cerevisiae. Five open reading frames had been entirely or partially sequenced previously: WHI3, GCR2, SPX19, SPX18 and a heat shock gene similar to SSB1. The products of 8 other ORFs are new putative proteins among which N1394 is probably a membrane protein. N1346 contains a leucine zipper pattern and the corresponding ORF presents an HAP (global regulator of respiratory genes) upstream activating sequence in the promoting region. N1386 shares homologies with the DNA structure-specific recognition protein family SSRPs and the corresponding ORF is preceded by an MCB (MluI cell cycle box) upstream activating factor.

Planck intermediate results. VII. Statistical properties of infrared and radio extragalactic sources from the Planck Early Release Compact Source Catalogue at frequencies between 100 and 857 GHz

Science.gov (United States)

Planck Collaboration; Ade, P. A. R.; Aghanim, N.; Argüeso, F.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Balbi, A.; Banday, A. J.; Barreiro, R. B.; Battaner, E.; Benabed, K.; Benoît, A.; Bernard, J.-P.; Bersanelli, M.; Bethermin, M.; Bhatia, R.; Bonaldi, A.; Bond, J. R.; Borrill, J.; Bouchet, F. R.; Burigana, C.; Cabella, P.; Cardoso, J.-F.; Catalano, A.; Cayón, L.; Chamballu, A.; Chary, R.-R.; Chen, X.; Chiang, L.-Y.; Christensen, P. R.; Clements, D. L.; Colafrancesco, S.; Colombi, S.; Colombo, L. P. L.; Coulais, A.; Crill, B. P.; Cuttaia, F.; Danese, L.; Davis, R. J.; de Bernardis, P.; de Gasperis, G.; de Zotti, G.; Delabrouille, J.; Dickinson, C.; Diego, J. M.; Dole, H.; Donzelli, S.; Doré, O.; Dörl, U.; Douspis, M.; Dupac, X.; Efstathiou, G.; Enßlin, T. A.; Eriksen, H. K.; Finelli, F.; Forni, O.; Fosalba, P.; Frailis, M.; Franceschi, E.; Galeotta, S.; Ganga, K.; Giard, M.; Giardino, G.; Giraud-Héraud, Y.; González-Nuevo, J.; Górski, K. M.; Gregorio, A.; Gruppuso, A.; Hansen, F. K.; Harrison, D.; Henrot-Versillé, S.; Hernández-Monteagudo, C.; Herranz, D.; Hildebrandt, S. R.; Hivon, E.; Hobson, M.; Holmes, W. A.; Jaffe, T. R.; Jaffe, A. H.; Jagemann, T.; Jones, W. C.; Juvela, M.; Keihänen, E.; Kisner, T. S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurinsky, N.; Kurki-Suonio, H.; Lagache, G.; Lähteenmäki, A.; Lamarre, J.-M.; Lasenby, A.; Lawrence, C. R.; Leonardi, R.; Lilje, P. B.; López-Caniego, M.; Macías-Pérez, J. F.; Maino, D.; Mandolesi, N.; Maris, M.; Marshall, D. J.; Martínez-González, E.; Masi, S.; Massardi, M.; Matarrese, S.; Mazzotta, P.; Melchiorri, A.; Mendes, L.; Mennella, A.; Mitra, S.; Miville-Deschènes, M.-A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Munshi, D.; Murphy, J. A.; Naselsky, P.; Nati, F.; Natoli, P.; Nørgaard-Nielsen, H. U.; Noviello, F.; Novikov, D.; Novikov, I.; Osborne, S.; Pajot, F.; Paladini, R.; Paoletti, D.; Partridge, B.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G. W.; Prunet, S.; Puget, J.-L.; Rachen, J. P.; Reach, W. T.; Rebolo, R.; Reinecke, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Rosset, C.; Rowan-Robinson, M.; Rubiño-Martín, J. A.; Rusholme, B.; Sajina, A.; Sandri, M.; Savini, G.; Scott, D.; Smoot, G. F.; Starck, J.-L.; Sudiwala, R.; Suur-Uski, A.-S.; Sygnet, J.-F.; Tauber, J. A.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tucci, M.; Türler, M.; Valenziano, L.; Van Tent, B.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L. A.; Wandelt, B. D.; White, M.; Yvon, D.; Zacchei, A.; Zonca, A.

2013-02-01

We make use of the Planck all-sky survey to derive number counts and spectral indices of extragalactic sources - infrared and radio sources - from the Planck Early Release Compact Source Catalogue (ERCSC) at 100 to 857 GHz (3 mm to 350 μm). Three zones (deep, medium and shallow) of approximately homogeneous coverage are used to permit a clean and controlled correction for incompleteness, which was explicitly not done for the ERCSC, as it was aimed at providing lists of sources to be followed up. Our sample, prior to the 80% completeness cut, contains between 217 sources at 100 GHz and 1058 sources at 857 GHz over about 12 800 to 16 550 deg2 (31 to 40% of the sky). After the 80% completeness cut, between 122 and 452 and sources remain, with flux densities above 0.3 and 1.9 Jy at 100 and 857 GHz. The sample so defined can be used for statistical analysis. Using the multi-frequency coverage of the Planck High Frequency Instrument, all the sources have been classified as either dust-dominated (infrared galaxies) or synchrotron-dominated (radio galaxies) on the basis of their spectral energy distributions (SED). Our sample is thus complete, flux-limited and color-selected to differentiate between the two populations. We find an approximately equal number of synchrotron and dusty sources between 217 and 353 GHz; at 353 GHz or higher (or 217 GHz and lower) frequencies, the number is dominated by dusty (synchrotron) sources, as expected. For most of the sources, the spectral indices are also derived. We provide for the first time counts of bright sources from 353 to 857 GHz and the contributions from dusty and synchrotron sources at all HFI frequencies in the key spectral range where these spectra are crossing. The observed counts are in the Euclidean regime. The number counts are compared to previously published data (from earlier Planck results, Herschel, BLAST, SCUBA, LABOCA, SPT, and ACT) and models taking into account both radio or infrared galaxies, and covering a

34 CFR 685.217 - Teacher loan forgiveness program.

Science.gov (United States)

2010-07-01

... borrower— (A) Demonstrated knowledge and teaching skills in reading, writing, mathematics, and other areas...) May receive up to $17,500 of loan forgiveness if the borrower— (A) Taught mathematics or science on a full-time basis at an eligible secondary school, or taught mathematics or science to secondary school...

48 CFR 217.7103-2 - Period of agreement.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for.... (c) Cancellation of a master agreement does not affect the rights and liabilities under any job order existing at the time of cancellation. The contractor must continue to perform all work covered by any job...

48 CFR 252.217-7014 - Discharge of liens.

Science.gov (United States)

2010-10-01

... discharged, any lien or right in rem of any kind, other than in favor of the Government, that exists or...) If any lien or right in rem is not immediately discharged, the Government, at the expense of the Contractor, may discharge, or cause to be discharged, the lien or right. (End of clause) ...

Heavy quark production at SLC and LEP

International Nuclear Information System (INIS)

Hearty, C.

1990-06-01

Experiments at SLC and LEP have made preliminary measurements of the relative partial widths of the c and b quarks. Using D* tagging, DELPHI has found R c bar c triple-bond/Γ c bar c/Γ hadr. = 0.162 ± 0.032 ± 0.031, in good agreement with the Standard Model value of 0.171. ALEPH has used semileptonic decays of charm to obtain 0.148 ± 0.044 -0.038 +0.045 . Three experiments have used semileptonic Β decays to measurement R b bar b: R b bar b = 0.23 ± 0.10 (Mark II), 0.218 ± 0.010 ± 0.021 (L3), and 0.220 ± 0.016 ± 0.024 (ALEPH). All agree well with the expected value of 0.217. The uncertainty in branching ratios of c and b hadrons is the largest systematic error in all of the results. Future LEP measurements of the branching ratios may reduce the errors. R b bar b will also be measured with different, and possibly lower, systematic errors by Mark II using impact parameter tagging

Evaluation of Musculoskeletal Disorders in Dentists and Application of DMAIC Technique to Improve the Ergonomics at Dental Clinics and Meta-Analysis of Literature.

Science.gov (United States)

Bedi, H S; Moon, Ninad Joshirao; Bhatia, Vineet; Sidhu, Gagandeep Kaur; Khan, Nadia

2015-06-01

Musculoskeletal disorders (MSD) result in discomfort, pain and illness that can result in disruption or impairment of dental practice. A cross-sectional study consisting of 60 dentists was carried out to determine musculoskeletal work related pain in major cities of Northern India. The study was planned in two phases. In the first phase, the subjects were given questionnaire related to the musculoskeletal pain happened over the last twelve months. In the second phase of study, improvement was carried out by recommending the subjects to implement ergonomics at their workplace. After three months subjects were again approached and given questionnaire about the musculoskeletal disorders. DMAIC (define, measure, analyse, improve and control) methodology of six sigma strategy was used to access the MSDs. Chi-square test was used for the analysis and a p-value of less than or equal to 0.05 was considered statistically significant. The overall prevalence of musculoskeletal problems in the present study was found to be 68.3%. After three months only 23 respondents applied ergonomics at their work place, prevalence of pain was reduced in neck from 47.8% to 21.7% out of total 23 respondents, shoulder pain 39.1% to 17.3%, pain in elbows from 26% to 21.7%, as well as in other locomotor organs. The p-value was significant with p <0.05. MSD represents a major occupational health issue for dentists in India as well as worldwide and result revealed necessitates the need of workshops to create awareness of ergonomics as effective measures for reducing MSD among dentists.

Women exposed to second-hand smoke more at home than at workplace: An analysis of GATS Report, India, 2009-10

Directory of Open Access Journals (Sweden)

Deepika Agrawal

2015-01-01

Full Text Available Background: Tobacco smoke has adverse health effects on women of the reproductive age group with serious health implications for the next generation. Objectives: This study assessed the prevalence of current active smoking, second-hand smoke (SHS exposure and the factors influencing smoke exposure in females of the reproductive age group. Materials and Methods: Data from the nationally representative Global Adult Tobacco Survey-India (GATS 2009 was analyzed for socio demographic variables, tobacco-related variables and knowledge variables. Results: 50.4% of the women in the reproductive age group had been exposed to SHS at home, though only 2.6% of the women were current active smokers. This was more than the SHS exposure at work (21.7% and elsewhere (32.6%. SHS exposure of the women at home did not vary significantly with knowledge of adverse effects of smoking but was affected by the place of dwelling as the smoke exposure was found to be more among rural women. Conclusion: SHS exposure is more prevalent than current active smoking in women of the reproductive age group and that too at home. Thus, policies need to be framed in order to curb this menace which is a vicious one as women don′t really have an alternative as far as this exposure is concerned.

Pre-Exposure Prophylaxis YouTube Videos: Content Evaluation.

Science.gov (United States)

Kecojevic, Aleksandar; Basch, Corey; Basch, Charles; Kernan, William

2018-02-16

Antiretroviral (ARV) medicines reduce the risk of transmitting the HIV virus and are recommended as daily pre-exposure prophylaxis (PrEP) in combination with safer sex practices for HIV-negative individuals at a high risk for infection, but are underused in HIV prevention. Previous literature suggests that YouTube is extensively used to share health information. While pre-exposure prophylaxis (PrEP) is a novel and promising approach to HIV prevention, there is limited understanding of YouTube videos as a source of information on PrEP. The objective of this study was to describe the sources, characteristics, and content of the most widely viewed PrEP YouTube videos published up to October 1, 2016. The keywords "pre-exposure prophylaxis" and "Truvada" were used to find 217 videos with a view count >100. Videos were coded for source, view count, length, number of comments, and selected aspects of content. Videos were also assessed for the most likely target audience. The total cumulative number of views was >2.3 million, however, a single Centers for Disease Control and Prevention video accounted for >1.2 million of the total cumulative views. A great majority (181/217, 83.4%) of the videos promoted the use of PrEP, whereas 60.8% (132/217) identified the specific target audience. In contrast, only 35.9% (78/217) of the videos mentioned how to obtain PrEP, whereas less than one third addressed the costs, side effects, and safety aspects relating to PrEP. Medical and academic institutions were the sources of the largest number of videos (66/217, 30.4%), followed by consumers (63/217, 29.0%), community-based organizations (CBO; 48/217, 22.1%), and media (40/217, 18.4%). Videos uploaded by the media sources were more likely to discuss the cost of PrEP (PYouTube videos can be used to share reliable PrEP information with individuals. Further research is needed to identify the best practices for using this medium to promote and increase PrEP uptake. ©Aleksandar Kecojevic

Respiratory behavior of turning stage mature tomato (Solanum lycopersicum L. under closed system at different temperature

Directory of Open Access Journals (Sweden)

Ranjeet Singh

2013-01-01

Full Text Available The respiration rate and respiratory quotient of mature tomato (Solanum lycopersicum L. cv. ‘Himsona’ fruits harvested at the turning stage were determined under closed system at 5, 10, 15, 20, 25 and 35 °C (ambient temperatures. The rate of respiration was higher at the start of the experiment and gradually declined as the storage period prolonged, before becoming almost constant. The steady-state respiration rate for CO2 evolution were observed to be 14.35, 15.04,19.95, 21.7 and 20.3 ml/kg-h at 10 °C, 15 °C, 20 °C, 25 °C and 35 °C, respectively. The RQ values for tomato varied from 0.55 to 1.10 with time under the experimental conditions. The respiration rate at steady state based on carbon dioxide evolution and oxygen consumption in closed condition decreased by about 46 % and 73 %, respectively relative to initial respiration rate values at normal air atmosphere. The results suggest that the respiration rate of tomato increased with temperature and decrease with storage time.

Gclust Server: 173731 [Gclust Server

Lifescience Database Archive (English)

Full Text Available 173731 TET_217.m00049 Cluster Sequences - 82 hypothetical protein chr_0_8254489_217...; no annotation 1 1.00e-40 0.0 11.11 0.0 0.0 0.0 0.0 Show 173731 Cluster ID 173731 Sequence ID TET_217.m0004

Vertical-axis wind turbine experiments at full dynamic similarity

Science.gov (United States)

Duvvuri, Subrahmanyam; Miller, Mark; Brownstein, Ian; Dabiri, John; Hultmark, Marcus

2017-11-01

This study presents results from pressurized (upto 200 atm) wind tunnel tests of a self-spinning 5-blade model Vertical-Axis Wind Turbine (VAWT). The model is geometrically similar (scale ratio 1:22) to a commercially available VAWT, which has a rotor diameter of 2.17 meters and blade span of 3.66 meters, and is used at the Stanford university field lab. The use of pressurized air as working fluid allows for the unique ability to obtain full dynamic similarity with field conditions in terms of matched Reynolds numbers (Re), tip-speed ratios (λ), and Mach number (M). Tests were performed across a wide range of Re and λ, with the highest Re exceeding the maximum operational field Reynolds number (Remax) by a factor of 3. With an extended range of accessible Re conditions, the peak turbine power efficiency was seen to occur roughly at Re = 2 Remax and λ = 1 . Beyond Re > 2 Remax the turbine performance is invariant in Re for all λ. A clear demonstration of Reynolds number invariance for an actual full-scale wind turbine lends novelty to this study, and overall the results show the viability of the present experimental technique in testing turbines at field conditions.

Spirit at work and hope among the ruins: registered nurses' covenant of care.

Science.gov (United States)

Wagner, Joan I J; Gregory, David M

2015-09-01

To explore registered nurses' (RNs) perspectives about the health care system, management/leadership, patients and spirit at work (SAW). Researchers investigating RNs experiences of reduced job satisfaction and diminishing organisational commitment are looking carefully at spirit at work as a means to foster healthier workplaces. A descriptive, cross-sectional mixed methods design was used to measure and explore the relationships between spirit at work, job satisfaction and organisational commitment. A 2012 postal survey sent by the provincial licensing body to a random sample of 217 surgical and 158 home care registered nurses' in western Canada returned 179 surveys. Seventy-five respondents answered the open-ended survey question. Their responses warrant further content analysis and serve as the foundation of this article. Participants noted that organisational structures and policies, combined with unsupportive leadership, were associated with a reduced sense of community, lack of trust and diminished accountability. Spirit at work was described as sustaining registered nurses' and providing them with hope as they fulfilled their covenant of care with patients. Leadership attention to the advancement of SAW may support the covenant of care between the registered nurses and patient while fostering healthier workplaces. © 2014 John Wiley & Sons Ltd.

Searches for scalar top and scalar bottom quarks at LEP2

CERN Document Server

Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Casado, M P; Chmeissani, M; Comas, P; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Bazarko, A O; Becker, U; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rizzo, G; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Turnbull, R M; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Morawitz, P; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Stacey, A M; Williams, M D; Ghete, V M; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Sloan, Terence; Whelan, E P; Williams, M I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Carr, J; Coyle, P; Diaconu, C A; Ealet, A; Fouchez, D; Konstantinidis, N P; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Tilquin, A; Trabelsi, K; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Schune, M H; Serin, L; Simion, S; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Bozzi, C; Calderini, G; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Steinberger, Jack; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Foss, J; Grupen, Claus; Lutters, G; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G

1997-01-01

Searches for scalar top and bottom quarks have been performed with data collected by the ALEPH detector at LEP. The data sample consists of 21.7 pb^-1 taken at sqrt{s} = 161, 170, and 172~GeV and 5.7 pb^-1 taken at sqrt{s} = 130 and 136~GeV. No evidence for scalar top quarks or scalar bottom quarks was found in the channels stop --> c chi, stop --> b l snu, and sbottom --> b chi. For the channel stop --> c chi a limit of 67 GeV/c^2 has been set on the scalar top quark mass, independent of the mixing angle between the supersymmetric partners of the left and right-handed states of the top quark. This limit assumes a mass difference between the stop and the chi of at least 10 GeV/c^2. For the channel stop --> b l snu the mixing-angle independent scalar top limit is 70 GeV/c^2, assuming a mass difference between the stop and the snu of at least 10 GeV/c^2. For the channel sbottom --> b chi, a limit of 73 GeV/c^2 has been set on the mass of the supersymmetric partner of the left-handed state of the bottom quark. T...

VizieR Online Data Catalog: HK photometry in an UCHII region near Sh2-217 (Brand+, 2011)

Science.gov (United States)

Brand, J.; Massi, F.; Zavagno, A.; Deharveng, L.; Lefloch, B.

2010-11-01

Coordinates and photometric parameters (magnitudes and colours) are presented of the stars located in a molecular condensation on the SW-border of the Galactic HII region Sh2-217. The data were obtained on January 4, 2004 with the 3.58-m Telescopio Nazionale Galileo (TNG; La Palma, Canary Islands, Spain). Near-infrared observations were carried out through H and K' broad-band filters with the camera NICS. The image scale is 0.25arcsec/pixel, yielding a field of view of about 4.2'x4.2'. Observing strategy and exposure times are described in Deharveng et al. (2006A&A...458..191D), the only difference being that the dithering sequence for the H-band images was the same as adopted for K'. The data reduction steps adopted are outlined in Deharveng et al. (2006A&A...458..191D). Aperture photometry was done using the DAOPHOT package in IRAF. We followed the same procedure described in Deharveng et al. (2006A&A...458..191D) to obtain aperture photometry, after which PSF-fitting photometry was performed. Although the seeing was good (<1"), the night was barely photometric, so we calibrated our H, K' photometry with that performed on the same field by Deharveng et al. (2003, Cat. J/A+A/399/1135). We calculated the difference in magnitudes for each coinciding source and plotted it against our derived instrumental H-K'. A colour term was present in K' because of the difference between the K and K' filters. After a best-fit calibration, a residual r.m.s. of about 0.2mag. was present in the difference between our photometry and that of Deharveng et al. (2003, J/A+A/399/1135), probably because of the different seeing and possibly also due to the intrinsic variability of young stars. Our photometry is thus on the same HK standard system as Deharveng et al. (2003, J/A+A/399/1135). Sources with K, H < 11-12 are in the non-linear regime or saturated, but such bright objects are few in number and lie outside the cluster, and are probably foreground stars. The approximate limiting

48 CFR 217.7801 - Definitions.

Science.gov (United States)

2010-10-01

... elements of the Department of Homeland Security concerned with the analysis of intelligence information... order for the acquisition of supplies or services on behalf of DoD. Direct acquisition means the type of interagency contracting through which DoD orders a supply or service from a Governmentwide acquisition...

217 - 222_Kawo and Bello

African Journals Online (AJOL)

User

1Department of Microbiology, Faculty of Science, Bayero University, PMB 3011, ... information to evaluate health risks for consumers. ... Kano Teaching Hospital, Kano, Nigeria, after seeking .... present in members of the Listeria genus with.

22 CFR 217.3 - Definitions.

Science.gov (United States)

2010-04-01

..., structures, equipment, roads, walks, parking lots, or other real or personal property or interest in such... property or the safety of others. (ii) Major life activities means functions such as caring for one's self... vocational education services, a handicapped person who meets the academic and technical standards requisite...

14 CFR 217.10 - Instructions.

Science.gov (United States)

2010-01-01

... compatible disk. Carriers wishing to use a different ADP procedure or e-mail must obtain written approval to... aircraft type— B-1—Aircraft type code B-2—Revenue aircraft departures B-3—Revenue passengers transported B-4—Revenue freight transported (kg) Sum of all aircraft types— C-1-Total revenue passengers in market...

48 CFR 217.7402 - Exceptions.

Science.gov (United States)

2010-10-01

... maximum extent practicable (also see paragraph (b) of this section): (1) UCAs for foreign military sales...) Congressionally mandated long-lead procurement contracts. (b) If the contracting officer determines that it is...

48 CFR 217.170 - General.

Science.gov (United States)

2010-10-01

... contract to the cost of an annual procurement approach, using a present value analysis. Do not award the multiyear contract unless the analysis shows that the multiyear contract will result in the lower cost (10 U...

48 CFR 217.7802 - Policy.

Science.gov (United States)

2010-10-01

... considered include— (i) Satisfying customer requirements; (ii) Schedule; (iii) Cost effectiveness (taking... threshold through a non-DoD agency in any fiscal year only if the head of the non-DoD agency has certified... order exceeds the simplified acquisition threshold. These procedures shall include— (1) Evaluating...

48 CFR 217.7101 - Definitions.

Science.gov (United States)

2010-10-01

... OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... master agreement. (2) Is not a contract. (b) Job order— (1) Is a fixed price contract incorporating, by... pertaining to subjects not covered by the master agreement; but applicable to the job order being awarded...

12 CFR 217.2 - Definitions.

Science.gov (United States)

2010-01-01

... that is considered to be a deposit under § 204.2(a) of the Board's Regulation D—Reserve Requirements of... bank under § 204.2(o) of the Board's Regulation D—Reserve Requirements of Depository Institutions (12... Banking FEDERAL RESERVE SYSTEM BOARD OF GOVERNORS OF THE FEDERAL RESERVE SYSTEM PROHIBITION AGAINST THE...

Nonparametric test of consistency between cosmological models and multiband CMB measurements

Energy Technology Data Exchange (ETDEWEB)

Aghamousa, Amir [Asia Pacific Center for Theoretical Physics, Pohang, Gyeongbuk 790-784 (Korea, Republic of); Shafieloo, Arman, E-mail: amir@apctp.org, E-mail: shafieloo@kasi.re.kr [Korea Astronomy and Space Science Institute, Daejeon 305-348 (Korea, Republic of)

2015-06-01

We present a novel approach to test the consistency of the cosmological models with multiband CMB data using a nonparametric approach. In our analysis we calibrate the REACT (Risk Estimation and Adaptation after Coordinate Transformation) confidence levels associated with distances in function space (confidence distances) based on the Monte Carlo simulations in order to test the consistency of an assumed cosmological model with observation. To show the applicability of our algorithm, we confront Planck 2013 temperature data with concordance model of cosmology considering two different Planck spectra combination. In order to have an accurate quantitative statistical measure to compare between the data and the theoretical expectations, we calibrate REACT confidence distances and perform a bias control using many realizations of the data. Our results in this work using Planck 2013 temperature data put the best fit ΛCDM model at 95% (∼ 2σ) confidence distance from the center of the nonparametric confidence set while repeating the analysis excluding the Planck 217 × 217 GHz spectrum data, the best fit ΛCDM model shifts to 70% (∼ 1σ) confidence distance. The most prominent features in the data deviating from the best fit ΛCDM model seems to be at low multipoles  18 < ℓ < 26 at greater than 2σ, ℓ ∼ 750 at ∼1 to 2σ and ℓ ∼ 1800 at greater than 2σ level. Excluding the 217×217 GHz spectrum the feature at ℓ ∼ 1800 becomes substantially less significance at ∼1 to 2σ confidence level. Results of our analysis based on the new approach we propose in this work are in agreement with other analysis done using alternative methods.

One year effectiveness of an individualised smoking cessation intervention at the workplace: a randomised controlled trial.

Science.gov (United States)

Rodríguez-Artalejo, F; Lafuente Urdinguio, P; Guallar-Castillón, P; Garteizaurrekoa Dublang, P; Sáinz Martínez, O; Díez Azcárate, J I; Foj Alemán, M; Banegas, J R

2003-05-01

To assess the effectiveness of a smoking cessation intervention at the workplace. The intervention was adapted to smokers' tobacco dependence, and included minimal structured counselling at the first visit (5-8 minutes), nicotine patches for three months, and three sessions of counselling for reinforcement of abstinence (2-3 minutes) over a three month period. Open randomised trial with two groups: the intervention group, and the control group which was subjected to standard clinical practice, consisting of short (30 seconds to one minute) sporadic sessions of unstructured medical antismoking advice. The trial was carried out among 217 smokers of both sexes, aged 20-63 years, motivated to quit smoking and without contraindications for nicotine patches, who were employees at a public transport company and at two worksites of an electric company. The main outcome measure was self reported tobacco abstinence confirmed by carbon monoxide in expired air workplace is effective to achieve long term smoking cessation. In a setting similar to ours, nine subjects would have to be treated for three months for one to achieve continuous abstinence for 12 months.

Environmental Assessment for the Installation of a Reclaimed Water Irrigation System Improvement Project at Tyndall Air Force Base, Florida

Science.gov (United States)

2012-05-04

Hinderliter. 2009. Gopherus polyphemus (Gopher Tortoise). Emergence behavior. Herpetological Review 40(1):77. Radzio, T. A., J. C. Hackler, A. D...Interaction. Herpetological Review. 40(2): 217. Evans, D., S. Roberts, J. Jones, K. Edwards, H. Alexis Londo, D. Nicholson, S. Tweddale, and D...Workshops and events (date, location, audience, organizer): Several of the researchers led a University of Georgia herpetology class on a weekend field

49 CFR 571.217 - Standard No. 217; Bus emergency exits and window retention and release.

Science.gov (United States)

2010-10-01

... piece of window glazing and each surrounding window frame when tested in accordance with the procedure... of the rear emergency door or doors shall be 45 inches high, 22 inches wide, and six inches deep. S5...

Detector Control System for the AFP detector in ATLAS experiment at CERN

CERN Document Server

AUTHOR|(INSPIRE)INSPIRE-00211068; The ATLAS collaboration; Caforio, Davide; Czekierda, Sabina; Hajduk, Zbigniew; Olszowska, Jolanta; Oleiro Seabra, Luis Filipe; Sicho, Petr

2017-01-01

The ATLAS Forward Proton (AFP) detector consists of two forward detectors located at 205 m and 217 m on either side of the ATLAS experiment. The aim is to measure the momenta and angles of diffractively scattered protons. In 2016, two detector stations on one side of the ATLAS interaction point were installed and commissioned. The detector infrastructure and necessary services were installed and are supervised by the Detector Control System (DCS), which is responsible for the coherent and safe operation of the detector. A large variety of used equipment represents a considerable challenge for the AFP DCS design. Industrial Supervisory Control and Data Acquisition (SCADA) product Siemens WinCCOA, together with the CERN Joint Control Project (JCOP) framework and standard industrial and custom developed server applications and protocols are used for reading, processing, monitoring and archiving of the detector parameters. Graphical user interfaces allow for overall detector operation and visualization of the det...

Improving readability of informed consents for research at an academic medical institution.

Science.gov (United States)

Hadden, Kristie B; Prince, Latrina Y; Moore, Tina D; James, Laura P; Holland, Jennifer R; Trudeau, Christopher R

2017-12-01

The final rule for the protection of human subjects requires that informed consent be "in language understandable to the subject" and mandates that "the informed consent must be organized in such a way that facilitates comprehension." This study assessed the readability of Institutional Review Board-approved informed consent forms at our institution, implemented an intervention to improve the readability of consent forms, and measured the first year impact of the intervention. Readability assessment was conducted on a sample of 217 Institutional Review Board-approved informed consents from 2013 to 2015. A plain language informed consent template was developed and implemented and readability was assessed again after 1 year. The mean readability of the baseline sample was 10th grade. The mean readability of the post-intervention sample (n=82) was seventh grade. Providing investigators with a plain language informed consent template and training can promote improved readability of informed consents for research.

Excited state non-adiabatic dynamics of N-methylpyrrole: A time-resolved photoelectron spectroscopy and quantum dynamics study

Energy Technology Data Exchange (ETDEWEB)

Wu, Guorong [National Research Council Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); State Key Laboratory of Molecular Reaction Dynamics, Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian, Liaoning 116023 (China); Synergetic Innovation Center of Quantum Information & Quantum Physics, University of Science and Technology of China, Hefei, Anhui 230026 (China); Neville, Simon P. [Department of Chemistry, University of Ottawa, 10 Marie Curie, Ottawa, Ontario K1N 6N5 (Canada); Schalk, Oliver [National Research Council Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); Department of Physics, AlbaNova University Center, Stockholm University, Roslagstullsbacken 21, 106 91 Stockholm (Sweden); Sekikawa, Taro [Department of Applied Physics, Hokkaido University, Kita-13 Nishi-8, Kita-ku, Sapporo 060-8628 (Japan); Ashfold, Michael N. R. [School of Chemistry, University of Bristol, Bristol BS8 1TS (United Kingdom); Worth, Graham A. [School of Chemistry, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Stolow, Albert, E-mail: astolow@uottawa.ca [National Research Council Canada, 100 Sussex Drive, Ottawa, Ontario K1A 0R6 (Canada); Department of Chemistry, University of Ottawa, 10 Marie Curie, Ottawa, Ontario K1N 6N5 (Canada); Department of Physics, University of Ottawa, 150 Louis Pasteur, Ottawa, Ontario K1N 6N5 (Canada)

2016-01-07

The dynamics of N-methylpyrrole following excitation at wavelengths in the range 241.5-217.0 nm were studied using a combination of time-resolved photoelectron spectroscopy (TRPES), ab initio quantum dynamics calculations using the multi-layer multi-configurational time-dependent Hartree method, as well as high-level photoionization cross section calculations. Excitation at 241.5 and 236.2 nm results in population of the A{sub 2}(πσ{sup ∗}) state, in agreement with previous studies. Excitation at 217.0 nm prepares the previously neglected B{sub 1}(π3p{sub y}) Rydberg state, followed by prompt internal conversion to the A{sub 2}(πσ{sup ∗}) state. In contrast with the photoinduced dynamics of pyrrole, the lifetime of the wavepacket in the A{sub 2}(πσ{sup ∗}) state was found to vary with excitation wavelength, decreasing by one order of magnitude upon tuning from 241.5 nm to 236.2 nm and by more than three orders of magnitude when excited at 217.0 nm. The order of magnitude difference in lifetimes measured at the longer excitation wavelengths is attributed to vibrational excitation in the A{sub 2}(πσ{sup ∗}) state, facilitating wavepacket motion around the potential barrier in the N–CH{sub 3} dissociation coordinate.

Excited state non-adiabatic dynamics of N-methylpyrrole: A time-resolved photoelectron spectroscopy and quantum dynamics study

International Nuclear Information System (INIS)

Wu, Guorong; Neville, Simon P.; Schalk, Oliver; Sekikawa, Taro; Ashfold, Michael N. R.; Worth, Graham A.; Stolow, Albert

2016-01-01

The dynamics of N-methylpyrrole following excitation at wavelengths in the range 241.5-217.0 nm were studied using a combination of time-resolved photoelectron spectroscopy (TRPES), ab initio quantum dynamics calculations using the multi-layer multi-configurational time-dependent Hartree method, as well as high-level photoionization cross section calculations. Excitation at 241.5 and 236.2 nm results in population of the A 2 (πσ ∗ ) state, in agreement with previous studies. Excitation at 217.0 nm prepares the previously neglected B 1 (π3p y ) Rydberg state, followed by prompt internal conversion to the A 2 (πσ ∗ ) state. In contrast with the photoinduced dynamics of pyrrole, the lifetime of the wavepacket in the A 2 (πσ ∗ ) state was found to vary with excitation wavelength, decreasing by one order of magnitude upon tuning from 241.5 nm to 236.2 nm and by more than three orders of magnitude when excited at 217.0 nm. The order of magnitude difference in lifetimes measured at the longer excitation wavelengths is attributed to vibrational excitation in the A 2 (πσ ∗ ) state, facilitating wavepacket motion around the potential barrier in the N–CH 3 dissociation coordinate

Childhood blindness at a school for the blind in Riyadh, Saudi Arabia.

Science.gov (United States)

Kotb, Amgad A; Hammouda, Ehab F; Tabbara, Khalid F

2006-02-01

To determine the major causes of eye diseases leading to visual loss and blindness among children attending a school for the blind in Riyadh, Saudi Arabia. A total of 217 school children with visual disabilities attending a school for the blind in Riyadh were included. All children were brought to The Eye Center, Riyadh, and had complete ophthalmologic examinations including visual acuity testing, biomicroscopy, ophthalmoscopy, tonometry and laboratory investigations. In addition, some patients were subjected to electroretinography (ERG), electrooculography (EOG), measurement of visual evoked potentials (VEP), and laboratory work-up for congenital disorders. There were 117 male students with an age range of 6-19 years and a mean age of 16 years. In addition, there were 100 females with an age range of 6-18 years and a mean age of 12 years. Of the 217 children, 194 (89%) were blind from genetically determined diseases or congenital disorders and 23 (11%) were blind from acquired diseases. The major causes of bilateral blindness in children were retinal degeneration, congenital glaucoma, and optic atrophy. The most common acquired causes of childhood blindness were infections and trauma. The etiological pattern of childhood blindness in Saudi Arabia has changed from microbial keratitis to genetically determined diseases of the retina and optic nerve. Currently, the most common causes of childhood blindness are genetically determined causes. Consanguineous marriages may account for the autosomal recessive disorders. Public education programs should include information for the prevention of trauma and genetic counseling. Eye examinations for preschool and school children are mandatory for the prevention and cure of blinding disorders.

On employing H216O, H217O, H218O, and D216O lines as frequency standards in the 15-170 cm-1 window

International Nuclear Information System (INIS)

Furtenbacher, Tibor; Csaszar, Attila G.

2008-01-01

The protocol MARVEL, standing for measured active rotational-vibrational energy levels, is used to study high-accuracy measurements of rotational lines of four isotopologues of water, H 2 16 O, H 2 17 O, H 2 18 O, and D 2 16 O, obtained by spectroscopy in the far-infrared (FIR) region of 15-170 cm -1 by Matsushima et al. [Matsushima F, Odashima H, Iwasaki T, Tsunekawa S, Takagi K. Frequency measurement of pure rotational transitions of H 2 O from 0.5 to 5 THz. J Mol Struct 1995; 352/353, 371-8; Matsushima F, Nagase H, Nakauchi T, Odashima H, Takagi K. Frequency measurement of pure rotational transitions of H 2 17 O and H 2 18 O from 0.5 to 5 THz. J Mol Spectrosc 1999;193: 217-23; Matsushima F, Matsunaga M, Qian GY, Ohtaki Y, Wang RL, Takagi K. Frequency measurement of pure rotational transitions of D 2 O from 0.5 to 5 THz. J Mol Spectrosc 2001;206: 41-6; Matsushima F, Tomatsu N, Nagai T, Moriwaki Y, Takagi K. Frequency measurement of pure rotational transitions in the v 2 =1 state of H 2 O. J Mol Spectrosc 2006;235: 190-5]. MARVEL validates the high accuracy of most of the measured line positions. It results in a considerable number of energy levels with an average internal uncertainty of only 40 kHz (2σ). It also supports serious inaccuracy problems when Watson-type A-reduced Hamiltonians are used for predicting the highly accurate rotational measurements for water. Finally, MARVEL suggests a large number of para-water levels, for example 41 for H 2 16 O, which are candidates for becoming frequency standards in the FIR region of 15-170 cm -1 (the 0.5-5 THz window) when an accuracy of about 0.1 MHz is deemed to be sufficient

Conjugated oestrogen during the menstrual cycle measured by a direct radioimmunoassay with an antiserum prepared against oestradiol-17-glucosiduronate-(C-6)-BSA conjugate

Energy Technology Data Exchange (ETDEWEB)

Honjo, H.; Otsubo, K.; Yasuda, J.; Kitawaki, J.; Okada, H. (Department of Obstetrics and Gynaecology, Kyoto Prefectural University of Medicine, Kyoto); Ohkubo, T.; Nambara, T. (Pharmaceutical Institute, Tohoku University, Sendai, Japan)

1984-01-01

Early morning and 24 h urine samples and serum were collected daily throughout the menstrual cycle in women. Urinary oestradiol-17-glucosiduronate (E/sub 2/-17G) was measured with a direct radioimmunoassay whose antiserum has been prepared against E/sub 2/-17-G-(C-6)-bovine serum albumin conjugate and was very specific. On the average, E/sub 2/-17-G in early morning and 24 h urine samples showed a prominent peak one day before the peak of urinary LH. The time relationship between these urinary E/sub 2/-17-G and serum E/sub 2/ levels and peaks was also investigated.

Planck 2013 results. VI. High Frequency Instrument data processing

DEFF Research Database (Denmark)

Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

2013-01-01

We describe the processing of the 531 billion raw data samples from the High Frequency Instrument (HFI), which we performed to produce six temperature maps from the first 473 days of Planck-HFI survey data. These maps provide an accurate rendition of the sky emission at 100, 143,217, 353, 545......, these two high frequency channels are calibrated to within 5% and the 353 GHz channel to the percent level. The 100 and217 GHz channels, which together with the 143 GHz channel determine the high-multipole part of the CMB power spectrum (50

Diversity of Coral Fish At Saebus Island, East Java, Indonesia

Science.gov (United States)

Fatimah, Siti; Putra, Tri Widya Laksana; Kondang, Putranto; Suratman; Gamelia, Larossa; Syahputra, Hendry; Rahmadayanti; Rizmaaadi, Mada; Ambariyanto, Ambariyanto

2018-02-01

Coral reef ecosystem is known as an important place to live various types of fish, where coral conditions will affect the diversity and abundance of the fish. In healthy coral reef ecosystems generally can be found many types of fish with high density. This research aims to investigate the diversity and abundance of coral fishes at Saebus Island, East Java. The observation conducted at 4 stations, according to cardinal point by UVS (underwater visual census) methods with belt transect with the visibility of 2,5 m horizontally, and 5 m vertically. The length of transect was 100 m parallel with coastline, with the area of observation is 500 m2. The censuses were conducted at 2 different depths (3 and 10 m). This study found 70 kinds of coral fish originated form 20 family at all stations. These fishes were from 3 different fish categories i.e. 7 target fishes, 13 indicator fishes, and 50 major fishes. Three different fishes that dominated target fish, indicator fish and major fish were Epinephelus fasciatus, Chaetodon baronessa and Aulostomus chinensis, respectively. There was similar value of fish diversity index at two different depths which were 3.635 and 3,623. While uniformity index at the depth of 3m was 0.153 and at 10m was 0.217, and domination index at the depth of 3m was 0.11 and at 10m was 0.167. These values suggest that diversity of coral fish at Saebus island can be categorized as high diversity.

Wnt signaling pathway involvement in genotypic and phenotypic variations in Waardenburg syndrome type 2 with MITF mutations.

Science.gov (United States)

Wang, Xue-Ping; Liu, Ya-Lan; Mei, Ling-Yun; He, Chu-Feng; Niu, Zhi-Jie; Sun, Jie; Zhao, Yu-Lin; Feng, Yong; Zhang, Hua

2018-05-01

Mutation in the gene encoding microphthalmia-associated transcription factor (MITF) lead to Waardenburg syndrome 2 (WS2), an autosomal dominantly inherited syndrome with auditory-pigmentary abnormalities, which is clinically and genetically heterogeneous. Haploinsufficiency may be the underlying mechanism for WS2. However, the mechanisms explaining the genotypic and phenotypic variations in WS2 caused by MITF mutations are unclear. A previous study revealed that MITF interacts with LEF-1, an important factor in the Wnt signaling pathway, to regulate its own transcription through LEF-1-binding sites on the MITF promoter. In this study, four different WS2-associated MITF mutations (p.R217I, p.R217G, p.R255X, p.R217del) that are associated with highly variable clinical features were chosen. According to the results, LEF-1 can activate the expression of MITF on its own, but MITF proteins inhibited the activation. This inhibition weakens when the dosage of MITF is reduced. Except for p.R217I, p.R255X, p.R217G, and p.R217del lose the ability to activate TYR completely and do not inhibit the LEF-1-mediated activation of the MITF-M promoter, and the haploinsufficiency created by mutant MITF can be overcome; correspondingly, the mutants' associated phenotypes are less severe than that of p.R217I. The dominant negative of p.R217del made it have a second-most severe phenotype. This study's data imply that MITF has a negative feedback loop of regulation to stabilize MITF gene dosage that involves the Wnt signaling pathway and that the interaction of MITF mutants with this pathway drives the genotypic and phenotypic differences observed in Waardenburg syndrome type 2 associated with MITF mutations.

Microbial burden of some herbal antimalarials marketed at Elele, Rivers State.

Science.gov (United States)

Tatfeng, Y M; Olama, E H; Ojo, T O

2009-12-30

Herbal antimalarials still remain an alternative to our traditional communities who can not afford orthodox antimalarials. This study was aimed at investigating the microbial quality of six herbal antimalarials using standard microbiological methods. Of the six preparations analyzed, "schnapps", palm wine and water were the media of preparation; the water base preparations recorded higher microbial load. The mean microbial load was 159.5 × 10(5) cfu/ml and 217.4 × 10(2)cfu/ml in water and alcohol base preparations respectively. The microbial profile of the preparations showed that the schnapps base preparations were predominantly contaminated with Bacillus sp (Aerobic spore bearers) and Mucor spp. The palm wine preparation harboured Bacillus sp, yeasts and Mucor spp while the water base preparations had several isolates such as Staphylococcus epidermidis, Pseudomonas aeruginosa, Escherichia coli 0157H7, Proteus mirabilis, Enterococcus feacalis, Serratia marcensces, Staph. aureus, Bacillus spp and Mucor spp. Conclusively, this study underlines the public health importance of these preparations given the high burden of such human pathogen as Ecoli O157H7, Ps aeruginosa, Stahp aureus, etc. in the preparations.

Searches for scalar top and scalar bottom quarks at LEP2

Science.gov (United States)

ALEPH Collaboration; Barate, R.; Buskulic, D.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll. M.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Bazarko, A. O.; Becker, U.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rizzo, G.; Rolandi, L.; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J. C.; Machefert, F.; Rougé, A.; Rumpf, M.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Huehn, T.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, E.; Thomson, F.; Turnbull, R. M.; Buchmüller, O.; Dhamotharan, S.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Martin, E. B.; Morawitz, P.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Spagnolo, P.; Stacey, A. M.; Williams, M. D.; Ghete, V. M.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W. L.; Sloan, T.; Whelan, E. P.; Williams, M. I.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Carr, J.; Coyle, P.; Diaconu, C.; Ealet, A.; Fouchez, D.; Konstantinidis, N.; Leroy, O.; Motsch, F.; Payre, P.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Schune, M.-H.; Serin, L.; Simion, S.; Tournefier, E.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Ciulli, V.; dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Sguazzoni, G.; Steinberger, J.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Fabbro, B.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Kelly, M. S.; Lehto, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Cowan, G.; Foss, J.; Grupen, C.; Lutters, G.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Charles, E.; Elmer, P.; Ferguson, D. P. S.; González, S.; Greening, T. C.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A., III; Nachtman, J. M.; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zobernig, G.

1997-11-01

Searches for scalar top and bottom quarks have been performed with data collected by the ALEPH detector at LEP. The data sample consists of 21.7 pb-1 taken at sqrt(s) = 161, 170, and 172 GeV and 5.7 pb-1 taken at sqrt(s) = 130 and 136 GeV. No evidence for scalar top quarks or scalar bottom quarks was found in the channels t~-->cχ, t~-->blν~, and b~-->bχ. For the channel t~-->cχ a limit of 67 GeV/c2has been set on the scalar top quark mass, independent of the mixing angle between the supersymmetric partners of the left and right-handed states of the top quark. This limit assumes a mass difference between the t~ and the χ of at least 10 GeV/c2. For the channel t~-->blν~ the mixing-angle independent scalar top limit is 70 GeV/c2, assuming a mass difference between the t~ and the ν~ of at least 10 GeV/c2. For the channel b~-->bχ, a limit of 73 GeV/c2has been set on the mass of the supersymmetric partner of the left-handed state of the bottom quark. This limit is valid if the mass difference between the b~ and the χ is at least 10 GeV/c2.

Detector Control System for the AFP detector in ATLAS experiment at CERN

Science.gov (United States)

Banaś, E.; Caforio, D.; Czekierda, S.; Hajduk, Z.; Olszowska, J.; Seabra, L.; Šícho, P.

2017-10-01

The ATLAS Forward Proton (AFP) detector consists of two forward detectors located at 205 m and 217 m on either side of the ATLAS experiment. The aim is to measure the momenta and angles of diffractively scattered protons. In 2016, two detector stations on one side of the ATLAS interaction point were installed and commissioned. The detector infrastructure and necessary services were installed and are supervised by the Detector Control System (DCS), which is responsible for the coherent and safe operation of the detector. A large variety of used equipment represents a considerable challenge for the AFP DCS design. Industrial Supervisory Control and Data Acquisition (SCADA) product Siemens WinCCOA, together with the CERN Joint Control Project (JCOP) framework and standard industrial and custom developed server applications and protocols are used for reading, processing, monitoring and archiving of the detector parameters. Graphical user interfaces allow for overall detector operation and visualization of the detector status. Parameters, important for the detector safety, are used for alert generation and interlock mechanisms.

Anonimi, “Ges al meu grat non sui joglar” (BdT 461.126, “Per zo no·m voil desconortar” (BdT 461.193, “Va, cobla: al Juge de Galur” (BdT 461.246, “Seigner Juge, ben aug dir a la gen” (BdT 461.217, “Ges per li diz non er bons prez sabuz” (BdT 461.133

Directory of Open Access Journals (Sweden)

Giuseppe Noto

2012-09-01

Full Text Available My paper provides a new critical edition, with critical apparatus, comment and translation of a set of anonymous ‘coblas’, copied as a sequence in the anthology present at ff. 55-66 in chansonnier P: BdT 461.126; BdT 461.193; BdT 461.246; BdT 461.217; BdT 461.133 (all of which are unica. I will examine in particular the attributions suggested so far for one or more of these ‘coblas’ (a name that has frequently been put forward is that of Paolo Lanfranchi da Pistoia, author of the sonnet in ‘cobla’ form copied in P immediately preceding the poems discussed here and address the hypothesis put forward by several scholars (and upheld with convincing evidence by Stefano Asperti that the sequence under consideration points to the strong presence of a Tuscan tradition in chansonnier P, clearly contributing, among other things, to outline a “fundamental coherence” (Asperti between some aspects of Dante’s literary culture and this particular songbook.

Results of the independent verification of radiological remedial action at 165 North 1st West Street, Monticello, Utah (MS00014)

International Nuclear Information System (INIS)

Crutcher, J.W.; Wilson, M.J.

1990-02-01

In 1980 the site of a vanadium and uranium mill at Monticello, Utah, was accepted into the US Department of Energy's (DOE's) Surplus Facilities Management Program, with the objectives of restoring the government-owned mill site to safe levels of radioactivity, disposing of or containing the tailings in an environmentally safe manner, and performing remedial actions on off-site (vicinity) properties that had been contaminated by radioactive material resulting from mill operations. During 1985 and 1986, UNC Geotech, the remedial action contractor designated by DOE, performed remedial action on the vicinity property at 217 South 2nd East Street, Monticello, Utah. The Pollutant Assessments Group (PAG) of Oak Ridge National Laboratory was assigned the responsibility of verifying the data supporting the adequacy of remedial action and confirming the site's compliance with DOE guidelines. The PAG found that the site successfully meets the DOE remedial action objectives. Procedures used by PAG are described. 3 refs., 2 tabs

75 FR 32418 - Notice of Intent To Grant Partially Exclusive License of the United States Patent Application No...

Science.gov (United States)

2010-06-08

...-1076. FOR FURTHER INFORMATION CONTACT: Ms. Bea Shahin (217) 373-7234, FAX (217) 373-7210, e-mail: Bea.S... applications to achieve increased soil strength, reduced air transport, and decreased soil erosion. During...

Size selective feeding in ICyclidium glaucoma/I (Ciliophora, Scuticociliatida) and its effects on bacterial community structure: a study from a continuous cultivation system

Czech Academy of Sciences Publication Activity Database

Posch, T.; Jezbera, Jan; Vrba, Jaroslav; Šimek, Karel; Pernthaler, J.; Andreatta, S.; Sonntag, B.

2001-01-01

Roč. 42, - (2001), s. 217-227 ISSN 0095-3628 Grant - others:ANB(AT) OENB6513; AKTION(AT) projects23p5; AKTION(AT) 2000/22 Keywords : protozoa * bacteria * predator-prey relation Subject RIV: EE - Microbiology, Virology Impact factor: 2.891, year: 2001

Publications | Page 217 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Knowledge integration and the adoption of new agricultural technologies: Kenyan perspectives (restricted access). The study aims to identify and better understand the barriers to knowledge integration for improved agricultural technologies and their adoption. Results suggest a potential link between farmers'' levels of ...

48 CFR 252.217-7007 - Payments.

Science.gov (United States)

2010-10-01

... Officer shall approve progress payments based on the value, computed on the price of the job order, of... Contracting Officer may require. (c) The Government will retain until final completion and acceptance of all... direct that progress payments be based on the price of the job order as adjusted as a result of change...

49 CFR 217.2 - Preemptive effect.

Science.gov (United States)

2010-10-01

... negligence standards apply where there is no Federal action covering the subject matter. Under 49 U.S.C. 20106 (section 20106), issuance of the regulations in this part preempts any State law, regulation, or order covering the same subject matter, except an additional or more stringent law, regulation, or order...

22 CFR 217.5 - Assurances required.

Science.gov (United States)

2010-04-01

... benefits. (2) In the case of Federal financial assistance extended to provide personal property, the... or recording this transfer shall contain a covenant running with the land to assure nondiscrimination... services or benefits. (2) Where no transfer of property is involved but property is purchased or improved...

22 CFR 217.44 - Academic adjustments.

Science.gov (United States)

2010-04-01

..., manual, or speaking skills as will best ensure that the results of the evaluation represents the student... speaking skills (except where such skills are the factors that the test purports to measure). (d) Auxiliary... sensory, manual, or speaking skills. (2) Auxiliary aids may include taped texts, interpreters or other...

Publications | Page 217 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

As reliable and timely health information is essential for public health action and ... proposals from the findings towards revising and developing the livelihoods inquiry. ... Kebijakan kawasan tanpa rokok : peluang dan hambatan (restricted access) ... This case study provides a summary of the Utilization Focused Evaluation ...

SU-E-T-217: Intrinsic Respiratory Gating in Small Animal CT

Energy Technology Data Exchange (ETDEWEB)

Liu, Y; Smith, M; Mistry, N [University of Maryland School of Medicine, Baltimore, MD (United States)

2014-06-01

Purpose: Preclinical animal models of lung cancer can provide a controlled test-bed for testing dose escalation or function-based-treatment-planning studies. However, to extract lung function, i.e. ventilation, one needs to be able to image the lung at different phases of ventilation (in-hale / ex-hale). Most respiratory-gated imaging using micro-CT involves using an external ventilator and surgical intervention limiting the utility in longitudinal studies. A new intrinsic respiratory retrospective gating method was developed and tested in mice. Methods: A fixed region of interest (ROI) that covers the diaphragm was selected on all projection images to estimate the mean intensity (M). The mean intensity depends on the projection angle and diaphragm position. A 3-point moving average (A) of consecutive M values: Mpre, Mcurrent and Mpost, was calculated to be subtracted from Mcurrent. A fixed threshold was used to enable amplitude based sorting into 4 different phases of respiration. Images at full-inhale and end-exhale phases of respiration were reconstructed using the open source OSCaR. Lung volumes estimated at the 2 phases of respiration were validated against literature values. Results: Intrinsic retrospective gating was accomplished without the use of any external breathing waveform. While projection images were acquired at 360 different angles. Only 138 and 104 projections were used to reconstruct images at full-inhale and end-exhale. This often results in non-uniform under-sampled angular projections leading to some minor streaking artifacts. The calculated expiratory, inspiratory and tidal lung volumes correlated well with the values known from the literature. Conclusion: Our initial result demonstrates an intrinsic gating method that is suitable for flat panel cone beam small animal CT systems. Reduction in streaking artifacts can be accomplished by oversampling the data or using iterative reconstruction methods. This initial experience will enable

Contamination valuation of soil and groundwater source at anaerobic municipal solid waste landfill site.

Science.gov (United States)

Aziz, Shuokr Qarani; Maulood, Yousif Ismael

2015-12-01

The present work aimed to determine the risks that formed landfill leachate from anaerobic Erbil Landfill Site (ELS) poses on groundwater source and to observe the effects of disposed municipal solid waste (MSW) on soil properties. The study further aims to fill the gap in studies on the effects of disposed MSW and produced leachate on the groundwater characteristics and soil quality at ELS, Iraq. Soil, leachate, and groundwater samples were collected from ELS for use as samples in this study. Unpolluted groundwater samples were collected from an area outside of the landfill. Field and laboratory experiments for the soil samples were conducted. Chemical analyses for the soil samples such as organic matter, total salts, and SO4 (=) were also performed. Raw leachate and groundwater samples were analyzed using physical and chemical experiments. The yields for sorptivity, steady-state infiltration rate, and hydraulic conductivity of the soil samples were 0.0006 m/√s, 0.00004 m/s, and 2.17 × 10(-5) m/s, respectively. The soil at ELS was found to be light brown clayey gravel with sand and light brown gravely lean clay layers with low permeability. Unprocessed leachate analysis identified the leachate as stabilized. Findings showed that the soil and groundwater at the anaerobic ELS were contaminated.

Measurement of the ratio σB(W→eν)/σB(Z0→e+e-) in bar pp collisions at √s =1.8 TeV

International Nuclear Information System (INIS)

Abe, F.; Albrow, M.; Amidei, D.; Anway-Wiese, C.; Apollinari, G.; Areti, H.; Auchincloss, P.; Azfar, F.; Azzi, P.; Bacchetta, N.; Badgett, W.; Bailey, M.W.; Bao, J.; de Barbaro, P.; Barbaro-Galtieri, A.; Barnes, V.E.; Barnett, B.A.; Bartalini, P.; Bauer, G.; Baumann, T.; Bedeschi, F.; Behrends, S.; Belforte, S.; Bellettini, G.; Bellinger, J.; Benjamin, D.; Benlloch, J.; Benton, D.; Beretvas, A.; Berge, J.P.; Bertolucci, S.; Bhatti, A.; Biery, K.; Binkley, M.; Bird, F.; Bisello, D.; Blair, R.E.; Blocker, C.; Bodek, A.; Bolognesi, V.; Bortoletto, D.; Boswell, C.; Boulos, T.; Brandenburg, G.; Buckley-Geer, E.; Budd, H.S.; Burkett, K.; Busetto, G.; Byon-Wagner, A.; Bryum, K.L.; Campagnari, C.; Campbell, M.; Caner, A.; Carithers, W.; Carlsmith, D.; Castro, A.; Cen, Y.; Cervelli, F.; Chapman, J.; Chiarelli, G.; Chikamatsu, T.; Cihangir, S.; Clark, A.G.; Cobal, M.; Contreras, M.; Conway, J.; Cooper, J.; Cordelli, M.; Coupal, D.P.; Crane, D.; Cunningham, J.D.; Daniels, T.; DeJongh, F.; Delchamps, S.; Dell'Agnello, S.; Dell'Orso, M.; Demortier, L.; Denby, B.; Deninno, M.; Derwent, P.F.; Devlin, T.; Dickson, M.; Donati, S.; Drucker, R.B.; Dunn, A.; Einsweiler, K.; Elias, J.E.; Ely, R.; Engels, E. Jr.; Eno, S.; Errede, D.; Errede, S.; Etchegoyen, A.; Fan, Q.; Farhat, B.; Fiori, I.; Flaugher, B.; Foster, G.W.; Franklin, M.; Frautschi, M.; Freeman, J.; Friedman, J.; Frisch, H.; Fry, A.; Fuess, T.A.; Fukui, Y.; Funaki, S.; Gagliardi, G.; Gallinaro, M.; Garfinkel, A.F.; Geer, S.; Gerdes, D.W.; Giannetti, P.; Giokaris, N.; Giromini, P.; Gladney, L.; Glenzinski, D.; Gold, M.; Gonzalez, J.; Gordon, A.; Goshaw, A.T.; Goulianos, K.; Grassmann, H.; Grewal, A.; Grieco, G.; Groer, L.; Grosso-Pilcher, C.; Haber, C.; Hahn, S.R.; Hamilton, R.; Handler, R.; Hans, R.M.; Hara, K.; Harral, B.; Harris, R.M.; Hauger, S.A.; Hauser, J.; Hawk, C.; Heinrich, J.; Hennessy, D.; Hollebeek, R.; Holloway, L.; Hoelscher, A.; Hong, S.; Houk, G.; Hu, P.; Huffman, B.T.; Hughes, R.; Hurst, P.

1994-01-01

We present a measurement of the ratio σB(W→ev)/σB(Z 0 →e + e - ) in bar pp collisions at √s =1.8 TeV. The data represent an integrated luminosity of 21.7 pb -1 from the 1992--1993 run of the Collider Detector at Fermilab. We find σB(W→eV)/σB(Z 0 →e + e - )=10.90±0.32(stat)±0.29(sys t). From this value, we extract a value for the W width, Γ(W)=2.064±0.061(stat)±0.059(syst) GeV, and the branching ratio, Γ(W→eV)/Γ(W)=0.1094±0.0033(stat)±0.0031(syst), and we set a decay-mode-independent limit on the top quark mass m top >62 GeV/c 2 at the 95% C.L

NCBI nr-aa BLAST: CBRC-SARA-01-0489 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-0489 ref|ZP_01035526.1| exopolysaccharide biosynthesis domain protein [Rose...ovarius sp. 217] gb|EAQ25691.1| exopolysaccharide biosynthesis domain protein [Roseovarius sp. 217] ZP_01035526.1 1.0 26% ...

Atmospheric extinction coefficients and night sky brightness at the Xuyi Observation Station

International Nuclear Information System (INIS)

Zhang Hui-Hua; Liu Xiao-Wei; Zhang Hua-Wei; Xiang Mao-Sheng; Yuan Hai-Bo; Zhao Hai-Bin; Yao Jin-Sheng

2013-01-01

We present measurements of the optical broadband atmospheric extinction coefficients and the night sky brightness at the Xuyi Observation Station of Purple Mountain Observatory. The measurements are based on CCD imaging data taken in the Sloan Digital Sky Survey's g, r and i bands with the Xuyi 1.04/1.20 m Schmidt Telescope for the Xuyi Schmidt Telescope Photometric Survey of the Galactic Anti-center (XSTPS-GAC), the photometric part of the Digital Sky Survey of the Galactic Anti-center (DSS-GAC). The data were collected during more than 140 winter nights from 2009 to 2011. We find that the atmospheric extinction coefficients for the g, r and i bands are 0.69, 0.55 and 0.38 mag/airmass, respectively, based on observations taken on several photometric nights. The night sky brightness determined from images with good quality has median values of 21.7, 20.8 and 20.0 mag arcsec −2 and reaches 22.1, 21.2 and 20.4 mag arcsec −2 under the best observing conditions for the g, r and i bands, respectively. The relatively large extinction coefficients compared with other good astronomical observing sites are mainly due to the relatively low elevation (i.e. 180 m) and high humidity at the station.

Orbit-Attitude Changes of Objects in Near Earth Space Induced by Natural Charging

Science.gov (United States)

2017-05-02

Program Manager Technical Advisor, Spacecraft Component Technology //SIGNED// JOHN BEAUCHEMIN Chief Engineer, Spacecraft Technology Division...istration (NASA) and the US Air Force to investigate the effects of charging and develop technologies to mitigate the same. Accumulated charges may...e2 [ Sesin f +T (1+ ecos f ) ] (217a) de dt = √ 1− e2 na [ S sin f +T (cos f + cosE) ] (217b) di dt = r cos(ω + f ) na2 √ 1− e2 W (217c) dΩ dt = r sin

Prevalence and correlates of violence among South African high ...

African Journals Online (AJOL)

learners (22.2%) had experienced some form of violence while at school,. 12.2% of .... home to parents/guardians providing information about the study. Thereafter .... In terms of their feelings of security, 379 (21.7%) learners missed school at ...

Radioiodinated 5-iodothienyl-2-substituted long chain fatty acids for myocardial imaging

International Nuclear Information System (INIS)

Goodman, M.M.; Knapp, F.F. Jr.; Kirsch, G.; Owen, B.A.

1984-01-01

Thienyl-2-alkyl derivatives undergo facile iodination regiospecifically at the 5-position of the thiophene ring and are alternatives to iodophenyl agents. /sup 125/I-labeled 2-(17-oxoheptadecanoly)-5-iodothiophene (VIIIa) and /sup 125/I-labeled 2-(13-oxotridecanoyl)-5-iodothiophene (VIIIb) were prepared as model agents. The substrate was 2-(17-oxoheptadecanoyl)thiophene (VIa), in which the thiophene ring was attached to the terminal position of heptadecanoic acid. (VIa) was prepared by Friedel-Crafts condensation of 16-iodohexadecanoyl chloride, with thiophene followed by -I + CN/sup -/ → -CN; Wolff-Kishner reduction; -CN + OH/sup -/ → -COOH (VI). Regiospecific rho-[bis-(trifluoroacety 1)] thallation of (VIa), followed by treatment with KI gave 2-(17-oxoheptadecanoyl)-5-iodothiophene (VIIIa). Compound VIIIb was prepared in the same manner. Compounds Ia, b-VIIIa,b, were analyzed by TLC, IR, MS, NMR, and CandH. I-125-labeled (VIIIa) and (VIIIb) were prepared in the same manner. I-125 (VIIIb) showed high myocardial uptake in rats (4/group). Iodothienyl fatty acids may represent alternatives to iodophenyl substituted fatty acids for myocardial imaging

Fusion research at Culham site

International Nuclear Information System (INIS)

Tolonen, P.; Toppila, T.

1998-01-01

One of the many targets on the Finnish Nuclear Society (ATS) excursion to England was the Culham fusion research site. The site has divided into two parts. One of them is UKAEA Fusion with small scale fusion reactors and 200 employees. UKAEA has 3 fusion reactors at Culham site. One of is the START (Small Tight Aspect Ratio Tokamak) which was operational since 1991 but is today already out of operation. UKAEA has been operating a JET-like tokamak fusion reactor COMPASS-D since 1989. The latest of three reactors is MAST (Mega Amp Spherical Tokamak), which is still under construction. The first plasma will take place in the end of 1998. Another part of Culham site is JET (Joint European Torus), an all-European fusion undertaking with 350 employees. 150 of them are from various European countries and the rest 200 are employed by UKAEA. JET is the biggest fusion reactor ever and it represents the latest step in world wide fusion programme. In October 1997 JET achieved a world record in fusion power and energy. JET produced 16,1 MW power for 1 s and totally 21,7 MJ energy. This is the closest attempt to achieve break-even conditions. The next step in world wide fusion programme will be international ITER-reactor. This undertaking has some financial problems, since United States has taken distance to magnetic fusion research and moved closer to inertial fusion with funding of US Department of Defence. The planned reactor, however, is physically twice as big as JET. The step after this phase will be DEMO, which is purposed to produce fusion energy. According to our hosts in Culham this phase is 40 years ahead. (author)

Efficiency and safety of fibroid embolisation

International Nuclear Information System (INIS)

Berczi, V.

2012-01-01

Full text: Introduction: Uterine Fibroid Embolisation (UFE) has been introduced in 1995 in France. It has been performed on growing number of cases in most countries. In Hungary, the first centre started these procedures in large number of cases approximately 7 years ago. Our group introduced this techniques in Budapest in 2008, and reached a steady rate of 60-80 fibroids per year. We regularly perform an audit of our cases. Patients and methods: Indication is decided by the interventional radiologist and the gynecologist knowing and accepting UFE. Most gynecologists in Hungary, however, still not inform the patient about UFE. Very often the patient finds the solution following an offer from the gynecologist to perform hysterectomy which she does not accept; searching on the internet leads her to our group in numerous cases. Prior to the embolisation, MR is performed in most cases. Fibroid embolisation is performed through to common femoral puncture using 500-700 μm PVA particles. Follow-up MR is performed 6 months following the procedure. Results: Between May, 2008 and October, 2011, 217 patients had UFE in our centre (mean age 42.2 years, range 24-55 years). Indications by symptoms: (n=218) Menorrhagia and metrorrhagia: 197, Pelvic pressure or pain: 117, Frequent urination: 85, Lack pain: 21, Lower complaints: 6, Risk reduction of future moymectomy: 3, Dyspareunia: 3. Indications based on morphology: (n=217), fibroid: 196, adenomyosis: 8, fibroid +adenomyosis: 13. Morphological changes: (n=50) decrease in volume at 6 months follow-up MR 55.3±3.8% (range 0-97.6%). Bilateral uterine artery catheterization and embolisation: 201/217=95.4%; 10/217=4.6% in ten cases, selective uterine artery was not possible due to the tortousity of the artery. Bilateral embolisation: 196/217=90%; 11/217=5% in eleven cases, unilateral embolisation was performed due to early venous filling or retrograde ovaric artery filling. Volume reduction at bilateral embolisation: 55.6±4.1% (n

77 FR 27777 - Agency Information Collection Activities: Proposed Collection; Comment Request

Science.gov (United States)

2012-05-11

... Hours: 1,217. (For policy questions regarding this collection contact Kim Roche at 410- 786-3524. For... include the bundling of separately billed drugs, clinical laboratory tests, and other items ``to maximum...

Growth hormone receptor gene mutations in two Italian patients with Laron Syndrome.

Science.gov (United States)

Fassone, L; Corneli, G; Bellone, S; Camacho-Hübner, C; Aimaretti, G; Cappa, M; Ubertini, G; Bona, G

2007-05-01

Laron Syndrome (LS) represents a condition characterized by GH insensitivity caused by molecular defects in the GH receptor (GHR) gene or in the post-receptor signalling pathway. We report the molecular characterization of two unrelated Italian girls from Sicily diagnosed with LS. The DNA sequencing of the GHR gene revealed the presence of different nonsense mutations, occurring in the same background haplotype. The molecular defects occurred in the extracellular domain of the GHR leading to a premature termination signal and to a truncated non-functional receptor. In one patient, a homozygous G to T transversion, in exon 6, led to the mutation GAA to TAA at codon 180 (E180X), while in the second patient a homozygous C to T transition in exon 7 was detected, causing the CGA to TAA substitution at codon 217 (R217X). Both probands presented the polymorphisms Gly168Gly and Ile544Leu in a homozygous state in exons 6 and 10, respectively. The E180X represents a novel defect of the GHR gene, while the R217X mutation has been previously reported in several patients from different ethnic backgrounds but all from countries located in the Mediterranean and Middle Eastern region.

Gastrin receptor characterization: affinity cross-linking of the gastrin receptor on canine gastric parietal cells

International Nuclear Information System (INIS)

Matsumoto, M.; Park, J.; Yamada, T.

1987-01-01

The authors applied affinity cross-linking methods to label the gastrin receptor on isolated canine gastric parietal cells in order to elucidate the nature of its chemical structure. 125 I-labeled Leu 15 -gastrin and 125 I-labeled gastrin/sub 2-17/ bound to intact parietal cells and their membranes with equal affinity, and half-maximal inhibition of binding was obtained at an incubation concentration of 3.2 x 10 -10 M unlabeled gastrin. 125 I-gastrin/sub 2-17/ was cross-linked to plasma membranes or intact parietal cells by incubation in disuccinimidyl suberate. The membrane pellets were solubilized with or without dithiothreitol and applied to electrophoresis on 7.5% sodium dodecyl sulfate polyacrylamide gels. Autoradiograms revealed a band of labeling at M/sub r/ 76,000 and labeling of this band was inhibited in a dose-dependent fashion by addition of unlabeled gastrin to the incubation mixture. Dithiothreitol in concentrations as high as 100 mM did not later the electrophoretic mobility of the labeled band. After taking into account the molecular weight of 125 I-gastrin/sub 2-17/, the results suggest that the gastrin receptor on parietal cells is a single protein of M/sub r/ 74,000 without disulfide-linked subunits

Reference: IDRSZMFER1 [PLACE

Lifescience Database Archive (English)

Full Text Available tial involvement of the IDRS cis-element in the developmental and environmental regulation of the AtFer1 ferritin gene from Arabidopsis. Planta. 217: 709-716 (2003) PubMed: 12728319 ...

Streamlined RI/FS planning for the groundwater operable unit at the Weldon Spring Site

International Nuclear Information System (INIS)

Picel, M.H.; Durham, L.A.; Blunt, D.L.; Hartmann, H.M.

1995-01-01

The U.S. Department of Energy (DOE) is conducting cleanup activities at the chemical plant area of the Weldon Spring Site located in St. Charles County, Missouri, about 48 km (30 mi) west of St. Louis and 22 km (14 mi) southwest of the City of St. Charles. The 88-ha (217-acre) chemical plant area is chemically and radioactively contaminated as a result of uranium processing activities conducted by the U.S. Atomic Energy Commission during the 1950s and 1960s. The Army also used the chemical plant area for the production of explosives in the 1940s. The Weldon Spring Site chemical plant area was listed on the National Priorities List (NPL) in 1989. Adjacent to the chemical plant area is another NPL site known as the Weldon Spring Ordnance Works. The ordnance works area is a former explosive production facility that manufactured trinitrotoluene (TNT) and dinitrotoluene (DNT) during World War II. The ordnance works area covers 7,000 ha (17,232 acres); cleanup of this site is managed by the U.S. Army Corps of Engineers (CE)

Analysis of Seasonal Soil Organic Carbon Content at Bukit Jeriau Forest, Fraser Hill, Pahang

International Nuclear Information System (INIS)

Ahmad Adnan Mohamed; Ahmad Adnan Mohamed; Sahibin Abd Rahim; David Allan Aitman; Mohd Khairul Amri Kamarudin; Mohd Khairul Amri Kamarudin

2016-01-01

Soil carbon is the carbon held within the soil, primarily in association with its organic content. The total soil organic carbon study was determined in a plot at Bukit Jeriau forest in Bukit Fraser, Pahang, Malaysia. The aim of this study is to determine the changing of soil organic carbon between wet season and dry season. Soil organic carbon was fined out using titrimetric determination. The soil organic carbon content in wet season is 223.24 t/ ha while dry season is 217.90 t/ ha. The soil pH range in wet season is between 4.32 to 4.45 and in dry season in 3.95 to 4.08 which is considered acidic. Correlation analysis showed that soil organic carbon value is influenced by pH value and climate. Correlation analysis between clay and soil organic carbon with depth showed positively significant differences and clay are very much influenced soil organic carbon content. Correlation analysis between electrical conductivity and soil organic carbon content showed negative significantly difference on wet season and positively significant different in dry season. (author)

Temporal physiological and biochemical changes in Hippeastrum vittatum ‘Red Lion’ bulbs stored at different temperatures

Directory of Open Access Journals (Sweden)

Xiaonan Yu

2014-05-01

Full Text Available Starch and soluble sugar concentrations, α-amylase activity and soluble protein of Hippeastrum vittatum ‘Red Lion’ bulbs were assessed under different storage temperatures and storage periods. Bulbs were stored for 45 days at 20°, 12°, 8° or 4°C. Starch concentration decreased most at 4°C on the 45th day, changing from 29.7% to 10.9% in the exterior scales and from 33.0% to 13.0% in the interior scales. The α-amylase activity in the exterior scales, except at 4° and 8°C, decreased significantly between 0 and 15 days of storage, and then increased significantly from the 15th day until the end of the trial. The soluble sugar concentration increased most at 4°C: in the exterior scales it changed from 54.73 to 153.93 mg•g-1 while in the interior scales it increased from 39.67 to 148.11 mg•g-1. The soluble protein concentration in all treatments peaked on the 30th day at 8°C in the exterior scales (2.15 mg•g-1 and at 12°C in the interior scales (2.17 mg•g-1. Understanding these physiological and biochemical changes in the bulbs of H. vittatum after storage would serve as a reference for bulb dormancy mechanisms in future studies.

Long-Term and Rapid Radio Variability of the Blazar 3C 454.3 in 2010-2017

Science.gov (United States)

Gorshkov, A. G.; Ipatov, A. V.; Ipatova, I. A.; Konnikova, V. K.; Mardyshkin, V. V.; Mingaliev, M. G.; Kharinov, M. A.

2018-03-01

The article presents the results of observations of the blazar 3C 454.3 (J2253+1608), obtained in 2010-2017 on the RATAN-600 radio telescope of the Special Astrophysical Observatory at 4.6, 8.2, 11.2, and 21.7 GHz and on the 32-m Zelenchuk and Badary radio telescopes of the Quasar VLBI Network of the Institute of Applied Astronomy at 4.84 and 8.57 GHz. Long-term variability of the radio emission is studied, as well as variability on time scales of several days and intraday variability (IDV). Two flares were observed in the long-term light curve, in 2010 and in 2015-2017. The flux density at 21.7 GHz increased by a factor of ten during these flares. The delay in the maximum of the first flare at 4.85 GHz relative to the maximum at 21.7 GHz was six months. The time scale for variability on the descending branch of the first flare at 21.7 GHz was τvar = 1.2 yrs, yielding an upper limit on the linear size of the emitting region of 0.4 pc, corresponding to an angular size of 0.06 mas. The brightness temperature during the flare exceeded the Compton limit, implying a Doppler factor δ = 3.5, consistent with the known presence of a relativistic jet oriented close to the line of sight. No significant variability on time scales from several days to several weeks was found in five sets of daily observations carried out over 120 days. IDV was detected at 8.57 GHz on the 32-m telescopes in 30 of 61 successful observing sessions, with the presence of IDV correlated with the maxima of flares. The characteristic time scale for the IDV was from two to ten hours. A number of IDV light curves show the presence of a time delay in the maxima in the light curves for simultaneous observations carried out on the Badary and Zelenchuk antennas, which are widely separated in longitude. This demonstrates that the IDV most like arises in the interstellar medium.

Biochemical composition of zooplankton from the northern Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Bhat, K.L.; Sreepada, R.A; Ansari, Z.A

stream_size 7 stream_content_type text/plain stream_name Pak_J_Mar_Sci_2_17.pdf.txt stream_source_info Pak_J_Mar_Sci_2_17.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

Benthic harpacticoid copepod community of Saphala salt marsh along the west coast of India

Digital Repository Service at National Institute of Oceanography (India)

Ingole, B.S.; Ansari, Z.A; Parulekar, A

stream_size 4 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_217.pdf.txt stream_source_info Indian_J_Mar_Sci_19_217.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

NCBI nr-aa BLAST: CBRC-DSIM-01-0068 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-DSIM-01-0068 ref|ZP_01038050.1| Nitric oxide reductase large subunit, cytochrome b [Rose...ovarius sp. 217] gb|EAQ23442.1| Nitric oxide reductase large subunit, cytochrome b [Roseovarius sp. 217] ZP_01038050.1 2.6 29% ...

Environmental Assessment for the Replacement of the JP-8 Transfer Pipeline between the 6000 Area and 400 Area at Tyndall Air Force Base Bay County, Florida

Science.gov (United States)

2012-09-01

Emergence behavior. Herpetological Review 40(1):77. Radzio, T. A., J. C. Hackler, A. D. Walde, D. K. Delaney and M. G. Hinderliter. 2009...Terrapene carolina (Eastern Box Turtle) and Gopherus polyphemus (Gopher Tortoise). Interspecific Interaction. Herpetological Review. 40(2): 217. Evans...Several of the researchers led a University of Georgia herpetology class on a weekend field trip to the AGTHP in 2010. A local Boy Scout Troop also

Evaluation of low impact development approach for mitigating flood inundation at a watershed scale in China.

Science.gov (United States)

Hu, Maochuan; Sayama, Takahiro; Zhang, Xingqi; Tanaka, Kenji; Takara, Kaoru; Yang, Hong

2017-05-15

Low impact development (LID) has attracted growing attention as an important approach for urban flood mitigation. Most studies evaluating LID performance for mitigating floods focus on the changes of peak flow and runoff volume. This paper assessed the performance of LID practices for mitigating flood inundation hazards as retrofitting technologies in an urbanized watershed in Nanjing, China. The findings indicate that LID practices are effective for flood inundation mitigation at the watershed scale, and especially for reducing inundated areas with a high flood hazard risk. Various scenarios of LID implementation levels can reduce total inundated areas by 2%-17% and areas with a high flood hazard level by 6%-80%. Permeable pavement shows better performance than rainwater harvesting against mitigating urban waterlogging. The most efficient scenario is combined rainwater harvesting on rooftops with a cistern capacity of 78.5 mm and permeable pavement installed on 75% of non-busy roads and other impervious surfaces. Inundation modeling is an effective approach to obtaining the information necessary to guide decision-making for designing LID practices at watershed scales. Copyright © 2017 Elsevier Ltd. All rights reserved.

An 8-Week Knee Osteoarthritis Treatment Program of Hyaluronic Acid Injection, Deliberate Physical Rehabilitation, and Patient Education is Cost Effective at 2 Years Follow-up: The OsteoArthritis Centers of America Experience

Directory of Open Access Journals (Sweden)

Larry E. Miller

2014-01-01

Full Text Available Numerous nonsurgical interventions have been reported to improve symptoms of knee osteoarthritis (OA over the short term. However, longer follow-up is required to accurately characterize outcomes such as cost effectiveness and delayed arthroplasty. A total of 553 patients with symptomatic knee OA who previously underwent a single 8-week multimodal treatment program were contacted at 1 year ( n = 336 or 2 years ( n = 217 follow-up. The percentage of patients who underwent knee arthroplasty was 10% at 1 year and 18% at 2 years following program completion. The treatment program was highly cost effective at $12,800 per quality-adjusted life year at 2 years. Cost effectiveness was maintained under a variety of plausible assumptions and regardless of gender, age, body mass index, disease severity, or knee pain severity. In summary, a single 8-week multimodal knee OA treatment program is cost effective and may lower knee arthroplasty utilization through 2 years follow-up.

Thermal evaluation facility for LMFBR spent fuel transport

International Nuclear Information System (INIS)

Wesley, D.A.

1980-04-01

A full-scale mock-up of a 217 pin breeder reactor fuel assembly in a cylindrical pipe was initially designed and constructed by Oak Ridge National Laboratory (ORNL). It was transferred to Sandia where it was extensively redesigned and modified. The 217 pin hexagonal core assembly was installed in a smaller diameter stainless steel pipe which more closely represents the diameter of a shipping canister or shipping cask basket wall. Two-hundred four of the tubes are electrically heated over an active length of 4-feet and the remaining thirteen are instrumented with multiple junction thermocouples which can be traversed axially. Thermocouples and heat-flux gauges are located on the hex core and canister perimeters at several axial locations

49 CFR 232.217 - Train brake tests conducted using yard air.

Science.gov (United States)

2010-10-01

... reduction of brake pipe air pressure at the same, or slower, rate as an engineer's brake valve. (b) The yard... 49 Transportation 4 2010-10-01 2010-10-01 false Train brake tests conducted using yard air. 232... Train brake tests conducted using yard air. (a) When a train air brake system is tested from a yard air...

Planck early results. VI. The High Frequency Instrument data processing

DEFF Research Database (Denmark)

Colley, J.-M.; Bartlett, J.G.; Bucher, M.

2011-01-01

We describe the processing of the 336 billion raw data samples from the High Frequency Instrument (HFI) which we performed to produce six temperature maps from the first 295 days of Planck-HFI survey data. These maps provide an accurate rendition of the sky emission at 100, 143, 217, 353, 545...... and 857 GHz with an angular resolution ranging from 9.9 to 4.4′. The white noise level is around 1.5 μK degree or less in the 3 main CMB channels (100-217 GHz). The photometric accuracy is better than 2% at frequencies between 100 and 353 GHz and around 7% at the two highest frequencies. The maps created...... by the HFI Data Processing Centre reach our goals in terms of sensitivity, resolution, and photometric accuracy. They are already sufficiently accurate and well-characterised to allow scientific analyses which are presented in an accompanying series of early papers. At this stage, HFI data appears...

Perspectives on spirituality at the end of life: a meta-summary.

Science.gov (United States)

Williams, Anna-Leila

2006-12-01

A meta-summary of the qualitative literature on spiritual perspectives of adults who are at the end of life was undertaken to summarily analyze the research to date and identify areas for future research on the relationship of spirituality with physical, functional, and psychosocial outcomes in the health care setting. Included were all English language reports from 1966 to the present catalogued in PubMed, Medline, PsycInfo, and CINAHL, identifiable as qualitative investigations of the spiritual perspectives of adults at the end of life. The final sample includes 11 articles, collectively representing data from 217 adults. The preponderance of participants had a diagnosis of cancer; those with HIV/AIDS, cardiovascular disease, and ALS were also represented. Approximately half the studies were conducted in the United States; others were performed in Australia, Finland, Scotland, and Taiwan. Following a process of theme extraction and abstraction, thematic patterns emerged and effect sizes were calculated. A spectrum of spirituality at the end of life encompassing spiritual despair (alienation, loss of self, dissonance), spiritual work (forgiveness, self-exploration, search for balance), and spiritual well-being (connection, self-actualization, consonance) emerged. The findings from this meta-summary confirm the fundamental importance of spirituality at the end of life and highlight the shifts in spiritual health that are possible when a terminally ill person is able to do the necessary spiritual work. Existing end-of-life frameworks neglect spiritual work and consequently may be deficient in guiding research. The area of spiritual work is fertile ground for further investigation, especially interventions aimed at improving spiritual health and general quality of life among the dying.

People and things. CERN Courier, September 1981, v. 21(7)

International Nuclear Information System (INIS)

Anon.

1981-01-01

The article reports on achievements of various people, staff changes and position opportunities within the CERN organization and contains news updates on upcoming or past events: The King of Belgium recently paid a state visit to the People's Republic of China and invited four Belgian scientists to accompany him — M. Engelborghs-Bertelsr P. Melchior (Royal Observatory of Brussels and Louvain), J. van der Veken (Louvain) and Y. Go/dschmidt-Clermont (Brussels and CERN). Yves Goldschmidt- Clermont provided us with the following report. Italian physicists are presently developing a large modular track detector to be installed in the future Gran Sasso underground laboratory. Such a 'Giant Underground track- Detector' (GUD), up to 10 Kt in mass, should be capable of investigating nucleon decay and the interactions of high energy cosmic neutrinos. An International Conference on Nucleus-Nucleus Collisions will be held at Michigan State University from 26 September to 1 October, 1982

The effects of umbilical cord entanglement upon labor management and fetal health: retrospective case control study.

Science.gov (United States)

Buyukkayaci Duman, Nuriye; Topuz, Senay; Bostanci, Mehmet Omer; Gorkem, Umit; Yuksel Kocak, Derya; Togrul, Cihan; Gungor, Tayfun

2018-03-01

This retrospective study aimed at determining prognostic factors that paved the way for umbilical cord entanglement (UCE) and the effects of UCE upon labor management and fetal health. Sixty women who gave term birth with head presentation and received UCE diagnosis following birth composed the case group while another 60 women with the same characteristics who were selected with randomized sampling method and who did not develop UCE comprised the control group. The data obtained were processed with SPSS 22.0 statistical program. T test was used for comparing demographic and obstetric data and mean birth weight of babies in the case group and control group. For comparing data on active labor management and fetal health, numbers, percentages and chi-square test were used. Also for comparing values case: 58.3.0%; control: 21.7%), vacuum assisted vaginal delivery (case: 20.0%; control: 3.3%), forceps assisted vaginal delivery (case: 8.3%; control: 1.7%), fetal distress (case: 60.0%; control: 25.0%), amniotic fluid meconium (case: 58.3%; control: 21.7%), APGAR score less than 7 at the 1st minute (case: 58.3%; control: 21.7%) and APGAR score less than 7 at the 5th minute were higher in the women in the case group than the women in the control group (p < 0.05). UCE increased rates of interventional birth, emergent cesarean delivery, vacuum assisted vaginal delivery, forceps assisted vaginal delivery, amniotic fluid meconium and fetal distress.

Fission excitation function for 19F + 194,196,198Pt at near and above barrier energies

Directory of Open Access Journals (Sweden)

Singh Varinderjit

2015-01-01

Full Text Available Fission excitation functions for 19F + 194,196,198Pt reactions populating 213,215,217Fr compound nuclei are reported. Out of these three compound nuclei, 213Fr is a shell closed (N=126 compound nucleus and the other two are away from the shell closure. From a comparison of the experimental fission cross-sections with the statistical model predictions, it is observed that the fission cross-sections are underestimated by the statistical model predictions using shell corrected finite range rotating liquid drop model (FRLDM fission barriers. Further the FRLDM fission barriers are reduced to fit the fission cross-sections over the entire measured energy range.

48 CFR 1217.7001 - Clauses.

Science.gov (United States)

2010-10-01

... CONTRACT TYPES SPECIAL CONTRACTING METHODS Fixed Price Contracts for Vessel Repair, Alteration or... acceptance tests will afford full protection to the Government in ascertaining conformance to specifications... through (TAR) 48 CFR 1252.217-80. (c) (TAR) 48 CFR 1252.217-75 may be included in sealed bid fixed-price...

14 CFR 145.209 - Repair station manual contents.

Science.gov (United States)

2010-01-01

...; (g) Procedures for maintenance, preventive maintenance, or alterations performed under § 145.205; (h)Procedures for— (1) Maintaining and revising the contract maintenance information required by § 145.217(a)(2...) Maintaining and revising the contract maintenance information required by § 145.217(a)(2)(ii) and notifying...

77 FR 76939 - Defense Federal Acquisition Regulation Supplement: Definition of Cost or Pricing Data (DFARS Case...

Science.gov (United States)

2012-12-31

... cost or pricing data'' in its place. PART 217--SPECIAL CONTRACTING METHODS 217.7401 [Amended] 0 11... Cost or Pricing Data (DFARS Case 2011-D040) AGENCY: Defense Acquisition Regulations System, Department... ``certified cost or pricing data'' and ``data other than certified cost or pricing data.'' The DFARS changes...

Structure of the conserved hypothetical protein MAL13P1.257 from Plasmodium falciparum

International Nuclear Information System (INIS)

Holmes, Margaret A.; Buckner, Frederick S.; Van Voorhis, Wesley C.; Mehlin, Christopher; Boni, Erica; Earnest, Thomas N.; DeTitta, George; Luft, Joseph; Lauricella, Angela; Anderson, Lori; Kalyuzhniy, Oleksandr; Zucker, Frank; Schoenfeld, Lori W.; Hol, Wim G. J.; Merritt, Ethan A.

2006-01-01

The crystal structure of a conserved hypothetical protein, MAL13P1.257 from P. falciparum, has been determined at 2.17 Å resolution. The structure represents a new protein fold and is the first structural representative for Pfam sequence family PF05907. The structure of a conserved hypothetical protein, PlasmoDB sequence MAL13P1.257 from Plasmodium falciparum, Pfam sequence family PF05907, has been determined as part of the structural genomics effort of the Structural Genomics of Pathogenic Protozoa consortium. The structure was determined by multiple-wavelength anomalous dispersion at 2.17 Å resolution. The structure is almost entirely β-sheet; it consists of 15 β-strands and one short 3 10 -helix and represents a new protein fold. The packing of the two monomers in the asymmetric unit indicates that the biological unit may be a dimer.

Identifying the effects of social media on health behavior: Data from a large-scale online experiment.

Science.gov (United States)

Zhang, Jingwen; Brackbill, Devon; Yang, Sijia; Centola, Damon

2015-12-01

Sedentary lifestyle is an escalating epidemic. Little is known about whether or how social media can be used to design a cost-effective solution for sedentary lifestyle. In this article we describe the data from a randomized controlled trial (RCT) that evaluated two prominent strategies for conducting exercise interventions using elements of social media: motivational media campaigns and online peer networks. The data file includes 217 participants' basic demographic information, number of exercise class enrollments over 13 weeks, and self-reported number of days for exercise activities in the previous 7 days at baseline. Among the 217, 164 also have data on self-reported number of days for exercise activities at the post-program. Data are supplied with this article. The interpretation of these data can be found in the research article published by the authors in Preventive Medicine Reports in 2015 [1].

Diethylstilbestrol can effectively accelerate estradiol-17-O-glucuronidation, while potently inhibiting estradiol-3-O-glucuronidation

International Nuclear Information System (INIS)

Zhu, Liangliang; Xiao, Ling; Xia, Yangliu; Zhou, Kun; Wang, Huili; Huang, Minyi; Ge, Guangbo; Wu, Yan; Wu, Ganlin; Yang, Ling

2015-01-01

This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), K m values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while V max values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate V max from 0.016 to 0.81 nmol/min/mg, while lifting K m in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with K A , α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the activity of UGT1A4

Diethylstilbestrol can effectively accelerate estradiol-17-O-glucuronidation, while potently inhibiting estradiol-3-O-glucuronidation

Energy Technology Data Exchange (ETDEWEB)

Zhu, Liangliang; Xiao, Ling [The Centre for Drug and Food Safety Evaluation, School of Life Science, Anqing Normal University, Anqing 246011 (China); Xia, Yangliu [Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China); Zhou, Kun [College of Pharmacy, Liaoning University of Traditional Chinese Medicine, Dalian 116600 (China); Wang, Huili; Huang, Minyi [The Centre for Drug and Food Safety Evaluation, School of Life Science, Anqing Normal University, Anqing 246011 (China); Ge, Guangbo, E-mail: geguangbo@dicp.ac.cn [Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China); Wu, Yan; Wu, Ganlin [The Centre for Drug and Food Safety Evaluation, School of Life Science, Anqing Normal University, Anqing 246011 (China); Yang, Ling, E-mail: yling@dicp.ac.cn [Dalian Institute of Chemical Physics, Chinese Academy of Sciences, Dalian 116023 (China)

2015-03-01

This in vitro study investigates the effects of diethylstilbestrol (DES), a widely used toxic synthetic estrogen, on estradiol-3- and 17-O- (E2-3/17-O) glucuronidation, via culturing human liver microsomes (HLMs) or recombinant UDP-glucuronosyltransferases (UGTs) with DES and E2. DES can potently inhibit E2-3-O-glucuronidation in HLM, a probe reaction for UGT1A1. Kinetic assays indicate that the inhibition follows a competitive inhibition mechanism, with the Ki value of 2.1 ± 0.3 μM, which is less than the possible in vivo level. In contrast to the inhibition on E2-3-O-glucuronidation, the acceleration is observed on E2-17-O-glucuronidation in HLM, in which cholestatic E2-17-O-glucuronide is generated. In the presence of DES (0–6.25 μM), K{sub m} values for E2-17-O-glucuronidation are located in the range of 7.2–7.4 μM, while V{sub max} values range from 0.38 to 1.54 nmol/min/mg. The mechanism behind the activation in HLM is further demonstrated by the fact that DES can efficiently elevate the activity of UGT1A4 in catalyzing E2-17-O-glucuronidation. The presence of DES (2 μM) can elevate V{sub max} from 0.016 to 0.81 nmol/min/mg, while lifting K{sub m} in a much lesser extent from 4.4 to 11 μM. Activation of E2-17-O-glucuronidation is well described by a two binding site model, with K{sub A}, α, and β values of 0.077 ± 0.18 μM, 3.3 ± 1.1 and 104 ± 56, respectively. However, diverse effects of DES towards E2-3/17-O-glucuronidation are not observed in liver microsomes from several common experimental animals. In summary, this study issues new potential toxic mechanisms for DES: potently inhibiting the activity of UGT1A1 and powerfully accelerating the formation of cholestatic E2-17-O-glucuronide by UGT1A4. - Highlights: • E2-3-O-glucuronidation in HLM is inhibited when co-incubated with DES. • E2-17-O-glucuronidation in HLM is stimulated when co-incubated with DES. • Acceleration of E2-17-O-glucuronidationin in HLM by DES is via activating the

Genome Sequences of Three Highly Copper-Resistant Salmonella enterica subsp. I Serovar Typhimurium Strains Isolated from Pigs in Denmark

DEFF Research Database (Denmark)

Qin, Yanan; Hasman, Henrik; Aarestrup, Frank Møller

2014-01-01

Salmonella typhimurium is the causative agent of typhoid fever, which causes nearly 21.7 million illnesses and 217,000 deaths around the world each year. Here, we describe the draft genome sequences of the Salmonella typhimurium strains S7, S15, and S23, isolated from copper-fed pigs in Denmark...

[Hearing screening at nursery schools: results of an evaluation study].

Science.gov (United States)

Weichbold, Viktor; Rohrer, Monika; Winkler, Cornelia; Welzl-Müller, Kunigunde

2004-07-31

This study aimed to evaluate the hearing screening of pre-school children at nursery schools in Tyrol, Austria. 47 nursery schools with a total of 2199 enrolled children participated in the study. At the screening, the children were presented a series of tones at frequencies 0.5 kHz (25dB), 1 kHz, 2 kHz, 3 kHz, and 4 kHz (20 dB each) from portable audiometers. The tones were presented over headphones for each ear separately and at irregular intervals. Failure to respond to any of the frequencies was considered failure of the screening. Parents were then advised in written form to have the child examined by an ENT-specialist. 1832 individuals were screened (coverage: 83% of nursery school children; corresponding to at least 63% of all Tyrolean children aged 3 to 5 years). Of these, 390 failed the test (referral rate: 21% of all screened). Examination through an ENT-specialist occurred with 217 children, and this confirmed the positive test in 139 children (hit rate: 64%). In most cases, a temporary conductive hearing loss due to external or middle ear problems (glue ear, tube dysfunction, cerumen, otitis media) was diagnosed. A sensorineural hearing loss was found in 4 children (in 3 of them bilateral). The need for therapy was recognized in 81 children (4% of all screened). Pre-school hearing screening identifies children with ear and hearing problems that need therapeutical intervention. Although the hearing problems are mostly of a temporary nature, some may require monitoring over some period. Also some children with permanent sensorineural hearing loss may be detected through this measure. Hearing screening is an efficient means of assessing ear and hearing problems in pre-school children. However, the follow-up rate needs to be improved for optimizing the efficacy.

Significance of apoptotic cell death after γ-irradiation

International Nuclear Information System (INIS)

Wu, H.G.; Kim, I.H.; Ha, S.W.; Park, C.I.

2003-01-01

Full text: The objectives of this study are to investigate the significance of apoptotic death compared to total cell death after γ-ray irradiation in human Hand N cancer cell lines and to find out correlation between apoptosis and radiation sensitivity. Materials and Method: Head and neck cancer cell lines (PCI-1, PCI-13, and SNU-1066), leukemia cell line (CCRF-CEM), and fibroblast cell line (LM217) as a normal control were used for this study. Cells were irradiated using Cs-137 animal experiment irradiator. Total cell death was measured by clonogenic assay. Annexin-V staining was used to detect the fraction of apoptotic death. The resulting data was analyzed with two parameters, apoptotic index (AI) and apoptotic fraction(AF). AI is ratio of apoptotic cells to total cells, and AF is ration of apoptotic cell death to mutant frequencytion ex(Number of apoptotic cells) / (Number of total cells counted) AF = {(AI) / (1-survival fraction)} x 100 (%) Results. Surviving fraction at 2 Gy (SF2) were 0.741, 0.544, 0.313, 0.302, and 0.100 for PCI-1, PCI-13, SNU-1066, CCRF-CEM, and LM217 cell lines, respectively. Apoptosis was detected in all cell lines. Apoptotic index reached peak value at 72 hours after irradiation in head and neck cancer cell lines, and that was at 24 hours in CCRF-CEM and LM217. Total cell death increased exponentially with increasing radiation dose from 0 Gy to 8 Gy, but the change was minimal in apoptotic index (Fig. 1.). Apoptotic fractions at 2 Gy were 46%, 48%, 46%, 24%, and 19% and at 6 Gy were 20%, 33%, 35%, 17%, and 20% for PCI-1, PCI-13, SNU-1066, CCRF-CEM, and LM217, respectively. The radioresistant cell lines showed more higher apoptotic fraction at 2 Gy (Table 1.), but there was not such correlation at 6 Gy. Conclusion: All cell lines used in this study showed apoptosis after irradiation, but time course of apoptosis was different from that of leukemia cell line and normal fibroblast cell line. Reproductive cell death was more important

Overexpression of the transporters AtZIP1 and AtMTP1 in cassava changes zinc accumulation and partitioning

Directory of Open Access Journals (Sweden)

Eliana eGaitan-Solis

2015-07-01

Full Text Available Zinc deficiency in humans is a serious problem worldwide with an estimated one third of populations at risk for insufficient zinc in diet which leads to impairment of cognitive abilities and immune system function. The goal of this research was to increase the bioavailable zinc in the edible portion of cassava roots to improve the overall zinc nutrition of populations that rely on cassava as a dietary staple. To increase zinc concentrations, two A. thaliana genes coding for ZIP1 and MTP1 were overexpressed with a tuber-specific or constitutive promoter. Eighteen transgenic events from four constructs, out of a total of 73 events generated, showed significantly higher zinc concentrations in the edible portion of the storage root compared to the non-transgenic controls. The zinc content in the transgenic lines ranged from 4 - 73 mg/Kg Dry Weight (DW as compared to the non-transgenic control which contained 8 mg/Kg. Striking changes in whole plant phenotype such as smaller plant size and chlorotic leaves were observed in transgenic lines that over accumulated zinc. In a confined field trial five transgenic events grown for 12 months showed a range of zinc concentrations from 18 – 217 mg/Kg DW. Although the overexpression of zinc transporters was successful in increasing the zinc concentrations in 25% of the transgenic lines generated, it also resulted in a decrease in plant and tuber size and overall yield due to what appears to be zinc deficiency in the aerial parts of the plant.

12038_2016_9610_Article_print 205..217

Indian Academy of Sciences (India)

2016-05-13

May 13, 2016 ... ground fluorescence from the HL5 medium, cells were in- cubated in 'Loflo' .... in the segregation of anterograde and retrograde trans- ported proteins .... enriched Golgi appears to be fractionated (figure 6, pan- el 1E).

48 CFR 252.217-7027 - Contract definitization.

Science.gov (United States)

2010-10-01

...., fixed-price or cost-and-fee) proposal and cost or pricing data supporting its proposal. (b) The schedule for definitizing this contract is as follows (insert target date for definitization of the contract... of the make-or-buy and subcontracting plans and cost or pricing data). (c) If agreement on a...

31 CFR 0.217 - Personal financial interests.

Science.gov (United States)

2010-07-01

... hold the following financial interests without violating 18 U.S.C. 208(a): (1) The stocks or bonds of a publicly traded corporation with a value of $1000 or less; and (2) The stocks or bonds in the investment portfolio of a diversified mutual fund in which an employee has invested. (b) The Department has found that...

29 CFR 1910.217 - Mechanical power presses.

Science.gov (United States)

2010-07-01

..., including relays, limit switches, and static output circuits. (9) Slide counterbalance systems. (i) Spring...., mechanical, electro-mechanical, or electronic) shall meet the requirements of paragraph (b)(13) of this...

48 CFR 217.7103-4 - Emergency work.

Science.gov (United States)

2010-10-01

..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Master Agreement for... soliciting offers, may issue a written job order to a contractor that has previously executed a master...

Nontuberculous Mycobacteria Infections at a Provincial Reference Hospital, Cambodia.

Science.gov (United States)

Bonnet, Maryline; San, Kim Chamroeun; Pho, Yati; Sok, Chandara; Dousset, Jean-Philippe; Brant, William; Hurtado, Northan; Eam, Khun Kim; Ardizzoni, Elisa; Heng, Seiha; Godreuil, Sylvain; Yew, Wing-Wai; Hewison, Cathy

2017-07-01

Prevalence of nontuberculous mycobacteria (NTM) disease is poorly documented in countries with high prevalence of tuberculosis (TB). We describe prevalence, risk factors, and TB program implications for NTM isolates and disease in Cambodia. A prospective cohort of 1,183 patients with presumptive TB underwent epidemiologic, clinical, radiologic, and microbiologic evaluation, including >12-months of follow-up for patients with NTM isolates. Prevalence of NTM isolates was 10.8% and of disease was 0.9%; 217 (18.3%) patients had TB. Of 197 smear-positive patients, 171 (86.8%) had TB confirmed (167 by culture and 4 by Xpert MTB/RIF assay only) and 11 (5.6%) had NTM isolates. HIV infection and past TB were independently associated with having NTM isolates. Improved detection of NTM isolates in Cambodia might require more systematic use of mycobacterial culture and the use of Xpert MTB/RIF to confirm smear-positive TB cases, especially in patients with HIV infection or a history of TB.

Intensity of delivery room resuscitation and neonatal outcomes in infants born at 33 to 36 weeks' gestation.

Science.gov (United States)

Jiang, S; Lyu, Y; Ye, X Y; Monterrosa, L; Shah, P S; Lee, S K

2016-02-01

Examine the relationship between delivery room resuscitation intensity and mortality, morbidities and resource use in late preterm infants. Retrospective cohort study of inborn infants born at 33 to 36 weeks' gestation and admitted to Canadian neonatal intensive care units during 2010 to 2013. The 13 619 infants were grouped according to delivery room resuscitation intensity: no or minimal resuscitation (64.5%); continuous positive airway pressure (10.2%); bag-mask ventilation (21.7%); endotracheal intubation (3.1%); and cardiopulmonary resuscitation (CPR) (0.6%). Overall mortality, early mortality, respiratory distress, pneumothorax, late-onset sepsis and resource use increased with higher intensity resuscitation. Compared with no or minimal resuscitation, intubation and CPR were associated with increased odds of mortality (adjusted odds ratio (95% confidence interval): 50 (20 to 125) and 180 (63 to 518), respectively). Intubation or higher intensity delivery room resuscitation is associated with increased mortality, morbidities and resource use in late preterm infants. Extra intensive care is required for such infants, especially during the first week of life.

The production rate of cosmogenic deuterium at the Moon's surface

Science.gov (United States)

Füri, Evelyn; Deloule, Etienne; Trappitsch, Reto

2017-09-01

The hydrogen (D/H) isotope ratio is a key tracer for the source of planetary water. However, secondary processes such as solar wind implantation and cosmic ray induced spallation reactions have modified the primordial D/H signature of 'water' in all rocks and soils recovered on the Moon. Here, we re-evaluate the production rate of cosmogenic deuterium (D) at the Moon's surface through ion microprobe analyses of hydrogen isotopes in olivines from eight Apollo 12 and 15 mare basalts. These in situ measurements are complemented by CO2 laser extraction-static mass spectrometry analyses of cosmogenic noble gas nuclides (3He, 21Ne, 38Ar). Cosmic ray exposure (CRE) ages of the mare basalts, derived from their cosmogenic 21Ne content, range from 60 to 422 Ma. These CRE ages are 35% higher, on average, than the published values for the same samples. The amount of D detected in the olivines increases linearly with increasing CRE ages, consistent with a production rate of (2.17 ± 0.11) ×10-12 mol(g rock)-1 Ma-1. This value is more than twice as high as previous estimates for the production of D by galactic cosmic rays, indicating that for water-poor lunar samples, i.e., samples with water concentrations ≤50 ppm, corrected D/H ratios have been severely overestimated.

Comparing large-scale hydrological model predictions with observed streamflow in the Pacific Northwest: effects of climate and groundwater

Science.gov (United States)

Mohammad Safeeq; Guillaume S. Mauger; Gordon E. Grant; Ivan Arismendi; Alan F. Hamlet; Se-Yeun Lee

2014-01-01

Assessing uncertainties in hydrologic models can improve accuracy in predicting future streamflow. Here, simulated streamflows using the Variable Infiltration Capacity (VIC) model at coarse (1/16°) and fine (1/120°) spatial resolutions were evaluated against observed streamflows from 217 watersheds. In...

Investigating the environmental adaptability of promising subtropical ...

African Journals Online (AJOL)

Trees were assessed for frost sensitivity at 15 months, and height and basal area at 48 months. Eucalyptus longirostrata, E. pilularis, Corymbia citriodora subsp. citriodora, C. henryi and C. maculata, species that performed well in forerunner ICFR coastal Zululand site-species trials (MAT range 21.7–21.9°C), generally ...

77 FR 26968 - Final Flood Elevation Determinations

Science.gov (United States)

2012-05-08

... upstream of Port-Hudson Pride Road. Sheet flow between McCarroll Drive and At North Jefferson Place 1 City.... Road. Approximately 0.9 mile +335 upstream of Wagener Trail Road. Dry Branch At the Hollow Creek West +217 Unincorporated Areas of confluence. Aiken County. Approximately 1,200 feet +318 upstream of Dry...

Identifying the effects of social media on health behavior: Data from a large-scale online experiment

Directory of Open Access Journals (Sweden)

Jingwen Zhang

2015-12-01

Full Text Available Sedentary lifestyle is an escalating epidemic. Little is known about whether or how social media can be used to design a cost-effective solution for sedentary lifestyle. In this article we describe the data from a randomized controlled trial (RCT that evaluated two prominent strategies for conducting exercise interventions using elements of social media: motivational media campaigns and online peer networks. The data file includes 217 participants’ basic demographic information, number of exercise class enrollments over 13 weeks, and self-reported number of days for exercise activities in the previous 7 days at baseline. Among the 217, 164 also have data on self-reported number of days for exercise activities at the post-program. Data are supplied with this article. The interpretation of these data can be found in the research article published by the authors in Preventive Medicine Reports in 2015 [1].

Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

African Journals Online (AJOL)

PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

76 FR 11411 - Defense Federal Acquisition Regulation Supplement; Multiyear Contracting (DFARS Case 2009-D026)

Science.gov (United States)

2011-03-02

... economic order quantity procurement, are merged into 217.170, General, and 217.172, Multiyear contracts for... guided by the following principles when entering into a multiyear contract for services: (1) The portion... authorized by law (10 U.S.C. 2306b and 10 U.S.C. 2306c). A multiyear supply contract may be authorized by an...

Nematodes from the genus Ascaridia parasitizing psittaciform birds: a review and determination key

Czech Academy of Sciences Publication Activity Database

Kajerová, V.; Baruš, Vlastimil; Literák, I.

2004-01-01

Roč. 49, č. 6 (2004), s. 217-223 ISSN 0375-8427 R&D Projects: GA ČR GA524/03/0061 Institutional research plan: CEZ:AV0Z6093917 Keywords : ascarids * parrots * morphometry Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 0.790, year: 2004 http://www.vri.cz/docs/vetmed/49-6-217.pdf

Persistence of Upper-Airway Symptoms During CPAP Compromises Adherence at 1 Year.

Science.gov (United States)

Kreivi, Hanna-Riikka; Maasilta, Paula; Bachour, Adel

2016-05-01

The most common adverse effects of CPAP are related to the upper airways. We evaluated upper-airway symptoms before and after a CPAP trial as well as their effect on CPAP adherence. We also evaluated the effect of humidification added to CPAP therapy on upper-airway symptoms. We followed for 1 y 536 subjects with obstructive sleep apnea scheduled consecutively for CPAP initiation. Subjects completed visual analog questionnaires on nasal stuffiness, rhinorrhea, and mouth dryness (0 = no symptoms, 100 = severe symptoms). Before CPAP initiation, mean nasal stuffiness score was 29.6 ± 24.9, rhinorrhea score was 16.0 ± 21.7, and mouth dryness score was 43.8 ± 33.1. In subjects who quit CPAP treatment before the 1-y follow-up, the increase in rhinorrhea score during CPAP initiation was significant, 5.3 (95% CI 0.5-9.5, P = .02), and in those using CPAP at 1 y, nasal stuffiness score and mouth dryness score decreased significantly during initiation, -5.1 (95% CI -7.9 to -2.4, P CPAP regardless of humidification: change with humidification, -18.1 (95% CI -22.1 to -14.3), P CPAP, whereas its absence induced a significant rise in symptom scores: change in rhinorrhea, 11.5 (95% CI 7.1-16.7), P CPAP does not predict CPAP use at 1 y, whereas CPAP non-users at 1 y had smaller or no alleviation in symptom scores during initiation compared with those who continued CPAP treatment. Copyright © 2016 by Daedalus Enterprises.

Adolescent predictors of objectively measured physical activity and sedentary behaviour at age 42: the Amsterdam Growth and Health Longitudinal Study (AGAHLS

Directory of Open Access Journals (Sweden)

Koppes Lando LJ

2011-10-01

Full Text Available Abstract Background This study investigated the associations of physical characteristics and personality in adolescence with physical activity and sedentary behaviour in adulthood. Findings Physical characteristics (i.e. objectively measured BMI, sum of skin folds, MOPER test battery performance, and personality (i.e. self-reported inadequacy, social inadequacy, rigidity, self-sufficiency/recalcitrance, dominance, achievement motivation, facilitating anxiety, debilitating anxiety, and social desirability were assessed in 217 adolescent boys (Mean 13.0, SD 0.6 and girls (Mean 12.9, SD 0.6. Twenty-nine years later, at the age of 42, their physical activity and sedentary behaviour were assessed by means of accelerometry. Boys who scored lower on self-sufficiency/recalcitrance and higher on facilitating anxiety spent more time sedentary in adulthood. Girls with a superior standing high jump performance, and a lower score on social desirability spent more time sedentary in adulthood. In contrast with sedentary behaviour, physical activity at age 42 year could not be predicted by physical characteristics or personality in adolescence. Conclusions Sedentary behaviour in adulthood was partly explained by physical characteristics and/or personality in adolescence. Thus, our results suggest that it may be possible to identify people who are at risk of becoming sedentary at a rather young age.

Post-operative pain management in paediatric surgery at Sylvanus Olympio University Teaching Hospital, Togo

Directory of Open Access Journals (Sweden)

Hamza Doles Sama

2014-01-01

Full Text Available Background: The aim of this study was to evaluate pain management in paediatric surgery at Sylvanus Olympio University Teaching Hospital, Lome. Patients and Methods: A prospective descriptive study was conducted in the Department of Anaesthesiology and Intensive Care at Sylvanus Olympio teaching hospital from 1 January to 30 June 2012. Data collected include: demography, type of surgery, American Society of Anaesthesiologists (ASA classification, anaesthetic protocol, analgesia technique, post-operative complications and cost of analgesia. Results: The study includes 106 post-operative children. Abdominal surgery was performed in 41.5% and orthopaedic surgery in 31.1%. A total of 75% of patients were classified ASA 1. General anaesthesia (GA was performed in 88%. Anaesthetists supervised post-operative care in 21.7% cases. Multimodal analgesia was used in every case and 12% of patients received a regional block. The most frequently unwanted effects of analgesics used were nausea and/or vomiting in 12.3%. At H24, child under 7 years have more pain assessment than those from 7 to 15 years (46% vs 24% and this difference was statistically significant (chi-square = 4.7598; P = 0.0291 < 0.05. The average cost of peri-operative analgesia under loco regional analgesia (LRA versus GA during the first 48 h post-operative was US $23 versus $46. Conclusion: Our study showed that post-operative pain management in paediatric surgery is often not well controlled and paediatric loco regional analgesia technique is under practiced in sub Saharan Africa.

Advantages and disadvantages of an objective selection process for early intervention in employees at risk for sickness absence.

Science.gov (United States)

Duijts, Saskia F A; Kant, Ijmert; Swaen, Gerard M H

2007-05-02

It is unclear if objective selection of employees, for an intervention to prevent sickness absence, is more effective than subjective 'personal enlistment'. We hypothesize that objectively selected employees are 'at risk' for sickness absence and eligible to participate in the intervention program. The dispatch of 8603 screening instruments forms the starting point of the objective selection process. Different stages of this process, throughout which employees either dropped out or were excluded, were described and compared with the subjective selection process. Characteristics of ineligible and ultimately selected employees, for a randomized trial, were described and quantified using sickness absence data. Overall response rate on the screening instrument was 42.0%. Response bias was found for the parameters sex and age, but not for sickness absence. Sickness absence was higher in the 'at risk' (N = 212) group (42%) compared to the 'not at risk' (N = 2503) group (25%) (OR 2.17 CI 1.63-2.89; p = 0.000). The selection process ended with the successful inclusion of 151 eligible, i.e. 2% of the approached employees in the trial. The study shows that objective selection of employees for early intervention is effective. Despite methodological and practical problems, selected employees are actually those at risk for sickness absence, who will probably benefit more from the intervention program than others.

Li(Zn,Co,MnAs: A bulk form diluted magnetic semiconductor with Co and Mn co-doping at Zn sites

Directory of Open Access Journals (Sweden)

Bijuan Chen

2016-11-01

Full Text Available We report the synthesis and characterization of a series of bulk forms of diluted magnetic semiconductors Li(Zn1-x-yCoxMnyAs with a crystal structure close to that of III-V diluted magnetic semiconductor (Ga,MnAs. No ferromagnetic order occurs with single (Zn,Co or (Zn, Mn substitution in the parent compound LiZnAs. Only with co-doped Co and Mn ferromagnetic ordering can occur at the Curie temperature ∼40 K. The maximum saturation moment of the this system reached to 2.17μB/Mn, which is comparable to that of Li (Zn,MnAs. It is the first time that a diluted magnetic semiconductor with co-doping Co and Mn into Zn sites is achieved in “111” LiZnAs system, which could be utilized to investigate the basic science of ferromagnetism in diluted magnetic semiconductors. In addition, ferromagnetic Li(Zn,Co,MnAs, antiferromagnetic LiMnAs, and superconducting LiFeAs share square lattice at As layers, which may enable the development of novel heterojunction devices in the future.

Comparison of elicitation potential of chloroatranol and atranol - 2 allergens in oak moss absolute

DEFF Research Database (Denmark)

Johansen, J.D.; Bernard, G.; Gimenez-Arnau, E.

2006-01-01

of chloroatranol relative to atranol based on testing with equimolar concentrations was 217% (95% confidence interval 116-409%). Both substances elicited reactions at very low levels of exposure. It is concluded that the differences in elicitation capacity between the 2 substances are counterbalanced by exposure...

Parents' willingness to get human papillomavirus vaccination for their adolescent children at a pharmacy.

Science.gov (United States)

Calo, William A; Gilkey, Melissa B; Shah, Parth; Marciniak, Macary W; Brewer, Noel T

2017-06-01

Pharmacies are promising alternative settings for human papillomavirus (HPV) vaccination because of their accessibility and existing infrastructure for vaccine delivery. We sought to examine parents' willingness to get HPV vaccination for their children at pharmacies. In 2014, we conducted a national, online survey of 1255 parents of 11- to 17-year-old adolescents in the United States. We used multivariable logistic regression to model parents' willingness for getting HPV vaccinations in pharmacies. Overall, 29% of parents would be willing to get HPV vaccine for their children at a pharmacy. Parental willingness was associated with believing that pharmacists are skilled at administering vaccines (OR=2.05, 95% CI:1.68-2.51), HPV vaccine was at least as important as other adolescent vaccines (OR=1.48, 95% CI:1.10-1.98), and getting vaccines in pharmacies would give children more opportunities to get health care (OR=2.17, 95% CI:1.63-2.89). Parental willingness was also more common among parents of adolescents ages 13-17 or who had already initiated the HPV vaccine series. Parents most often indicated that they would like to learn about HPV vaccination in pharmacies from their children's doctor (37%). Offering HPV vaccine in pharmacies may increase uptake as a meaningful number of parents would get the vaccine for their children in these settings. Physician referrals for completing the HPV vaccine series may serve as an important source for increasing awareness of and demand for adolescent vaccination services in pharmacies. Copyright © 2017 Elsevier Inc. All rights reserved.

Spectroscopic Investigations of High-Power Laser Sparks in Gas Mixtures Containing Methane: A Laboratory Model of Energetic Events in Strongly Reduced Planetary Atmospheres

Czech Academy of Sciences Publication Activity Database

Civiš, Svatopluk; Civiš, Martin; Rašín, R.; Kamas, Michal; Dryahina, Kseniya; Španěl, Patrik; Juha, Libor; Ferus, Martin

2009-01-01

Roč. 39, 3-4 (2009), s. 217-217 ISSN 0169-6149 R&D Projects: GA MŠk LC510; GA MŠk(CZ) LC528; GA ČR GA203/06/1278 Institutional research plan: CEZ:AV0Z40400503; CEZ:AV0Z10100523 Keywords : planetary atmosphere * lasers * spectroscopy Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.053, year: 2009

Regulatory Assistance, Stakeholder Outreach, and Coastal and Marine Spatial Planning Activities in Support of Marine and Hydrokinetic Energy Deployment

Energy Technology Data Exchange (ETDEWEB)

Geerlofs, Simon H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Copping, Andrea E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Van Cleve, Frances B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Blake, Kara M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hanna, Luke A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2011-09-01

This fiscal year 2011 progress report summarizes activities carried out under DOE Water Power Task 2.1.7, Permitting and Planning. Activities under Task 2.1.7 address the concerns of a wide range of stakeholders with an interest in the development of the marine and hydrokinetic (MHK) energy industry, including regulatory and resource management agencies, tribes, nongovernmental organizations, and industry.

Acousto-Optic Adaptive Processing (AOAP).

Science.gov (United States)

1983-12-01

2.03 mm 136 mm 41.6 mm Dense Flint Glass .58 1.06 48.6 21.7 LiNbO3 .65 2.24 250 46 1011 1 -: PbMoO4 .207 1.25 84.3 25.3 .- Slow Shear TeO2 .0586...mm 41.6 m Dense Flint Glass 5.9 1.06 3.2 21.7 LiNbO3 6.6 2.24 16.3 46 PbMoO4 2.1 1.25 5.5 25.6 TeO2 ’" ’" (slow,•...: Shear) 0.59 0.21 0.15 4.32 It is...was observed. 3.1.3 Delay Line The delay line used for the initial experiment is an Isomet Type 1201 AO modulator. This is a glass unit operat- ing at

Milnacipran and venlafaxine at flexible doses (up to 200 mg/day) in the outpatient treatment of adults with moderate-to-severe major depressive disorder: a 24-week randomized, double-blind exploratory study

OpenAIRE

Briley, Mike

2010-01-01

Jean-Pierre Olié1, David Gourion2, Agnès Montagne3, Michel Rostin4, Marie-France Poirier11Service de Santé Mentale et Thérapeutique, Centre Hospitalier Sainte-Anne, Paris, France; 217 rue des Marronniers, 75016 Paris, France; 3Pierre Fabre Médicament, Labège, France; 4Pierre Fabre Médicament, Castres, FranceAbstract: The objective of this exploratory, multicenter, randomized, double-blind study, was to evaluate the e...

Resting-state networks in healthy adult subjects: a comparison between a 32-element and an 8-element phased array head coil at 3.0 Tesla.

Science.gov (United States)

Paolini, Marco; Keeser, Daniel; Ingrisch, Michael; Werner, Natalie; Kindermann, Nicole; Reiser, Maximilian; Blautzik, Janusch

2015-05-01

Little research exists on the influence of a magnetic resonance imaging (MRI) head coil's channel count on measured resting-state functional connectivity. To compare a 32-element (32ch) and an 8-element (8ch) phased array head coil with respect to their potential to detect functional connectivity within resting-state networks. Twenty-six healthy adults (mean age, 21.7 years; SD, 2.1 years) underwent resting-state functional MRI at 3.0 Tesla with both coils using equal standard imaging parameters and a counterbalanced design. Independent component analysis (ICA) at different model orders and a dual regression approach were performed. Voxel-wise non-parametric statistical between-group contrasts were determined using permutation-based non-parametric inference. Phantom measurements demonstrated a generally higher image signal-to-noise ratio using the 32ch head coil. However, the results showed no significant differences between corresponding resting-state networks derived from both coils (p coil does not offer any significant advantages in detecting ICA-based functional connectivity within RSNs. © The Foundation Acta Radiologica 2015 Reprints and permissions: sagepub.co.uk/journalsPermissions.nav.

Bulletin of Materials Science | News

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science; Volume 25; Issue 3 ... Sintering of nano crystalline silicon carbide by doping with boron carbide ... of these powders was achieved by addition of boron carbide of 0.5 wt% together with carbon of 1 wt% at 2050°C at vacuum (3 mbar) for 15 min. ... pp 213-217 Alloys and Steels.

Birth by cesarean section in relation to adult offspring overweight and biomarkers of cardiometabolic risk

DEFF Research Database (Denmark)

Hansen, S; Halldorsson, T I; Olsen, S F

2018-01-01

insulin, leptin and adiponectin, and lipid concentrations. RESULTS: In the cohort, 7% were born by C-section, and at age 20 years, 18% of the offspring had a BMI ⩾25 kg m-2. Birth by C-section was associated with increased odds of overweight or obesity at 20 years (Odds ratio=2.17 (95% confidence interval...

77 FR 51115 - Integrated Mortgage Disclosures Under the Real Estate Settlement Procedures Act (Regulation X...

Science.gov (United States)

2012-08-23

... products were sold both to borrowers with poor or no credit history, as well as to borrowers with good... serious delinquency (90 or more days past due or in foreclosure) for these subprime and Alt-A products... in 2010.\\28\\ \\27\\ FCIC Report at 215. \\28\\ Id. at 217. The impact of this level of delinquencies on...

48 CFR 917.7403 - Application.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Application. 917.7403 Section 917.7403 Federal Acquisition Regulations System DEPARTMENT OF ENERGY CONTRACTING METHODS AND... Application. The clause at 48 CFR 952.217-70 shall be included in contracts or modifications where contractor...

Single Electrode Heat Effects

DEFF Research Database (Denmark)

Jacobsen, Torben; Broers, G. H. J.

1977-01-01

Standard Peltier entropies for the reactions in molten carbonate paste electrolytes at 1000°K have been determined fromthermogalvanic measurements. The results are –217 and –118 J/mole°K,respectively. No dependence on electrolyte composition is observed. The reversiblepart of the Peltier entropy ...

MODELING THERMAL DUST EMISSION WITH TWO COMPONENTS: APPLICATION TO THE PLANCK HIGH FREQUENCY INSTRUMENT MAPS

International Nuclear Information System (INIS)

Meisner, Aaron M.; Finkbeiner, Douglas P.

2015-01-01

We apply the Finkbeiner et al. two-component thermal dust emission model to the Planck High Frequency Instrument maps. This parameterization of the far-infrared dust spectrum as the sum of two modified blackbodies (MBBs) serves as an important alternative to the commonly adopted single-MBB dust emission model. Analyzing the joint Planck/DIRBE dust spectrum, we show that two-component models provide a better fit to the 100-3000 GHz emission than do single-MBB models, though by a lesser margin than found by Finkbeiner et al. based on FIRAS and DIRBE. We also derive full-sky 6.'1 resolution maps of dust optical depth and temperature by fitting the two-component model to Planck 217-857 GHz along with DIRBE/IRAS 100 μm data. Because our two-component model matches the dust spectrum near its peak, accounts for the spectrum's flattening at millimeter wavelengths, and specifies dust temperature at 6.'1 FWHM, our model provides reliable, high-resolution thermal dust emission foreground predictions from 100 to 3000 GHz. We find that, in diffuse sky regions, our two-component 100-217 GHz predictions are on average accurate to within 2.2%, while extrapolating the Planck Collaboration et al. single-MBB model systematically underpredicts emission by 18.8% at 100 GHz, 12.6% at 143 GHz, and 7.9% at 217 GHz. We calibrate our two-component optical depth to reddening, and compare with reddening estimates based on stellar spectra. We find the dominant systematic problems in our temperature/reddening maps to be zodiacal light on large angular scales and the cosmic infrared background anisotropy on small angular scales

Lateral Epicondylitis and Tobacco Use: A Case-Control Study.

Science.gov (United States)

Michienzi, Avery E; Anderson, Christopher P; Vang, Sandy; Ward, Christina M

2015-01-01

Although lateral epicondylitis (LE) is a very common tendinopathy, we understand little about the etiology of the disease. Tobacco use has been associated with other tendinopathies, and the purpose of this study is to determine if there is an association between the incidence of lateral epicondylitis and tobacco use. We performed a retrospective cohort study of adult patients diagnosed with lateral epicondylitis. Patients from a single orthopaedic surgeon's practice with LE were matched to control patients with other common upper extremity conditions based on age, gender, and occupation. A total of 65 case patients and 217 control patients were included in the study. The incidence of smoking in patients with lateral epicondylitis was compared to the incidence of smoking in the control group. Of the LE patients, 30/65 (46.2%) were non-smokers, 23/65 (35.4%) were former smokers, and 12/65 (18.5%) were current smokers. Of the control patients, 121/217 (55.8%) were non-smokers, 45/217 (20.7%) were former smokers, and 51/217 (23.5%) were current smokers. The odds of LE patients being former or current smokers compared to control patients were 1.45 times higher, but this was not statistically significant. Among people who did not smoke at the time of presentation, the odds of being a former smoker were 2.28 times higher in LE patients than in controls, which was statistically significant. The odds of being a former smoker were significantly higher in patients with lateral epicondylitis compared to patients with other upper extremity conditions. Although it did not reach statistical significance, the odds of being former or current smokers were also higher in the LE group. These results suggest a relationship between smoking history and incidence of lateral epicondylitis, though more research is needed to determine the exact nature of the relationship. Prognostic, Level III.

Mid IR-fiber spectroscopy in the 2-17μm range

Science.gov (United States)

Artyushenko, Viatcheslav G.; Bocharnikov, A.; Colquhoun, Gary; Leach, Clive A.; Lobachov, Vladimir; Pirogova, Lyudmila; Sakharova, Tatjana; Savitskij, Dmitrij; Ezhevskaya, Tatjana; Bublikov, Alexandr

2007-10-01

The latest development in IR-fibre optics enables us to expand the spectral range of process spectroscopy from 2μm out to 17μm (5000 to 600cm-1) i.e. into the most informative "finger-print" part of the spectrum. Mid-IR wavelength ranges from 2 to 6-10μm may be covered by Chalcogenide IR-glass CIR-fibres while Polycrystalline PIR-fibres made of Silver Halides solid solutions transmit 4-17 μm wavelength radiation. PIR-fibre immersion ATR probes and Transmission/Reflection probes had been manufactured and successfully tested with different FTIR spectrometers in the field of remote spectroscopy for forensic substances identification, chemical reaction control, and monitoring of exhaust or exhalation gases. Using these techniques no sample preparation is necessary for fibre probes to measure evanescent, reflection and transmission spectra, in situ and in real time. QCL spectrometer may be used as a portable device for multispectral gas analysis at 1ppb level of detectivity for various applications in environmental pollution monitoring.

Personal ways of handling everyday life

DEFF Research Database (Denmark)

Jensen, Lasse Meinert

at variations in everyday life pursuits:  How does a person's pursuit of goals and concerns lead him/her to experience and handle breaks, interruptions, and variation in everyday activities?  The research project so far holds quantitative data.  A convenient sample of 217 persons were administered...

Persistent Pain and Sensory Abnormalities after Abdominoplasty

DEFF Research Database (Denmark)

Presman, Benjamin; Finnerup, Kenneth; Andresen, Sven Robert

2015-01-01

and characteristics of persistent pain after abdominoplasty, which is one of the most frequent cosmetic surgical procedures. METHODS: In September 2014, a link to a web-based questionnaire was mailed to 217 patients who had undergone abdominoplasty between 2006 and 2014 at the Department of Plastic Surgery, Aalborg...

Early post-stroke cognition in stroke rehabilitation patients predicts functional outcome at 13 months.

Science.gov (United States)

Wagle, Jørgen; Farner, Lasse; Flekkøy, Kjell; Bruun Wyller, Torgeir; Sandvik, Leiv; Fure, Brynjar; Stensrød, Brynhild; Engedal, Knut

2011-01-01

To identify prognostic factors associated with functional outcome at 13 months in a sample of stroke rehabilitation patients. Specifically, we hypothesized that cognitive functioning early after stroke would predict long-term functional outcome independently of other factors. 163 stroke rehabilitation patients underwent a structured neuropsychological examination 2-3 weeks after hospital admittance, and their functional status was subsequently evaluated 13 months later with the modified Rankin Scale (mRS) as outcome measure. Three predictive models were built using linear regression analyses: a biological model (sociodemographics, apolipoprotein E genotype, prestroke vascular factors, lesion characteristics and neurological stroke-related impairment); a functional model (pre- and early post-stroke cognitive functioning, personal and instrumental activities of daily living, ADL, and depressive symptoms), and a combined model (including significant variables, with p value Stroke Scale; β = 0.402, p stroke cognitive functioning (Repeatable Battery of Neuropsychological Status, RBANS; β = -0.248, p = 0.001) and prestroke personal ADL (Barthel Index; β = -0.217, p = 0.002). Further linear regression analyses of which RBANS indexes and subtests best predicted long-term functional outcome showed that Coding (β = -0.484, p stroke cognitive functioning as measured by the RBANS is a significant and independent predictor of long-term functional post-stroke outcome. Copyright © 2011 S. Karger AG, Basel.

Planck 2013 results. VI. High Frequency Instrument data processing

CERN Document Server

Ade, P.A.R.; Armitage-Caplan, C.; Arnaud, M.; Ashdown, M.; Atrio-Barandela, F.; Aumont, J.; Baccigalupi, C.; Banday, A.J.; Barreiro, R.B.; Battaner, E.; Benabed, K.; Benoît, A.; Benoit-Lévy, A.; Bernard, J. -P.; Bersanelli, M.; Bielewicz, P.; Bobin, J.; Bock, J.J.; Bond, J.R.; Borrill, J.; Bouchet, F.R.; Boulanger, F.; Bowyer, J.W.; Bridges, M.; Bucher, M.; Burigana, C.; Cardoso, J. -F.; Catalano, A.; Chamballu, A.; Chary, R. -R.; Chen, X.; Chiang, L. -Y; Chiang, H.C.; Christensen, P.R.; Church, S.; Clements, D.L.; Colombi, S.; Colombo, L.P.L.; Combet, C.; Couchot, F.; Coulais, A.; Crill, B.P.; Curto, A.; Cuttaia, F.; Danese, L.; Davies, R.D.; Davis, R.J.; de Bernardis, P.; de Rosa, A.; de Zotti, G.; Delabrouille, J.; Delouis, J. -M.; Désert, F. -X.; Dickinson, C.; Diego, J.M.; Dole, H.; Donzelli, S.; Doré, O.; Douspis, M.; Dunkley, J.; Dupac, X.; Efstathiou, G.; Enßlin, T.A.; Eriksen, H.K.; Finelli, F.; Forni, O.; Frailis, M.; Fraisse, A.A.; Franceschi, E.; Galeotta, S.; Ganga, K.; Giard, M.; Giardino, G.; Girard, D.; Giraud-Héraud, Y.; González-Nuevo, J.; Górski, K.M.; Gratton, S.; Gregorio, A.; Gruppuso, A.; Gudmundsson, J.E.; Hansen, F.K.; Hanson, D.; Harrison, D.; Helou, G.; Henrot-Versillé, S.; Herent, O.; Hernández-Monteagudo, C.; Herranz, D.; Hildebrandt, S.R.; Hivon, E.; Hobson, M.; Holmes, W.A.; Hornstrup, A.; Hou, Z.; Hovest, W.; Huffenberger, K.M.; Hurier, G.; Jaffe, T.R.; Jaffe, A.H.; Jones, W.C.; Juvela, M.; Keihänen, E.; Keskitalo, R.; Kisner, T.S.; Kneissl, R.; Knoche, J.; Knox, L.; Kunz, M.; Kurki-Suonio, H.; Lagache, G.; Lamarre, J. -M.; Lasenby, A.; Laureijs, R.J.; Lawrence, C.R.; Jeune, M. Le; Leonardi, R.; Leroy, C.; Lesgourgues, J.; Liguori, M.; Lilje, P.B.; Linden-Vørnle, M.; López-Caniego, M.; Lubin, P.M.; Macías-Pérez, J.F.; MacTavish, C.J.; Maffei, B.; Mandolesi, N.; Maris, M.; Marshall, D.J.; Martin, P.G.; Martínez-González, E.; Masi, S.; Matarrese, S.; Matthai, F.; Mazzotta, P.; McGehee, P.; Meinhold, P.R.; Melchiorri, A.; Mendes, L.; Mennella, A.; Migliaccio, M.; Mitra, S.; Miville-Deschênes, M. -A.; Moneti, A.; Montier, L.; Morgante, G.; Mortlock, D.; Mottet, S.; Munshi, D.; Naselsky, P.; Nati, F.; Natoli, P.; Netterfield, C.B.; Nørgaard-Nielsen, H.U.; North, C.; Noviello, F.; Novikov, D.; Novikov, I.; Orieux, F.; Osborne, S.; Oxborrow, C.A.; Paci, F.; Pagano, L.; Pajot, F.; Paladini, R.; Paoletti, D.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Pietrobon, D.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Poutanen, T.; Pratt, G.W.; Prézeau, G.; Prunet, S.; Puget, J. -L.; Rachen, J.P.; Racine, B.; Reach, W.T.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Riller, T.; Ristorcelli, I.; Rocha, G.; Rosset, C.; Roudier, G.; Rowan-Robinson, M.; Rusholme, B.; Sanselme, L.; Santos, D.; Sauvé, A.; Savini, G.; Shellard, E.P.S.; Spencer, L.D.; Starck, J. -L.; Stolyarov, V.; Stompor, R.; Sudiwala, R.; Sureau, F.; Sutton, D.; Suur-Uski, A. -S.; Sygnet, J. -F.; Tauber, J.A.; Tavagnacco, D.; Techene, S.; Terenzi, L.; Tomasi, M.; Tristram, M.; Tucci, M.; Umana, G.; Valenziano, L.; Valiviita, J.; Van Tent, B.; Vibert, L.; Vielva, P.; Villa, F.; Vittorio, N.; Wade, L.A.; Wandelt, B.D.; White, S.D.M.; Yvon, D.; Zacchei, A.; Zonca, A.

2014-01-01

We describe the processing of the 531 billion raw data samples from the High Frequency Instrument (hereafter HFI), which we performed to produce six temperature maps from the first 473 days of Planck-HFI survey data. These maps provide an accurate rendition of the sky emission at 100, 143, 217, 353, 545, and 857 GHz with an angular resolution ranging from 9.7 to 4.6 arcmin. The detector noise per (effective) beam solid angle is respectively, 10, 6, 12 and 39 microKelvin in HFI four lowest frequency channel (100--353 GHz) and 13 and 14 kJy/sr for the 545 and 857 GHz channels. Using the 143 GHz channel as a reference, these two high frequency channels are intercalibrated within 5% and the 353 GHz relative calibration is at the percent level. The 100 and 217 GHz channels, which together with the 143 GHz channel determine the high-multipole part of the CMB power spectrum (50 < l <2500), are intercalibrated at better than 0.2 %.

Crystallization of a flavodoxin involved in nitrogen fixation in Rhodobacter capsulatus

Energy Technology Data Exchange (ETDEWEB)

Pérez-Dorado, Inmaculada [Grupo de Cristalografía Macromolecular y Biología Estructural, Instituto de Química-Física Rocasolano, CSIC, Serrano 119, 28006 Madrid (Spain); Bortolotti, Ana; Cortez, Néstor [Instituto de Biología Molecular y Celular de Rosario (Universidad Nacional de Rosario y CONICET), Suipacha 531, S2002LRK Rosario (Argentina); Hermoso, Juan A., E-mail: xjuan@iqfr.csic.es [Grupo de Cristalografía Macromolecular y Biología Estructural, Instituto de Química-Física Rocasolano, CSIC, Serrano 119, 28006 Madrid (Spain)

2008-05-01

The flavodoxin NifF from R. capsulatus, a candidate for nitrogenase reduction during nitrogen fixation, has been crystallized using the hanging-drop vapour-diffusion method. Preliminary X-ray data processing at 2.17 Å resolution allowed determination of the crystal system and unit-cell parameters. Flavodoxins are small electron-transfer proteins that contain one molecule of noncovalently bound flavin mononucleotide (FMN). The flavodoxin NifF from the photosynthetic bacterium Rhodobacter capsulatus is reduced by one electron from ferredoxin/flavodoxin:NADP(H) reductase and was postulated to be an electron donor to nitrogenase in vivo. NifF was cloned and overexpressed in Escherichia coli, purified and concentrated for crystallization using the hanging-drop vapour-diffusion method at 291 K. Crystals grew from a mixture of PEG 3350 and PEG 400 at pH 5.5 and belong to the tetragonal space group P4{sub 1}2{sub 1}2, with unit-cell parameters a = b = 66.49, c = 121.32 Å. X-ray data sets have been collected to 2.17 Å resolution.

Crystallization of a flavodoxin involved in nitrogen fixation in Rhodobacter capsulatus

International Nuclear Information System (INIS)

Pérez-Dorado, Inmaculada; Bortolotti, Ana; Cortez, Néstor; Hermoso, Juan A.

2008-01-01

The flavodoxin NifF from R. capsulatus, a candidate for nitrogenase reduction during nitrogen fixation, has been crystallized using the hanging-drop vapour-diffusion method. Preliminary X-ray data processing at 2.17 Å resolution allowed determination of the crystal system and unit-cell parameters. Flavodoxins are small electron-transfer proteins that contain one molecule of noncovalently bound flavin mononucleotide (FMN). The flavodoxin NifF from the photosynthetic bacterium Rhodobacter capsulatus is reduced by one electron from ferredoxin/flavodoxin:NADP(H) reductase and was postulated to be an electron donor to nitrogenase in vivo. NifF was cloned and overexpressed in Escherichia coli, purified and concentrated for crystallization using the hanging-drop vapour-diffusion method at 291 K. Crystals grew from a mixture of PEG 3350 and PEG 400 at pH 5.5 and belong to the tetragonal space group P4 1 2 1 2, with unit-cell parameters a = b = 66.49, c = 121.32 Å. X-ray data sets have been collected to 2.17 Å resolution

Response of foster grapefruit (Citrus paradisi Macf. to organic and inorganic fertilization in central Sudan

Directory of Open Access Journals (Sweden)

Abdalla A.M. Elhassan

2011-06-01

Full Text Available The response of Foster grapefruit (Citrus paradisi Macf. to organic and inorganic fertilization in Sennar area (13°37′N–33°37′E representing central Sudan, was studied for two successive seasons (2003/2004 and 2004/2005. Urea, sheep manure and terra-sorb (as foliar at the rates of 2.17 kg/tree/year, 20 kg/tree/year and 200 ml/100 L water, respectively, and their combinations were applied to 18 years old trees to determine their effects on fruit yield and quality. The layout was a randomized complete block design replicated three times. Results indicated that all treatments significantly increased average yield over control with inconsistent effects on fruit quality parameters. Trees received urea at the rate of 2.17 kg/tree/year, yielded thick peel fruits of reduced vitamin C. Sheep manure at the rate of 20 kg/tree/year resulted in dark green fruits of thick peel. The foliar treated trees at the rate of 200 ml/100 L water gave little thick peel fruits of lower total soluble solids, low % titrable acidity and low vitamin C. The best fruits reflected by color, thinner peel, high % TSS and high vitamin C were obtained from urea + sheep manure treatment. Application of urea with foliar gave green large fruits. Small fruits of intensive green color on surface and low titrable acidity were recorded by combination of sheep manure and foliar. Application of the three fertilizers together gave fruits of dark green color on surface and thick peel. Therefore, application of 2.17 kg urea + 20 kg sheep manure/tree/year is recommended to Foster grapefruit trees in Sennar area and areas of similar environmental conditions.

48 CFR 970.1706-2 - Contract clause.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Contract clause. 970.1706... SUPPLEMENTARY REGULATIONS DOE MANAGEMENT AND OPERATING CONTRACTS Special Contracting Methods 970.1706-2 Contract clause. The contracting officer shall insert the clause at 48 CFR 52.217-9, Option to Extend the Term of...

Erectile dysfunction and type 2 diabetes mellitus in northern Pakistan

International Nuclear Information System (INIS)

Ahmed, I.; Anwar, E.; Ali, S.S.; Ali, A.

2013-01-01

Objective: To determine the frequency of erectile dysfunction in married male Type-2 diabetic patients. Methods: The cross-sectional observational study was carried out at the Endocrinology, Diabetes and Metabolic Diseases Unit Hayatabad Medical Complex, Peshawar, from July 2011 to Apr 2012, comprising 217 male married Type-2 diabetic patients. Serum samples were assayed for blood glucose, lipid profile and glycated haemoglobin A1c. Body mass index and waist-to-hip ratio was calculated. Erectile dysfunction was assessed by Sexual Health Inventory for Men questionnaire. SPSS 18 was used for statistical analysis. Results: A total of 217 patients were initially interviewed. The mean age was 43.1+-8.160 years. The frequency of drectile dysfunction increased with age, duration of patients and increased body mass index. Overall, 6 (2.8%) patients had no erectile dysfunction, 37 (17.1%) had mild, 82 (37.8%) mild to moderate; 47 (21.7%) moderate; and 45 (20.7%) severe. Higher HbA1c levels and atherogenic dyslipidaemia were associated with erectile dysfunction. Conclusion: Poor glycaemic control was associated with increased erectile dysfunction risk. Duration of diabetes, older age, increased body mass index are associated with increased incidence of the condition in patients with diabetes. Intensive lifestyle changes in the beginning can add to the better management of Type-2 diabetes and prevention of erectile dysfunction. (author)

Marketing Strategy Analysis Based On SWOT At PT. Muba Link Business Unit Of Wisma Ranggonang

Directory of Open Access Journals (Sweden)

Desi Ulpa Anggraini

2017-09-01

Full Text Available The purpose of this research was to know and analyze the marketing strategy based on SWOT analysis at PT. Muba Link Business unit Wisma Ranggonang Sekayu district Musi Banyuasin. The population of this research were the leadership and the employees of Wisma Ranggonang. This research was conducted by using descriptive research method with a quantitive approach in the form of quadrant position analysis by using SWOT Matrix analysis and after that it was proceed with the decision of making phase in the form of marketing strategy. The result showed that based on the external/internal Matrix get value of each strength factor for about 1, weakness is 1.25 opportunity worth 1,285 and threat is 1,217. Meanwhile, based on cartesius diagram, the quadrant position of Wisma Ranggonang Sekayu was in the third quadrant supporting the turnaraound strategy, i.e. the company faces a huge market opportunity, but on the other hand it faces some internal conctraints/weakness. The focus of this company’s strategy was to minimize the internal company problems, so as to seize the more market opportunities. So, the initial hypothesis that Wisma Ranggonang Sekayu supports the growth/aggressive strategy was not fulfilled.

48 CFR 552.217-70 - Evaluation of Options.

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Evaluation of Options. 552... Evaluation of Options. As prescribed in 517.208(a), insert the following provision: Evaluation of Options... period price. When option year pricing is based on a formula (e.g., changes in the Producer Price Index...

48 CFR 217.171 - Multiyear contracts for services.

Science.gov (United States)

2010-10-01

... services (e.g., ground maintenance, in-plane refueling, bus transportation, and refuse collection and... installation being closed or realigned under a base closure law as defined in 10 U.S.C. 2667(h)(2); or (C) A... Public Law 105-56 and similar sections in subsequent DoD appropriations acts); or (ii) A cancellation...

JCSC_128_2_217-226_SI_a.doc

Indian Academy of Sciences (India)

All reagents were purchased from TCI and Sigma Aldrich and used without further purification. All the products ... General procedure for the four component synthesis of compounds 13 and 14: A solution of 4-chloro-3-formyl coumarin (1 mmol), morpholine/ thiomorpholine (2 mmol) were refluxed for 2 min in benzene. To this ...

48 CFR 1252.217-76 - Liability and insurance.

Science.gov (United States)

2010-10-01

...) The Contractor shall not make any allowance in the contract price for the inclusion of any premium... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

48 CFR 252.217-7012 - Liability and insurance.

Science.gov (United States)

2010-10-01

...) The Contractor shall not make any allowance in the job order price for the inclusion of any premium... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

48 CFR 1252.217-78 - Discharge of liens.

Science.gov (United States)

2010-10-01

... lien or right in rem of any kind, other than in favor of the Government, that exists or arises in connection with work done or materials furnished under this contract. (b) If any such lien or right in rem is... to be discharged, the lien or right. (End of clause) ...

Dicty_cDB: CHM217 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available .ab1 QG_EFGHJ lettuce serriola Lactuca sativa cDNA clone QGJ1L02, mRNA sequence. 80 6e-11 1 CV164410 |CV164410.1 rsmsx... 3e-09 3 CV172465 |CV172465.1 rsmsxlre_008717.z1.scf cDNA Library of Salvia milti

Electronic structure calculations and optical properties of a new organic-inorganic luminescent perovskite: (C9H19NH3)2PbI2Br2

International Nuclear Information System (INIS)

Abid, H.; Samet, A.; Dammak, T.; Mlayah, A.; Hlil, E.K.; Abid, Y.

2011-01-01

(C 9 H 19 NH 3 ) 2 PbI 2 Br 2 compound is a new crystal belonging to the large hybrid organic-inorganic perovskites compounds family. Optical properties are investigated by optical absorption UV-visible and photoluminescence (PL) techniques. Bands to band absorption peak at 2.44 eV as well as an extremely strong yellow-green photoluminescence emission at 2.17 eV is observed at room temperature. First principle calculations based on the DFT and FLAPW methods combined with LDA approximation are performed as well. Density of state close to the gap is presented and discussed in terms of optical absorption and photoluminescence experimental results. The perfect agreement between experimental data and electronic structure calculations is highlighted. - Highlights: → (C 9 H 19 NH 3 ) 2 PbI 2 Br 2 compound is a new crystal with strong yellow-green PL emission at 2.17 eV. → Calculations based on DFT and FLAPW method combined with LDA approximation are performed. → Gap, optical transitions and exciton presence were predicted from density of states. → Agreement between experimental data and electronic structure calculations.

Electronic structure calculations and optical properties of a new organic-inorganic luminescent perovskite: (C{sub 9}H{sub 19}NH{sub 3}){sub 2}PbI{sub 2}Br{sub 2}

Energy Technology Data Exchange (ETDEWEB)

Abid, H., E-mail: haithamlpa@yahoo.fr [Laboratoire de Physique Appliquee, Faculte des sciences, Universite de Sfax (Tunisia); Institut Neel, CNRS-Universite J. Fourier, BP 166, 38042 Grenoble (France); Samet, A.; Dammak, T. [Laboratoire de Physique Appliquee, Faculte des sciences, Universite de Sfax (Tunisia); Mlayah, A. [Centre d' Elaboration de Materiaux et d' Etudes Structurales (CEMES), CNRS-Universite de Toulouse, 29 rue Jeanne Marvig, 31055 Toulouse (France); Hlil, E.K. [Institut Neel, CNRS-Universite J. Fourier, BP 166, 38042 Grenoble (France); Abid, Y. [Laboratoire de Physique Appliquee, Faculte des sciences, Universite de Sfax (Tunisia)

2011-08-15

(C{sub 9}H{sub 19}NH{sub 3}){sub 2}PbI{sub 2}Br{sub 2} compound is a new crystal belonging to the large hybrid organic-inorganic perovskites compounds family. Optical properties are investigated by optical absorption UV-visible and photoluminescence (PL) techniques. Bands to band absorption peak at 2.44 eV as well as an extremely strong yellow-green photoluminescence emission at 2.17 eV is observed at room temperature. First principle calculations based on the DFT and FLAPW methods combined with LDA approximation are performed as well. Density of state close to the gap is presented and discussed in terms of optical absorption and photoluminescence experimental results. The perfect agreement between experimental data and electronic structure calculations is highlighted. - Highlights: > (C{sub 9}H{sub 19}NH{sub 3}){sub 2}PbI{sub 2}Br{sub 2} compound is a new crystal with strong yellow-green PL emission at 2.17 eV. > Calculations based on DFT and FLAPW method combined with LDA approximation are performed. > Gap, optical transitions and exciton presence were predicted from density of states. > Agreement between experimental data and electronic structure calculations.

Planck early results. XIII. Statistical properties of extragalactic radio sources in the Planck Early Release Compact Source Catalogue

DEFF Research Database (Denmark)

Lähteenmäki, A.; Poutanen, T.; Natoli, P.

2011-01-01

The data reported in Planck's Early Release Compact Source Catalogue (ERCSC) are exploited to measure the number counts (dN/dS) of extragalactic radio sources at 30, 44, 70, 100, 143 and 217 GHz. Due to the full-sky nature of the catalogue, this measurement extends to the rarest and brightest sou...

Dissolved petroleum hydrocarbons along the oil tanker route in the southern Bay of Bengal

Digital Repository Service at National Institute of Oceanography (India)

Topgi, R; Noronha, R; Fondekar, S.P.; SenGupta, R

Concentrations of dissolved petroleum hydrocarbons during 3 cruises (Nos. 51, 66 and 68) of R V Gaveshani, along the oil tanker route, in the southern Bay of Bengal at 0, 10 and 20 m were 19.95 + or - 3.38, 16.78 + or - 2.53 and 13.45 + or - 2.17 mu...

40 CFR 413.24 - Pretreatment standards for existing sources.

Science.gov (United States)

2010-07-01

... management plan approved by the control authority. (Secs. 301, 304, 306, 307, 308, and 501 of the Clean Water...) EFFLUENT GUIDELINES AND STANDARDS ELECTROPLATING POINT SOURCE CATEGORY Electroplating of Precious Metals... by the Clean Water Act of 1977, Pub. L. 95-217)) [46 FR 9467, Jan. 28, 1981, as amended at 48 FR...

26 CFR 1.163-4 - Deduction for original issue discount on certain obligations issued after May 27, 1969.

Science.gov (United States)

2010-04-01

... be includible in the gross income of such taxpayer for such taxable year. (b) Examples. The rules in... Board of Governors of the Federal Reserve. See 12 CFR § 217.4(d). The stated redemption price at... any amount of original issue discount deducted prior to repurchase, or minus any amount of premium...

Reliability Information Analysis Center 1st Quarter 2007, Technical Area Task (TAT) Report

Science.gov (United States)

2007-02-05

Library or [twField/Test 217Plus Ally w/ a.romtu DAAData Experience Data Need t( rdito Trqnd • s aa(Model) develol analisis Mappng & ANLED217Plu...of collected reliability data and have discovered that even with sparse data, analysis of the data shows clustering of reliability data by equipment...intended search target. Conceptually cluster discovered data to allow more detailed analysis by equipment type. For example, it may be useful to

Několik poznámek k problematice ochrany duševního vlastnictví

Czech Academy of Sciences Publication Activity Database

Krejčí, Jindřich

2011-01-01

Roč. 5, č. 2 (2011), s. 217-219 ISSN 1802-8152 R&D Projects: GA MŠk LM2010006 Institutional research plan: CEZ:AV0Z70280505 Keywords : social science databases * intellectual property rights * open access Subject RIV: AO - Sociology, Demography http://dav.soc.cas.cz/uploads/9aded5ef84867217588bfc788d640e8a3b0e50d2_DaVp217-219%20Krejci.pdf

(3He,α) reaction mechanism at high energy and neutron inner shell structure

International Nuclear Information System (INIS)

Wiele, J. van de.

1980-01-01

The ( 3 He,α) reaction on 12 C, 16 O, 28 Si, 58 Ni, 90 Zr, 118 Sn, 124 Sn and 208 Pb targets has been studied at Esub( 3 He) = 217 MeV (or 205 MeV) in order to investigate the reaction mechanism at high energy and large momentum transfer. The reaction yields large cross sections at very forward angles and strongly enhances the largest orbital momentum transfer. The angular distribution shapes are well reproduced in the frame-work of the Z-R- D.W.B.A. analysis if we use a unique empirical α-potential: Vsub(α)(Esub(α)) = Vsub( 3 He)(3/4 Esub(α)) + Vsub(n)(1/4 Esub(α)). The excitation energy spectra have been measured up to 100 MeV in the residual light and medium nuclei and up to about 16 MeV in heavy nuclei. In addition to the well-known low-lying levels, peaks or broad structures are observed for each nucleus at higher excitation energies. They are attributed to pick up from inner shells: 1s( 11 C and 15 O), 1p( 27 Si), 1d5/2 + 1p( 57 Ni), 1f7/2( 89 Zr) 1g9/2 117 Sn, 123 Sn and 1h11/2( 207 Pb). Selectivity and localization of direct and indirect pick up ( 3 He,α) reactions were studied. Finite range calculations show that this reaction is not very sensitive to the details of the range from function but only to D 0 coefficient and range R. A microscopic α-nucleus optical potential calculated with n-n dependent and independent density forces is able to reproduce both elastic scattering and pick up reaction angular distributions [fr

Genetic and non-genetic factors affecting body weight in Tellicherry ...

African Journals Online (AJOL)

VCRI_AN_GENETICS

Abstract. Data on 566 Tellicherry goats, recorded between 1988 and 2007 were used to study the effect of non- genetic factors on body weight and daily gain from birth to 12 months of age. The least-squares means for body weight at birth and at 12 months of age were 2.17 ± 0.03 and 18.78 ± 0.44 kg, respectively. The pre-.

Sequencing analysis of mutations induced by N-ethyl-N-nitrosourea at different sampling times in mouse bone marrow.

Science.gov (United States)

Wang, Jianyong; Chen, Tao

2010-03-01

In our previous study (Wang et al., 2004, Toxicol. Sci. 82: 124-128), we observed that the cII gene mutant frequency (MF) in the bone marrow of Big Blue mice showed significant increase as early as day 1, reached the maximum at day 3 and then decreased to a plateau by day 15 after a single dose of carcinogen N-ethyl-N-nitrosourea (ENU) treatment, which is different from the longer mutation manifestation time and the constancy of MFs after reaching their maximum in some other tissues. To determine the mechanism underlying the quick increase in MF and the peak formation in the mutant manifestation, we examined the mutation frequencies and spectra of the ENU-induced mutants collected from different sampling times in this study. The cII mutants from days 1, 3 and 120 after ENU treatment were randomly selected from different animals. The mutation frequencies were 33, 217, 305 and 144 x 10(-6) for control, days 1, 3, and 120, respectively. The mutation spectra at days 1 and 3 were significantly different from that at day 120. Considering that stem cells are responsible for the ultimate MF plateau (day 120) and transit cells are accountable for the earlier MF induction (days 1 or 3) in mouse bone marrow, we conclude that transit cells are much more sensitive to mutation induction than stem cells in mouse bone marrow, which resulted in the specific mutation manifestation induced by ENU.

Investigation of spectral interferences in the determination of lead in fertilizers and limestone samples using high-resolution continuum source graphite furnace atomic absorption spectrometry

Energy Technology Data Exchange (ETDEWEB)

Borges, Aline R. [Instituto de Química, Universidade Federal do Rio Grande do Sul, Av. Bento Gonçalves 9500, 91501-970 Porto Alegre, RS (Brazil); Instituto Nacional de Ciência e Tecnologia do CNPq — INCT de Energia e Ambiente, Universidade Federal da Bahia, Salvador, BA (Brazil); Becker, Emilene M.; François, Luciane L.; Jesus, Alexandre de [Instituto de Química, Universidade Federal do Rio Grande do Sul, Av. Bento Gonçalves 9500, 91501-970 Porto Alegre, RS (Brazil); Vale, Maria Goreti R. [Instituto de Química, Universidade Federal do Rio Grande do Sul, Av. Bento Gonçalves 9500, 91501-970 Porto Alegre, RS (Brazil); Instituto Nacional de Ciência e Tecnologia do CNPq — INCT de Energia e Ambiente, Universidade Federal da Bahia, Salvador, BA (Brazil); Welz, Bernhard [Instituto Nacional de Ciência e Tecnologia do CNPq — INCT de Energia e Ambiente, Universidade Federal da Bahia, Salvador, BA (Brazil); Departamento de Química, Universidade Federal de Santa Catarina, 88040-900 Florianópolis, SC (Brazil); Dessuy, Morgana B., E-mail: mbdessuy@ufrgs.br [Instituto de Química, Universidade Federal do Rio Grande do Sul, Av. Bento Gonçalves 9500, 91501-970 Porto Alegre, RS (Brazil); Andrade, Jailson B. de [Instituto Nacional de Ciência e Tecnologia do CNPq — INCT de Energia e Ambiente, Universidade Federal da Bahia, Salvador, BA (Brazil)

2014-11-01

In the present work, spectral interferences on the determination of lead in fertilizer and limestone samples were investigated using high-resolution continuum source graphite furnace atomic absorption spectrometry at the main analytical lines: 217.001 and 283.306 nm. For these investigations, samples were introduced into the furnace as slurry together with a mixture of Pd and Mg as chemical modifier. Spectral interferences were observed for some samples at both analytical lines. In order to verify whether a wet digestion procedure would avoid these interferences, a reference method for wet digestion of fertilizers was employed as an alternative sample preparation procedure. However, the same interferences were also observed in the digested samples. In order to identify and eliminate the fine-structured background using a least-squares background correction, reference spectra were generated using the combination of different species. The use of the latter technique allowed the elimination of spectral interferences for most of the investigated samples, making possible the determination of lead in fertilizer and limestone samples free of interferences. The best results were found using a reference spectrum of NH{sub 4}H{sub 2}PO{sub 4} at 217.001 nm, and a mixture of H{sub 2}SO{sub 4} + Ca and HNO{sub 3} + Ca at the 283.306 nm line. The accuracy of the method was evaluated using a certified reference material “Trace Elements in Multi-Nutrient Fertilizer”. Similar results were obtained using line source graphite furnace atomic absorption spectrometry with Zeeman-effect background correction, indicating that the latter technique was also capable to correct the spectral interferences, at least in part. - Highlights: • Spectral interferences on the determination of lead in fertilizers and limestone. • The analytical lines at 217.001 nm and 283.306 nm using HR-CS GF AAS. • Various combinations of compounds were used to create reference spectra. • LSBC

Differential cross sections for reactions of π+n → K+Ε0 and π+n → K+Λ and ratio of differential cross sections of π+A → K+Y+A' quasi-binary processes for carbon and deuterium nuclei at 10.3 GeV/c

International Nuclear Information System (INIS)

Bitsadze, G.S.; Budagov, Yu.A.; Dzhelepov, V.P.

1986-01-01

The results of the study of π + n → K + Σ 0 and π + n → K + Λ reactions at 10.3 GeB/c are presented. The measurements were carried out at missing mass spectrometer HYPERON at IHEP accelerator. The differential cross sections in 0 ≤ t-t min 2 momentum transfer range are measured. The integral cross sections in the studied t-interval are (11.8±1.1)μb and (21.7±2.2)μb for reactions π + n → K + Σ 0 and π + n → K + Λ, respectively. The obtained results were compared with the predictions of quasi-eikonal model and with other experimental data. The ratio A eff (t) of differential cross sections for π + A → K + Y+A' reactions on carbon and deuterium nuclei are measured. The A cff (t) tend to grow with increasing t in agreement with the predictions of QCD-based model

Comparison of chloroquine with artesunate in the treatment of cerebral malaria in Ghanaian children

DEFF Research Database (Denmark)

Goka, B Q; Adabayeri, V; Ofori-Adjei, E

2001-01-01

and neurological deficits were documented. There was no difference in mortality rates (chloroquine, 16.7 per cent; artesunate, 21.7 per cent; p = 0.6), neurological deficit at day 14 (chloroquine, 0 per cent; artesunate, 4.3 per cent; p = 0.3), resolution of fever (p = 0.55), and coma recovery time (p = 0...

Planck 2015 results. VII. HFI TOI and beam processing

CERN Document Server

Adam, R.; Aghanim, N.; Arnaud, M.; Ashdown, M.; Aumont, J.; Baccigalupi, C.; Banday, A.J.; Barreiro, R.B.; Bartolo, N.; Battaner, E.; Benabed, K.; Benoît, A.; Benoit-Lévy, A.; Bernard, J.-P.; Bersanelli, M.; Bertincourt, B.; Bielewicz, P.; Bock, J.J.; Bonavera, L.; Bond, J.R.; Borrill, J.; Bouchet, F.R.; Boulanger, F.; Bucher, M.; Burigana, C.; Calabrese, E.; Cardoso, J.-F.; Catalano, A.; Challinor, A.; Chamballu, A.; Chary, R.-R.; Chiang, H.C.; Christensen, P.R.; Clements, D.L.; Colombi, S.; Colombo, L.P.L.; Combet, C.; Couchot, F.; Coulais, A.; Crill, B.P.; Curto, A.; Cuttaia, F.; Danese, L.; Davies, R.D.; Davis, R.J.; de Bernardis, P.; de Rosa, A.; de Zotti, G.; Delabrouille, J.; Delouis, J.-M.; Désert, F.-X.; Diego, J.M.; Dole, H.; Donzelli, S.; Doré, O.; Douspis, M.; Ducout, A.; Dupac, X.; Efstathiou, G.; Elsner, F.; Enßlin, T.A.; Eriksen, H.K.; Falgarone, E.; Fergusson, J.; Finelli, F.; Forni, O.; Frailis, M.; Fraisse, A.A.; Franceschi, E.; Frejsel, A.; Galeotta, S.; Galli, S.; Ganga, K.; Ghosh, T.; Giard, M.; Giraud-Héraud, Y.; Gjerløw, E.; González-Nuevo, J.; Górski, K.M.; Gratton, S.; Gruppuso, A.; Gudmundsson, J.E.; Hansen, F.K.; Hanson, D.; Harrison, D.L.; Henrot-Versillé, S.; Herranz, D.; Hildebrandt, S.R.; Hivon, E.; Hobson, M.; Holmes, W.A.; Hornstrup, A.; Hovest, W.; Huffenberger, K.M.; Hurier, G.; Jaffe, A.H.; Jaffe, T.R.; Jones, W.C.; Juvela, M.; Keihänen, E.; Keskitalo, R.; Kisner, T.S.; Kneissl, R.; Knoche, J.; Kunz, M.; Kurki-Suonio, H.; Lagache, G.; Lamarre, J.-M.; Lasenby, A.; Lattanzi, M.; Lawrence, C.R.; Le Jeune, M.; Leahy, J.P.; Lellouch, E.; Leonardi, R.; Lesgourgues, J.; Levrier, F.; Liguori, M.; Lilje, P.B.; Linden-Vørnle, M.; López-Caniego, M.; Lubin, P.M.; Macías-Pérez, J.F.; Maggio, G.; Maino, D.; Mandolesi, N.; Mangilli, A.; Maris, M.; Martin, P.G.; Martínez-González, E.; Masi, S.; Matarrese, S.; McGehee, P.; Melchiorri, A.; Mendes, L.; Mennella, A.; Migliaccio, M.; Mitra, S.; Miville-Deschênes, M.-A.; Moneti, A.; Montier, L.; Moreno, R.; Morgante, G.; Mortlock, D.; Moss, A.; Mottet, S.; Munshi, D.; Murphy, J.A.; Naselsky, P.; Nati, F.; Natoli, P.; Netterfield, C.B.; Nørgaard-Nielsen, H.U.; Noviello, F.; Novikov, D.; Novikov, I.; Oxborrow, C.A.; Paci, F.; Pagano, L.; Pajot, F.; Paoletti, D.; Pasian, F.; Patanchon, G.; Pearson, T.J.; Perdereau, O.; Perotto, L.; Perrotta, F.; Pettorino, V.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Pietrobon, D.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Pratt, G.W.; Prézeau, G.; Prunet, S.; Puget, J.-L.; Rachen, J.P.; Reinecke, M.; Remazeilles, M.; Renault, C.; Renzi, A.; Ristorcelli, I.; Rocha, G.; Rosset, C.; Rossetti, M.; Roudier, G.; Rowan-Robinson, M.; Rusholme, B.; Sandri, M.; Santos, D.; Sauvé, A.; Savelainen, M.; Savini, G.; Scott, D.; Seiffert, M.D.; Shellard, E.P.S.; Spencer, L.D.; Stolyarov, V.; Stompor, R.; Sudiwala, R.; Sutton, D.; Suur-Uski, A.-S.; Sygnet, J.-F.; Tauber, J.A.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tucci, M.; Tuovinen, J.; Valenziano, L.; Valiviita, J.; Van Tent, B.; Vibert, L.; Vielva, P.; Villa, F.; Wade, L.A.; Wandelt, B.D.; Watson, R.; Wehus, I.K.; Yvon, D.; Zacchei, A.

2016-01-01

The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the detector and pointing samples must be processed and the angular response must be assessed. The full mission TOI is included in the Planck 2015 release. This paper describes the HFI TOI and beam processing for the 2015 release. HFI calibration and map-making are described in a companion paper. The main pipeline has been modified since the last release (2013 nominal mission in intensity only), by including a correction for the non-linearity of the warm readout and by improving the model of the bolometer time response. The beam processing is an essential tool that derives the angular response used in all the Planck science papers and we report an improvement in the effective beam window function uncertainty of more than a...

VizieR Online Data Catalog: JHK lightcurves of red giants in the SMC (Takayama+, 2015)

Science.gov (United States)

Takayama, M.; Wood, P. R.; Ita, Y.

2017-11-01

This is JHK light curves of 7 oxygen rich stars and 14 carbon stars which show the variability of prominent long secondary periods (LSPs). Those stars are cross-identified with OGLE LSP variables in the Small Magellanic Cloud (Soszynski et al. 2011, J/AcA/61/217). A long-term multiband near-IR photometric survey for variable stars in the Large and Small Magellanic Clouds has been carried out at the South African Astronomical Observatory at Sutherland (Ita et al., in preparation). The SIRIUS camera attached to the IRSF 1.4 m telescope was used for this survey and more than 10 yr of observations in the near-IR bands J(1.25 μm), H(1.63 μm) and KS(2.14 μm) band were obtained. In this work, we select the SMC stars from the SIRIUS data base. We obtained the V- and I-band time series of SMC red giants from the OGLE project (Soszynski et al. 2011, J/AcA/61/217). (2 data files).

Environmental Impact Analysis Process. Final Environmental Impact Statement Supersonic Flight Operations in the Valentine Military Operations Area

Science.gov (United States)

1983-11-04

Federal Activities, U.S. Environmental Protection Agency, Washington, D.C. Sincerely yours,, PD k Whittington , P.E Regional Administrator Enclosure I I I I...many of the residents are deprived , disadvantaged; uninformed and part of a minority); nor is anyone certain the AF will make full restitUtion in light...only wash 217 our home away but would deprive to us of water for the pipelines that supply 217 water over the whole ranch. This reservoir has been here

Physical Activity

DEFF Research Database (Denmark)

Andersen, Lars Bo; Anderssen, Sigmund Alfred; Wisløff, Ulrik

2014-01-01

Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers.......Andersen LB, Anderssen SA, Wisløff U, Hellénius M-L, Fogelholm M, Ekelund U. (Expert Group) Nordic Nutrition Recommendations 2012. Integrating nutrition and physical activity. Chapter: Physical Activity p. 195-217.Nordic Counsil of Ministers....

Thermoelectric materials evaluation program. Quarterly technical task report No. 46

International Nuclear Information System (INIS)

Hampl, E.F. Jr.

1976-02-01

This forty-sixth Technical Task Report prepared under contract E(11-1)-2331 with the U.S. AEC and U.S. ERDA covers the performance period from October 1, 1975, to December 31, 1975. Highlights include the following tasks: N-type material development (material synthesis--gadolinium selenide compositions; material analyses; material processing; element contacting; ingradient compatibility and life testing; mechanical property characterization), TPM-217 P-type characterization (material preparation and analyses; element contacting; thermodynamic stability; isothermal chemical compatibility; ingradient compatibility and ingradient life testing; performance mapping of contacted and noncontacted elements; high-temperature partitioned P-legs), couple development (design and development of TPM-217/gadolinium selenide rare earth chalcogenide couple; design and development of TPM-217/3N-PbTe couples; advanced generator concepts), module development, liaison with Jet Propulsion Laboratory and material supply, liaison with GGA, and program management. 24 figures, 27 tables

[Effects of different NO3--N/NH4+-N ratios on cucumber seedlings growth, nitrogen absorption and metabolism under suboptimal temperature and light intensity].

Science.gov (United States)

Zhang, Xiao Cui; Liu, Yu Mei; Bai, Long Qiang; He, Chao Xing; Yu, Xian Chang; Li, Yan Su

2016-08-01

Cucumber (cv. Zhongnong 26) was used as material, the effects of NO 3 - -N/NH 4 + -N ratios on growth and physiological characteristics of cucumber seedlings under suboptimal temperature and light intensity (18 ℃/10 ℃,180 ± 20 μmol·m -2 ·s -1 ) were studied. Total nitrogen in the nutrient solution was equal and three NO 3 - -N/NH 4 + -N ratios, 26:2, 21:7 and 14:14, were applied as treatments. The results showed that cucumber treated by NO 3 - -N/NH 4 + -N=21:7 had the longest total root length, the biggest root volume and root surface area, and the maximum number of root tips. H + -ATPase activity and relative expression of genes encoding nitrate transporter (NRT) and ammonium transporter (AMT) in cucumber roots were increased significantly by the treatment of NO 3 - -N/NH 4 + -N=21:7. In addition, nitrate reductase (NR), glutamine synthetase (GS) and glutamate synthase (GOGAT) in cucumber leaves under the treatment of NO 3 - -N/NH 4 + -N=21:7 were higher. As a result, the nitrogen content and biomass of cucumber were significantly increased. Compared with the plants under the treatment of NO 3 - -N/NH 4 + -N=26:2 or 14:14, cucumber seedlings under the treatment of NO 3 - -N/NH 4 + -N=21:7 had the highest biomass and total dry mass (DM) which were increased by 14.0% and 19.3% respectively under suboptimal temperature and light intensity. In conclusion, under suboptimal environmental conditions, NO 3 - -N/NH 4 + -N ratio could be adjusted to increase nitrogen absorption and metabolism of cucumber and alleviate the de-trimental effects caused by suboptimal conditions and promoted the cucumber growth.

Slightly increased BMI at young age is a risk factor for future hypertension in Japanese men.

Directory of Open Access Journals (Sweden)

Yuki Someya

Full Text Available Hypertension is developed easily in Asian adults with normal body mass index (BMI (~23 kg/m2, compared with other ethnicities with similar BMI. This study tested the hypothesis that slightly increased BMI at young age is a risk factor for future hypertension in Japanese men by historical cohort study.The study participants were 636 male alumni of the physical education school. They had available data on their physical examination at college age and follow-up investigation between 2007 and 2011. The participants were categorized into six categories: BMI at college age of <20.0 kg/m2, 20.0-21.0kg/m2, 21.0-22.0kg/m2, 22.0-23.0kg/m2, 23.0-24.0kg/m2, and ≥24.0kg/m2, and the incidence of hypertension was compared.This study covered 27-year follow-up period (interquartile range: IQR: 23-31 which included 17,059 person-years of observation. Subjects were 22 (22-22 years old at graduated college, and 49 (45-53 years old at first follow-up investigation. During the period, 120 men developed hypertension. The prevalence rates of hypertension for lowest to highest BMI categories were 9.4%, 14.6%, 16.1%, 17.5%, 30.3%, and 29.3%, respectively (p<0.001 for trend, and their hazard ratios were 1.00 (reference, 1.80 (95%CI: 0.65-4.94, 2.17 (0.83-5.64, 2.29 (0.89-5.92, 3.60 (1.37-9.47 and 4.72 (1.78-12.48, respectively (p<0.001 for trend. This trend was similar after adjustment for age, year of graduation, smoking, current exercise status and current dietary intake.Slightly increased BMI at young age is a risk factor for future hypertension in Japanese men.

Temporal variability of exchange between groundwater and surface water based on high-frequency direct measurements of seepage at the sediment-water interface

Science.gov (United States)

Rosenberry, Donald O.; Sheibley, Rich W.; Cox, Stephen E.; Simonds, Frederic W.; Naftz, David L.

2013-01-01

Seepage at the sediment-water interface in several lakes, a large river, and an estuary exhibits substantial temporal variability when measured with temporal resolution of 1 min or less. Already substantial seepage rates changed by 7% and 16% in response to relatively small rain events at two lakes in the northeastern USA, but did not change in response to two larger rain events at a lake in Minnesota. However, seepage at that same Minnesota lake changed by 10% each day in response to withdrawals from evapotranspiration. Seepage increased by more than an order of magnitude when a seiche occurred in the Great Salt Lake, Utah. Near the head of a fjord in Puget Sound, Washington, seepage in the intertidal zone varied greatly from −115 to +217 cm d−1 in response to advancing and retreating tides when the time-averaged seepage was upward at +43 cm d−1. At all locations, seepage variability increased by one to several orders of magnitude in response to wind and associated waves. Net seepage remained unchanged by wind unless wind also induced a lake seiche. These examples from sites distributed across a broad geographic region indicate that temporal variability in seepage in response to common hydrological events is much larger than previously realized. At most locations, seepage responded within minutes to changes in surface-water stage and within minutes to hours to groundwater recharge associated with rainfall. Likely implications of this dynamism include effects on water residence time, geochemical transformations, and ecological conditions at and near the sediment-water interface.

The relationship between health risks and health and productivity costs among employees at Pepsi Bottling Group.

Science.gov (United States)

Henke, Rachel M; Carls, Ginger S; Short, Meghan E; Pei, Xiaofei; Wang, Shaohung; Moley, Susan; Sullivan, Mark; Goetzel, Ron Z

2010-05-01

To evaluate relationships between modifiable health risks and costs and measure potential cost savings from risk reduction programs. Health risk information from active Pepsi Bottling Group employees who completed health risk assessments between 2004 and 2006 (N = 11,217) were linked to medical care, workers' compensation, and short-term disability cost data. Ten health risks were examined. Multivariate analyses were performed to estimate costs associated with having high risk, holding demographics, and other risks constant. Potential savings from risk reduction were estimated. High risk for weight, blood pressure, glucose, and cholesterol had the greatest impact on total costs. A one-percentage point annual reduction in the health risks assessed would yield annual per capita savings of $83.02 to $103.39. Targeted programs that address modifiable health risks are expected to produce substantial cost reductions in multiple benefit categories.

From COBRA to the Seine, August 1944: A Microcosm of the Operational Art

Science.gov (United States)

1986-05-09

while Patto , c,,rducted operational maneuvers in the German rear. Hill 217 was decisive t erra i r. The 2nd SS Piz Div reached almost to St.Hilaire by...with Eberbach as a r-eplacement for- vonr Funick. But the combined effects oif TOTALIZE, stiffening pressure at lortamii aria Patto -n’ 5 cuit north

50 CFR 14.22 - Certain antique articles.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 1 2010-10-01 2010-10-01 false Certain antique articles. 14.22 Section 14....22 Certain antique articles. Any person may import at any Customs Service port designated for such purpose, any article (other than scrimshaw, defined in 16 U.S.C 1539(f)(1)(B) and 50 CFR 217.12 as any art...

76 FR 82031 - Public Notice for Waiver of Aeronautical Land-use Assurance; DuPage Airport, West Chicago, IL

Science.gov (United States)

2011-12-29

... retained by the DAA. Parcel A includes portions of Parcels 209A (SOUTH OF THE Union Pacific Railroad, 231 (south of the Union Pacific Railroad) and all of Parcels 217, 218, 219, 220, 221, 314 and 315 as per the... AT THE FOUND CAST IRON MONUMENT MARKING THE WEST QUARTER CORNER OF SAID SECTION 18, PER DOCUMENT NO...

Hydrocarbon Synthesis from Carbon Dioxide and Hydrogen: A Two-Step Process

Science.gov (United States)

2013-08-14

gases, where flows were set by mass flow controllers (Sierra Instruments) at 100 sccm (25 sccm CO2, 75 sccm H2) with 10 sccm of nitrogen as an internal ...77, 315-323. (42) Vít, Z.; Šolcová, O. Microporous Mesoporous Mater. 2006, 96, 197-204. (43) Nicolaides, C. P. Appl. Catal., A 1999, 185, 211-217

The Effects of Gender and Loneliness Levels on Ways of Coping among University Students

Science.gov (United States)

Cecen, A. Rezan

2008-01-01

The purpose of this study is to determine the effects of gender differences and levels of loneliness on ways of coping. The sample of the study is composed of 462 university students (245 male, 217 female) from different departments from the Education Faculty at Cukurova University. In this study to collect data related to loneliness as an…

Further genetic localization of the transforming sequences of the p21 v-ras gene of Harvey murine sarcoma virus

DEFF Research Database (Denmark)

Willumsen, B M; Ellis, R W; Scolnick, E M

1984-01-01

, DNA sequence analysis has found a single open reading frame large enough to encode the viral p21 (R. Dhar, R. W. Ellis, T. Y. Shih, S. Oroszlan, B. Shapiro, J. Maizel, D. Lowy, and E. M. Scolnick, Science 217:934-937, 1982). There are three potential in-frame ATG initiation codons at the 5' end...

76 FR 36849 - Adjustment of Civil Money Penalty Amount for Inflation

Science.gov (United States)

2011-06-22

..., telephone number 202-402-7687 (this is not a toll-free number). Hearing- or speech- impaired individuals may access this number via TTY by calling the toll-free Federal Relay Service at 800-877-8339. SUPPLEMENTARY.../special.requests/cpi/cpiai.txt . For June 2010 and June 1996, the CPI-U values are 217.965 and 156.7...

Production and identification of new, neutron-rich nuclei in the 208Pb region

International Nuclear Information System (INIS)

Rykaczewski, K.; Kurpeta, J.; Plochocki, A.; Karny, M.; Szerypo, J.; Evensen, A.-H.; Kugler, E.; Lettry, J.; Ravn, H.; Duppen, P. van; Andreyev, A.; Huyse, M.; Woehr, A.; Jokinen, A.; Aeystoe, J.; Nieminen, A.; Huhta, M.; Ramdhane, M.; Walter, G.; Hoff, P.

1998-01-01

The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic 208 Pb are briefly described. An identification of new neutron-rich isotopes 215 Pb and 217 Bi, and new decay properties of 216 Bi studied by means of a pulsed release element selective technique at PS Booster-ISOLDE are reported

Traumatic hyphaema in Ilorin, Nigeria: implications for designing ...

African Journals Online (AJOL)

Log in or Register to get access to full text downloads. ... included children while at play 6 (26%), children while being disciplined by adults 5 (21.7%), ... The implications of these in fashioning relevant health education messages are explored. ... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's ...

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available 8 PDGLRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHISITGHTDTTAYSSD 217 ... PDG...LRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHISITGHTDTTAYSSD Sbjct: 1 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVDILRELSSFINQVPNHIS

Colorectal cancer screening: results of a 5-year program in asymptomatic subjects at increased risk.

Science.gov (United States)

Pezzoli, A; Matarese, V; Rubini, M; Simoni, M; Caravelli, G C; Stockbrugger, R; Cifalà, V; Boccia, S; Feo, C; Simone, L; Trevisani, L; Liboni, A; Gullini, S

2007-01-01

The province of Ferrara has one of the highest incidences of colorectal cancer (CRC) in Italy. In January 2000, we set up a colonoscopy screening program focussing on first-degree relatives of CRC patients. We now report the results 5 years after the beginning of the project. SCREENEES AND METHODS: In October 1999, we started a campaign stressing the usefulness of colonoscopy for the first-degree relatives of CRC patients. Subjects included in the screening program were aged between 45 and 75 years with at least one first-degree relative affected by CRC. They were invited to an interview where a physician suggested colonoscopy as a screening option. In 5 years, 776 subjects were interviewed and 733 (94.4%) agreed to an endoscopic examination (M/F:375/401; mean age 55 years): 562 colonoscopies were performed. Adenomas and cancers were found in 122 (21.7%) and 12 (2.1%) subjects, respectively. Histological examination in 181 persons with lesions (32.8%) showed (most serious lesion quoted) 47 hyperplastic polyps (26% of all lesions), 2 serrated adenomas (1.1%), 68 tubular adenomas (48%), 24 tubulovillous adenomas (13.3%), 9 adenomas with high grade dysplasia (5%) and 12 adenocarcinomas (6.6%). The majority of the cancers were at an early stage (8 Dukes A and 3 Dukes B). Sedation was used in only 42 colonoscopies (7.5%). A colonoscopy-based screening in this selected high-risk population is feasible. Even without sedation subjects readily agreed to the endoscopic procedure. We identified a significant number of advanced neoplasms and cancers at an early stage suggesting that this could be a useful tool in early identification of CRC.

Thermal stability and temperature coefficients of four rare-earth-cobalt matrix magnets heated in dry air

Science.gov (United States)

Strnat, R. M. W.; Liu, S.; Strnat, K. J.

1982-03-01

Flux-loss characteristics during long-term air aging of four rare-earth-cobalt matrix magnet types were measured. Irreversible losses and reversible temperature coefficients on heating above room temperature are reported. Purely magnetic and permanent microstructure-related changes during aging were differentiated by measuring hysteresis curves before and after long-term exposure. Three commercial polymer-bonded magnets using different rare-earth-cobalt-transition metal alloys and a solder-matrix magnet with Sm(Co, Cu, Fe, Zr)7.4 were studied. They were cycled between 25 °C and maximum temperatures to 150 °C (25 ° intervals) as applicable. Aging data at 50 and 125 °C for an exposure time of 3300 h are reported. The 2-17 samples have a stability far superior to bonded 1-5. The soft metal binder imparts significantly better aging behavior on precipitation-hardened 2-17 magnet alloys above 100 °C than an epoxy resin matrix.

Associations between spondyloarthritis features and magnetic resonance imaging findings

DEFF Research Database (Denmark)

Arnbak, Bodil; Jurik, Anne Grethe; Hørslev-Petersen, Kim

2016-01-01

were 1) to estimate the prevalence of magnetic resonance imaging (MRI) findings and clinical features included in the ASAS criteria for SpA and 2) to explore the associations between MRI findings and clinical features. METHODS: We included patients ages 18-40 years with persistent low back pain who had...... been referred to the Spine Centre of Southern Denmark. We collected information on clinical features (including HLA-B27 and high-sensitivity C-reactive protein) and MRI findings in the spine and sacroiliac (SI) joints. RESULTS: Of 1,020 included patients, 537 (53%) had at least 1 of the clinical...... according to the ASAS definition was present in 217 patients (21%). Of those 217 patients, 91 (42%) had the minimum amount of bone marrow edema required according to the ASAS definition (a low bone marrow edema score). The presence of HLA-B27, peripheral arthritis, a good response to NSAIDs, and preceding...

Examining the physical health and lifestyle of young people at ultra-high risk for psychosis: A qualitative study involving service users, parents and clinicians.

Science.gov (United States)

Carney, Rebekah; Cotter, Jack; Bradshaw, Tim; Yung, Alison R

2017-09-01

Emerging evidence suggests young people at ultra-high risk for psychosis (UHR) are also at-risk for poor physical health, and display high rates of modifiable cardiometabolic risk factors. However, before we can develop effective interventions there is a need to understand factors affecting lifestyle choices in the UHR group. We conducted semi-structured qualitative interviews with 20 UHR individuals (50% male; mean age 21.7), 5 parents (4 mothers, 1 father), and 6 clinicians from early intervention services in the Northwest of England to identify barriers and facilitators to living a healthy lifestyle, including achieving regular exercise, eating well and refraining from excessive substance use. Thematic analysis revealed the main barriers to living a healthy lifestyle related to psychiatric symptoms, beliefs about self, social withdrawal and practical considerations such as accessibility and cost. Provision of social support and promoting autonomy emerged as the two main themes which would facilitate a healthy lifestyle. Promoting physical health in people with emerging symptoms of psychosis is an important, yet neglected area of mental health practice and warrants further investigation. UHR individuals experience numerous barriers to living a healthy lifestyle, and interventions should focus primarily on targeting autonomous motivation and providing social support to facilitate this change. Copyright © 2017. Published by Elsevier B.V.

Cell proliferation on UV-excimer lamp modified and grafted polytetrafluoroethylene

Czech Academy of Sciences Publication Activity Database

Švorčík, V.; Ročková, K.; Ratajová, E.; Heitz, J.; Huber, N.; Bäuerle, D.; Bačáková, Lucie; Dvořánková, B.; Hnatowicz, Vladimír

2004-01-01

Roč. 217, č. 2 (2004), s. 307-313 ISSN 0168-583X R&D Projects: GA AV ČR IAA5011301; GA ČR GA106/03/0514 Grant - others:CZ-AT(CZ) Aktion 2002-7 Institutional research plan: CEZ:AV0Z5011922 Keywords : polytetrafluoroethylene * UV-beam modification * grafting Subject RIV: EI - Biotechnology ; Bionics Impact factor: 0.997, year: 2004

Production and identification of new, neutron-rich nuclei in the {sup 208}Pb region

Energy Technology Data Exchange (ETDEWEB)

Rykaczewski, K. [Oak Ridge National Lab., TN (United States). Physics Div.]|[ISOLDE-CERN, Geneva (Switzerland)]|[Univ. of Warsaw (Poland); Kurpeta, J.; Plochocki, A. [Univ. of Warsaw (Poland)] [and others

1998-11-01

The recently developed methods allowing the experimental studies on new neutron-rich nuclei beyond doubly-magic {sup 208}Pb are briefly described. An identification of new neutron-rich isotopes {sup 215}Pb and {sup 217}Bi, and new decay properties of {sup 216}Bi studied by means of a pulsed release element selective technique at PS Booster-ISOLDE are reported.

Sites of Au atoms in Sn crystals as determined by channeling

International Nuclear Information System (INIS)

Miller, J.W.; Gemmell, D.S.; Holland, R.E.; Poizat, J.C.; Worthington, J.N.; Loess, R.E.

1974-01-01

The position of Au atoms diffused into Sn monocrystals has been studied by channeling and backscattering of 2.5-MeV Ne ions. For equilibrium conditions at 217 0 C, Au atoms are found almost entirely in substitutional positions, so that the unusually fast diffusion of Au in Sn most likely arises from a small fraction of Au atoms migrating interstitially

Cross-sectional survey of treatment practices for urethritis at pharmacies, private clinics and government health facilities in coastal Kenya: many missed opportunities for HIV prevention.

Science.gov (United States)

Mugo, Peter M; Duncan, Sarah; Mwaniki, Samuel W; Thiong'o, Alexander N; Gichuru, Evanson; Okuku, Haile Selassie; van der Elst, Elise M; Smith, Adrian D; Graham, Susan M; Sanders, Eduard J

2013-11-01

While bacterial sexually transmitted infections (STIs) are important cofactors for HIV transmission, STI control has received little attention in recent years. The aim of this study was to assess STI treatment and HIV testing referral practices among health providers in Kenya. In 2011 we assessed quality of case management for male urethritis at pharmacies, private clinics and government health facilities in coastal Kenya using simulated visits at pharmacies and interviews at pharmacies and health facilities. Quality was assessed using Ministry of Health guidelines. Twenty (77%) of 26 pharmacies, 20 (91%) of 22 private clinics and all four government facilities in the study area took part. The median (IQR) number of adult urethritis cases per week was 5 (2-10) at pharmacies, 3 (1-3) at private clinics and 5 (2-17) at government facilities. During simulated visits, 10% of pharmacies prescribed recommended antibiotics at recommended dosages and durations and, during interviews, 28% of pharmacies and 27% of health facilities prescribed recommended antibiotics at recommended dosages and durations. Most regimens were quinolone-based. HIV testing was recommended during 10% of simulated visits, 20% of pharmacy interviews and 25% of health facility interviews. In an area of high STI burden, most men with urethritis seek care at pharmacies and private clinics. Most providers do not comply with national guidelines and very few recommend HIV testing. In order to reduce the STI burden and mitigate HIV transmission, there is an urgent need for innovative dissemination of up-to-date guidelines and inclusion of all health providers in HIV/STI programmes.

Enzyme architecture: deconstruction of the enzyme-activating phosphodianion interactions of orotidine 5'-monophosphate decarboxylase.

Science.gov (United States)

Goldman, Lawrence M; Amyes, Tina L; Goryanova, Bogdana; Gerlt, John A; Richard, John P

2014-07-16

The mechanism for activation of orotidine 5'-monophosphate decarboxylase (OMPDC) by interactions of side chains from Gln215 and Try217 at a gripper loop and R235, adjacent to this loop, with the phosphodianion of OMP was probed by determining the kinetic parameters k(cat) and K(m) for all combinations of single, double, and triple Q215A, Y217F, and R235A mutations. The 12 kcal/mol intrinsic binding energy of the phosphodianion is shown to be equal to the sum of the binding energies of the side chains of R235 (6 kcal/mol), Q215 (2 kcal/mol), Y217 (2 kcal/mol), and hydrogen bonds to the G234 and R235 backbone amides (2 kcal/mol). Analysis of a triple mutant cube shows small (ca. 1 kcal/mol) interactions between phosphodianion gripper side chains, which are consistent with steric crowding of the side chains around the phosphodianion at wild-type OMPDC. These mutations result in the same change in the activation barrier to the OMPDC-catalyzed reactions of the whole substrate OMP and the substrate pieces (1-β-D-erythrofuranosyl)orotic acid (EO) and phosphite dianion. This shows that the transition states for these reactions are stabilized by similar interactions with the protein catalyst. The 12 kcal/mol intrinsic phosphodianion binding energy of OMP is divided between the 8 kcal/mol of binding energy, which is utilized to drive a thermodynamically unfavorable conformational change of the free enzyme, resulting in an increase in (k(cat))(obs) for OMPDC-catalyzed decarboxylation of OMP, and the 4 kcal/mol of binding energy, which is utilized to stabilize the Michaelis complex, resulting in a decrease in (K(m))(obs).

The 13 ka Pelée-Type Dome Collapse at Nevado de Toluca Volcano, México.

Science.gov (United States)

D'Antonio, M.; Capra, L.; Sarocchi, D.; Bellotti, F.

2007-05-01

The Nevado de Toluca is an active volcano located in the central sector of the Trans-Mexican Volcanic Belt, 80 km southwest of Mexico City. Activity at this andesitic to dacitic stratovolcano began ca. 2.6 Ma ago. During the last 42 ka, the volcano has been characterized by different eruptive styles, including five dome collapses dated at 37, 32, 28, 26, and 13 ka and five Plinian eruptions at 42 ka, 36 ka, 21.7 ka, 12.1 ka and 10.5 ka. The 13 ka dome collapse is the youngest event of this type, and originated a 0.11 km3 block-and-ash flow deposit on the north-eastern sector of the volcano. The deposit consists of two facies: channel-like, 10 m thick, monolitologic, that is composed of up to five units, with decimetric dacitic clasts set in a sandy matrix; and a lateral facies that consists of a gray, sandy horizon, up to 4 m thick, with a 30 cm-thick surge layer at the base. The main component is a dacitic lava, with different degree of vesciculation, with mineral association of Pl-Hbl-Opx. Plagioclases show two different textures: in equilibrium, with normal zoning (core = An37-64.3, rim = An30.7-45.8) or with spongy cellular texture with inverse zoning (core = An38-43.5, rim = An45-51.2). Hornblende is normally light green, barren of oxidation. The rock matrix contains up to 53 perc. of glass with abundant microlites, indicating over-pressure on the crystallizing magma and a rapid expulsion. All these stratigraphic and petrographic features indicate that the dome was quickly extruded on the summit of the volcano, probably triggered by a magma mixing process, and its collapse was accompanied by an explosive component, being classified as a Pelée-type event.

Differences between users and non-users of emergency contraception after a recognized unprotected intercourse

DEFF Research Database (Denmark)

Sørensen, M B; Pedersen, B L; Nyrnberg, L E

2000-01-01

Knowledge of emergency contraception is crucial but might not transform into use. Factors influencing decision-making related to use of emergency contraception after an unprotected intercourse and the characteristics of users of emergency contraception (EC) were assessed. In an abortion clinic...... setting, 217 women referred for termination of pregnancy were asked to fill in a questionnaire. Of the 217 women, 139 (64%) were aware of pregnancy risk but only 9 (4%) had used EC after the unprotected intercourse. 42% were estimated to have sufficient knowledge to use hormonal emergency contraception...

Alcoholic ingestion and alcohol abuse in university students at Jequié-BA

Directory of Open Access Journals (Sweden)

Marcos Henrique Fernandes

2008-01-01

Full Text Available Introduction: Epidemiologic researches about psychoactive substance use have shown an up-and-coming situation to abusive consumption of alcohol in adolescent and young-adult groups. This consumption over come the knowledge about damage caused by abusive of these substances, especially for the population part who is in the “top of life experiences”; the university students. Aim: To estimate the prevalence of the alcoholic ingestion and alcohol abuse in university students at Jequié-BA, and to verify the association between the alcoholic ingestion and alcohol abuse with the gender, race, smoking and graduation area. Methods: Prevalence study with probabilistic randomized sample (n = 129 of a population of 3,644 university students, registered in three universities. It was used a Questionnaire contends socio-demographic data, asking for the alcoholic ingestion and test CAGE to abuse. Results: It has been found prevalence of 63.6% to alcohol ingestion, 21.7% of high risk in abuse, and 8.5% of alcohol abuse. Although they have not been gotten association statistics between these variable and gender, race, graduation area and smoking; the data had demonstrated highest rates of alcohol abuse, and high risk in developing in students of masculine gender, medium brown race, who attend a graduation course in the health area. Those who have used of the tobacco had presented percentile greater of high risk in becoming alcohol consumer abusive. Conclusions: Intent for data found, as much alcohol ingestion as abuse, since they reflect the necessity of prevention politics to the alcoholic abusive ingestion in this population

27 CFR 9.217 - Happy Canyon of Santa Barbara.

Science.gov (United States)

2010-04-01

..., which is a boundary line of the Los Padres National Forest, to its intersection with the southwest corner of section 18 that coincides with one of the two 90-degree, southwest corners of the Los Padres... Padres National Forest, to its intersection with the boundary line of the Cañada de Los Pinos, or College...

48 CFR 552.217-71 - Notice Regarding Option(s).

Science.gov (United States)

2010-10-01

... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice Regarding Option(s... Notice Regarding Option(s). As prescribed in 517.208(b), insert the following provision: Notice Regarding Option(s) (NOV 1992) The General Services Administration (GSA) has included an option to [Insert...

48 CFR 52.217-2 - Cancellation Under Multiyear Contracts.

Science.gov (United States)

2010-10-01

... precluded anticipated benefits of Contractor or subcontractor learning. (g) The claim shall not include— (1...) This contract may include an Option clause with the period for exercising the option limited to the...

All projects related to | Page 217 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Region: Mexico, North and Central America, South America. Program: Maternal and Child Health. Total Funding: CA$ 391,650.00. Understanding Southern Influence in Cyberspace Security and Governance: Toward a Global Network of Southern-based Cyber Scholars. Project. The securitization of cyberspace - that is, ...

48 CFR 3052.217-95 - Liability and insurance (USCG).

Science.gov (United States)

2010-10-01

... inclusion of any premium expense or charge for any reserve made on account of self-insurance for coverage... of and shall not affect the pricing structure of the contract, and are additional to the compensation...

48 CFR 3052.217-97 - Discharge of liens (USCG).

Science.gov (United States)

2010-10-01

...) (a) The Contractor shall immediately discharge or cause to be discharged, any lien or right in rem of... materials furnished under this contract. (b) If any such lien or right in rem is not immediately discharged... 48 Federal Acquisition Regulations System 7 2010-10-01 2010-10-01 false Discharge of liens (USCG...

50 CFR 216.217 - Requirements for monitoring and reporting.

Science.gov (United States)

2010-10-01

... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND IMPORTING OF MARINE MAMMALS Taking of Marine Mammals Incidental to Explosive Severance Activities Conducted During Offshore Structure Removal Operations on the Outer Continental Shelf in the U.S. Gulf of Mexico...

7 CFR 2.17 - Under Secretary for Rural Development.

Science.gov (United States)

2010-01-01

... research and analysis, statistical programs, and associated service work related to rural people and the...). (iii) Designate the chief executive officer of the Rural Telephone Bank. (iv) Administer the following...

8 CFR 217.5 - Electronic System for Travel Authorization.

Science.gov (United States)

2010-01-01

...) Required elements. ESTA will collect such information as the Secretary deems necessary to issue a travel... changes his or her name; (3) The alien changes his or her gender; (4) The alien's country of citizenship...

20 CFR 702.217 - Penalty for false statement, misrepresentation.

Science.gov (United States)

2010-04-01

... representation for the purpose of obtaining a benefit or payment under this Act shall be guilty of a felony, and... or representation for the purpose of reducing, denying or terminating benefits to an injured employee, or his dependents pursuant to section 9, 33 U.S.C. 909, if the injury results in death, shall be...

48 CFR 217.7103-6 - Modification of master agreements.

Science.gov (United States)

2010-10-01

... REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS... only by modifying the master agreement itself. It shall not be changed through a job order. (c) A modification to a master agreement shall not affect job orders issued before the effective date of the...

ORF Alignment: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available GDFFGPMTVVAVYVDAKQIPLLKELGVKDSKNLNDEQITAIAKQLLHVVPY 60 ... Query: 217 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQF...DELSKKAGMPLPKGAGKQV 276 ... YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV Sbjct: 121 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV 180 ...

ORF Alignment: NC_004722 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available FFGPMTVVAVYVDAKQIPLLKELGVKDSKNLNDDQITAIAKQLLHVVPY 60 ... Query: 217 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDE...LSKKAGMPLPKGAGKQV 276 ... YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV Sbjct: 121 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFDELSKKAGMPLPKGAGKQV 180 ...

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available IPLLKELGVKDSKNLNDEQITAIAKQLLHVVPY 60 ... Query: 217 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFNELSKKAGMPLPKGAGKQ...V 276 ... YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFNELSKKAGMPLPKGAGKQV Sbjct: 121 YLAKQKQVQRENVYFATKGESVHLAVAAASILARYSFVKQFNELSKKAGMPLPKGAGKQV 180 ...

Introduction of the rd29A: AtDREB2A CA gene into soybean (Glycine max L. Merril and its molecular characterization in leaves and roots during dehydration

Directory of Open Access Journals (Sweden)

Cibelle Engels

2013-01-01

Full Text Available The loss of soybean yield to Brazilian producers because of a water deficit in the 2011-2012 season was 12.9%. To reduce such losses, molecular biology techniques, including plant transformation, can be used to insert genes of interest into conventional soybean cultivars to produce lines that are more tolerant to drought. The abscisic acid (ABA-independent Dehydration Responsive Element Binding (DREB gene family has been used to obtain plants with increased tolerance to abiotic stresses. In the present study, the rd29A:AtDREB2A CA gene from Arabidopsis thaliana was inserted into soybean using biolistics. Seventy-eight genetically modified (GM soybean lines containing 2-17 copies of the AtDREB2A CA gene were produced. Two GM soybean lines (P1397 and P2193 were analyzed to assess the differential expression of the AtDREB2A CA transgene in leaves and roots submitted to various dehydration treatments. Both GM lines exhibited high expression of the transgene, with the roots of P2193 showing the highest expression levels during water deficit. Physiological parameters examined during water deficit confirmed the induction of stress. This analysis of AtDREB2A CA expression in GM soybean indicated that line P2193 had the greatest stability and highest expression in roots during water deficit-induced stress.

Symbiotic Properties of Sinorhizobium Fredii, J-TGS50 an Indonesian Soybean Nodule Forming Bacteria

International Nuclear Information System (INIS)

Setiyo Hadi Waluyo

2004-01-01

Green House experiments were conducted to study symbiotic properties of Sinorhizobium Fredii, J-TGS50. Sinorhizobium Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217 and Bradyrhizobium japonicum USDA 110 were used as references. Yeast extract mannitol broth culture of the bacteria were made and used as inoculation for several local and imported soybean varieties used in this study. Plants were harvested at 20 days after inoculation. Number of nodules were counted, fresh weight of nodules and shoot were determined. S. Fredii J-TGS50 and S. Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217 were found different in their symbiotic properties. S. Fredii J-TGS50 formed nodules on same imported soybean. While there were no nodules obtained from the plant inoculated with S. Fredii USDA 192, USDA 201, USDA 205, USDA 206, USDA 217. S. Fredii J-TGS50 and recommended B. Japonicum USDA 110 formed nodule on several local soybean varieties. There was no differences between those two bacteria either in nodulation efficiency or in the effectiveness of the formed nodules. Results of this study can be concluded that S. Fredii, J-TGS50 is a native to Indonesian soil and it is a promising soybean nodule forming bacteria in Indonesia. Using indigenous bacteria is valuable. Since they are mostly more tolerant and adaptable than the introduced ones. An important aspect for the success of Biological Nitrogen Fixation (BNF) is insight in the structure of indigenous soybean rhizobia populations. Study on the biodiversity of soybean rhizobia was important conducted. (author)

The Cosmology Large Angular Scale Surveyor (CLASS): 38 GHz Detector Array of Bolometric Polarimeters

Science.gov (United States)

Appel, John W.; Ali, Aamir; Amiri, Mandana; Araujo, Derek; Bennett, Charles L.; Boone, Fletcher; Chan, Manwei; Cho, Hsiao-Mei; Chuss, David T.; Colazo, Felipe;

The cosmology large angular scale surveyor (CLASS): 38-GHz detector array of bolometric polarimeters

Science.gov (United States)

Appel, John W.; Ali, Aamir; Amiri, Mandana; Araujo, Derek; Bennet, Charles L.; Boone, Fletcher; Chan, Manwei; Cho, Hsiao-Mei; Chuss, David T.; Colazo, Felipe; Crowe, Erik; Denis, Kevin; Dünner, Rolando; Eimer, Joseph; Essinger-Hileman, Thomas; Gothe, Dominik; Halpern, Mark; Harrington, Kathleen; Hilton, Gene; Hinshaw, Gary F.; Huang, Caroline; Irwin, Kent; Jones, Glenn; Karakula, John; Kogut, Alan J.; Larson, David; Limon, Michele; Lowry, Lindsay; Marriage, Tobias; Mehrle, Nicholas; Miller, Amber D.; Miller, Nathan; Moseley, Samuel H.; Novak, Giles; Reintsema, Carl; Rostem, Karwan; Stevenson, Thomas; Towner, Deborah; U-Yen, Kongpop; Wagner, Emily; Watts, Duncan; Wollack, Edward; Xu, Zhilei; Zeng, Lingzhen

2014-07-01

The Cosmology Large Angular Scale Surveyor (CLASS) experiment aims to map the polarization of the Cosmic Microwave Background (CMB) at angular scales larger than a few degrees. Operating from Cerro Toco in the Atacama Desert of Chile, it will observe over 65% of the sky at 38, 93, 148, and 217 GHz. In this paper we discuss the design, construction, and characterization of the CLASS 38 GHz detector focal plane, the first ever Q-band bolometric polarimeter array.

The Effective Deterrence of Environmental Damage during Armed Conflict: A Case Analysis of the Persian Gulf War

Science.gov (United States)

1992-04-01

understandings, the United States never ratified either of them. Id. at 459- * 68. 7Id. at 460. 79MOORE, supra note 5, at 81. See also Paul C. Szasz ...supra note 3, at 64. 󈧉Although no source concludes that the 1977 ENMOD Convention is customary international law, see Szasz , supra note 79, at 216-17...156M. at 3-4. 1571d. at 4. 1581d. at 4-6. 1591d. at 6. 16° Szasz , supra note 79, at 217. 16ld. at 216-17. 162LAWS OF WAR, supra note 9, at 4. 100 0

Test plan: Potash Core Test. WIPP experimental program borehole plugging

International Nuclear Information System (INIS)

Christensen, C.L.

1979-09-01

The Potash Core Test will utilize a WIPP emplaced plug to obtain samples of an in-situ cured plug of known mix constituents for bench scale testing. An earlier effort involved recovery at the salt horizon of Plug 217, a 17 year old plug in a potash exploration hole for bond testing, but the lack of particulars in the emplacement precluded significant determination of plug performance

Clean Water Act and biological studies at the Savannah River Plant

International Nuclear Information System (INIS)

Fleming, R.R.

1985-01-01

Federal facilities are required to comply with applicable water quality standards, effluent limitations, and permit requirements established by the EPA or agreement state pursuant to provision of the Federal Water Pollution Control Act, as amended in 1977 (P.L. 95-217). Production reactors and a large fossil-fueled powerplant at the Savannah River Plant (SRP) use either once-through water from the Savannah River or recirculating water from 2700-acre reservoir to remove waste heat. Once through cooling water is discharged directly to streams whose headwaters originate on the plant. The thermal load carried by these streams is largely dissipated by the time the streams re-enter the river. However, effluent discharge temperatures to the streams and reservoir do not meet current criteria specified by the State of South Carolina for a National Pollutant Discharge Elimination System (NPDES) permit. Less stringent effluent limitations can be approved by the State if DOE can demonstrate that current or mitigated thermal discharges will ensure the protection and propagation of a balanced biological community within the receiving waters. Following information provided in the EPA 316(a) Technical Guidance Manual, biological studies were designed and implemented that will identify and determine the significance of impacts on waters receiving thermal effluents. Sampling is being conducted along the length of each thermal stream, in the cooling water reservoir, and along a 160-mile stretch of the Savannah River and in the mouths of 33 of its tributaries. Preliminary results of the 316(a) type studies and how they are being used to achieve compliance with State water quality regulations will be discussed

Fires at storage sites of organic materials, waste fuels and recyclables.

Science.gov (United States)

Ibrahim, Muhammad Asim; Alriksson, Stina; Kaczala, Fabio; Hogland, William

2013-09-01

During the last decade, the European Union has enforced the diversion of organic wastes and recyclables to waste management companies operating incineration plants, composting plants and recycling units instead of landfills. The temporary storage sites have been established as a buffer against fluctuations in energy demand throughout the year. Materials also need to be stored at temporary storage sites before recovery and recycling. However, regulations governing waste fuel storage and handling have not yet been developed, and, as a result, companies have engaged in risky practices that have resulted in a high number of fire incidents. In this study, a questionnaire survey was distributed to 249 of the 400 members of Avfall Sverige (Swedish Waste Management Association), which represents the waste management of 95% of the Swedish population. Information regarding 122 storage facilities owned by 69 companies was obtained; these facilities were responsible for the storage of 47% of the total treated waste (incineration + digestion + composting) in 2010 in Sweden. To identify factors related to fire frequency, the questionnaire covered the amounts of material handled and burnt per year, financial losses due to fires, storage duration, storage method and types of waste. The results show that 217 fire incidents corresponded to 170 kilotonnes of material burnt and cumulative losses of 49 million SEK (€4.3 million). Fire frequency and amount of material burnt per fire was found to be dependent upon type of management group (waste operator). Moreover, a correlation was found between fire frequency and material recycled during past years. Further investigations of financial aspects and externalities of fire incidents are recommended.

Pharmacokinetics and tissue behavior of enrofloxacin and its metabolite ciprofloxacin in turbot Scophthalmus maximus at two water temperatures

Science.gov (United States)

Liang, Junping; Li, Jian; Zhao, Fazhen; Liu, Ping; Chang, Zhiqiang

2012-07-01

Turbot Scophthalmus maximus, an important aquaculture species in China, currently suffers from epizootic diseases because of high density aquaculture. Enrofloxacin has been used to treat various systemic bacterial fish infections. However, studies concerning the pharmacokinetics of enrofloxacin in turbot are limited. In this study, the pharmacokinetics of enrofloxacin and its metabolite ciprofloxacin, were investigated in the turbot following intravenous and oral administration at 10 mg enrofloxacin/kg body weight, at 16°C and 10°C water temperatures. The concentrations of enrofloxacin and ciprofloxacin in the main tissues (plasma, muscle, liver and kidney) were detected by HPLC. The results show that the plasma concentration-time data for enrofloxacin were best described as a two-compartment open model after intravenous and oral administration. Three pharmacokinetic equations were established between the concentrations and temperatures. The kinetic profile of enrofloxacin was temperature dependent. The absorption half-life of enrofloxacin was 1.99 h and 2.17 h after oral administration, whereas the elimination half-life of the drug was 98.63 h and 136.59 h at 16°C and 10°C, respectively. The peak concentration of enrofloxacin in plasma and tissues was higher at 16°C than that at 10°C, and the peak plasma concentration time in the liver was the shortest at both temperatures among those of other tissues. The plasma C max /MIC ratio varied between 11.08 and 5 540.00 at 16°C; and between 7.92 and 3 960.00 at 10°C. The AUC/MIC ratio was 467.82-280 690.00 at 16°C, and 359.48-215 690.00 at 10°C. These ratios indicate that it is possible to obtain therapeutic efficacy. Very low levels of ciprofloxacin were detected. The AUC ratios of ciprofloxacin and enrofloxacin in plasma suggest that plasma ciprofloxacin might play a minor role in enrofloxacin treatment for turbot.

Security and privacy in massively-multiplayer online games and social and corporate virtual worlds

OpenAIRE

Hogben, G.; Barosso, D.; Bartle, R.; Chazeran, C.; de Zwart, M.; Doumen, J.M.; Gorniak, S.; Kaźmierczak, M.; Kaskenmaa, M.; Benavente López, D.; Martin, A.; Naumann, I.; Reynolds, R.; Richardson, J; Rossow, C.

2008-01-01

2007 was the year of online gaming fraud - with malicious programs that specifically target online games and virtual worlds increasing by 145% and the emergence of over 30,000 new programs aimed at stealing online game passwords. Such malware is invariably aimed at the theft of virtual property accumulated in a user’s account and its sale for real money. With 217 million regular users of MMO/VWs (Massively Multiplayer Online Games and Virtual Worlds) and real-money sales of virtual objects es...

[A thin-layer chromatography method for determining the styrene metabolites mandelic and phenylglyoxylic acid in urine].

Science.gov (United States)

Gartzke, J; Burck, D

1989-06-01

A thin-layer chromatographic method is described for the determination of mandelic and phenyglyoxillic acid on silicagel (Silufol UV 254) after extraction from urine of styrene exposed workers. The quantitative determination was performed after eluting the spots. Phenylglyoxilic acid was measured at 255 nm and mandelic acid by derivative spectroscopically estimation of the .CH(OH).COOH -chromophore at 217 nm or by a three-wavelength mode, respectively. The recovery in urine was 80-104% for phenylglyoxilic acid and 99-105% for mandelic acid.

Analysis of Relative Concentration of Ethanol and Other Odorous Compounds (OCs) Emitted from the Working Surface at a Landfill in China

Science.gov (United States)

Li, Dong; Lu, Wenjing; Liu, Yanjun; Guo, Hanwen; Xu, Sai; Ming, Zhongyuan; Wang, Hongtao

2015-01-01

Estimating odor emissions from landfill sites is a complicated task because of the various chemical and biological species that exist in landfill gases. In this study, the relative concentration of ethanol and other odorous compounds emitted from the working surface at a landfill in China was analyzed. Gas sampling was conducted at the landfill on a number of selected days from March 2012 to March 2014, which represented different periods throughout the two years. A total of 41, 59, 66, 54, 63, 54, 41, and 42 species of odorous compounds were identified and quantified in eight sampling activities, respectively; a number of 86 species of odorous compounds were identified and quantified all together in the study. The measured odorous compounds were classified into six different categories (Oxygenated compounds, Halogenated compounds, Terpenes, Sulfur compounds, Aromatics, and Hydrocarbons). The total average concentrations of the oxygenated compounds, sulfur compounds, aromatics, halogenated compounds, hydrocarbons, and terpenes were 2.450 mg/m3, 0.246 mg/m3, 0.203 mg/m3, 0.319 mg/m3, 0.530 mg/m3, and 0.217 mg/m3, respectively. The relative concentrations of 59 odorous compounds with respect to the concentration of ethyl alcohol (1000 ppm) were determined. The dominant contaminants that cause odor pollution around the landfill are ethyl sulfide, methyl mercaptan, acetaldehyde, and hydrogen sulfide; dimethyl disulfide and dimethyl sulfide also contribute to the pollution to a certain degree. PMID:25769100

Particles produced in association with PSI(3098)

International Nuclear Information System (INIS)

Alverson, G.O.

1979-01-01

Dimuon production was studied at 217 GeV/c in π - -hydrogen and π - -beryllium collisions with a multiparticle spectrometer to detect associated particles. Particular attention was paid to the phiγ spectrum which shows an excess of events in the region 3.5 GeV. Attributing this to the presence of the chi(approx. 3.5) states implies that 94 +- 50% of psis are produced via radiative chi decay

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... [Symbiobacterium thermophilum IAM 14863] ... Length = 217 ... Query: 15 ... AEVYRRLLEAFGPRHWWPSALEPPPAKAQPFEM...IAGAILVQNVAWSNAAKAVRALAEAGX 74 ... AEVYRRLLEAFGPRHWWPSALEPPPAKAQPFEM...IAGAILVQNVAWSNAAKAVRALAEAG ... Sbjct: 1 ... AEVYRRLLEAFGPRHWWPSALEPPPAKAQPFEMIAGAILVQNVAWSNAAKAVRALAEAGL 60 ... Q

Bladder volume at onset of vesicoureteral reflux is an independent risk factor for breakthrough febrile urinary tract infection.

Science.gov (United States)

Alexander, Siobhan E; Arlen, Angela M; Storm, Douglas W; Kieran, Kathleen; Cooper, Christopher S

2015-04-01

Improved identification of children with vesicoureteral reflux at risk for recurrent febrile urinary tract infection may impact management decisions. We hypothesized that reflux occurring earlier during bladder filling increases the duration of exposure of the kidneys to bacteria, and, therefore, increases the risk of pyelonephritis. Children with vesicoureteral reflux and detailed voiding cystourethrogram data were identified. Bladder volume at onset of reflux was normalized for age. Demographics, reflux grade, laterality, presence/absence of bladder-bowel dysfunction and breakthrough febrile urinary tract infections were assessed. Median followup was 24 months (IQR 12 to 52). A total of 208 girls and 47 boys were analyzed with a mean ± SD age at diagnosis of 3.1 ± 2.6 years. On univariate analysis history of febrile urinary tract infection (HR 2.17, 95% CI 1.33-2.85, p = 0.01), dilating vesicoureteral reflux (HR 1.6, 95% CI 1.05-2.42, p = 0.03) and bladder-bowel dysfunction (HR 1.66, 95% CI 0.99-2.75, p = 0.05) were associated with an increased risk of breakthrough febrile urinary tract infection. Median bladder volume at onset of reflux in children with breakthrough febrile urinary tract infection was significantly less (33.1%) than in those without infection (49.5%, p = 0.003). Reflux onset at 35% predicted bladder capacity or less was associated with a significantly increased risk of breakthrough febrile urinary tract infection on multivariate analysis (HR 1.58, 95% CI 1.05-2.38, p = 0.03). Children with early filling vesicoureteral reflux are at increased risk for breakthrough febrile urinary tract infection independent of reflux grade. Bladder volume at onset of reflux should be recorded during cystograms since it provides additional prognostic information about the risk of pyelonephritis and resolution, and may assist with counseling and clinical decision making. Copyright © 2015 American Urological Association Education and Research, Inc. Published by

P2-17: Individual Differences in Dynamic Criterion Shifts during Perceptual Decision Making

Directory of Open Access Journals (Sweden)

Issac Rhim

2012-10-01

Full Text Available Perceptual decision-making involves placing an optimal criterion on the axis of encoded sensory evidence to maximize outcomes for choices. Optimal criterion setting becomes critical particularly when neural representations of sensory inputs are noisy and feedbacks for perceptual choices vary over time in an unpredictable manner. Here we monitored time courses of decision criteria that are adopted by human subjects while abruptly shifting the criterion of stochastic feedback to perceptual choices with certain amounts in an unpredictable direction and at an unpredictable point of time. Subjects viewed a brief (0.3 s, thin (.07 deg annulus around the fixation and were forced to judge whether the annulus was smaller or larger than an unknown boundary. We estimated moment-to-moment criteria by fitting a cumulative Gaussian function to the data within a sliding window of trials that are locked to a shift in feedback criterion. Unpredictable shifts in feedback criterion successfully induced shifts in actual decision criterion towards an optimal criterion for many of subjects, but with time delay and amount of shifts varying across individual subjects. There were disproportionately more numbers of overshooters (reaching and then surpassing the optimal criterion required than undershooters (subpar reach, with a significant anti-correlation with sensory sensitivity. To find a mechanism that generates these individual differences, we developed a dynamic criterion learning model by modifying a reinforcement learning model, which assumes that a criterion is adjusted every trial by a weighted discrepancy between actual and expected rewards.

[Humor at Work Questionnaire - Polish adaptation of Humor Climate Questionnaire (HCQ)].

Science.gov (United States)

Stańczak, Aleksander; Drabek, Marcin

2018-03-09

The aim of the paper is to present the Polish adaptation of the Humor Climate Questionnaire (HCQ), designed to measure humor as organizational climate feature. The authors employed back-translation and independent judges method to choose the best version of the translated items. The psychometric properties of HCQ were estimated on the basis of 2 samples: the basic group of employees (N = 217) and the group of employees who had completed the survey twice (N = 55). The results of statistical analyses proved that HCQ is a reliable tool. Explorative Factor Analysis supported the 4-factor structure of the original method's theoretical model. The validity of the subscales is high, Cronbach's α varied from 0.8 to 0.9. The directions and values of intercorrelations between subscales were similar to those of the English version. The Humor Climate Questionnaire is a relatively time-stable tool (r = 0.44-0.74). Polish adaptation is reliable and applicable for cross-sectional studies. The obtained results are comparable to the characteristics of the original version. However, the results of factor analysis show that the data do not fully fit the theoretical model. Med Pr 2018;69(2):143-152. This work is available in Open Access model and licensed under a CC BY-NC 3.0 PL license.

Cross-categorization of legal concepts across boundaries of legal systems: in consideration of inferential links

DEFF Research Database (Denmark)

Glückstad, Fumiko Kano; Herlau, Tue; Schmidt, Mikkel Nørgaard

2014-01-01

This work contrasts Giovanni Sartor’s view of inferential semantics of legal concepts (Sartor in Artif Intell Law 17:217–251, 2009) with a probabilistic model of theory formation (Kemp et al. in Cognition 114:165–196, 2010). The work further explores possibilities of implementing Kemp’s probabili......This work contrasts Giovanni Sartor’s view of inferential semantics of legal concepts (Sartor in Artif Intell Law 17:217–251, 2009) with a probabilistic model of theory formation (Kemp et al. in Cognition 114:165–196, 2010). The work further explores possibilities of implementing Kemp...... and Griffiths in Behav Brain Sci 4:629–640, 2001), the probabilistic model of theory formation, i.e., the Infinite Relational Model (IRM) first introduced by Kemp et al. (The twenty-first national conference on artificial intelligence, 2006, Cognition 114:165–196, 2010) and its extended model, i.e., the normal...... to the International Standard Classification of Education. The main contribution of this work is the proposal of a conceptual framework of the cross-categorization approach that, inspired by Sartor (Artif Intell Law 17:217–251, 2009), attempts to explain reasoner’s inferential mechanisms....

Hydrogen at the Rooftop: Compact CPV-Hydrogen system to Convert Sunlight to Hydrogen

KAUST Repository

Burhan, Muhammad

2017-12-27

Despite being highest potential energy source, solar intermittency and low power density make it difficult for solar energy to compete with the conventional power plants. Highly efficient concentrated photovoltaic (CPV) system provides best technology to be paired with the electrolytic hydrogen production, as a sustainable energy source with long term energy storage. However, the conventional gigantic design of CPV system limits its market and application to the open desert fields without any rooftop installation scope, unlike conventional PV. This makes CPV less popular among solar energy customers. This paper discusses the development of compact CPV-Hydrogen system for the rooftop application in the urban region. The in-house built compact CPV system works with hybrid solar tracking of 0.1° accuracy, ensured through proposed double lens collimator based solar tracking sensor. With PEM based electrolyser, the compact CPV-hydrogen system showed 28% CPV efficiency and 18% sunlight to hydrogen (STH) efficiency, for rooftop operation in tropical region of Singapore. For plant designers, the solar to hydrogen production rating of 217 kWh/kg has been presented with 15% STH daily average efficiency, recorded from the long term field operation of the system.

Hydrogen at the Rooftop: Compact CPV-Hydrogen system to Convert Sunlight to Hydrogen

KAUST Repository

Burhan, Muhammad; Wakil Shahzad, Muhammad; Ng, Kim Choon

2017-01-01

Despite being highest potential energy source, solar intermittency and low power density make it difficult for solar energy to compete with the conventional power plants. Highly efficient concentrated photovoltaic (CPV) system provides best technology to be paired with the electrolytic hydrogen production, as a sustainable energy source with long term energy storage. However, the conventional gigantic design of CPV system limits its market and application to the open desert fields without any rooftop installation scope, unlike conventional PV. This makes CPV less popular among solar energy customers. This paper discusses the development of compact CPV-Hydrogen system for the rooftop application in the urban region. The in-house built compact CPV system works with hybrid solar tracking of 0.1° accuracy, ensured through proposed double lens collimator based solar tracking sensor. With PEM based electrolyser, the compact CPV-hydrogen system showed 28% CPV efficiency and 18% sunlight to hydrogen (STH) efficiency, for rooftop operation in tropical region of Singapore. For plant designers, the solar to hydrogen production rating of 217 kWh/kg has been presented with 15% STH daily average efficiency, recorded from the long term field operation of the system.

Maple Syrup Urine Disease Complicated with Kyphoscoliosis and Myelopathy

Directory of Open Access Journals (Sweden)

Jia-Woei Hou

2016-10-01

Full Text Available Maple syrup urine disease (MSUD is an autosomal recessive aminoacidopathy secondary to an enzyme defect in the catabolic pathway of the branched-chain amino acids (BCAAs: leucine, isoleucine, and valine. Accumulation of their corresponding keto-acids leads to encephalopathy if not treated in time. A newborn male patient was suspected to have MSUD after tandem mass study when he presented symptoms and signs suggestive neonatal sepsis, anemia, and diarrhea. Food restriction of BCAAs was started; however, acrodermatitis enteropathica-like skin eruptions occurred at age 2 months. The skin rashes resolved after adding BCAAs and adjusting the infant formula. At age 7 months, he suffered from recurrent skin lesions, zinc deficiency, osteoporosis, and kyphosis of the thoracic spine with acute angulation over the T11-T12 level associated with spinal compression and myelopathy. After supplementation of zinc products and pamidronate, skin lesions and osteopenia improved gradually. Direct sequencing of the DBT gene showed a compound heterozygous mutation [4.7 kb deletion and c.650-651insT (L217F or L217fsX223]. It is unusual that neurodegeneration still developed in this patient despite diet restriction. Additionally, brain and spinal magnetic resonance imaging, bone mineral density study, and monitoring of zinc status are suggested in MSUD patients.

Fragment molecular orbital study on electron tunneling mechanisms in bacterial photosynthetic reaction center.

Science.gov (United States)

Kitoh-Nishioka, Hirotaka; Ando, Koji

2012-11-01

The tunneling mechanisms of electron transfers (ETs) in photosynthetic reaction center of Blastochloris viridis are studied by the ab initio fragment molecular orbital (FMO) method combined with the generalized Mulliken-Hush (GMH) and the bridge Green function (GF) calculations of the electronic coupling T(DA) and the tunneling current method for the ET pathway analysis at the fragment-based resolution. For the ET from batctriopheophytin (H(L)) to menaquinone (MQ), a major tunneling current through Trp M250 and a minor back flow via Ala M215, Ala M216, and His M217 are quantified. For the ET from MQ to ubiquinone, the major tunneling pathway via the nonheme Fe(2+) and His L190 is identified as well as minor pathway via His M217 and small back flows involving His L230, Glu M232, and His M264. At the given molecular structure from X-ray experiment, the spin state of the Fe(2+) ion, its replacement by Zn(2+), or its removal are found to affect the T(DA) value by factors within 2.2. The calculated T(DA) values, together with experimentally estimated values of the driving force and the reorganization energy, give the ET rates in reasonable agreement with experiments.

Planck 2015 results: VII. High Frequency Instrument data processing: Time-ordered information and beams

International Nuclear Information System (INIS)

Adam, R.; Ade, P. A. R.; Aghanim, N.; Arnaud, M.; Ashdown, M.

2016-01-01

The Planck High Frequency Instrument (HFI) has observed the full sky at six frequencies (100, 143, 217, 353, 545, and 857 GHz) in intensity and at four frequencies in linear polarization (100, 143, 217, and 353 GHz). In order to obtain sky maps, the time-ordered information (TOI) containing the detector and pointing samples must be processed and the angular response must be assessed. The full mission TOI is included in the Planck 2015 release. This study describes the HFI TOI and beam processing for the 2015 release. HFI calibration and map making are described in a companion paper. The main pipeline has been modified since the last release (2013 nominal mission in intensity only), by including a correction for the nonlinearity of the warm readout and by improving the model of the bolometer time response. The beam processing is an essential tool that derives the angular response used in all the Planck science papers and we report an improvement in the effective beam window function uncertainty of more than a factor of 10 relative to the2013 release. Noise correlations introduced by pipeline filtering function are assessed using dedicated simulations. Finally, angular cross-power spectra using data sets that are decorrelated in time are immune to the main systematic effects.

Valor de la laparoscopia en las enfermedades de la cavidad abdominal

Directory of Open Access Journals (Sweden)

Milton Argüello

1972-07-01

Full Text Available Se practicaron 223 Laparoscopias de las cuales se analizan 217: 115 en pacientes de sexo femenino, y 102 en pacientes de sexo masculino, con edades entre 13 y 80 años. De los 217 exámenes estudiados, en 208 (95.8% se encontraron alteraciones patológicas con predominio de cirrosis, carcinoma de vías biliares y lesiones metastásicas a hígado. Se puntualiza la utilidad de la endoscopia en los diferentes tipos de lesiones de la cavidad peritoneal, las que se ilustran con imágenes fotográficas de casos representativos. Se presentaron cuatro (4 complicaciones que evolucionaron satisfactoriamente.

Correlates of exposure to secondhand smoke (SHS) at home among non-smoking adults in Bangladesh: findings from the ITC Bangladesh survey.

Science.gov (United States)

Abdullah, Abu S; Driezen, Pete; Sansone, Genevieve; Nargis, Nigar; Hussain, Ghulam Akm; Quah, Anne Ck; Fong, Geoffrey T

2014-07-16

Exposure to secondhand smoke (SHS) is a serious global public health problem. Understanding the correlates of SHS exposure could guide the development of evidence based SHS exposure reduction interventions. The purpose of this study is to describe the pattern of and factors associated with SHS exposure among non-smoking adults in Bangladesh. Data come from adult non-smokers who participated in the second wave (2010) of the International Tobacco Control Policy (ITC) Evaluation Bangladesh Survey conducted in all six administrative divisions of Bangladesh. A structured questionnaire gathered information on participants' demographic characteristics, pattern of SHS exposure, SHS knowledge, and attitudes towards tobacco control. Exposure to SHS at home was defined as non-smokers who lived with at least one smoker in their household and who reported having no home smoking ban. The data were analyzed using chi-square tests and logistic regression procedures. The SHS exposure rate at home among the participants (N=2813) was 43%. Several sociodemographic and attitudinal factors were associated with SHS exposure. Logistic regression analyses identified eight predictors of SHS exposure: being female (OR=2.35), being aged 15-24 (OR=2.17), being recruited from Dhaka slums (OR=5.19) or non-tribal/non-border areas outside Dhaka (OR=2.19) or tribal/border area (OR=4.36), having lower education (1-8 years: OR=2.45; illiterate: OR=3.00, having higher monthly household income (5000 to non-smoking Bangladeshi adults are exposed to SHS at home. The findings suggest the need for comprehensive tobacco control measures that would improve public understanding about health hazards of SHS exposure at home and encourage educational initiatives to promote smoke-free homes. Interventions should deliver targeted messages to reach those in the low socioeconomic status group.

Four-body effects in the 6He+58Ni scattering

International Nuclear Information System (INIS)

Morcelle, V.; Pires, K.C.C.; Rodríguez-Gallardo, M.; Lichtenthäler, R.; Lépine-Szily, A.; Guimarães, V.; Faria, P.N. de; Mendes Junior, D.R.; Moro, A.M.; Gasques, L.R.; Leistenschneider, E.; Pampa Condori, R.; Scarduelli, V.; Morais, M.C.

2014-01-01

We present angular distributions of the 6 He+ 58 Ni scattering measured at three bombarding energies above the Coulomb barrier: E lab =12.2 MeV,16.5 MeV,and 21.7 MeV. The angular distributions have been analysed in terms of three- and four-body Continuum-Discretized Coupled-Channels calculations considering the effect of the 6 He breakup. A behaviour in the cross section at large angles has been observed which was reproduced only by the four-body Continuum-Discretized Coupled-Channels calculation.

Prenatal mercury exposure, maternal seafood consumption and associations with child language at five years.

Science.gov (United States)

Vejrup, Kristine; Brandlistuen, Ragnhild Eek; Brantsæter, Anne Lise; Knutsen, Helle Katrine; Caspersen, Ida Henriette; Alexander, Jan; Lundh, Thomas; Meltzer, Helle Margrete; Magnus, Per; Haugen, Margaretha

2018-01-01

Methyl mercury (MeHg) is a well-known neurotoxin and evidence suggests that also low level exposure may affect prenatal neurodevelopment. Uncertainty exists as to whether the maternal MeHg burden in Norway might affect child neurodevelopment. To evaluate the association between prenatal mercury exposure, maternal seafood consumption and child language and communication skills at age five. The study sample comprised 38,581 mother-child pairs in the Norwegian Mother and Child Cohort Study. Maternal mercury blood concentration in gestational week 17 was analysed in a sub-sample of 2239 women. Prenatal mercury exposure from maternal diet was calculated from a validated FFQ answered in mid-pregnancy. Mothers reported children's language and communications skills at age five by a questionnaire including questions from the Ages and Stages Questionnaire (ASQ), the Speech and Language Assessment Scale (SLAS) and the Twenty Statements about Language-Related Difficulties (language 20). We performed linear regression analyses adjusting for maternal characteristics, nutritional status and socioeconomic factors. Median maternal blood mercury concentration was 1.03μg/L, dietary mercury exposure was 0.15μg/kgbw/wk, and seafood intake was 217g/wk. Blood mercury concentrations were not associated with any language and communication scales. Increased dietary mercury exposure was significantly associated with improved SLAS scores when mothers had a seafood intake below 400g/wk in the adjusted analysis. Sibling matched analysis showed a small significant adverse association between those above the 90th percentile dietary mercury exposure and the SLAS scores. Maternal seafood intake during pregnancy was positively associated with the language and communication scales. Low levels of prenatal mercury exposure were positively associated with language and communication skills at five years. However, the matched sibling analyses suggested an adverse association between mercury and child

Report of the Defense Science Board Task Force on Military System Applications of Superconductors

Science.gov (United States)

1988-10-01

LTS materials. A superconducting homopolar D.C. motor of 40,000 h.p., employing superconducting shield- ing, could be built at about one fourth the...ENERGY STORAGE .................... 2-17 Figure 2-9 - MOTOR /GENERATOR APPLICATIONS ............... 2-19 Figure 2-10 - MAGNETICALLY ASSISTED HYPERSONIC...sensitivity increases over current scan- ning IR sensors, # W’W Ana/&_ and U/tin-Fast Di sia$zd W Pfor radar and optical sen- sors; W’Ujh Power Motors

Z-Area Saltstone Disposal Facility Groundwater Monitoring Report. 1997 Annual Report

International Nuclear Information System (INIS)

Roach, J.L. Jr.

1997-12-01

Samples from the ZBG wells at the Z-Area Saltstone Disposal Facility are analyzed for constituents required by South Carolina Department of Health and Environmental Control (SCDHEC) Industrial Solid Waste Permit number-sign 025500-1603 (formerly IWP-217). No constituents were reported above SCDHEC-proposed groundwater monitoring standards or final Primary Drinking Water Standards during first or third quareters 1997. No constituents were detected above SRS flagging criteria during first or third quarters 1997

Pre-operative brachial plexus block compared with an identical block performed at the end of surgery: a prospective, double-blind, randomised clinical trial.

Science.gov (United States)

Holmberg, A; Sauter, A R; Klaastad, Ø; Draegni, T; Raeder, J C

2017-08-01

We evaluated whether pre-emptive analgesia with a pre-operative ultrasound-guided infraclavicular brachial plexus block resulted in better postoperative analgesia than an identical block performed postoperatively. Fifty-two patients undergoing fixation of a fractured radius were included. All patients received general anaesthesia with remifentanil and propofol. Patients were randomly allocated into two groups: a pre-operative block or a postoperative block with 0.5 ml.kg -1 ropivacaine 0.75%. After surgery, all patients received regular paracetamol plus opioids for breakthrough pain. Mean (SD) time to first rescue analgesic after emergence from general anaesthesia was 544 (217) min in the pre-operative block group compared with 343 (316) min in the postoperative block group (p = 0.015). Postoperative pain scores were higher and more patients required rescue analgesia during the first 4 h after surgery in the postoperative block group. There were no significant differences in plasma stress mediators between the groups. Analgesic consumption was lower at day seven in the pre-operative block group. Pain was described as very strong at block resolution in 27 (63%) patients and 26 (76%) had episodes of mild pain after 6 months. We conclude that a pre-operative ultrasound-guided infraclavicular brachial plexus block provides longer and better analgesia in the acute postoperative period compared with an identical postoperative block in patients undergoing surgery for fractured radius. © 2017 The Association of Anaesthetists of Great Britain and Ireland.

Protein (Cyanobacteria): 504984487 [PGDBj - Ortholog DB

Lifescience Database Archive (English)

Full Text Available WP_015171589.1 ... 1117:22124 ... 1150:57295 1301283:79049 ... 63132:217 1173025:1268 ... hypothetical protein Geit...lerinema sp. PCC 7407 MAQLQRLDIVGDDGQTIEIFVEEKDAPVLATSPNRDGRPSMGAGSPSVKMQQMQQVIRGYATYALNAFKDFSAAEVEEITLMFGVKLSASAGIPYIANGTTDSNLEVQVKCRFPAKDG

217 | Page A JURISPRUDENCE OF THE RULE OF LAW: AN ...

African Journals Online (AJOL)

Fr. Ikenga

In the previous republics in Nigeria, the rule of law has not been .... 5 T. Aquinas in S.O. Eboh, Legal Theories and The African Concept of Law, Heb – Uni – Tech ... Not only with us no man is above the law (what is a different thing) that here.

217 THE LAND USE ACT AND EQUITY FACTOR IN PROPERTY ...

African Journals Online (AJOL)

Fr. Ikenga

discretion in tax management, provides harsh and inequitable penalties on tax defaulters, does not provide any .... remains one of the fundamental pillars of taxation guideline globally. ..... expense of the land owner and a disincentive to property investments. It is an .... establishing clear indices for tax valuation and review.

217 An International Multi-Disciplinary Journal, Ethiopia Vol. 4 (1 ...

African Journals Online (AJOL)

FIRST LADY

An alternative structure exist when a party does not perceive sufficiently important interest .... Considering the grand strategies of the superpowers during the cold war,. Freiberg .... the two adversaries; how they construct and interpret reality; and the. “bounded ... to loss… it can only make people behave to avoid it. The only.

78 FR 217 - Shared Responsibility for Employers Regarding Health Coverage

Science.gov (United States)

2013-01-02

...-time employees on business days during the preceding calendar year. For purposes of determining whether... referred to, for convenience, as the ``look-back measurement method.'') This method may not be used for... employer (the start date), a new employee was reasonably expected to be employed an average of 30 hours of...

Stand-off laser-induced breakdown spectroscopy of aluminum and geochemical reference materials at pressure below 1 torr

Energy Technology Data Exchange (ETDEWEB)

Lee, Kang-Jae; Choi, Soo-Jin; Yoh, Jack J., E-mail: jjyoh@snu.ac.kr

2014-11-01

Laser-induced breakdown spectroscopy (LIBS) is an atomic emission spectroscopy that utilizes a highly irradiated pulse laser focused on the target surface to produce plasma. We obtain spectroscopic information from the microplasma and determine the chemical composition of the sample based on its elemental and molecular emission peaks. We develop a stand-off LIBS system to analyze the effect of the remote sensing of aluminum and various geochemical reference materials at pressures below 1 torr. Using a commercial 4 inch refracting telescope, our stand-off LIBS system is configured at a distance of 7.2 m from the four United States Geological Survey (USGS) geochemical samples that include granodiorite, quartz latite, shale-cody, and diabase, which are selected for planetary exploration. Prepared samples were mixed with a paraffin binder containing only hydrogen and carbon, and were pelletized for experimental convenience. The aluminum plate sample is considered as a reference prior to using the geochemical samples in order to understand the influence of a low pressure condition on the resulting LIBS signal. A Q-switched Nd:YAG laser operating at 1064 nm and pulsed at 10 Hz with 21.7 to 48.5 mJ/pulse was used to obtain signals, which showed that the geochemical samples were successfully detected by the present stand-off detection scheme. A low pressure condition generally results in a decrease of the signal intensity, while the signal to noise ratio can vary according to the samples and elements of various types. We successfully identified the signals at below 1 torr with stand-off detection by a tightly focused light detection and by using a relatively larger aperture telescope. The stand-off LIBS detection at low pressure is promising for potential detection of the minor elements at pressures below 1 torr. - Highlights: • Stand-off LIBS signals at below 1 torr are compared to those of in-situ conditions. • Vacuum condition provides easier detection of the

Moessbauer investigation of Sm{sub 2}Fe{sub 17-x}Ga{sub x} powders at different steps of the HDDR process

Energy Technology Data Exchange (ETDEWEB)

Steyaert, S.; Breton, J.-M. le; Teillet, J. [Rouen Univ. (France). Groupe de Metall. Phys.; Kubis, M.; Handstein, A.; Mueller, K.H. [Rouen Univ. (France). Groupe de Metall. Phys.]|[Institut fuer Festkoerper- und Werkstofforschung Dresden e.V. (Germany). Inst. fuer Metallische Werkstoffe

1998-07-01

Sm{sub 2}Fe{sub 17-x}Ga{sub x} powders (x=0,0.5,1,2) obtained at different steps of the HDDR process were analysed by Moessbauer spectrometry. For the homogenised powders, the mean hyperfine field of the Sm{sub 2}Fe{sub 17-x}Ga{sub x} contribution increases with Ga content in agreement with a lattice expansion. The anisotropy change from planar to uniaxial is confirmed in samples with x = 2. In the hydrogenated powders, the value of the mean hyperfine field of Sm{sub 2}Fe{sub 17-x}Ga{sub x}H{sub y} is greater than that of Sm{sub 2}Fe{sub 17-x}Ga{sub x} in the corresponding homogenised powders, in agreement with the presence of hydrogen in the 2:17 structure. It decreases with increasing Ga amount, suggesting that the H content in the Sm{sub 2}Fe{sub 17-x}Ga{sub x}H{sub y} phase decreases with increasing Ga content. In the disproportionated powders, the disproportionation reaction is incomplete for x {>=} 1 as the contributions of both the Sm{sub 2}Fe{sub 17-x}Ga{sub x}H{sub y} and {alpha}-Fe(Ga) phases are observed in the corresponding Moessbauer spectra. This indicates that for x {>=} 1 the hydrogen diffusion is inhibited during hydrogenation. (orig.)

Predictors of mortality among children on Antiretroviral Therapy at a referral hospital, Northwest Ethiopia: A retrospective follow up study

Directory of Open Access Journals (Sweden)

Koye Digsu

2012-10-01

Full Text Available Abstract Background An estimated 2.5 million children were living with HIV/AIDS at the end of 2009, 2.3 million (92% in sub-Saharan Africa. Without treatment, a third of children with HIV will die of AIDS before their first birthday, half dying before two years of age. Hence, this study aimed to assess magnitude and predictors of mortality among children on Antiretroviral Therapy (ART at a referral hospital in North-West Ethiopia. Methods Institution based retrospective follow up study was carried out among HIV-positive children from January 1st, 2006 - March 31st, 2011. Information on relevant variables was collected from patients’ charts and registries. Life table was used to estimate the cumulative survival of children. Log rank tests were employed to compare survival between the different categories of the explanatory variables. Multivariate Cox proportional hazards model was fitted to identify predictors of mortality. Results A total of 549 records were included in the analysis. The mean age at initiation of treatment was 6.35 ±3.78 SD years. The median follow up period was 22 months. At the end of the follow up, 41(7.5% were dead and 384(69.9% were alive. Mortality was 4.0 deaths per 100 child-years of follow-up period. The cumulative probabilities of survival at 3, 6, 12, 24, and 60 months of ART were 0.96, 0.94, 0.93, 0.92 and 0.83 respectively. Majority (90.2% of the deaths occurred within the first year of treatment. Absence of cotrimoxazole preventive therapy (adjusted hazard ratio [AHR] = 4.74, 95% CI: 2.17, 10.34, anaemia (haemoglobin level Conclusions There was a high rate of early mortality. Hence, starting ART very early reduces disease progression and early mortality; close follow up of all children of HIV-positive mothers is recommended to make the diagnosis and start treatment at an earlier time before they develop severe immunodeficiency.

Adenomyosis uteri in infertile women: experience in a tropical community teaching hospital

International Nuclear Information System (INIS)

Adesiyun, A.G.; Kolawole, A.; Samaila, M.O.

2008-01-01

To determine the demographic pattern and clinical presentation of 23 infertile women with intraoperative diagnosis of adenomyosis followed by histopathologic confirmation. A review of 23 consecutive infertile women that underwent surgery due to preoperative misdiagnosis for uterine fibroids over a period of 5 years. The patients mean age was 37.3 years with age range of 26 to 47 years. Only five patients (21.7%) had delivered before. Eighteen patients (78.3%) had had abortion(s) in the past. Secondary infertility accounted for 78.3% and 21.7% had primary infertility. Past gynaecological procedures included dilatation and curettage or manual vacuum aspiration in 17 (73.9%) patients, previous adhesiolysis for uterine synaechiae in 3 (13.1%) patients and past history of myomectomy in 5 (21.7%) patients. Preoperative hysterosalpingogram showed only 2 patients (8.7%) with bilateral tubal patency and 17 patients (73.9%) had bilateral tubal blockage. Unilateral patency of the fallopian tube was observed in 4 (17.4%) patients. Amongst patients with bilateral tubal blockage, cornual blockages were mostly encountered in 15 (88.2%) of the 17 patients. The modes of clinical presentation were abdominopelvic mass 100%, dymenorrhoea 82.6%, menorrhagia 60.9%, dyspareunia 47.8% and metrorrhagia in 34.8% of cases. Intraoperatively adenomyosis encountered were diffuse adenomyosis in 13 (56.5%) patients, multiple focal adenomyosis in 7 (30.4%) patients and unifocal adenomyosis in 3 (13.1%) patients. Co-existing uterine fibroid were found in 17 (73.9%) of the 23 patients. Two patients (8.7%) had coexisting endometriosis. At surgery, significant pelvic adhesion was encountered in 7 (30.4%) patients. In infertile women, adenomyosis is significantly associated with proximal tubal occlusion and tends to co-exist with insignificant uterine fibroids. (author)

Public health impact and cost-effectiveness of intranasal live attenuated influenza vaccination of children in Germany.

Science.gov (United States)

Damm, Oliver; Eichner, Martin; Rose, Markus Andreas; Knuf, Markus; Wutzler, Peter; Liese, Johannes Günter; Krüger, Hagen; Greiner, Wolfgang

2015-06-01

In 2011, intranasally administered live attenuated influenza vaccine (LAIV) was approved in the EU for prophylaxis of seasonal influenza in 2-17-year-old children. Our objective was to estimate the potential epidemiological impact and cost-effectiveness of an LAIV-based extension of the influenza vaccination programme to healthy children in Germany. An age-structured dynamic model of influenza transmission was developed and combined with a decision-tree to evaluate different vaccination strategies in the German health care system. Model inputs were based on published literature or were derived by expert consulting using the Delphi technique. Unit costs were drawn from German sources. Under base-case assumptions, annual routine vaccination of children aged 2-17 years with LAIV assuming an uptake of 50% would prevent, across all ages, 16 million cases of symptomatic influenza, over 600,000 cases of acute otitis media, nearly 130,000 cases of community-acquired pneumonia, nearly 1.7 million prescriptions of antibiotics and over 165,000 hospitalisations over 10 years. The discounted incremental cost-effectiveness ratio was 1,228 per quality-adjusted life year gained from a broad third-party payer perspective (including reimbursed direct costs and specific transfer payments), when compared with the current strategy of vaccinating primarily risk groups with the conventional trivalent inactivated vaccine. Inclusion of patient co-payments and indirect costs in terms of productivity losses resulted in discounted 10-year cost savings of 3.4 billion. In conclusion, adopting universal influenza immunisation of healthy children and adolescents would lead to a substantial reduction in influenza-associated disease at a reasonable cost to the German statutory health insurance system. On the basis of the epidemiological and health economic simulation results, a recommendation of introducing annual routine influenza vaccination of children 2-17 years of age might be taken into

Comparison of vaccine efficacy for different antigen delivery systems for infectious pancreatic necrosis virus vaccines in Atlantic salmon (Salmo salar L.) in a cohabitation challenge model.

Science.gov (United States)

Munang'andu, Hetron M; Fredriksen, Børge N; Mutoloki, Stephen; Brudeseth, Bjørn; Kuo, Tsun-Yung; Marjara, Inderjit S; Dalmo, Roy A; Evensen, Øystein

2012-06-08

Two strains of IPNV made by reverse genetics on the Norwegian Sp strain NVI-015 (GenBank AY379740) backbone encoding the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs were used to prepare inactivated whole virus (IWV), nanoparticle vaccines with whole virus, Escherichia coli subunit encoding truncated VP2-TA and VP2-PT, VP2-TA and VP2-PT fusion antigens with putative translocating domains of Pseudomonas aeruginosa exotoxin, and plasmid DNA encoding segment A of the TA strain. Post challenge survival percentages (PCSP) showed that IWV vaccines conferred highest protection (PCSP=42-53) while nanoparticle, sub-unit recombinant and DNA vaccines fell short of the IWV vaccines in Atlantic salmon (Salmo salar L.) postsmolts challenged with the highly virulent Sp strain NVI-015 (TA strain) of IPNV after 560 degree days post vaccination. Antibody levels induced by these vaccines did not show antigenic differences between the virulent and avirulent motifs for vaccines made with the same antigen dose and delivery system after 8 weeks post vaccination. Our findings show that fish vaccinated with less potent vaccines comprising of nanoparticle, DNA and recombinant vaccines got infected much earlier and yielded to higher infection rates than fish vaccinated with IWV vaccines that were highly potent. Ability of the virulent (T(217)A(221)) and avirulent (P(217)T(221)) motifs to limit establishment of infection showed equal protection for vaccines made of the same antigen dose and delivery systems. Prevention of tissue damage linked to viral infection was eminent in the more potent vaccines than the less protective ones. Hence, there still remains the challenge of developing highly efficacious vaccines with the ability to eliminate the post challenge carrier state in IPNV vaccinology. Copyright © 2012 Elsevier Ltd. All rights reserved.

Prevalence of thrombocytopenia among pregnant women attending antenatal care service at Gondar University Teaching Hospital in 2014, northwest Ethiopia.

Science.gov (United States)

Asrie, Fikir; Enawgaw, Bamlaku; Getaneh, Zegeye

2017-01-01

Thrombocytopenia is a common hematologic abnormality during pregnancy. Pregnant women with thrombocytopenia have a higher risk of bleeding excessively during or after childbirth, particularly if they need to have a cesarean section or other surgical intervention during pregnancy, labor or in the puerperium. The main aim of this study was to determine the prevalence of thrombocytopenia among pregnant women attending antenatal care service at Gondar University Hospital, northwest Ethiopia. A cross-sectional study was used to assess the prevalence of thrombocytopenia among pregnant women attending antenatal care service at Gondar University Hospital from January to April 2015. A total of 217 pregnant women were included in the study and a structured pretested questionnaire was used to obtain sociodemographic information, nutritional factors, obstetrics and gynecological factors, history and clinical condition. Blood samples were collected for platelet count and other platelet parameters, which were determined by using SysmexKX 21 automation. The data were entered to Epi info version 6 software and analyzed using SPSS version 20 software. Bivariable and multivariable statistical analyses were used to evaluate the effect of independent variable over the dependent variable. A p -value of women receiving antenatal care service at Gondar University Hospital participated in the study. Thrombocytopenia among 19 pregnant women showed a prevalence of 8.8%. The mean ± standard deviation platelet count was 238.85×10 9 /L (±74.57). Thrombocytopenia was significantly associated with patients who lived rurally (crude odds ratio =4.3, 95% confidence interval 1.48-12.76). The prevalence of thrombocytopenia was 8.8% predominantly with mild type of thrombocytopenia. Thrombocytopenia was higher among pregnant women who lived rurally. Therefore, health care providers should screen routinely for thrombocytopenia to avoid excessive bleeding during pregnancy, especially in women who live

Prevalência da síndrome de Sjögren primária em importante área metropolitana no Brasil Primary Sjögren's syndrome prevalence in a major metropolitan area in Brazil

Directory of Open Access Journals (Sweden)

Valéria Valim

2013-02-01

Full Text Available Não há estudo anterior sobre a prevalência de síndrome de Sjögren (SS no Brasil. O objetivo deste estudo foi avaliar a prevalência de SS na população geral de Vitória, estado do Espírito Santo, Brasil. Trata-se de estudo epidemiológico, observacional e transversal com 1.205 indivíduos randomizados, cujas idades variaram de 18 a 65 anos, residentes em Vitória. Os indivíduos foram triados para xerostomia e xeroftalmia por meio de entrevista domiciliar. Aqueles com sintomas "sicca" foram convidados a comparecer ao hospital para realizar avaliação médica adicional, avaliação do fluxo salivar não estimulado, teste de Schirmer I, exame de sangue e biopsia de glândula salivar labial menor. Os sintomas "sicca" foram identificados em 18% (217 indivíduos da amostra. Dos 217 indivíduos com sintomas "sicca", 127 (58% estavam disponíveis para exame. Nessa amostra, 61,7% eram mulheres e 46,8% usavam medicação. A síndrome "sicca" foi confirmada em 12% deles por pelo menos um exame (fluxo salivar ou teste de Schirmer I. Dois pacientes (0,17% preencheram quatro critérios classificatórios americano-europeus (95% IC = 0,020-0,5983.There has been no previous prevalence study about of Sjögren's syndrome (SS in Brazil. The aim was to evaluate the SS prevalence in a general population in Vitória, ES, Brazil. This was an epidemiological, observational, and cross-sectional study conducted on 1,205 randomized people, aged 18-65 years, who lived in Vitória. The subjects were screened for xerostomia and xerofphthalmia through home interviews. Those with sicca symptoms were asked to report to a hospital for further medical evaluation, unstimulated salivary flow, Schirmer I test, blood analysis and minor labial salivary biopsy. Sicca symptoms were found in 18% (217 subjects of the sample. Of the 217 subjects with sicca symptoms, 127 (58% were available for examination. In this sample, 61.7% were female and 46.8% were under medication. Sicca

ORF Alignment: NC_001263 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available QALPVYYVQDGVAF 60 ... Query: 217 ASVRGLWXXXXXXXXXXXXXXRHPELFGRVASHSGAFIARPGATYANGVID...TTTAGEWLR 276 ... ASVRGLW ... RHPELFGRVASHSGAFIARPGATYANGVIDTTTAGEWLR Sbjct: 121 ASVRGLWGASL...GGLISLYLGSRHPELFGRVASHSGAFIARPGATYANGVIDTTTAGEWLR 180 ... Query: 337 EALLFL 342 ... EALLFL Sbjct: 241 EALLFL 246

Clinical evaluation of a software for automated localization of lung nodules at follow-up CT examinations

International Nuclear Information System (INIS)

Beyer, F.; Wormanns, D.; Heindel, W.; Kohl, G.

2004-01-01

Purpose: To evaluate a software algorithm for automated localization of pulmonary nodules at follow-up CT examinations of the chest and to determine factors influencing the rate of correctly matched nodules. Materials and Methods: The 'real-time automatic matching' (RAM) algorithm (Siemens LungCare TM software) was applied to 22 follow-up multirow-detector CT (MDCT) examinations in 11 patients (Siemens Somatom VolumeZoom, tube voltage 120 kVp; effective tube current 20 mAs (n=18) or 100 mAs (n=4); 4 x 1 mm detector configuration, 1.25 mm slice thickness; 0.8 mm reconstruction increment; standard lung kernel B50f) with a total of 190 lung nodules (mean diameter 6.7±3.5 mm, range 2-17 mm). The following nodule features were recorded: diameter, edge definition (well- or ill-defined), location (upper, middle or lower third; central or peripheral; right of left lung) and inspiration level (considered identical if the difference of diaphragm-apex distance between baseline and follow-up examination was 2 -test was used to describe influence of nodule features on detection rate. Influence of nodule size was assessed using Mann-Whitney-U-Test. Results: RAM correctly located 164 of 190 of all lung nodules (86.3%). Detection rate did not depend on nodule location (left vs. right lung: p=0.48; upper vs. middle vs. lower third: p=0.96; peripheral vs. central: p=0.47) or diameter (p=0.30). Influence of inspiration level was highly significant (p [de

Examining the Matthew effect on the motivation and ability to stay at work after heart disease.

Science.gov (United States)

Meland, Eivind; Grønhaug, Siri; Oystese, Kristin; Mildestvedt, Thomas

2011-07-01

Cardiac rehabilitation should safeguard that socioeconomic factors or other differences that affect people's cardiovascular health are not further aggravated after healthcare treatment. The study examines whether socioeconomic status, emotional problems, or the severity of disease affect people's ability to continue to work after heart disease. We also examined if these effects can be explained by differences in motivational factors. 217 patients (41 women) from the Krokeide Rehabilitation Centre in Bergen participated. Multiple linear regression analysis was used to examine motivational differences, and logistic regression analysis was used to examine whether socioeconomic factors or other differences affected people's ability to continue to work after heart disease. Self-efficacy for future work strongly impacted the likelihood of being incapacitated for work during the 2-year follow-up. The household's total income and emotional problems were statistically significant related to patients dropping out from work in the course of the observation. The association between emotional problems and future work was mediated by motivational problems. The relation between income and future incapacity for work could not be explained by motivational factors. The study shows a clear Matthew effect on people's ability to continue to work after heart disease as low-income groups and people with emotional problems are more at risk of dropping out of work. This Matthew effect was, however, only explained by the motivational difficulties for the association between emotional distress and dropping out of work and not for the impact of household income on the likelihood of leaving work.

Astrometry and early astrophysics at Kuffner Observatory in the late 19th century

Science.gov (United States)

Habison, Peter

out in 1886, followed by an international program called the ``Zonenunternehmen der Astronomischen Gesellschaft''. During this program 8468 stars were measured at the meridian circle. The Vertical Circle (81/1200 mm) was used as an auxiliary instrument for the meridian circle and for measuring polar motion. It is a rare instrument and only very few are still in existence at European observatories. Originally the Heliometer (217/3000 mm) was an instrument for measuring very small distances at the celestial sphere. Of this type of instrument, the Vienna heliometer was the largest in the world. It was installed at the observatory in 1896 and was mainly used for measuring the trigonometric parallaxes of the stars. Of 108 known parallaxes in 1910, 16 stars were measured at Kuffner Observatory at that time.

[Sleeping habits and sleep disorders during adolescence: relation to school performance].

Science.gov (United States)

Salcedo Aguilar, F; Rodríguez Almonacid, F M; Monterde Aznar, M L; García Jiménez, M A; Redondo Martínez, P; Marcos Navarro, A I

2005-05-15

To determine the prevalence of sleep disorders in adolescence. To describe sleeping habits of adolescents in relation to sleep disorders and associated factors. To determine the relation between sleep disorders/inappropiate sleeping habits and school performance. Observational, descriptive, cross-sectional study. Secondary school of Cuenca (city in Spain). 1293 school children of first and fourth curses of secondary education. Structured questionnaire with opened and closed questions on sleeping habits during weekdays and at weekends and sleep disorders to be answered by the adolescents anonymously and on their own. Student's school performance with relation with to sleeping habits and sleep disorders were determined. 1155 students out of 1293 (response rate 89.33%) answered the questionnaire, 537 (45.9%) boys and 618 (54.1%) girls, 14 years old on average (between 11-18 years). On weekdays students went to bed at 23.17 h and got up at 7.46 h (average sleeping time =8 hours and 18 minutes). At weekends they went to bed at 1.02 h and got up at 10.42 h (average sleeping time =9 hours and 40 minutes). 45.4% of students said to sleep badly on Sunday night's. On average the number of subjects failed in class is higher with adolescents who complain about sleep (2.28 vs 1.91; P=.04), who are tired at waking up time (2.17 vs 1.97; P=.048) and who have morning sleepiness (2.17 vs 1.75; P=.004). Schools hours cause deficit sleeping time during weekdays which is partly made up for at weekend. At weekends there is an interruption of the adolescent's sleeping habits. School performance of adolescents with sleep disorders is lower.

Partial Purification and Characterization of Anticoagulant Factor from the Snake (Echis Carinatus) Venom

Science.gov (United States)

Amrollahi Byoki, Elham; Zare Mirakabadi, Abbas

2013-01-01

Objective(s): Snake venoms contain complex mixture of proteins with biological activities. Some of these proteins affect blood coagulation and platelet function in different ways. Snake venom toxin may serve as a starting material for drug design to combat several pathophysiological problems such as cardiovascular disorders. In the present study, purification of anticoagulation factor from venom of snake (Echis carinatus) was studied. Materials and Methods: Anticoagulation activity of crude venom, fractions and purified peptide were determined by using prothrombin time (PT) and thrombin time (TT). Three fractions were partially purified from the venom of E. Carinatus by gel filtration on sephadex G-75 and final purification was performed by high-performance liquid chromatography (HPLC) with C18 column. A purified anticoagulant factor was derived which showed a single protein band in SDS-PAGE electrophoresis under reducing condition. Results: Results of PT and TT tests for purified peptide (EC217) were found to be 102±4.242 and < 5 min. respectively. Determination of molecular weight revealed that the active purified peptide (EC217) was about 30 KD. Conclusion: The present study showed that the venom of E. carinatus contains at least one anticoagulant factor. PMID:24494065

Partial Purification and Characterization of Anticoagulant Factor from the Snake (Echis carinatus Venom

Directory of Open Access Journals (Sweden)

Elham Amrollahi Byoki

2013-11-01

Full Text Available   Objective(s: Snake venoms contain complex mixture of proteins with biological activities. Some of these proteins affect blood coagulation and platelet function in different ways. Snake venom toxin may serve as a starting material for drug design to combat several pathophysiological problems such as cardiovascular disorders. In the present study, purification of anticoagulation factor from venom of snake (Echis carinatus was studied. Anticoagulation activity of crude venom, fractions and purified peptide were determined by using prothrombin time (PT and thrombin time (TT. Three fractions were partially purified from the venom of E. Carinatus by gel filtration on sephadex G-75 and final purification was performed by high-performance liquid chromatography (HPLC with C18 column. A purified anticoagulant factor was derived which showed a single protein band in SDS-PAGE electrophoresis under reducing condition. Results of PT and TT tests for purified peptide (EC217 were found to be 102±4.242 and < 5 min. respectively. Determination of molecular weight revealed that the active purified peptide (EC217 was about 30 KD. In conclusion, the present study showed that the venom of E. carinatus contains at least one anticoagulant factor.

Planck 2013 results. XVII. Gravitational lensing by large-scale structure

DEFF Research Database (Denmark)

Ade, P. A. R.; Aghanim, N.; Armitage-Caplan, C.

2013-01-01

On the arcminute angular scales probed by Planck, the cosmic microwave background (CMB) anisotropies are gently perturbed by gravitational lensing. Here we present a detailed study of this eect, detecting lensing independently in the 100, 143, and 217 GHz frequency bands with an overall significa...... information, our measurement corresponds to a 4% constraint on the amplitude of the lensing potential power spectrum, or a 2% constraint on the root-mean-squared amplitude of matter fluctuations at z ∼ 2....

Catalytic Decomposition of Hydroxylammonium Nitrate Ionic Liquid: Enhancement of NO Formation

Science.gov (United States)

2017-04-24

decomposition due to reduction in the acidity (i.e., [HNO3]) in the mixture. Reaction 2 has an activation barrier of Ea = 105 kJ/mol and is dominant at low...Propellants. Appl . Catal., B 2006, 62, 217−225. (15) Amariei, D.; Courtheóux, L.; Rossignol, S.; Kappenstein, C. Catalytic and Thermal Decomposition...Monopropellants: Thermal and Catalytic Decom- position Processes. Appl . Catal., B 2012, 127, 121−128. (19) Amrousse, R.; Katsumi, T.; Itouyama, N.; Azuma

[Preparation and application of monoclonal antibodies against DR region of Na+-K+-ATPase α1 subunit].

Science.gov (United States)

Yan, Xiaofei; Wu, Litao; DU, Xiaojuan; Li, Jing; Zhang, Fujun; Han, Yan; Lyu, Shemin; Li, Dongmin

2016-12-01

Objective To prepare monoclonal antibodies against DR region (897DVEDSYGQQWTYEQR911) of Na + -K + -ATPase α1 subunit and identify their properties. Methods BALB/c mice were immunized with DR-keyholelimpet hemocyanin (KLH). Splenocytes from the immunized mice were collected and subsequently fused with SP2/0 mouse myeloma cells. Positive hybridoma clones were obtained after cell fusion and selection. ELISA was used to detect DR antibody titer in the cell supernatants. DR region-specific monoclonal antibodies were analyzed by dot blotting, Western blotting and immunofluorescence assay. Na + -K + -ATPase activity was detected by SensoLyte R FDP Protein Phosphatase Assay Kit and the protective effect of the monoclonal antibody against high glucose-induced cell injury was assessed in H9c2 cells. Results Three hybridoma cell lines which secreted stable DR monoclonal antibody were obtained. The strongest positive cell line, named DRm217, was selected to prepare ascites. Dot blotting, Western blotting and immunofluorescence assay showed that DRm217 recognized specially DR region of Na + -K + -ATPase and bound on H9c2 cell membranes. DRm217 stimulated Na + -K + -ATPase activity and alleviated high glucose-induced H9c2 cells injury. Conclusion The monoclonal antibodies against DR region of Na + -K + -ATPase α1 subunit is prepared.

Genotype‐specific pathogenic effects in human dilated cardiomyopathy

Science.gov (United States)

Schuldt, Maike; Harakalova, Magdalena; Vink, Aryan; Asselbergs, Folkert W.; Pinto, Jose R.; Krüger, Martina; Kuster, Diederik W. D.; van der Velden, Jolanda

2017-01-01

Key points Mutations in genes encoding cardiac troponin I (TNNI3) and cardiac troponin T (TNNT2) caused altered troponin protein stoichiometry in patients with dilated cardiomyopathy. TNNI3p.98trunc resulted in haploinsufficiency, increased Ca2+‐sensitivity and reduced length‐dependent activation. TNNT2p.K217del caused increased passive tension.A mutation in the gene encoding Lamin A/C (LMNA p.R331Q) led to reduced maximal force development through secondary disease remodelling in patients suffering from dilated cardiomyopathy.Our study shows that different gene mutations induce dilated cardiomyopathy via diverse cellular pathways. Abstract Dilated cardiomyopathy (DCM) can be caused by mutations in sarcomeric and non‐sarcomeric genes. In this study we defined the pathogenic effects of three DCM‐causing mutations: the sarcomeric mutations in genes encoding cardiac troponin I (TNNI3p.98truncation) and cardiac troponin T (TNNT2p.K217deletion; also known as the p.K210del) and the non‐sarcomeric gene mutation encoding lamin A/C (LMNAp.R331Q). We assessed sarcomeric protein expression and phosphorylation and contractile behaviour in single membrane‐permeabilized cardiomyocytes in human left ventricular heart tissue. Exchange with recombinant troponin complex was used to establish the direct pathogenic effects of the mutations in TNNI3 and TNNT2. The TNNI3p.98trunc and TNNT2p.K217del mutation showed reduced expression of troponin I to 39% and 51%, troponin T to 64% and 53%, and troponin C to 73% and 97% of controls, respectively, and altered stoichiometry between the three cardiac troponin subunits. The TNNI3p.98trunc showed pure haploinsufficiency, increased Ca2+‐sensitivity and impaired length‐dependent activation. The TNNT2p.K217del mutation showed a significant increase in passive tension that was not due to changes in titin isoform composition or phosphorylation. Exchange with wild‐type troponin complex corrected troponin protein levels to 83% of

Optimizing fluorescently tethered Hsp90 inhibitor dose for maximal specific uptake by breast tumors

Science.gov (United States)

Crouch, Brian T.; Duer, Joy; Wang, Roujia; Gallagher, Jennifer; Hall, Allison; Soo, Mary Scott; Hughes, Philip; Haystead, Timothy A. J.; Ramanujam, Nirmala

2018-03-01

Despite improvements in surgical resection, 20-40% of patients undergoing breast conserving surgery require at least one additional re-excision. Leveraging the unique surface expression of heat shock protein 90 (Hsp90), a chaperone protein involved in several key hallmarks of cancer, in breast cancer provides an exciting opportunity to identify residual disease during surgery. We developed a completely non-destructive strategy using HS-27, a fluorescently-tethered Hsp90 inhibitor, to assay surface Hsp90 expression on intact tissue specimens using a fluorescence microendoscope with a field of view of 750 μm and subcellular resolution of 4 μm. HS-27 consists of an FDA approved Hsp90 inhibitor tethered to fluorescein isothiocyanate (EX 488nm, EM 525nm). Here, we optimized ex vivo HS-27 administration in pre-clinical breast cancer models and validated our approach on 21 patients undergoing standard of care ultrasound guided core needle biopsy. HS-27 administration time was fixed at 1- minute to minimize imaging impact on clinical workflow. HS-27 and HS-217 (non-specific control) doses were modulated from 1 μM up to 100 μM to identify the dose maximizing the ratio of specific uptake (HS-27 fluorescence) to non-specific uptake (HS-217 fluorescence). The specificity ratio was maximized at 100 μM and was significantly greater than all other doses (pcancer makes this technology attractive for assessing tumor margins, as one agent can be used for all subtypes.

The Y-chromosome haplogroup C3*-F3918, likely attributed to the Mongol Empire, can be traced to a 2500-year-old nomadic group.

Science.gov (United States)

Zhang, Ye; Wu, Xiyan; Li, Jiawei; Li, Hongjie; Zhao, Yongbin; Zhou, Hui

2018-02-01

The Mongol Empire had a significant role in shaping the landscape of modern populations. Many populations living in Eurasia may have been the product of population mixture between ancient Mongolians and natives following the expansion of Mongol Empire. Geneticists have found that most of these populations carried the Y-haplogroup C3* (C-M217). To trace the history of haplogroup (Hg) C3* and to further understand the origin and development of Mongolians, ancient human remains from the Jinggouzi, Chenwugou and Gangga archaeological sites, which belonged to the Donghu, Xianbei and Shiwei, respectively, were analysed. Our results show that nine of the eleven males of the Gangga site, two of the eight males of Chengwugou site and all of the twelve males of Jinggouzi site were found to have mutations at M130 (Hg C), M217 (Hg C3), L1373 (C2b, ISOGG2015), with the absence of mutations at M93 (Hg C3a), P39 (Hg C3b), M48 (Hg C3c), M407 (Hg C3d) and P62 (Hg C3f). These samples were attributed to the Y-chromosome Hg C3* (Hg C2b, ISOGG2015), and most of them were further typed as Hg C2b1a based on the mutation at F3918. Finally, we inferred that the Y-chromosome Hg C3*-F3918 can trace its origins to the Donghu ancient nomadic group.

Knowledge, attitude and practice regarding lifestyle modification in type 2 diabetic patients.

Science.gov (United States)

Okonta, Henry I; Ikombele, John B; Ogunbanjo, Gboyega A

2014-12-09

The number of persons suffering from type 2 diabetes mellitus continues to rise worldwide and causes significant morbidity and mortality, especially in the developing world. Behaviour change and adoption of healthy lifestyle habits help to prevent or slow down the complications of type 2 diabetes mellitus. However, the knowledge and practice of healthy lifestyles in many diabetic patients have been inadequate. This study sought to establish the knowledge, attitude and practice regarding lifestyle modification amongst type 2 diabetic patients. The diabetic clinic of Mamelodi hospital, Pretoria, Gauteng Province, South Africa. A cross-sectional study was done using a structured questionnaire amongst 217 type 2 diabetic patients seen at the diabetic clinic of Mamelodi hospital. Baseline characteristics of the participants were obtained and their knowledge, attitude and practice regarding lifestyle modification were assessed. Of the 217 participants, 154 (71%) were obese and 15 (7%) were morbidly obese. The majority of respondents (92.2%) had poor knowledge of the benefits of exercise, weight loss and a healthy diet. What is interesting is that the majority (97.7%) demonstrated bad practices in relation to lifestyle modifications, although over four-fifths (84.3%) had a positive attitude toward healthy lifestyle modifications. Despite the positive attitudes of respondents toward healthy lifestyle modifications, the knowledge and practice regarding lifestyle modifications amongst type 2 diabetes mellitus participants seen at Mamelodi hospital were generally poor.

Recovery of barotrauma injuries in Chinook salmon, Oncorhynchus tshawytscha from exposure to pile driving sound.

Directory of Open Access Journals (Sweden)

Brandon M Casper

Full Text Available Juvenile Chinook salmon, Oncorhynchus tshawytscha, were exposed to simulated high intensity pile driving signals to evaluate their ability to recover from barotrauma injuries. Fish were exposed to one of two cumulative sound exposure levels for 960 pile strikes (217 or 210 dB re 1 µPa(2·s SEL(cum; single strike sound exposure levels of 187 or 180 dB re 1 µPa(2⋅s SEL(ss respectively. This was followed by an immediate assessment of injuries, or assessment 2, 5, or 10 days post-exposure. There were no observed mortalities from the pile driving sound exposure. Fish exposed to 217 dB re 1 µPa(2·s SEL(cum displayed evidence of healing from injuries as post-exposure time increased. Fish exposed to 210 dB re 1 µPa(2·s SEL(cum sustained minimal injuries that were not significantly different from control fish at days 0, 2, and 10. The exposure to 210 dB re 1 µPa(2·s SEL(cum replicated the findings in a previous study that defined this level as the threshold for onset of injury. Furthermore, these data support the hypothesis that one or two Mild injuries resulting from pile driving exposure are unlikely to affect the survival of the exposed animals, at least in a laboratory environment.

Ballooning behavior in the golden orbweb spider Nephilapilipes (Araneae: Nephilidae

Directory of Open Access Journals (Sweden)

Vanessa M.J. Lee

2015-01-01

Full Text Available Ballooning, a mode of aerial dispersal in spiders, is an innate behavior that requires appropriate physiological and meteorological conditions. Although only rarely reported in the golden orbweb spiders, family Nephilidae, the large geographic distributions of most nephilids—in particular of Nephila species—would imply that these spiders likely routinely disperse by ballooning in spite of giant female sizes. Here we study ballooning behavior in the golden orbweb spider Nephila pilipes (Fabricius, 1793. Specifically, we test for the propensity of spiderlings to deploy ballooning as a dispersal mechanism. We subjected a total of 59 first-instar spiderlings to a wind experiment at two wind speeds (2.17 ± 0.02 m s-1 and 3.17 ± 0.02 m s-1 under laboratory conditions. Under an average wind speed of 3.17 m s-1, none of the spiderlings exhibited pre-ballooning or ballooning behavior. However, at an average wind speed of 2.17 m s-1, 53 (89.8% spiderlings showed pre-ballooning behavior, and 17 (32.1% of the pre-ballooners ultimately ballooned. Our results concur with prior reports on spiderlings of other families that pre-ballooning behavior is a requirement for ballooning to occur. Furthermore, although we cannot rule out other dispersal mechanisms such as synanthropic spread, our findings suggest that the widespread N. pilipes uses ballooning to colonize remote oceanic islands.

Hot wire production of single-wall and multi-wall carbon nanotubes

Science.gov (United States)

Dillon, Anne C.; Mahan, Archie H.; Alleman, Jeffrey L.

2010-10-26

Apparatus (210) for producing a multi-wall carbon nanotube (213) may comprise a process chamber (216), a furnace (217) operatively associated with the process chamber (216), and at least one filament (218) positioned within the process chamber (216). At least one power supply (220) operatively associated with the at least one filament (218) heats the at least one filament (218) to a process temperature. A gaseous carbon precursor material (214) operatively associated with the process chamber (216) provides carbon for forming the multi-wall carbon nanotube (213). A metal catalyst material (224) operatively associated with the process (216) catalyzes the formation of the multi-wall carbon nanotube (213).

Evaluation of the new Vitek 2 ANC card for identification of medically relevant anaerobic bacteria.

Science.gov (United States)

Mory, Francine; Alauzet, Corentine; Matuszeswski, Céline; Riegel, Philippe; Lozniewski, Alain

2009-06-01

Of 261 anaerobic clinical isolates tested with the new Vitek 2 ANC card, 257 (98.5%) were correctly identified at the genus level. Among the 251 strains for which identification at the species level is possible with regard to the ANC database, 217 (86.5%) were correctly identified at the species level. Two strains (0.8%) were not identified, and eight were misidentified (3.1%). Of the 21 strains (8.1%) with low-level discrimination results, 14 were correctly identified at the species level by using the recommended additional tests. This system is a satisfactory new automated tool for the rapid identification of most anaerobic bacteria isolated in clinical laboratories.

40 CFR 408.71 - Specialized definitions.

Science.gov (United States)

2010-07-01

... waste water amenable to measurement by the method described in Methods for Chemical Analysis of Water and Wastes, 1971, Environmental Protection Agency, Analytical Quality Control Laboratory, page 217. (c...

Search for minimal supersymmetric standard model Higgs Bosons H / A and for a $Z^{\\prime}$ boson in the $\\tau\\tau $ final state produced in pp collisions at $\\sqrt{s}$= 13 TeV with the ATLAS detector

Energy Technology Data Exchange (ETDEWEB)

Aaboud, M.; Aad, G.; Abbott, B.; Abdallah, J.; Abdinov, O.; Abeloos, B.; Aben, R.; AbouZeid, O. S.; Abraham, N. L.; Abramowicz, H.; Abreu, H.; Abreu, R.; Abulaiti, Y.; Acharya, B. S.; Adachi, S.; Adamczyk, L.; Adams, D. L.; Adelman, J.; Adomeit, S.; Adye, T.; Affolder, A. A.; Agatonovic-Jovin, T.; Agricola, J.; Aguilar-Saavedra, J. A.; Ahlen, S. P.; Ahmadov, F.; Aielli, G.; Akerstedt, H.; Åkesson, T. P. A.; Akimov, A. V.; Alberghi, G. L.; Albert, J.; Albrand, S.; Verzini, M. J. Alconada; Aleksa, M.; Aleksandrov, I. N.; Alexa, C.; Alexander, G.; Alexopoulos, T.; Alhroob, M.; Ali, B.; Aliev, M.; Alimonti, G.; Alison, J.; Alkire, S. P.; Allbrooke, B. M. M.; Allen, B. W.; Allport, P. P.; Aloisio, A.; Alonso, A.; Alonso, F.; Alpigiani, C.; Alshehri, A. A.; Alstaty, M.; Alvarez Gonzalez, B.; Álvarez Piqueras, D.; Alviggi, M. G.; Amadio, B. T.; Amako, K.; Amaral Coutinho, Y.; Amelung, C.; Amidei, D.; Amor Dos Santos, S. P.; Amorim, A.; Amoroso, S.; Amundsen, G.; Anastopoulos, C.; Ancu, L. S.; Andari, N.; Andeen, T.; Anders, C. F.; Anders, G.; Anders, J. K.; Anderson, K. J.; Andreazza, A.; Andrei, V.; Angelidakis, S.; Angelozzi, I.; Anger, P.; Angerami, A.; Anghinolfi, F.; Anisenkov, A. V.; Anjos, N.; Annovi, A.; Antel, C.; Antonelli, M.; Antonov, A.; Anulli, F.; Aoki, M.; Bella, L. Aperio; Arabidze, G.; Arai, Y.; Araque, J. P.; Arce, A. T. H.; Arduh, F. A.; Arguin, J-F.; Argyropoulos, S.; Arik, M.; Armbruster, A. J.; Armitage, L. J.; Arnaez, O.; Arnold, H.; Arratia, M.; Arslan, O.; Artamonov, A.; Artoni, G.; Artz, S.; Asai, S.; Asbah, N.; Ashkenazi, A.; Åsman, B.; Asquith, L.; Assamagan, K.; Astalos, R.; Atkinson, M.; Atlay, N. B.; Augsten, K.; Avolio, G.; Axen, B.; Ayoub, M. K.; Azuelos, G.; Baak, M. A.; Baas, A. E.; Baca, M. J.; Bachacou, H.; Bachas, K.; Backes, M.; Backhaus, M.; Bagiacchi, P.; Bagnaia, P.; Bai, Y.; Baines, J. T.; Baker, O. K.; Baldin, E. M.; Balek, P.; Balestri, T.; Balli, F.; Balunas, W. K.; Banas, E.; Banerjee, Sw.; Bannoura, A. A. E.; Barak, L.; Barberio, E. L.; Barberis, D.; Barbero, M.; Barillari, T.; Barisits, M-S; Barklow, T.; Barlow, N.; Barnes, S. L.; Barnett, B. M.; Barnett, R. M.; Barnovska-Blenessy, Z.; Baroncelli, A.; Barone, G.; Barr, A. J.; Barranco Navarro, L.; Barreiro, F.; Baarreiro Guimrães da Costa, J.; Bartoldus, R.; Barton, A. E.; Bartos, P.; Basalaev, A.; Bassalat, A.; Bates, R. L.; Batista, S. J.; Batley, J. R.; Battaglia, M.; Bauce, M.; Bauer, F.; Bawa, H. S.; Beacham, J. B.; Beattie, M. D.; Beau, T.; Beauchemin, P. H.; Bechtle, P.; Beck, H. P.; Becker, K.; Becker, M.; Beckingham, M.; Becot, C.; Beddall, A. J.; Beddall, A.; Bednyakov, V. A.; Bedognetti, M.; Bee, C. P.; Beemster, L. J.; Beermann, T. A.; Begel, M.; Behr, J. K.; Belanger-Champagne, C.; Bell, A. S.; Bella, G.; Bellagamba, L.; Bellerive, A.; Bellomo, M.; Belotskiy, K.; Beltramello, O.; Belyaev, N. L.; Benary, O.; Benchekroun, D.; Bender, M.; Bendtz, K.; Benekos, N.; Benhammou, Y.; Benhar Noccioli, E.; Benitez, J.; Benjamin, D. P.; Bensinger, J. R.; Bentvelsen, S.; Beresford, L.; Beretta, M.; Berge, D.; Bergeaas Kuutmann, E.; Berger, N.; Beringer, J.; Berlendis, S.; Bernard, N. R.; Bernius, C.; Bernlochner, F. U.; Berry, T.; Berta, P.; Bertella, C.; Bertoli, G.; Bertolucci, F.; Bertram, I. A.; Bertsche, C.; Bertsche, D.; Besjes, G. J.; Bessidskaia Bylund, O.; Bessner, M.; Besson, N.; Betancourt, C.; Bethani, A.; Bethke, S.; Bevan, A. J.; Bianchi, R. M.; Bianchini, L.; Bianco, M.; Biebel, O.; Biedermann, D.; Bielski, R.; Biesuz, N. V.; Biglietti, M.; De Mendizabal, J. Bilbao; Billoud, T. R. V.; Bilokon, H.; Bindi, M.; Binet, S.; Bingul, A.; Bini, C.; Biondi, S.; Bisanz, T.; Bjergaard, D. M.; Black, C. W.; Black, J. E.; Black, K. M.; Blackburn, D.; Blair, R. E.; Blanchard, J. -B.; Blazek, T.; Bloch, I.; Blocker, C.; Blue, A.; Blum, W.; Blumenschein, U.; Blunier, S.; Bobbink, G. J.; Bobrovnikov, V. S.; Bocchetta, S. S.; Bocci, A.; Bock, C.; Boehler, M.; Boerner, D.; Bogaerts, J. A.; Bogavac, D.; Bogdanchikov, A. G.; Bohm, C.; Boisvert, V.; Bokan, P.; Bold, T.; Boldyrev, A. S.; Bomben, M.; Bona, M.; Boonekamp, M.; Borisov, A.; Borissov, G.; Bortfeldt, J.; Bortoletto, D.; Bortolotto, V.; Bos, K.; Boscherini, D.; Bosman, M.; Bossio Sola, J. D.; Boudreau, J.; Bouffard, J.; Bouhova-Thacker, E. V.; Boumediene, D.; Bourdarios, C.; Boutle, S. K.; Boveia, A.; Boyd, J.; Boyko, I. R.; Bracinik, J.; Brandt, A.; Brandt, G.; Brandt, O.; Bratzler, U.; Brau, B.; Brau, J. E.; Breaden Madden, W. D.; Brendlinger, K.; Brennan, A. J.; Brenner, L.; Brenner, R.; Bressler, S.; Bristow, T. M.; Britton, D.; Britzger, D.; Brochu, F. M.; Brock, I.; Brock, R.; Brooijmans, G.; Brooks, T.; Brooks, W. K.; Brosamer, J.; Brost, E.; Broughton, J. H.; de Renstrom, P. A. Bruckman; Bruncko, D.; Bruneliere, R.; Bruni, A.; Bruni, G.; Bruni, L. S.; Brunt, BH; Bruschi, M.; Bruscino, N.; Bryant, P.; Bryngemark, L.; Buanes, T.; Buat, Q.; Buchholz, P.; Buckley, A. G.; Budagov, I. A.; Buehrer, F.; Bugge, M. K.; Bulekov, O.; Bullock, D.; Burckhart, H.; Burdin, S.; Burgard, C. D.; Burghgrave, B.; Burka, K.; Burke, S.; Burmeister, I.; Burr, J. T. P.; Busato, E.; Büscher, D.; Büscher, V.; Bussey, P.; Butler, J. M.; Buttar, C. M.; Butterworth, J. M.; Butti, P.; Buttinger, W.; Buzatu, A.; Buzykaev, A. R.; Cabrera Urbán, S.; Caforio, D.; Cairo, V. M.; Cakir, O.; Calace, N.; Calafiura, P.; Calandri, A.; Calderini, G.; Calfayan, P.; Callea, G.; Caloba, L. P.; Calvente Lopez, S.; Calvet, D.; Calvet, S.; Calvet, T. P.; Camacho Toro, R.; Camarda, S.; Camarri, P.; Cameron, D.; Caminal Armadans, R.; Camincher, C.; Campana, S.; Campanelli, M.; Camplani, A.; Campoverde, A.; Canale, V.; Canepa, A.; Cano Bret, M.; Cantero, J.; Cao, T.; Capeans Garrido, M. D. M.; Caprini, I.; Caprini, M.; Capua, M.; Carbone, R. M.; Cardarelli, R.; Cardillo, F.; Carli, I.; Carli, T.; Carlino, G.; Carminati, L.; Caron, S.; Carquin, E.; Carrillo-Montoya, G. D.; Carter, J. R.; Carvalho, J.; Casadei, D.; Casado, M. P.; Casolino, M.; Casper, D. W.; Castaneda-Miranda, E.; Castelijn, R.; Castelli, A.; Castillo Gimenez, V.; Castro, N. F.; Catinaccio, A.; Catmore, J. R.; Cattai, A.; Caudron, J.; Cavaliere, V.; Cavallaro, E.; Cavalli, D.; Cavalli-Sforza, M.; Cavasinni, V.; Ceradini, F.; Cerda Alberich, L.; Cerio, B. C.; Cerqueira, A. S.; Cerri, A.; Cerrito, L.; Cerutti, F.; Cerv, M.; Cervelli, A.; Cetin, S. A.; Chafaq, A.; Chakraborty, D.; Chan, S. K.; Chan, Y. L.; Chang, P.; Chapman, J. D.; Charlton, D. G.; Chatterjee, A.; Chau, C. C.; Chavez Barajas, C. A.; Che, S.; Cheatham, S.; Chegwidden, A.; Chekanov, S.; Chekulaev, S. V.; Chelkov, G. A.; Chelstowska, M. A.; Chen, C.; Chen, H.; Chen, K.; Chen, S.; Chen, S.; Chen, X.; Chen, Y.; Cheng, H. C.; Cheng, H. J.; Cheng, Y.; Cheplakov, A.; Cheremushkina, E.; Moursli, R. Cherkaoui El; Chernyatin, V.; Cheu, E.; Chevalier, L.; Chiarella, V.; Chiarelli, G.; Chiodini, G.; Chisholm, A. S.; Chitan, A.; Chizhov, M. V.; Choi, K.; Chomont, A. R.; Chouridou, S.; Chow, B. K. B.; Christodoulou, V.; Chromek-Burckhart, D.; Chudoba, J.; Chuinard, A. J.; Chwastowski, J. J.; Chytka, L.; Ciapetti, G.; Ciftci, A. K.; Cinca, D.; Cindro, V.; Cioara, I. A.; Ciocca, C.; Ciocio, A.; Cirotto, F.; Citron, Z. H.; Citterio, M.; Ciubancan, M.; Clark, A.; Clark, B. L.; Clark, M. R.; Clark, P. J.; Clarke, R. N.; Clement, C.; Coadou, Y.; Cobal, M.; Coccaro, A.; Cochran, J.; Colasurdo, L.; Cole, B.; Colijn, A. P.; Collot, J.; Colombo, T.; Compostella, G.; Conde Muiño, P.; Coniavitis, E.; Connell, S. H.; Connelly, I. A.; Consorti, V.; Constantinescu, S.; Conti, G.; Conventi, F.; Cooke, M.; Cooper, B. D.; Cooper-Sarkar, A. M.; Cormier, K. J. R.; Cornelissen, T.; Corradi, M.; Corriveau, F.; Cortes-Gonzalez, A.; Cortiana, G.; Costa, G.; Costa, M. J.; Costanzo, D.; Cottin, G.; Cowan, G.; Cox, B. E.; Cranmer, K.; Crawley, S. J.; Cree, G.; Crépé-Renaudin, S.; Crescioli, F.; Cribbs, W. A.; Crispin Ortuzar, M.; Cristinziani, M.; Croft, V.; Crosetti, G.; Cueto, A.; Cuhadar Donszelmann, T.; Cummings, J.; Curatolo, M.; Cúth, J.; Czirr, H.; Czodrowski, P.; D’amen, G.; D’Auria, S.; D’Onofrio, M.; De Sousa, M. J. Da Cunha Sargedas; Via, C. Da; Dabrowski, W.; Dado, T.; Dai, T.; Dale, O.; Dallaire, F.; Dallapiccola, C.; Dam, M.; Dandoy, J. R.; Dang, N. P.; Daniells, A. C.; Dann, N. S.; Danninger, M.; Dano Hoffmann, M.; Dao, V.; Darbo, G.; Darmora, S.; Dassoulas, J.; Dattagupta, A.; Davey, W.; David, C.; Davidek, T.; Davies, M.; Davison, P.; Dawe, E.; Dawson, I.; De, K.; de Asmundis, R.; De Benedetti, A.; De Castro, S.; De Cecco, S.; De Groot, N.; de Jong, P.; De la Torre, H.; De Lorenzi, F.; De Maria, A.; De Pedis, D.; De Salvo, A.; De Sanctis, U.; De Santo, A.; De Regie, J. B. De Vivie; Dearnaley, W. J.; Debbe, R.; Debenedetti, C.; Dedovich, D. V.; Dehghanian, N.; Deigaard, I.; Del Gaudio, M.; Del Peso, J.; Del Prete, T.; Delgove, D.; Deliot, F.; Delitzsch, C. M.; Dell’Acqua, A.; Dell’Asta, L.; Dell’Orso, M.; Della Pietra, M.; della Volpe, D.; Delmastro, M.; Delsart, P. A.; DeMarco, D. A.; Demers, S.; Demichev, M.; Demilly, A.; Denisov, S. P.; Denysiuk, D.; Derendarz, D.; Derkaoui, J. E.; Derue, F.; Dervan, P.; Desch, K.; Deterre, C.; Dette, K.; Deviveiros, P. O.; Dewhurst, A.; Dhaliwal, S.; Di Ciaccio, A.; Di Ciaccio, L.; Di Clemente, W. K.; Di Donato, C.; Di Girolamo, A.; Di Girolamo, B.; Di Micco, B.; Di Nardo, R.; Di Simone, A.; Di Sipio, R.; Di Valentino, D.; Diaconu, C.; Diamond, M.; Dias, F. A.; Diaz, M. A.; Diehl, E. B.; Dietrich, J.; Cornell, S. Díez; Dimitrievska, A.; Dingfelder, J.; Dita, P.; Dita, S.; Dittus, F.; Djama, F.; Djobava, T.; Djuvsland, J. I.; do Vale, M. A. B.; Dobos, D.; Dobre, M.; Doglioni, C.; Dolejsi, J.; Dolezal, Z.; Donadelli, M.; Donati, S.; Dondero, P.; Donini, J.; Dopke, J.; Doria, A.; Dova, M. T.; Doyle, A. T.; Drechsler, E.; Dris, M.; Du, Y.; Duarte-Campderros, J.; Duchovni, E.; Duckeck, G.; Ducu, O. A.; Duda, D.; Dudarev, A.; Dudder, A. Chr.; Duffield, E. M.; Duflot, L.; Dührssen, M.; Dumancic, M.; Dunford, M.; Duran Yildiz, H.; Düren, M.; Durglishvili, A.; Duschinger, D.; Dutta, B.; Dyndal, M.; Eckardt, C.; Ecker, K. M.; Edgar, R. C.; Edwards, N. C.; Eifert, T.; Eigen, G.; Einsweiler, K.; Ekelof, T.; Kacimi, M. El; Ellajosyula, V.; Ellert, M.; Elles, S.; Ellinghaus, F.; Elliot, A. A.; Ellis, N.; Elmsheuser, J.; Elsing, M.; Emeliyanov, D.; Enari, Y.; Endner, O. C.; Ennis, J. S.; Erdmann, J.; Ereditato, A.; Ernis, G.; Ernst, J.; Ernst, M.; Errede, S.; Ertel, E.; Escalier, M.; Esch, H.; Escobar, C.; Esposito, B.; Etienvre, A. I.; Etzion, E.; Evans, H.; Ezhilov, A.; Ezzi, M.; Fabbri, F.; Fabbri, L.; Facini, G.; Fakhrutdinov, R. M.; Falciano, S.; Falla, R. J.; Faltova, J.; Fang, Y.; Fanti, M.; Farbin, A.; Farilla, A.; Farina, C.; Farina, E. M.; Farooque, T.; Farrell, S.; Farrington, S. M.; Farthouat, P.; Fassi, F.; Fassnacht, P.; Fassouliotis, D.; Faucci Giannelli, M.; Favareto, A.; Fawcett, W. J.; Fayard, L.; Fedin, O. L.; Fedorko, W.; Feigl, S.; Feligioni, L.; Feng, C.; Feng, E. J.; Feng, H.; Fenyuk, A. B.; Feremenga, L.; Fernandez Martinez, P.; Fernandez Perez, S.; Ferrando, J.; Ferrari, A.; Ferrari, P.; Ferrari, R.; de Lima, D. E. Ferreira; Ferrer, A.; Ferrere, D.; Ferretti, C.; Ferretto Parodi, A.; Fiedler, F.; Filipčič, A.; Filipuzzi, M.; Filthaut, F.; Fincke-Keeler, M.; Finelli, K. D.; Fiolhais, M. C. N.; Fiorini, L.; Firan, A.; Fischer, A.; Fischer, C.; Fischer, J.; Fisher, W. C.; Flaschel, N.; Fleck, I.; Fleischmann, P.; Fletcher, G. T.; Fletcher, R. R. M.; Flick, T.; Flores Castillo, L. R.; Flowerdew, M. J.; Forcolin, G. T.; Formica, A.; Forti, A.; Foster, A. G.; Fournier, D.; Fox, H.; Fracchia, S.; Francavilla, P.; Franchini, M.; Francis, D.; Franconi, L.; Franklin, M.; Frate, M.; Fraternali, M.; Freeborn, D.; Fressard-Batraneanu, S. M.; Friedrich, F.; Froidevaux, D.; Frost, J. A.; Fukunaga, C.; Fullana Torregrosa, E.; Fusayasu, T.; Fuster, J.; Gabaldon, C.; Gabizon, O.; Gabrielli, A.; Gabrielli, A.; Gach, G. P.; Gadatsch, S.; Gadomski, S.; Gagliardi, G.; Gagnon, L. G.; Gagnon, P.; Galea, C.; Galhardo, B.; Gallas, E. J.; Gallop, B. J.; Gallus, P.; Galster, G.; Gan, K. K.; Gao, J.; Gao, Y.; Gao, Y. S.; Garay Walls, F. M.; García, C.; García Navarro, J. E.; Garcia-Sciveres, M.; Gardner, R. W.; Garelli, N.; Garonne, V.; Gascon Bravo, A.; Gasnikova, K.; Gatti, C.; Gaudiello, A.; Gaudio, G.; Gauthier, L.; Gavrilenko, I. L.; Gay, C.; Gaycken, G.; Gazis, E. N.; Gecse, Z.; Gee, C. N. P.; Geich-Gimbel, Ch.; Geisen, M.; Geisler, M. P.; Gellerstedt, K.; Gemme, C.; Genest, M. H.; Geng, C.; Gentile, S.; Gentsos, C.; George, S.; Gerbaudo, D.; Gershon, A.; Ghasemi, S.; Ghneimat, M.; Giacobbe, B.; Giagu, S.; Giannetti, P.; Gibbard, B.; Gibson, S. M.; Gignac, M.; Gilchriese, M.; Gillam, T. P. S.; Gillberg, D.; Gilles, G.; Gingrich, D. M.; Giokaris, N.; Giordani, M. P.; Giorgi, F. M.; Giorgi, F. M.; Giraud, P. F.; Giromini, P.; Giugni, D.; Giuli, F.; Giuliani, C.; Giulini, M.; Gjelsten, B. K.; Gkaitatzis, S.; Gkialas, I.; Gkougkousis, E. L.; Gladilin, L. K.; Glasman, C.; Glatzer, J.; Glaysher, P. C. F.; Glazov, A.; Goblirsch-Kolb, M.; Godlewski, J.; Goldfarb, S.; Golling, T.; Golubkov, D.; Gomes, A.; Gonçalo, R.; Costa, J. Goncalves Pinto Firmino Da; Gonella, G.; Gonella, L.; Gongadze, A.; de la Hoz, S. González; Parra, G. Gonzalez; Gonzalez-Sevilla, S.; Goossens, L.; Gorbounov, P. A.; Gordon, H. A.; Gorelov, I.; Gorini, B.; Gorini, E.; Gorišek, A.; Gornicki, E.; Goshaw, A. T.; Gössling, C.; Gostkin, M. I.; Goudet, C. R.; Goujdami, D.; Goussiou, A. G.; Govender, N.; Gozani, E.; Graber, L.; Grabowska-Bold, I.; Gradin, P. O. J.; Grafström, P.; Gramling, J.; Gramstad, E.; Grancagnolo, S.; Gratchev, V.; Gravila, P. M.; Gray, H. M.; Graziani, E.; Greenwood, Z. D.; Grefe, C.; Gregersen, K.; Gregor, I. M.; Grenier, P.; Grevtsov, K.; Griffiths, J.; Grillo, A. A.; Grimm, K.; Grinstein, S.; Gris, Ph.; Grivaz, J. -F.; Groh, S.; Grohs, J. P.; Gross, E.; Grosse-Knetter, J.; Grossi, G. C.; Grout, Z. J.; Guan, L.; Guan, W.; Guenther, J.; Guescini, F.; Guest, D.; Gueta, O.; Guido, E.; Guillemin, T.; Guindon, S.; Gul, U.; Gumpert, C.; Guo, J.; Guo, Y.; Gupta, R.; Gupta, S.; Gustavino, G.; Gutierrez, P.; Gutierrez Ortiz, N. G.; Gutschow, C.; Guyot, C.; Gwenlan, C.; Gwilliam, C. B.; Haas, A.; Haber, C.; Hadavand, H. K.; Haddad, N.; Hadef, A.; Hageböck, S.; Hagihara, M.; Hajduk, Z.; Hakobyan, H.; Haleem, M.; Haley, J.; Halladjian, G.; Hallewell, G. D.; Hamacher, K.; Hamal, P.; Hamano, K.; Hamilton, A.; Hamity, G. N.; Hamnett, P. G.; Han, L.; Hanagaki, K.; Hanawa, K.; Hance, M.; Haney, B.; Hanke, P.; Hanna, R.; Hansen, J. B.; Hansen, J. D.; Hansen, M. C.; Hansen, P. H.; Hara, K.; Hard, A. S.; Harenberg, T.; Hariri, F.; Harkusha, S.; Harrington, R. D.; Harrison, P. F.; Hartjes, F.; Hartmann, N. M.; Hasegawa, M.; Hasegawa, Y.; Hasib, A.; Hassani, S.; Haug, S.; Hauser, R.; Hauswald, L.; Havranek, M.; Hawkes, C. M.; Hawkings, R. J.; Hayakawa, D.; Hayden, D.; Hays, C. P.; Hays, J. M.; Hayward, H. S.; Haywood, S. J.; Head, S. J.; Heck, T.; Hedberg, V.; Heelan, L.; Heim, S.; Heim, T.; Heinemann, B.; Heinrich, J. J.; Heinrich, L.; Heinz, C.; Hejbal, J.; Helary, L.; Hellman, S.; Helsens, C.; Henderson, J.; Henderson, R. C. W.; Heng, Y.; Henkelmann, S.; Henriques Correia, A. M.; Henrot-Versille, S.; Herbert, G. H.; Herde, H.; Herget, V.; Hernández Jiménez, Y.; Herten, G.; Hertenberger, R.; Hervas, L.; Hesketh, G. G.; Hessey, N. P.; Hetherly, J. W.; Hickling, R.; Higón-Rodriguez, E.; Hill, E.; Hill, J. C.; Hiller, K. H.; Hillier, S. J.; Hinchliffe, I.; Hines, E.; Hinman, R. R.; Hirose, M.; Hirschbuehl, D.; Hobbs, J.; Hod, N.; Hodgkinson, M. C.; Hodgson, P.; Hoecker, A.; Hoeferkamp, M. R.; Hoenig, F.; Hohn, D.; Holmes, T. R.; Homann, M.; Honda, T.; Hong, T. M.; Hooberman, B. H.; Hopkins, W. H.; Horii, Y.; Horton, A. J.; Hostachy, J-Y.; Hou, S.; Hoummada, A.; Howarth, J.; Hoya, J.; Hrabovsky, M.; Hristova, I.; Hrivnac, J.; Hryn’ova, T.; Hrynevich, A.; Hsu, C.; Hsu, P. J.; Hsu, S. -C.; Hu, Q.; Hu, S.; Huang, Y.; Hubacek, Z.; Hubaut, F.; Huegging, F.; Huffman, T. B.; Hughes, E. W.; Hughes, G.; Huhtinen, M.; Huo, P.; Huseynov, N.; Huston, J.; Huth, J.; Iacobucci, G.; Iakovidis, G.; Ibragimov, I.; Iconomidou-Fayard, L.; Ideal, E.; Idrissi, Z.; Iengo, P.; Igonkina, O.; Iizawa, T.; Ikegami, Y.; Ikeno, M.; Ilchenko, Y.; Iliadis, D.; Ilic, N.; Ince, T.; Introzzi, G.; Ioannou, P.; Iodice, M.; Iordanidou, K.; Ippolito, V.; Ishijima, N.; Ishino, M.; Ishitsuka, M.; Ishmukhametov, R.; Issever, C.; Istin, S.; Ito, F.; Iturbe Ponce, J. M.; Iuppa, R.; Iwanski, W.; Iwasaki, H.; Izen, J. M.; Izzo, V.; Jabbar, S.; Jackson, B.; Jackson, P.; Jain, V.; Jakobi, K. B.; Jakobs, K.; Jakobsen, S.; Jakoubek, T.; Jamin, D. O.; Jana, D. K.; Jansky, R.; Janssen, J.; Janus, M.; Jarlskog, G.; Javadov, N.; Javůrek, T.; Jeanneau, F.; Jeanty, L.; Jeng, G. -Y.; Jennens, D.; Jenni, P.; Jeske, C.; Jézéquel, S.; Ji, H.; Jia, J.; Jiang, H.; Jiang, Y.; Jiggins, S.; Jimenez Pena, J.; Jin, S.; Jinaru, A.; Jinnouchi, O.; Jivan, H.; Johansson, P.; Johns, K. A.; Johnson, W. J.; Jon-And, K.; Jones, G.; Jones, R. W. L.; Jones, S.; Jones, T. J.; Jongmanns, J.; Jorge, P. M.; Jovicevic, J.; Ju, X.; Juste Rozas, A.; Köhler, M. K.; Kaczmarska, A.; Kado, M.; Kagan, H.; Kagan, M.; Kahn, S. J.; Kaji, T.; Kajomovitz, E.; Kalderon, C. W.; Kaluza, A.; Kama, S.; Kamenshchikov, A.; Kanaya, N.; Kaneti, S.; Kanjir, L.; Kantserov, V. A.; Kanzaki, J.; Kaplan, B.; Kaplan, L. S.; Kapliy, A.; Kar, D.; Karakostas, K.; Karamaoun, A.; Karastathis, N.; Kareem, M. J.; Karentzos, E.; Karnevskiy, M.; Karpov, S. N.; Karpova, Z. M.; Karthik, K.; Kartvelishvili, V.; Karyukhin, A. N.; Kasahara, K.; Kashif, L.; Kass, R. D.; Kastanas, A.; Kataoka, Y.; Kato, C.; Katre, A.; Katzy, J.; Kawagoe, K.; Kawamoto, T.; Kawamura, G.; Kazanin, V. F.; Keeler, R.; Kehoe, R.; Keller, J. S.; Kempster, J. J.; Kentaro, K.; Keoshkerian, H.; Kepka, O.; Kerševan, B. P.; Kersten, S.; Keyes, R. A.; Khader, M.; Khalil-zada, F.; Khanov, A.; Kharlamov, A. G.; Kharlamova, T.; Khoo, T. J.; Khovanskiy, V.; Khramov, E.; Khubua, J.; Kido, S.; Kilby, C. R.; Kim, H. Y.; Kim, S. H.; Kim, Y. K.; Kimura, N.; Kind, O. M.; King, B. T.; King, M.; Kirk, J.; Kiryunin, A. E.; Kishimoto, T.; Kisielewska, D.; Kiss, F.; Kiuchi, K.; Kivernyk, O.; Kladiva, E.; Klein, M. H.; Klein, M.; Klein, U.; Kleinknecht, K.; Klimek, P.; Klimentov, A.; Klingenberg, R.; Klinger, J. A.; Klioutchnikova, T.; Kluge, E. -E.; Kluit, P.; Kluth, S.; Knapik, J.; Kneringer, E.; Knoops, E. B. F. G.; Knue, A.; Kobayashi, A.; Kobayashi, D.; Kobayashi, T.; Kobel, M.; Kocian, M.; Kodys, P.; Koehler, N. M.; Koffas, T.; Koffeman, E.; Koi, T.; Kolanoski, H.; Kolb, M.; Koletsou, I.; Komar, A. A.; Komori, Y.; Kondo, T.; Kondrashova, N.; Köneke, K.; König, A. C.; Kono, T.; Konoplich, R.; Konstantinidis, N.; Kopeliansky, R.; Koperny, S.; Köpke, L.; Kopp, A. K.; Korcyl, K.; Kordas, K.; Korn, A.; Korol, A. A.; Korolkov, I.; Korolkova, E. V.; Kortner, O.; Kortner, S.; Kosek, T.; Kostyukhin, V. V.; Kotwal, A.; Kourkoumeli-Charalampidi, A.; Kourkoumelis, C.; Kouskoura, V.; Kowalewska, A. B.; Kowalewski, R.; Kowalski, T. Z.; Kozakai, C.; Kozanecki, W.; Kozhin, A. S.; Kramarenko, V. A.; Kramberger, G.; Krasnopevtsev, D.; Krasny, M. W.; Krasznahorkay, A.; Kravchenko, A.; Kretz, M.; Kretzschmar, J.; Kreutzfeldt, K.; Krieger, P.; Krizka, K.; Kroeninger, K.; Kroha, H.; Kroll, J.; Kroseberg, J.; Krstic, J.; Kruchonak, U.; Krüger, H.; Krumnack, N.; Kruse, M. C.; Kruskal, M.; Kubota, T.; Kucuk, H.; Kuday, S.; Kuechler, J. T.; Kuehn, S.; Kugel, A.; Kuger, F.; Kuhl, A.; Kuhl, T.; Kukhtin, V.; Kukla, R.; Kulchitsky, Y.; Kuleshov, S.; Kuna, M.; Kunigo, T.; Kupco, A.; Kurashige, H.; Kurochkin, Y. A.; Kus, V.; Kuwertz, E. S.; Kuze, M.; Kvita, J.; Kwan, T.; Kyriazopoulos, D.; Rosa, A. La; Navarro, J. L. La Rosa; Rotonda, L. La; Lacasta, C.; Lacava, F.; Lacey, J.; Lacker, H.; Lacour, D.; Lacuesta, V. R.; Ladygin, E.; Lafaye, R.; Laforge, B.; Lagouri, T.; Lai, S.; Lammers, S.; Lampl, W.; Lançon, E.; Landgraf, U.; Landon, M. P. J.; Lanfermann, M. C.; Lang, V. S.; Lange, J. C.; Lankford, A. J.; Lanni, F.; Lantzsch, K.; Lanza, A.; Laplace, S.; Lapoire, C.; Laporte, J. F.; Lari, T.; Manghi, F. Lasagni; Lassnig, M.; Laurelli, P.; Lavrijsen, W.; Law, A. T.; Laycock, P.; Lazovich, T.; Lazzaroni, M.; Le, B.; Dortz, O. Le; Guirriec, E. Le; Quilleuc, E. P. Le; LeBlanc, M.; LeCompte, T.; Ledroit-Guillon, F.; Lee, C. A.; Lee, S. C.; Lee, L.; Lefebvre, B.; Lefebvre, G.; Lefebvre, M.; Legger, F.; Leggett, C.; Lehan, A.; Lehmann Miotto, G.; Lei, X.; Leight, W. A.; Leisos, A.; Leister, A. G.; Leite, M. A. L.; Leitner, R.; Lellouch, D.; Lemmer, B.; Leney, K. J. C.; Lenz, T.; Lenzi, B.; Leone, R.; Leone, S.; Leonidopoulos, C.; Leontsinis, S.; Lerner, G.; Leroy, C.; Lesage, A. A. J.; Lester, C. G.; Levchenko, M.; Levêque, J.; Levin, D.; Levinson, L. J.; Levy, M.; Lewis, D.; Leyko, A. M.; Leyton, M.; Li, B.; Li, C.; Li, H.; Li, H. L.; Li, L.; Li, L.; Li, Q.; Li, S.; Li, X.; Li, Y.; Liang, Z.; Liberti, B.; Liblong, A.; Lichard, P.; Lie, K.; Liebal, J.; Liebig, W.; Limosani, A.; Lin, S. C.; Lin, T. H.; Lindquist, B. E.; Lionti, A. E.; Lipeles, E.; Lipniacka, A.; Lisovyi, M.; Liss, T. M.; Lister, A.; Litke, A. M.; Liu, B.; Liu, D.; Liu, H.; Liu, H.; Liu, J.; Liu, J. B.; Liu, K.; Liu, L.; Liu, M.; Liu, M.; Liu, Y. L.; Liu, Y.; Livan, M.; Lleres, A.; Merino, J. Llorente; Lloyd, S. L.; Sterzo, F. Lo; Lobodzinska, E. M.; Loch, P.; Lockman, W. S.; Loebinger, F. K.; Loevschall-Jensen, A. E.; Loew, K. M.; Loginov, A.; Lohse, T.; Lohwasser, K.; Lokajicek, M.; Long, B. A.; Long, J. D.; Long, R. E.; Longo, L.; Looper, K. A.; López, J. A.; Lopez Mateos, D.; Lopez Paredes, B.; Lopez Paz, I.; Lopez Solis, A.; Lorenz, J.; Lorenzo Martinez, N.; Losada, M.; Lösel, P. J.; Lou, X.; Lounis, A.; Love, J.; Love, P. A.; Lu, H.; Lu, N.; Lubatti, H. J.; Luci, C.; Lucotte, A.; Luedtke, C.; Luehring, F.; Lukas, W.; Luminari, L.; Lundberg, O.; Lund-Jensen, B.; Luzi, P. M.; Lynn, D.; Lysak, R.; Lytken, E.; Lyubushkin, V.; Ma, H.; Ma, L. L.; Ma, Y.; Maccarrone, G.; Macchiolo, A.; Macdonald, C. M.; Maček, B.; Machado Miguens, J.; Madaffari, D.; Madar, R.; Maddocks, H. J.; Mader, W. F.; Madsen, A.; Maeda, J.; Maeland, S.; Maeno, T.; Maevskiy, A.; Magradze, E.; Mahlstedt, J.; Maiani, C.; Maidantchik, C.; Maier, A. A.; Maier, T.; Maio, A.; Majewski, S.; Makida, Y.; Makovec, N.; Malaescu, B.; Malecki, Pa.; Maleev, V. P.; Malek, F.; Mallik, U.; Malon, D.; Malone, C.; Malone, C.; Maltezos, S.; Malyukov, S.; Mamuzic, J.; Mancini, G.; Mandelli, L.; Mandić, I.; Maneira, J.; Filho, L. Manhaes de Andrade; Manjarres Ramos, J.; Mann, A.; Manousos, A.; Mansoulie, B.; Mansour, J. D.; Mantifel, R.; Mantoani, M.; Manzoni, S.; Mapelli, L.; Marceca, G.; March, L.; Marchiori, G.; Marcisovsky, M.; Marjanovic, M.; Marley, D. E.; Marroquim, F.; Marsden, S. P.; Marshall, Z.; Marti-Garcia, S.; Martin, B.; Martin, T. A.; Martin, V. J.; Latour, B. Martin dit; Martinez, M.; Martinez Outschoorn, V. I.; Martin-Haugh, S.; Martoiu, V. S.; Martyniuk, A. C.; Marzin, A.; Masetti, L.; Mashimo, T.; Mashinistov, R.; Masik, J.; Maslennikov, A. L.; Massa, I.; Massa, L.; Mastrandrea, P.; Mastroberardino, A.; Masubuchi, T.; Mättig, P.; Mattmann, J.; Maurer, J.; Maxfield, S. J.; Maximov, D. A.; Mazini, R.; Mazza, S. M.; Fadden, N. C. Mc; Goldrick, G. Mc; Kee, S. P. Mc; McCarn, A.; McCarthy, R. L.; McCarthy, T. G.; McClymont, L. I.; McDonald, E. F.; Mcfayden, J. A.; Mchedlidze, G.; McMahon, S. J.; McPherson, R. A.; Medinnis, M.; Meehan, S.; Mehlhase, S.; Mehta, A.; Meier, K.; Meineck, C.; Meirose, B.; Melini, D.; Mellado Garcia, B. R.; Melo, M.; Meloni, F.; Mengarelli, A.; Menke, S.; Meoni, E.; Mergelmeyer, S.; Mermod, P.; Merola, L.; Meroni, C.; Merritt, F. S.; Messina, A.; Metcalfe, J.; Mete, A. S.; Meyer, C.; Meyer, C.; Meyer, J-P.; Meyer, J.; Theenhausen, H. Meyer Zu; Miano, F.; Middleton, R. P.; Miglioranzi, S.; Mijović, L.; Mikenberg, G.; Mikestikova, M.; Mikuž, M.; Milesi, M.; Milic, A.; Miller, D. W.; Mills, C.; Milov, A.; Milstead, D. A.; Minaenko, A. A.; Minami, Y.; Minashvili, I. A.; Mincer, A. I.; Mindur, B.; Mineev, M.; Minegishi, Y.; Ming, Y.; Mir, L. M.; Mistry, K. P.; Mitani, T.; Mitrevski, J.; Mitsou, V. A.; Miucci, A.; Miyagawa, P. S.; Mjörnmark, J. U.; Mlynarikova, M.; Moa, T.; Mochizuki, K.; Mohapatra, S.; Molander, S.; Moles-Valls, R.; Monden, R.; Mondragon, M. C.; Mönig, K.; Monk, J.; Monnier, E.; Montalbano, A.; Montejo Berlingen, J.; Monticelli, F.; Monzani, S.; Moore, R. W.; Morange, N.; Moreno, D.; Moreno Llácer, M.; Morettini, P.; Morgenstern, S.; Mori, D.; Mori, T.; Morii, M.; Morinaga, M.; Morisbak, V.; Moritz, S.; Morley, A. K.; Mornacchi, G.; Morris, J. D.; Mortensen, S. S.; Morvaj, L.; Mosidze, M.; Moss, J.; Motohashi, K.; Mount, R.; Mountricha, E.; Moyse, E. J. W.; Muanza, S.; Mudd, R. D.; Mueller, F.; Mueller, J.; Mueller, R. S. P.; Mueller, T.; Muenstermann, D.; Mullen, P.; Mullier, G. A.; Munoz Sanchez, F. J.; Murillo Quijada, J. A.; Murray, W. J.; Musheghyan, H.; Muškinja, M.; Myagkov, A. G.; Myska, M.; Nachman, B. P.; Nackenhorst, O.; Nagai, K.; Nagai, R.; Nagano, K.; Nagasaka, Y.; Nagata, K.; Nagel, M.; Nagy, E.; Nairz, A. M.; Nakahama, Y.; Nakamura, K.; Nakamura, T.; Nakano, I.; Namasivayam, H.; Naranjo Garcia, R. F.; Narayan, R.; Narrias Villar, D. I.; Naryshkin, I.; Naumann, T.; Navarro, G.; Nayyar, R.; Neal, H. A.; Nechaeva, P. Yu.; Neep, T. J.; Negri, A.; Negrini, M.; Nektarijevic, S.; Nellist, C.; Nelson, A.; Nemecek, S.; Nemethy, P.; Nepomuceno, A. A.; Nessi, M.; Neubauer, M. S.; Neumann, M.; Neves, R. M.; Nevski, P.; Newman, P. R.; Nguyen, D. H.; Manh, T. Nguyen; Nickerson, R. B.; Nicolaidou, R.; Nielsen, J.; Nikiforov, A.; Nikolaenko, V.; Nikolic-Audit, I.; Nikolopoulos, K.; Nilsen, J. K.; Nilsson, P.; Ninomiya, Y.; Nisati, A.; Nisius, R.; Nobe, T.; Nomachi, M.; Nomidis, I.; Nooney, T.; Norberg, S.; Nordberg, M.; Norjoharuddeen, N.; Novgorodova, O.; Nowak, S.; Nozaki, M.; Nozka, L.; Ntekas, K.; Nurse, E.; Nuti, F.; O’grady, F.; O’Neil, D. C.; O’Rourke, A. A.; O’Shea, V.; Oakham, F. G.; Oberlack, H.; Obermann, T.; Ocariz, J.; Ochi, A.; Ochoa, I.; Ochoa-Ricoux, J. P.; Oda, S.; Odaka, S.; Ogren, H.; Oh, A.; Oh, S. H.; Ohm, C. C.; Ohman, H.; Oide, H.; Okawa, H.; Okumura, Y.; Okuyama, T.; Olariu, A.; Oleiro Seabra, L. F.; Olivares Pino, S. A.; Damazio, D.; Olszewski, A.; Olszowska, J.; Onofre, A.; Onogi, K.; Onyisi, P. U. E.; Oreglia, M. J.; Oren, Y.; Orestano, D.; Orlando, N.; Orr, R. S.; Osculati, B.; Ospanov, R.; Garzon, G. Otero y.; Otono, H.; Ouchrif, M.; Ould-Saada, F.; Ouraou, A.; Oussoren, K. P.; Ouyang, Q.; Owen, M.; Owen, R. E.; Ozcan, V. E.; Ozturk, N.; Pachal, K.; Pacheco Pages, A.; Pacheco Rodriguez, L.; Padilla Aranda, C.; Pagáčová, M.; Pagan Griso, S.; Paganini, M.; Paige, F.; Pais, P.; Pajchel, K.; Palacino, G.; Palazzo, S.; Palestini, S.; Palka, M.; Pallin, D.; Panagiotopoulou, E. St.; Pandini, C. E.; Panduro Vazquez, J. G.; Pani, P.; Panitkin, S.; Pantea, D.; Paolozzi, L.; Papadopoulou, Th. D.; Papageorgiou, K.; Paramonov, A.; Paredes Hernandez, D.; Parker, A. J.; Parker, M. A.; Parker, K. A.; Parodi, F.; Parsons, J. A.; Parzefall, U.; Pascuzzi, V. R.; Pasqualucci, E.; Passaggio, S.; Pastore, Fr.; Pásztor, G.; Pataraia, S.; Pater, J. R.; Pauly, T.; Pearce, J.; Pearson, B.; Pedersen, L. E.; Pedersen, M.; Pedraza Lopez, S.; Pedro, R.; Peleganchuk, S. V.; Penc, O.; Peng, C.; Peng, H.; Penwell, J.; Peralva, B. S.; Perego, M. M.; Perepelitsa, D. V.; Perez Codina, E.; Perini, L.; Pernegger, H.; Perrella, S.; Peschke, R.; Peshekhonov, V. D.; Peters, K.; Peters, R. F. Y.; Petersen, B. A.; Petersen, T. C.; Petit, E.; Petridis, A.; Petridou, C.; Petroff, P.; Petrolo, E.; Petrov, M.; Petrucci, F.; Pettersson, N. E.; Peyaud, A.; Pezoa, R.; Phillips, P. W.; Piacquadio, G.; Pianori, E.; Picazio, A.; Piccaro, E.; Piccinini, M.; Pickering, M. A.; Piegaia, R.; Pilcher, J. E.; Pilkington, A. D.; Pin, A. W. J.; Pinamonti, M.; Pinfold, J. L.; Pingel, A.; Pires, S.; Pirumov, H.; Pitt, M.; Plazak, L.; Pleier, M. -A.; Pleskot, V.; Plotnikova, E.; Plucinski, P.; Pluth, D.; Poettgen, R.; Poggioli, L.; Pohl, D.; Polesello, G.; Poley, A.; Policicchio, A.; Polifka, R.; Polini, A.; Pollard, C. S.; Polychronakos, V.; Pommès, K.; Pontecorvo, L.; Pope, B. G.; Popeneciu, G. A.; Poppleton, A.; Pospisil, S.; Potamianos, K.; Potrap, I. N.; Potter, C. J.; Potter, C. T.; Poulard, G.; Poveda, J.; Pozdnyakov, V.; Pozo Astigarraga, M. E.; Pralavorio, P.; Pranko, A.; Prell, S.; Price, D.; Price, L. E.; Primavera, M.; Prince, S.; Prokofiev, K.; Prokoshin, F.; Protopopescu, S.; Proudfoot, J.; Przybycien, M.; Puddu, D.; Purohit, M.; Puzo, P.; Qian, J.; Qin, G.; Qin, Y.; Quadt, A.; Quayle, W. B.; Queitsch-Maitland, M.; Quilty, D.; Raddum, S.; Radeka, V.; Radescu, V.; Radhakrishnan, S. K.; Radloff, P.; Rados, P.; Ragusa, F.; Rahal, G.; Raine, J. A.; Rajagopalan, S.; Rammensee, M.; Rangel-Smith, C.; Ratti, M. G.; Rauscher, F.; Rave, S.; Ravenscroft, T.; Ravinovich, I.; Raymond, M.; Read, A. L.; Readioff, N. P.; Reale, M.; Rebuzzi, D. M.; Redelbach, A.; Redlinger, G.; Reece, R.; Reed, R. G.; Reeves, K.; Rehnisch, L.; Reichert, J.; Reiss, A.; Rembser, C.; Ren, H.; Rescigno, M.; Resconi, S.; Rezanova, O. L.; Reznicek, P.; Rezvani, R.; Richter, R.; Richter, S.; Richter-Was, E.; Ricken, O.; Ridel, M.; Rieck, P.; Riegel, C. J.; Rieger, J.; Rifki, O.; Rijssenbeek, M.; Rimoldi, A.; Rimoldi, M.; Rinaldi, L.; Ristić, B.; Ritsch, E.; Riu, I.; Rizatdinova, F.; Rizvi, E.; Rizzi, C.; Robertson, S. H.; Robichaud-Veronneau, A.; Robinson, D.; Robinson, J. E. M.; Robson, A.; Roda, C.; Rodina, Y.; Rodriguez Perez, A.; Rodriguez Rodriguez, D.; Roe, S.; Rogan, C. S.; Røhne, O.; Romaniouk, A.; Romano, M.; Romano Saez, S. M.; Romero Adam, E.; Rompotis, N.; Ronzani, M.; Roos, L.; Ros, E.; Rosati, S.; Rosbach, K.; Rose, P.; Rosien, N. -A.; Rossetti, V.; Rossi, E.; Rossi, L. P.; Rosten, J. H. N.; Rosten, R.; Rotaru, M.; Roth, I.; Rothberg, J.; Rousseau, D.; Rozanov, A.; Rozen, Y.; Ruan, X.; Rubbo, F.; Rudolph, M. S.; Rühr, F.; Ruiz-Martinez, A.; Rurikova, Z.; Rusakovich, N. A.; Ruschke, A.; Russell, H. L.; Rutherfoord, J. P.; Ruthmann, N.; Ryabov, Y. F.; Rybar, M.; Rybkin, G.; Ryu, S.; Ryzhov, A.; Rzehorz, G. F.; Saavedra, A. F.; Sabato, G.; Sacerdoti, S.; Sadrozinski, H. F-W.; Sadykov, R.; Tehrani, F. Safai; Saha, P.; Sahinsoy, M.; Saimpert, M.; Saito, T.; Sakamoto, H.; Sakurai, Y.; Salamanna, G.; Salamon, A.; Salazar Loyola, J. E.; Salek, D.; De Bruin, P. H. Sales; Salihagic, D.; Salnikov, A.; Salt, J.; Salvatore, D.; Salvatore, F.; Salvucci, A.; Salzburger, A.; Sammel, D.; Sampsonidis, D.; Sanchez, A.; Sánchez, J.; Sanchez Martinez, V.; Sandaker, H.; Sandbach, R. L.; Sander, H. G.; Sandhoff, M.; Sandoval, C.; Sankey, D. P. C.; Sannino, M.; Sansoni, A.; Santoni, C.; Santonico, R.; Santos, H.; Santoyo Castillo, I.; Sapp, K.; Sapronov, A.; Saraiva, J. G.; Sarrazin, B.; Sasaki, O.; Sato, K.; Sauvan, E.; Savage, G.; Savard, P.; Savic, N.; Sawyer, C.; Sawyer, L.; Saxon, J.; Sbarra, C.; Sbrizzi, A.; Scanlon, T.; Scannicchio, D. A.; Scarcella, M.; Scarfone, V.; Schaarschmidt, J.; Schacht, P.; Schachtner, B. M.; Schaefer, D.; Schaefer, L.; Schaefer, R.; Schaeffer, J.; Schaepe, S.; Schaetzel, S.; Schäfer, U.; Schaffer, A. C.; Schaile, D.; Schamberger, R. D.; Scharf, V.; Schegelsky, V. A.; Scheirich, D.; Schernau, M.; Schiavi, C.; Schier, S.; Schillo, C.; Schioppa, M.; Schlenker, S.; Schmidt-Sommerfeld, K. R.; Schmieden, K.; Schmitt, C.; Schmitt, S.; Schmitz, S.; Schneider, B.; Schnoor, U.; Schoeffel, L.; Schoening, A.; Schoenrock, B. D.; Schopf, E.; Schott, M.; Schouwenberg, J. F. P.; Schovancova, J.; Schramm, S.; Schreyer, M.; Schuh, N.; Schulte, A.; Schultens, M. J.; Schultz-Coulon, H. -C.; Schulz, H.; Schumacher, M.; Schumm, B. A.; Schune, Ph.; Schwartzman, A.; Schwarz, T. A.; Schweiger, H.; Schwemling, Ph.; Schwienhorst, R.; Schwindling, J.; Schwindt, T.; Sciolla, G.; Scuri, F.; Scutti, F.; Searcy, J.; Seema, P.; Seidel, S. C.; Seiden, A.; Seifert, F.; Seixas, J. M.; Sekhniaidze, G.; Sekhon, K.; Sekula, S. J.; Seliverstov, D. M.; Semprini-Cesari, N.; Serfon, C.; Serin, L.; Serkin, L.; Sessa, M.; Seuster, R.; Severini, H.; Sfiligoj, T.; Sforza, F.; Sfyrla, A.; Shabalina, E.; Shaikh, N. W.; Shan, L. Y.; Shang, R.; Shank, J. T.; Shapiro, M.; Shatalov, P. B.; Shaw, K.; Shaw, S. M.; Shcherbakova, A.; Shehu, C. Y.; Sherwood, P.; Shi, L.; Shimizu, S.; Shimmin, C. O.; Shimojima, M.; Shirabe, S.; Shiyakova, M.; Shmeleva, A.; Shoaleh Saadi, D.; Shochet, M. J.; Shojaii, S.; Shope, D. R.; Shrestha, S.; Shulga, E.; Shupe, M. A.; Sicho, P.; Sickles, A. M.; Sidebo, P. E.; Sidiropoulou, O.; Sidorov, D.; Sidoti, A.; Siegert, F.; Sijacki, Dj.; Silva, J.; Silverstein, S. B.; Simak, V.; Simic, Lj.; Simion, S.; Simioni, E.; Simmons, B.; Simon, D.; Simon, M.; Sinervo, P.; Sinev, N. B.; Sioli, M.; Siragusa, G.; Sivoklokov, S. Yu.; Sjölin, J.; Skinner, M. B.; Skottowe, H. P.; Skubic, P.; Slater, M.; Slavicek, T.; Slawinska, M.; Sliwa, K.; Slovak, R.; Smakhtin, V.; Smart, B. H.; Smestad, L.; Smiesko, J.; Smirnov, S. Yu.; Smirnov, Y.; Smirnova, L. N.; Smirnova, O.; Smith, M. N. K.; Smith, R. W.; Smizanska, M.; Smolek, K.; Snesarev, A. A.; Snyder, I. M.; Snyder, S.; Sobie, R.; Socher, F.; Soffer, A.; Soh, D. A.; Sokhrannyi, G.; Solans Sanchez, C. A.; Solar, M.; Soldatov, E. Yu.; Soldevila, U.; Solodkov, A. A.; Soloshenko, A.; Solovyanov, O. V.; Solovyev, V.; Sommer, P.; Son, H.; Song, H. Y.; Sood, A.; Sopczak, A.; Sopko, V.; Sorin, V.; Sosa, D.; Sotiropoulou, C. L.; Soualah, R.; Soukharev, A. M.; South, D.; Sowden, B. C.; Spagnolo, S.; Spalla, M.; Spangenberg, M.; Spanò, F.; Sperlich, D.; Spettel, F.; Spighi, R.; Spigo, G.; Spiller, L. A.; Spousta, M.; Denis, R. D. St.; Stabile, A.; Stamen, R.; Stamm, S.; Stanecka, E.; Stanek, R. W.; Stanescu, C.; Stanescu-Bellu, M.; Stanitzki, M. M.; Stapnes, S.; Starchenko, E. A.; Stark, G. H.; Stark, J.; Staroba, P.; Starovoitov, P.; Stärz, S.; Staszewski, R.; Steinberg, P.; Stelzer, B.; Stelzer, H. J.; Stelzer-Chilton, O.; Stenzel, H.; Stewart, G. A.; Stillings, J. A.; Stockton, M. C.; Stoebe, M.; Stoicea, G.; Stolte, P.; Stonjek, S.; Stradling, A. R.; Straessner, A.; Stramaglia, M. E.; Strandberg, J.; Strandberg, S.; Strandlie, A.; Strauss, M.; Strizenec, P.; Ströhmer, R.; Strom, D. M.; Stroynowski, R.; Strubig, A.; Stucci, S. A.; Stugu, B.; Styles, N. A.; Su, D.; Su, J.; Suchek, S.; Sugaya, Y.; Suk, M.; Sulin, V. V.; Sultansoy, S.; Sumida, T.; Sun, S.; Sun, X.; Sundermann, J. E.; Suruliz, K.; Susinno, G.; Sutton, M. R.; Suzuki, S.; Svatos, M.; Swiatlowski, M.; Sykora, I.; Sykora, T.; Ta, D.; Taccini, C.; Tackmann, K.; Taenzer, J.; Taffard, A.; Tafirout, R.; Taiblum, N.; Takai, H.; Takashima, R.; Takeshita, T.; Takubo, Y.; Talby, M.; Talyshev, A. A.; Tan, K. G.; Tanaka, J.; Tanaka, M.; Tanaka, R.; Tanaka, S.; Tanioka, R.; Tannenwald, B. B.; Tapia Araya, S.; Tapprogge, S.; Tarem, S.; Tartarelli, G. F.; Tas, P.; Tasevsky, M.; Tashiro, T.; Tassi, E.; Tavares Delgado, A.; Tayalati, Y.; Taylor, A. C.; Taylor, G. N.; Taylor, P. T. E.; Taylor, W.; Teischinger, F. A.; Teixeira-Dias, P.; Temming, K. K.; Temple, D.; Ten Kate, H.; Teng, P. K.; Teoh, J. J.; Tepel, F.; Terada, S.; Terashi, K.; Terron, J.; Terzo, S.; Testa, M.; Teuscher, R. J.; Theveneaux-Pelzer, T.; Thomas, J. P.; Thomas-Wilsker, J.; Thompson, E. N.; Thompson, P. D.; Thompson, A. S.; Thomsen, L. A.; Thomson, E.; Thomson, M.; Tibbetts, M. J.; Ticse Torres, R. E.; Tikhomirov, V. O.; Tikhonov, Yu. A.; Timoshenko, S.; Tipton, P.; Tisserant, S.; Todome, K.; Todorov, T.; Todorova-Nova, S.; Tojo, J.; Tokár, S.; Tokushuku, K.; Tolley, E.; Tomlinson, L.; Tomoto, M.; Tompkins, L.; Toms, K.; Tong, B.; Tornambe, P.; Torrence, E.; Torres, H.; Torró Pastor, E.; Toth, J.; Touchard, F.; Tovey, D. R.; Trefzger, T.; Tricoli, A.; Trigger, I. M.; Trincaz-Duvoid, S.; Tripiana, M. F.; Trischuk, W.; Trocmé, B.; Trofymov, A.; Troncon, C.; Trottier-McDonald, M.; Trovatelli, M.; Truong, L.; Trzebinski, M.; Trzupek, A.; Tseng, J. C. -L.; Tsiareshka, P. V.; Tsipolitis, G.; Tsirintanis, N.; Tsiskaridze, S.; Tsiskaridze, V.; Tskhadadze, E. G.; Tsui, K. M.; Tsukerman, I. I.; Tsulaia, V.; Tsuno, S.; Tsybychev, D.; Tu, Y.; Tudorache, A.; Tudorache, V.; Tuna, A. N.; Tupputi, S. A.; Turchikhin, S.; Turecek, D.; Turgeman, D.; Turra, R.; Tuts, P. M.; Tyndel, M.; Ucchielli, G.; Ueda, I.; Ughetto, M.; Ukegawa, F.; Unal, G.; Undrus, A.; Unel, G.; Ungaro, F. C.; Unno, Y.; Unverdorben, C.; Urban, J.; Urquijo, P.; Urrejola, P.; Usai, G.; Vacavant, L.; Vacek, V.; Vachon, B.; Valderanis, C.; Valdes Santurio, E.; Valencic, N.; Valentinetti, S.; Valero, A.; Valery, L.; Valkar, S.; Valls Ferrer, J. A.; Van Den Wollenberg, W.; Van Der Deijl, P. C.; van der Graaf, H.; van Eldik, N.; van Gemmeren, P.; Van Nieuwkoop, J.; van Vulpen, I.; van Woerden, M. C.; Vanadia, M.; Vandelli, W.; Vanguri, R.; Vaniachine, A.; Vankov, P.; Vardanyan, G.; Vari, R.; Varnes, E. W.; Varol, T.; Varouchas, D.; Vartapetian, A.; Varvell, K. E.; Vasquez, J. G.; Vasquez, G. A.; Vazeille, F.; Vazquez Schroeder, T.; Veatch, J.; Veeraraghavan, V.; Veloce, L. M.; Veloso, F.; Veneziano, S.; Ventura, A.; Venturi, M.; Venturi, N.; Venturini, A.; Vercesi, V.; Verducci, M.; Verkerke, W.; Vermeulen, J. C.; Vest, A.; Vetterli, M. C.; Viazlo, O.; Vichou, I.; Vickey, T.; Vickey Boeriu, O. E.; Viehhauser, G. H. A.; Viel, S.; Vigani, L.; Villa, M.; Villaplana Perez, M.; Vilucchi, E.; Vincter, M. G.; Vinogradov, V. B.; Vittori, C.; Vivarelli, I.; Vlachos, S.; Vlasak, M.; Vogel, M.; Vokac, P.; Volpi, G.; Volpi, M.; von der Schmitt, H.; von Toerne, E.; Vorobel, V.; Vorobev, K.; Vos, M.; Voss, R.; Vossebeld, J. H.; Vranjes, N.; Vranjes Milosavljevic, M.; Vrba, V.; Vreeswijk, M.; Vuillermet, R.; Vukotic, I.; Vykydal, Z.; Wagner, P.; Wagner, W.; Wahlberg, H.; Wahrmund, S.; Wakabayashi, J.; Walder, J.; Walker, R.; Walkowiak, W.; Wallangen, V.; Wang, C.; Wang, C.; Wang, F.; Wang, H.; Wang, H.; Wang, J.; Wang, J.; Wang, K.; Wang, R.; Wang, S. M.; Wang, T.; Wang, T.; Wang, W.; Wang, X.; Wanotayaroj, C.; Warburton, A.; Ward, C. P.; Wardrope, D. R.; Washbrook, A.; Watkins, P. M.; Watson, A. T.; Watson, M. F.; Watts, G.; Watts, S.; Waugh, B. M.; Webb, S.; Weber, M. S.; Weber, S. W.; Weber, S. A.; Webster, J. S.; Weidberg, A. R.; Weinert, B.; Weingarten, J.; Weiser, C.; Weits, H.; Wells, P. S.; Wenaus, T.; Wengler, T.; Wenig, S.; Wermes, N.; Werner, M.; Werner, M. D.; Werner, P.; Wessels, M.; Wetter, J.; Whalen, K.; Whallon, N. L.; Wharton, A. M.; White, A.; White, M. J.; White, R.; Whiteson, D.; Wickens, F. J.; Wiedenmann, W.; Wielers, M.; Wiglesworth, C.; Wiik-Fuchs, L. A. M.; Wildauer, A.; Wilk, F.; Wilkens, H. G.; Williams, H. H.; Williams, S.; Willis, C.; Willocq, S.; Wilson, J. A.; Wingerter-Seez, I.; Winklmeier, F.; Winston, O. J.; Winter, B. T.; Wittgen, M.; Wittkowski, J.; Wolf, T. M. H.; Wolter, M. W.; Wolters, H.; Worm, S. D.; Wosiek, B. K.; Wotschack, J.; Woudstra, M. J.; Wozniak, K. W.; Wu, M.; Wu, M.; Wu, S. L.; Wu, X.; Wu, Y.; Wyatt, T. R.; Wynne, B. M.; Xella, S.; Xu, D.; Xu, L.; Yabsley, B.; Yacoob, S.; Yamaguchi, D.; Yamaguchi, Y.; Yamamoto, A.; Yamamoto, S.; Yamanaka, T.; Yamauchi, K.; Yamazaki, Y.; Yan, Z.; Yang, H.; Yang, H.; Yang, Y.; Yang, Z.; Yao, W. -M.; Yap, Y. C.; Yasu, Y.; Yatsenko, E.; Yau Wong, K. H.; Ye, J.; Ye, S.; Yeletskikh, I.; Yen, A. L.; Yildirim, E.; Yorita, K.; Yoshida, R.; Yoshihara, K.; Young, C.; Young, C. J. S.; Youssef, S.; Yu, D. R.; Yu, J.; Yu, J. M.; Yu, J.; Yuan, L.; Yuen, S. P. Y.; Yusuff, I.; Zabinski, B.; Zaidan, R.; Zaitsev, A. M.; Zakharchuk, N.; Zalieckas, J.; Zaman, A.; Zambito, S.; Zanello, L.; Zanzi, D.; Zeitnitz, C.; Zeman, M.; Zemla, A.; Zeng, J. C.; Zeng, Q.; Zengel, K.; Zenin, O.; Ženiš, T.; Zerwas, D.; Zhang, D.; Zhang, F.; Zhang, G.; Zhang, H.; Zhang, J.; Zhang, L.; Zhang, R.; Zhang, R.; Zhang, X.; Zhang, Z.; Zhao, X.; Zhao, Y.; Zhao, Z.; Zhemchugov, A.; Zhong, J.; Zhou, B.; Zhou, C.; Zhou, L.; Zhou, L.; Zhou, M.; Zhou, N.; Zhu, C. G.; Zhu, H.; Zhu, J.; Zhu, Y.; Zhuang, X.; Zhukov, K.; Zibell, A.; Zieminska, D.; Zimine, N. I.; Zimmermann, C.; Zimmermann, S.; Zinonos, Z.; Zinser, M.; Ziolkowski, M.; Živković, L.; Zobernig, G.; Zoccoli, A.; Nedden, M. zur; Zwalinski, L.

2016-10-27

A search for neutral Higgs bosons of the minimal supersymmetric standard model (MSSM) and for a heavneutral Z' boson is performed using a data sample corresponding to an integrated luminosity of 3.2 fb ^-1 from proton–proton collisions at √s=13 TeV recorded by the ATLAS detector at the LHC. The heavy resonance is assumed to decay to a τ⁺τ^- pair with at least one τ lepton decaying to final states with hadrons and a neutrino. The search is performed in the mass range of 0.2–1.2 TeV for the MSSM neutral Higgs bosons and 0.5–2.5 TeV for the heavy neutral Z' boson. The data are in good agreement with the background predicted by the Standard Model. The results are interpreted in MSSM and Z' benchmark scenarios. The most stringent constraints on the MSSM m_A – tanβ space exclude at 95 % confidence level (CL) tanβ>7.6 for mA=200 GeV in the m$mod+\\atop{h}$ MSSM scenario. For the Sequential Standard Model, a Z'_SSM mass up to 1.90 TeV is excluded at 95 % CL and masses up to 1.82–2.17 TeV are excluded for a Z'_SFM of the strong flavour model.

LEUKOTOXIC ACTIVITY OF ACTINOBACILLUS ACTINOMYCETEMCOMITANS ISOLATED FROM HUMAN AND NON-HUMAN PRIMATES Atividade leucotóxica de amostras de Actinobacillus actinomycetemcomitans de primatas humanos não-humanos

Directory of Open Access Journals (Sweden)

Francisca Lúcia de Lima

2001-10-01

Full Text Available Actinobacillus actinomycetemcomitans is a clinically relevant periodontopathogenic Gram-negative coccobacillus that produces a leukotoxin of the RTX cytolysin family. In this study, we evaluated the leukotoxic activity of A. actinomycetemcomitans strains isolated from human and marmosets by Trypan blue exclusion and by the chemiluminescence assays. Among eight A. actinomycetemcomitans human strains studied, two (P2.17 and P8.12 were classified as high leukotoxin producers and among eight marmoset strains, one (M22.11 showed high leukotoxin production, as determined by Trypan blue exclusion assay. The reference strains ATCC 29523 and FDC Y4 respectively behaved like moderate and low producers. The chemiluminescence assay was used to evaluate the leukotoxic activity of M22.11 and P2.17 strains submitted to different growth conditions. Leukotoxic activity was detected on cells at the logarithmic phase and was similar under anaerobic and microaerophilic growth conditions. It was greatly reduced when cells were grown at glucose concentrations lower or higher than 0.75% (0.25% and 1.5% in thioglycolate medium. Leukotoxin production mainly by the M22.11 strain was low in BHI broth, whereas production in TSB medium showed a similar level as in thioglycolate broth medium. Sodium bicarbonate at 10 mM did not affect leukotoxin production.Actinobacillus actinomycetemcomitans é um cocobacilo Gram negativo, periodontopatógeno clinicamente importante, que produz uma leucotoxina pertencente à família das citolisinas RTX. Neste estudo, avaliou-se a atividade leucotóxica de amostras de A. actinomycetemcomitans isoladas de seres humanos e de calitriquídeos pelos métodos de exclusão de azul de Tripan e quimioluminescência. Duas (P2.17 e P8.12 entre oito amostras de A. actinomycetemcomitans isoladas de seres humanos, e uma (M22.11 entre 8 amostras isoladas de sagüis se apresentaram como altamente produtoras de leucotoxina, como determinado pelo teste de

Comparing Tobacco Use Knowledge, Attitudes and Practices between Engineering Students at a Public and Islamic Azad University in Shiraz, Iran 2011.

Science.gov (United States)

Askarian, Mehrdad; Kouchak, Farideh; Youssef, Moussa; Romito, Laura M

2013-10-01

To compare the level of knowledge, the attitudes, and practices with regards to tobacco use between Iranian students at a public (PBU) and Islamic Azad (IAU) university. A cross-sectional design was used in this study. As the number of students at the IAU were three times greater than that of the PBU, we selected 150 students from the PBU and 450 students from the IAU using simple random sampling. A 57-item survey instrument was utilized for this study. The collected data were recorded by SPSS version 15 software and then it underwent statistical analysis using descriptive statistics and ANOVA to compare the difference between means of knowledge, attitude and practice scores. Logistic regression analysis was conducted to identify variables that have an independent association with students smoking and to describe possible variations in these relationships. The P value level for statistical significance was set at 0.05. From participants, 46.8% were females, 10% of 327 students reported being daily smokers; of these, 84% were from the IAU. Totally, among the 107 smokers, 61 (57%) and 29 (27.1%) were water pipe and cigarettes smokers, respectively. Ninety-three IAU students (21.7%) and 30 PBU students (20.7%) reported smoking during the past 30 days. The mean of the knowledge items between the students of IAU was lower than PBU students. Female gender, smoking in the home, and allowing visitors to smoke in the home were significant predictors of smoking in the past 30 days in PBU, respectively. In IAU, female gender, smoking by friends, and health status were predictors for smoking in the past 30 days. Future studies should assess the factors affecting smoking initiation, as well as effective techniques for the prevention of smoking initiation and substance abuse in Iranian adolescents and young adults.

A cosmic-ray nuclear event with an anomalously strong concentration of energy and particles in the central region

International Nuclear Information System (INIS)

Amato, N.M.; Arata, N.; Maldonado, R.H.C.

1987-01-01

A cosmic-ray-induced nuclear event detected in an emulsion chamber is described. The event consist of 217 shower cores with ΣEγ=1.275 TeV. In a logarithmic scale, energy and particles are emitted most densely at the small lateral distance corresponding to 0.5 mm; 77% of the total energy and 61% of the total multiplicity are inside a radius of 0.65 cm. The shower cores in the central region show exponential-type energy distribution and nonisotropic azimuthal distribution

Unusual AIP mutation and phenocopy in the family of a young patient with acromegalic gigantism

OpenAIRE

Syed Ali Imran; Khaled A Aldahmani; Lynette Penney; Sidney E Croul; David B Clarke; Donato Iacovazzo; Márta Korbonits

2018-01-01

Summary Early-onset acromegaly causing gigantism is often associated with aryl-hydrocarbon-interacting receptor protein (AIP) mutation, especially if there is a positive family history. A15y male presented with tiredness and visual problems. He was 201 cm tall with a span of 217 cm. He had typical facial features of acromegaly, elevated IGF-1, secondary hypogonadism and a large macroadenoma. His paternal aunt had a history of acromegaly presenting at the age of 35 years. Following transspheno...

Geologic map of metallic and nonmetallic mineral deposits, Badakhshan Province, Afghanistan, modified from the 1967 original map compilation of G.G. Semenov and others

Science.gov (United States)

Peters, Stephen G.; Stettner, Will R.; Mathieux, Donald P.; Masonic, Linda M.; Moran, Thomas W.

2014-01-01

This geologic map of central Badakhshan Province, Afghanistan, is a combined, redrafted, and modified version of the Geological map of central Badakhshan, scale 1:200,000 (sheet 217), and Map of minerals of central Badakhshan, scale 1:200,000 (also sheet 217) from Semenov and others (1967) (Soviet report no. R0815). That unpublished Soviet report contains the original maps and cross sections, which were prepared in cooperation with the Ministry of Mines and Industries of the Republic of Afghanistan in 1967 under contract no. 1378 (Technoexport, USSR). This USGS publication also includes the gold metallogeny summarized in Abdullah and others (1977) and Peters and others (2007, 2011), and additional compilations from Guguev and others (1967).

Upgrade of ductal carcinoma in situ on core biopsies to invasive disease at final surgery: a retrospective review across the Scottish Breast Screening Programme.

Science.gov (United States)

Sim, Y T; Litherland, J; Lindsay, E; Hendry, P; Brauer, K; Dobson, H; Cordiner, C; Gagliardi, T; Smart, L

2015-05-01

To identify factors affecting upgrade rates from B5a (non-invasive) preoperative core biopsies to invasive disease at surgery and ways to improve screening performance. This was a retrospective analysis of 1252 cases of B5a biopsies across all six Scottish Breast Screening Programmes (BSPs), ranging between 2004 and 2012. Final surgical histopathology was correlated with radiological and biopsy factors. Data were analysed using basic Microsoft Excel and standard Chi-squared test used for evaluating statistical significance. B5a upgrade rates for the units ranged from 19.2% to 29.2%, with an average of 23.6%. Mean sizes of invasive tumours were small (3-11 mm). The upgrade rate was significantly higher for cases where the main mammographic abnormality was mass, distortion, or asymmetry, compared with micro-calcification alone (33.2% versus 21.7%, p = 0.0004). The upgrade rate was significantly lower with the use of large-volume vacuum-assisted biopsy (VAB) devices than 14 G core needles (19.9% versus 26%, p = 0.013); in stereotactic than ultrasound-guided biopsies (21.2% versus 36.1%, p Scottish BSPs, including first-line biopsy technique and/or device; and it is of interest that a few centres maintain low upgrade rates despite not using VAB routinely for biopsy of micro-calcification. Copyright © 2015 The Royal College of Radiologists. Published by Elsevier Ltd. All rights reserved.

Do all frogs swim alike? The effect of ecological specialization on swimming kinematics in frogs

Czech Academy of Sciences Publication Activity Database

Robovská-Havelková, P.; Aerts, P.; Roček, Zbyněk; Přikryl, Tomáš; Fabre, A.-C.; Herrel, A.

2014-01-01

Roč. 217, č. 20 (2014), s. 3637-3644 ISSN 0022-0949 Institutional support: RVO:67985831 Keywords : Anura * kinematics * locomotion * swimming Subject RIV: EG - Zoology Impact factor: 2.897, year: 2014

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available monas ... oryzae pv. oryzae KACC10331] ... Length = 130 ... Query: 158 PDGLRIQIVDKQNRPMFDIGRDQLKPYTVAILHELSNFINQVPNHIS...ITGHTDTTAYSSD 217 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVAILHELSNFINQVPNHIS...ITGHTDTTAYSSD Sbjct: 1 ... PDGLRIQIVDKQNRPMFDIGRDQLKPYTVAILHELSNFINQVPNHISITGHTDTTAYSSD 60 ... Query: 278 TQDAES 283 ... TQDAES Sbjct: 121 TQDAES 126

Meaningful Communication Before Death, but Not Present at the Time of Death Itself, Is Associated With Better Outcomes on Measures of Depression and Complicated Grief Among Bereaved Family Members of Cancer Patients.

Science.gov (United States)

Otani, Hiroyuki; Yoshida, Saran; Morita, Tatsuya; Aoyama, Maho; Kizawa, Yoshiyuki; Shima, Yasuo; Tsuneto, Satoru; Miyashita, Mitsunori

2017-09-01

Few studies have explored the clinical significance of the family's presence or absence at the moment of a patient's death and meaningful communication (saying "goodbye") in terms of post-bereavement outcomes. To explore the potential association between the family's depression/complicated grief and their presence at the moment of a patient's death and the patient's communication with the family. A nationwide questionnaire survey was conducted on 965 family members of cancer patients who had died at palliative care units. More than 90% of family members wished to have been present at the moment of death (agree: 40%, n = 217; strongly agree: 51%, n = 280); 79% (n = 393) thereof were present. Families' presence at death was not significantly associated with the occurrence of depression and complicated grief, but the dying patient's ability to say "goodbye" to the family beforehand was (depression: adjusted odds rate, 0.42; 95% CI, 0.26-0.69 adjusted P = 0.001; complicated grief: adjusted odds rate, 0.53; 95% CI, 0.29-0.94 adjusted P = 0.009). Many families wished to be present at the moment of the patient's death; however, meaningful communication (saying "goodbye") between the patient and family members, and not their presence or absence itself, was associated with better outcomes on measures of depression or complicated grief. Health care professionals could consider promoting both mutual communication (relating to preparation for death) between family members and patients before imminent death, as well as the family's presence at the moment of death. Copyright © 2017 American Academy of Hospice and Palliative Medicine. Published by Elsevier Inc. All rights reserved.

First record in America of Aedes albopictus naturally infected with dengue virus during the 1995 outbreak at Reynosa, Mexico.

Science.gov (United States)

Ibáñez-Bernal, S; Briseño, B; Mutebi, J P; Argot, E; Rodríguez, G; Martínez-Campos, C; Paz, R; de la Fuente-San Román, P; Tapia-Conyer, R; Flisser, A

1997-10-01

Mosquito collections were conducted during a dengue outbreak in Reynosa, Tamaulipas, Mexico, July-December 1995. A total of 6694 adult mosquitoes (four genera and nine species) were captured, of which 2986 (78.3% females and 21.7% males) were Aedes albopictus and 2339 (39.7% females and 60.3% males) were Ae.aegypti. These two species comprised 84.2% of the total collection. Specimens were grouped into pools, nearly 50% of them processed for detection of virus by cythopathic effect in C6-36 and VERO cell cultures and by haemagglutination test. Five pools gave positive haemagglutination reactions and were examined by immunofluorescence using monoclonal antibodies to flavivirus and to dengue virus. One pool of ten Ae.albopictus males was positive for dengue virus: serotypes 2 and 3 were identified by serotype-specific monoclonal antibodies and confirmed by RT-PCR. This is the first report of Ae.albopictus naturally infected with dengue virus in America. Also, it is the very first time Ae.albopictus males have been found infected with dengue virus in the wild.

Soy Protein Isolate-Phosphatidylcholine Nanoemulsions Prepared Using High-Pressure Homogenization.

Science.gov (United States)

Li, Yang; Wu, Chang-Ling; Liu, Jun; Zhu, Ying; Zhang, Xiao-Yuan; Jiang, Lian-Zhou; Qi, Bao-Kun; Zhang, Xiao-Nan; Wang, Zhong-Jiang; Teng, Fei

2018-05-07

The nanoemulsions of soy protein isolate-phosphatidylcholine (SPI-PC) with different emulsion conditions were studied. Homogenization pressure and homogenization cycle times were varied, along with SPI and PC concentration. Evaluations included turbidity, particle size, ζ-potential, particle distribution index, and turbiscan stability index (TSI). The nanoemulsions had the best stability when SPI was at 1.5%, PC was at 0.22%, the homogenization pressure was 100 MPa and homogenization was performed 4 times. The average particle size of the SPI-PC nanoemulsions was 217 nm, the TSI was 3.02 and the emulsification yield was 93.4% of nanoemulsions.

Criticism and Depression among the Caregivers of At-Risk Mental State and First-Episode Psychosis Patients.

Directory of Open Access Journals (Sweden)

Yumiko Hamaie

Full Text Available Expressed emotion (EE, especially criticism, is an important predictor of outcomes for the patient for a wide range of mental health problems. To understand complex links between EE and various relevant variables in early phase psychosis, this study examined criticism, distress of caregivers, other patients', and caregivers' variables, and links between criticism and these variables in those with at-risk mental state (ARMS for psychosis and first-episode psychosis (FEP. The participants were 56 patients (mean age 18.8 ± 4.2 years with ARMS and their caregivers (49.4 ± 5.8 years and 43 patients (21.7 ± 5.2 years with FEP and their caregivers (49.3 ± 7.4 years. We investigated criticisms made by caregivers using the Japanese version of the Family Attitude Scale and caregiver depressive symptoms via the self-report Beck Depression Inventory. We also assessed psychiatric symptoms and functioning of the patients. Approximately one-third of caregivers of patients with ARMS or FEP had depressive symptoms, predominately with mild-to-moderate symptom levels, whereas only a small portion exhibited high criticism. The level of criticism and depression were comparable between ARMS and FEP caregivers. The link between criticism, caregivers' depression, and patients' symptoms were observed in FEP but not in ARMS caregivers. These findings imply that the interaction between criticism and caregivers' and patients' mental states may develop during or after the onset of established psychosis and interventions for the caregivers should be tailored to the patient's specific stage of illness. Interventions for FEP caregivers should target their emotional distress and include education about patient's general symptoms.

78 FR 35837 - North Carolina: Final Authorization of State Hazardous Waste Management Program Revisions

Science.gov (United States)

2013-06-14

... the docket are listed in the www.regulations.gov index. Although listed in the index, some information... Natural Resources, 217 West Jones Street, Raleigh, North Carolina 27603; telephone number (919) 707-8219...

Updated mortality analysis of radiation workers at Rocketdyne (Atomics International), 1948-2008

International Nuclear Information System (INIS)

Boice, John; Cohen, Sarah; Mumma, Michael; Ellis, Elizabeth D.; Eckerman, Keith F.; Leggett, Richard Wayne; Boecker, Bruce; Brill, Bertrand; Henderson, Brian

2011-01-01

Updated analyses of mortality data are presented on 5,801 radiation workers, including 2,232 monitored for radionuclide intakes, and 41,169 non-radiation workers employed 1948-1999 at Rocketdyne (Atomics International). The worker population is unique in that lifetime occupational doses from all places of employment were sought and incorporated into the analyses. Further, radiation doses from intakes of 14 different radionuclides were calculated for 16 organs or tissues using biokinetic models of the International Commission on Radiation Protection (ICRP). The mean dose from external radiation was 13.5 mSv (maximum 1 Sv), and the mean lung dose from external and internal radiation combined was 19.0 mSv (maximum 3.6 Sv). An additional nine years of follow-up, from December 31,1999 through 2008, increased the person-years of observation by 21.7% to 196,674 (mean 33.9 years) and the number of cancer deaths by 50% to 684. Analyses included comparisons with the general population and the computation of standardized mortality ratios (SMRs), and internal comparisons using proportional hazards models. All cancers taken together (SMR 0.88; 95% CI 0.81-0.95), lung cancer (SMR 0.87; 95% CI 0.76-1.00) and leukemia other than chronic lymphocytic leukemia (CLL) (SMR 1.04; 95% 0.67-1.53) were not significantly elevated. Cox regression analyses revealed no significant dose-response trends for any cancer. For all cancers excluding leukemia, the relative risk (RR) at 100 mSv was estimated as 0.98 (95% CI 0.82-1.17) and for all leukemia other than CLL it was 1.06 (95% CI 0.50-2.23). Uranium was the primary radionuclide contributing to internal exposures, but significant increases in lung and kidney disease were not seen. The extended follow-up re-enforces the findings in the previous study in failing to observe a detectable increase in cancer deaths associated with radiation, but strong conclusions still cannot be drawn because of small numbers and relatively low career doses. Larger

Frequency of hyponatraemia and its influence on liver cirrhosis-related complications

International Nuclear Information System (INIS)

Sheikh, S.; Khalid, S.; Baloch, G.H.

2010-01-01

To evaluate the frequency, clinical associations and prognostic impact of hyponatraemia on cirrhosis related complications in patients with cirrhosis of liver. In this case control study 217 cirrhotic patients consecutively admitted to our department from September 2006 to November 2007 were studied. Serum sodium levels were determined in all patients admitted. The cutoff level of 130 meq/l was chosen because it is widely accepted to define hyponatraemia in patients with cirrhosis while the level of 135 meq/L is the lower normal value. Patients were grouped on the basis of serum sodium concentration into serum sodium 135 meq /l (Group 3). P values of less than 0.05 were considered as significant. The patients with hyponatraemia Group( 135 meq/l) for the severity of liver disease, degree of ascites and other cirrhosis related complications such as hepatorenal syndrome, spontaneous bacterial peritonitis and hepatic encephalopathy. This case control study constituted 217 consecutive cirrhotic patients of which 141(65%) were male and 76/217 (35%) were female. Hyponatraemia (sodium 135. Out of 58 patients with hyponatraemia, 48 were in child - Pugh C class (p=0.001). Patients with serum sodium 135 meq/l). Hyponatraemia is frequent in cirrhotic patients. It is seldom spontaneous and has a negative influence on cirrhosis related complications (JPMA 60:116; 2010). (author)

Identification of the antigenic region of Neospora caninum dense granule protein 7 using ELISA.

Science.gov (United States)

Abdelbaky, Hanan H; Fereig, Ragab M; Nishikawa, Yoshifumi

2018-06-26

Dense granule protein 7 (NcGRA7) is a potent diagnostic antigen of Neospora caninum. Some studies have reported on the difficult expression, low yield, and variable degree of solubility of recombinant NcGRA7. We aimed to unravel the possible causes for these issues and tested NcGRA7 antigenicity in enzyme linked immunosorbent assays (ELISAs). The NcGRA7 coding sequence (217 amino acids) was split into five amino acid regions: NcGRA7m (27-217), NcGRA7m3 (27-160), NcGRA7m4 (27-135), NcGRA7m5 (161-190), and NcGRA7m6 (188-217). Three fragments, NcGRA7m, NcGRA7m3 and NcGRA7m4, exhibited high antigenic properties when tested against experimentally-infected mice and dog sera by ELISA. High levels of IgG2 antibodies against NcGRA7m were observed in field dog sera. In experimentally and naturally-infected cattle, the N. caninum-specific sera only reacted with NcGRA7m, indicating that this antigenic region differs among the three animal species. This study presents valuable information about the antigenic properties and topology of NcGRA7, and highlights its suitability for diagnostic purposes. Copyright © 2018. Published by Elsevier B.V.

Follicular development in a 7-day versus 4-day hormone-free interval with an oral contraceptive containing 20 mcg ethinyl estradiol and 1 mg norethindrone acetate.

Science.gov (United States)

Rible, Radhika D; Taylor, DeShawn; Wilson, Melissa L; Stanczyk, Frank Z; Mishell, Daniel R

2009-03-01

Combined oral contraceptive (COC) formulations with 20 mcg ethinyl estradiol (EE) have a greater incidence of ovarian hormone production and follicular development, which can be managed by shortening the number of hormone-free days per COC cycle. This study evaluates differences in follicular development during a 7-day versus 4-day hormone-free interval in a COC regimen with 20 mcg EE and 1 mg norethindrone acetate. Forty-one healthy women were randomized in an open-label fashion to this formulation in either a 24/4 or a 21/7 day regimen for three cycles. Estradiol, progesterone, follicle-stimulating hormone, luteinizing hormone and inhibin B were measured daily from Cycle 2, Day 21 to Cycle 3, Day 3 and on Day 7 of Cycle 3. Follicular diameter and Hoogland score were calculated on Cycle 2, Days 21, 24 and 28 and Cycle 3, Days 3 and 7. Sixty-six percent of subjects in the 21/7 group and 70% of the subjects in the 24/4 group developed a follicle greater than 10 mm diameter. Ovarian steroid hormone levels, Hoogland scores and bleeding patterns were not statistically significant between the groups. In contrast to prior studies, this analysis suggests no difference in follicle development or bleeding patterns among women receiving a 21/7 or 24/4 regimen of a 20-mcg EE/1-mg norethindrone acetate COC.

The use of biodegradable polymers for the stabilization of copper ...

Indian Academy of Sciences (India)

2017-08-03

Aug 3, 2017 ... nanoparticles synthesized by chemical reduction method ... and the reaction temperature on the size and size distribution of copper nanoparticles were investigated using the ..... on chemical and process engineering p 217.

Meeting Report: Minutes from EMBO: Ten Years of Comparative Genomics of Eukaryotic Microorganisms

Czech Academy of Sciences Publication Activity Database

Lukeš, Julius; López-García, P.; Louis, E.; Boekhout, T.

2016-01-01

Roč. 167, č. 3 (2016), s. 217-221 ISSN 1434-4610 Institutional support: RVO:60077344 Keywords : protist * eukaryotic microorganisms * genomics Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.794, year: 2016

Genomic and Functional Characterization of the Unusual pLOCK 0919 Plasmid Harboring the spaCBA Pili Cluster in Lactobacillus casei LOCK 0919

Czech Academy of Sciences Publication Activity Database

Aleksandrzak-Piekarczyk, T.; Koryszewska-Baginska, A.; Grynberg, M.; Nowak, A.; Cukrowska, B.; Kozáková, Hana; Bardowski, J.

2016-01-01

Roč. 8, č. 1 (2016), s. 202-217 ISSN 1759-6653 Institutional support: RVO:61388971 Keywords : adhesion * spaCBA pilus cluster * lactobacillus Subject RIV: EC - Immunology Impact factor: 3.979, year: 2016

Success and Survival Rates of Dental Implants Restored at an Undergraduate Dental Clinic: A 13-Year Retrospective Study with a Mean Follow-up of 5.8 Years.

Science.gov (United States)

Daneshvar, Shahrzad S; Matthews, Debora C; Michuad, Pierre-Luc; Ghiabi, Edmond

2016-01-01

The purpose of this study was to evaluate the clinical, radiographic, and patient-based outcomes of dental implants placed at an undergraduate student dental clinic. A retrospective study was performed to determine the success and survival rates of dental implants placed at the undergraduate dental clinic at Dalhousie University between January 1999 and January 2012. Only patients with a minimum of 1-year follow-up were included. Clinical and radiographic assessments determined implant success and survival rates. Questionnaires recorded patients' satisfaction with esthetics, comfort, and ease of hygiene. Of the 352 patients (n = 591 implants) who received implants over 13 years, 165 patients completed the clinical and radiographic examinations. By the end of the study period, demographic information and implant characteristics were collected for 111 (n = 217 implants; 47.5% in the maxilla, 52.6% in the mandible) of these patients. Of those assessed clinically, 36.4% were males and 63.6% females, with a mean age of 56.1 ± 14.15 years (range, 17 to 86 years) at the time of implant placement. The mean follow-up period was 5.8 years (range, 1 to 13 years). The overall implant success and survival rates were 88.0% and 97.2%, respectively. No observable bone loss was evident in 88.0% of the surviving implants. There were no implant fractures. Most patients (91.2%) were very satisfied with the implant restoration appearance, 88.0% were very comfortable with the implant, 92.6% were very satisfied with their ability to chew, and 84.8% reported easy hygiene maintenance at the implant sites. Implant success and survival in an undergraduate student clinic were comparable to those reported in the literature. It seems that inexperienced students were able to provide restorations that were very satisfying to the patients.

48 CFR 252.217-7005 - Inspection and manner of doing work.

Science.gov (United States)

2010-10-01

... over activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms... the extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair; (6) Furnish the Contracting Officer or designated representative with a copy of the “gas-free” or...

48 CFR 1252.217-73 - Inspection and manner of doing work.

Science.gov (United States)

2010-10-01

... activities taking place in the vicinity of the vessel's magazines, fuel oil tanks, or storerooms containing... extent necessary, clean, wash, and steam out or otherwise make safe, all tanks under alteration or repair... work is done on a tank; (7) Treat the contents of any tank as Government property in accordance with...

217. Experiencia en asistencia circulatoria mecánica en nuestro centro

Directory of Open Access Journals (Sweden)

J. Otero

2012-04-01

Conclusiones: Dada la gravedad de estos pacientes, con mortalidad cercana al 100% sin asistencia, consideramos el beneficio que aporta esta técnica y la gran utilidad que representa su disponibilidad.

5 CFR 591.217 - In which outlets does OPM collect prices?

Science.gov (United States)

2010-01-01

... data collection areas, accessibility by road, physical size, advertising, and other characteristics that reflect sales volume. To the extent practical, OPM prices like items in the same types of outlets...

http://journals.tbzmed.ac.ir/JARCM/Manuscript/JARCM-2-217.pdf

Directory of Open Access Journals (Sweden)

Ali Ghavidel

2014-11-01

Full Text Available Introduction: Secondary aortoenteric fistula (SAF is an uncommon, but very important complication of abdominal aortic reconstruction. The complication often occurs months to years after aortic surgery. The clinical manifestation of the aortoenteric fistula is always upper gastrointestinal bleeding. Treatment of the disease is early surgical intervention. If operative treatment is not performed promptly, the mortality is high. Case Report: A case of secondary aortoduodenal fistula found 6 years after aortic reconstructive surgery, with the clinical presentation of upper gastrointestinal bleeding because of the increasing number of elective aortic aneurysm repairs in the aging population, it is likely that more patients with SAF will present to the clinical physicians in the future. Hence, a high index of suspicion is necessary for prompt diagnosis and treatment of this lifethreatening event. The patient treated medically and finally expiration of the patient and review of the literature currently available in Medline. Conclusion: The aim of this case report is to emphasize early diagnosis and management of all gastrointestinal bleeding in patients who have a history of aortic reconstructive surgery.

: tous les projets | Page 217 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

L'établissement d'un réseau de politique étrangère à Ottawa aidera à combler certaines lacunes, à renforcer le milieu de la politique étrangère dans la région de la capitale nationale et à intégrer de jeunes professionnels aux travaux en cours. Date de début : 1 mars 2012. End Date: 28 février 2015. Sujet: FOREIGN ...

42 CFR 436.217 - Individuals receiving home and community-based services.

Science.gov (United States)

2010-10-01

... THE VIRGIN ISLANDS Options for Coverage as Categorically Needy Options for Coverage of Families and... receiving home and community-based services. The agency may provide Medicaid to any group or groups of individuals in the community who meet the following requirements: (a) The group would be eligible for Medicaid...

Effect of manual tilt adjustments on incident irradiance on fixed and tracking solar panels

International Nuclear Information System (INIS)

Lubitz, William David

2011-01-01

Hourly typical meteorological year (TMY3) data was utilized with the Perez radiation model to simulate solar radiation on fixed, azimuth tracking and two axis tracking surfaces at 217 geographically diverse temperate latitude sites across the contiguous United States of America. The optimum tilt angle for maximizing annual irradiation on a fixed south-facing panel varied from being equal to the latitude at low-latitude, high clearness sites, to up to 14 o less than the latitude at a north-western coastal site with very low clearness index. Across the United States, the optimum tilt angle for an azimuth tracking panel was found to be on average 19 o closer to vertical than the optimum tilt angle for a fixed, south-facing panel at the same site. Azimuth tracking increased annual solar irradiation incident on a surface by an average of 29% relative to a fixed south-facing surface at optimum tilt angle. Two axis tracking resulted in an average irradiation increase of 34% relative to the fixed surface. Introduction of manual surface tilt changes during the year produced a greater impact for non-tracking surfaces than it did for azimuth tracking surfaces. Even monthly tilt changes only resulted in an average annual irradiation increase of 5% for fixed panels and 1% for azimuth tracked surfaces, relative to using a single optimized tilt angle in each case. In practice, the decision whether to manually tilt panels requires balancing the added cost in labor and the panel support versus the extra energy generation and the cost value of that energy. A spreadsheet file is available that gives individual results for each of the 217 simulated sites.

Mathematical modelling of the osmotic dehydration of cherry tomato (Lycopersicon esculentum var. cerasiforme

Directory of Open Access Journals (Sweden)

AZOUBEL Patricia Moreira

2000-01-01

Full Text Available Osmotic dehydration of cherry tomato as influenced by osmotic agent (sodium chloride and a mixed sodium chloride and sucrose solutions and solution concentration (10 and 25% w/w at room temperature (25°C was studied. Kinetics of water loss and solids uptake were determined by a two parameter model, based on Fick's second law and applied to spherical geometry. The water apparent diffusivity coefficients obtained ranged from 2.17x10-10 to 11.69x10-10 m²/s.

Transient fission product release during reactor shutdown and startup

International Nuclear Information System (INIS)

Hunt, C.E.L.; Lewis, B.J.

1995-01-01

Sweep gas experiments performed at CRL from 1979 to 1985 have been analysed to determine the fraction of the fission product gas inventory that is released on reactor shutdown and startup. Empirical equations were derived and applied to calculate the xenon release from companion fuel elements and from a well documented experimental fuel bundle irradiated in the NRU reactor. The measured gas release could be matched to within about a factor of two for an experimental irradiation with a burnup of 217 MWh/kgU. (author)

General Aspects Regarding the Crime of Human Trafficking

Directory of Open Access Journals (Sweden)

Vasile Draghici

2016-01-01

Thus, according to article 210 of the Penal Code, the crime of human trafficking involves„recruiting, transportation, sheltering or receiving of a person with the purpose of exploiting.Forthe offense of human trafficking there may exist preparatory acts, but the law does not incriminatethese acts as crimes and does not punish them. The attempt is punished according to article 217 ofthe Penal Code, stating that the attempt to the offenses stipulated at articles 209- 211 and article213 paragraph 2 of the Penal Code shall be punished.

Shock compression of diamond crystal

OpenAIRE

Kondo, Ken-ichi; Ahrens, Thomas J.

1983-01-01

Two shock wave experiments employing inclined mirrors have been carried out to determine the Hugoniot elastic limit (HEL), final shock state at 191 and 217 GPa, and the post-shock state of diamond crystal, which is shock-compressed along the intermediate direction between the and crystallographic axes. The HEL wave has a velocity of 19.9 ± 0.3 mm/µsec and an amplitude of 63 ± 28 GPa. An alternate interpretation of the inclined wedge mirror streak record suggests a ramp precursor wave and th...

STABILITAS OKSIDATIF MINYAK BIJI KENARI (Canarium indicum DAN Canarium vulgare SELAMA PENYIMPANAN PADA SUHU 30 DAN 40°C [Oxidative Stability of Canarium Nut (Canarium indicum and Canarium vulgare Oil during Storage at 30 and 40°C

Directory of Open Access Journals (Sweden)

Suhartati Djarkasi1

2008-12-01

Full Text Available The aims of this research were to study the effect of temperature and storage on the oxidative stability of crude and refined canarium nut oil extracted from the seeds of Canarium indicum and Canarium vulgare. The experiment was designed to include storage of two type of canarium nut oil at two different temperatures for up to 35 days. The oils (crude and refined used had the similar condition. Parameter used for oxidative deterioration indicators were two peroxide value, TBARS (thiobarbituric acid reactive substances, and free fatty acid value. The result showed that refining oil can decrease component natural antioxidant of canarium oil cause more sensitive to the oxidation. Increased storage temperature can raise oxidation of crude and refined oils from both species Canarium. The peroxide values of crude and refined oils both Canarium indicum and Canarium vulgare stored at 30 °C were 2.17, 4.35, 3.36 and 3.77 meq O2/kg oil, respectively. When they were stored at 4C the similar results were 6.21, 19.09, 8.12 and 17.23 meq O2/kg oil. Furthermore, TBARS value of crude and refined oils both for Canarium indicum and Canarium vulgare stored 30C were 4.55, 7.78, 5.70 and 6.58 µmol MDA/kg oil. When they were stored at 40 °C the similar results were 9.99, 55.46, 12.46 and 43.62 µmol MDA/kg oil.

Basic webliography on health promotion and disease prevention - doi:10.5020/18061230.2009.p217

Directory of Open Access Journals (Sweden)

Ana Claudia Camargo Gonçalves da Silva

2012-01-01

Full Text Available Objectives: To introduce a basic webliography to access highly qualified evidence-based material on health promotion and disease prevention, aiming at the continuing education of health professionals. Methods: By means of Google® browser, applying the descriptors in sequence to progressively refine the search on Internet and key concepts to be learned, all previously defined by the authors themselves, we proceeded a qualitative analyses of the 20 first listed links for each searched issue and the final selection of the most scientifically relevant ones. Results: The 34 selected links are presented in 4 groups: 23 portals, 5 guides and recommendations, 4 scientific journals and 3 blogs that allow free access to health promotion and disease prevention related subjects, such as: concepts; national and international public policies; epidemiology, statistics and health indicators; diseases screening and prophylaxis; counseling for behavior change of health related habits; and interdisciplinary work. Among the selected links 10 (29% are written in English while the others are in Portuguese. Conclusions: The identification of reading materials on health promotion and disease prevention available on Internet, many in Portuguese, allowed us to select relevant scientifically qualified literature and turn it accessible to health professionals, enabling the acquisition of new knowledge or quick update.

Hatchling sex ratio and female mating status in the great reed warbler, Acrocephalus arundinaceus (Aves, Passeriformes): further evidence for offspring sex ratio manipulation

Czech Academy of Sciences Publication Activity Database

Trnka, A.; Prokop, P.; Kašová, M.; Sobeková, Karolina; Kocian, Ľ.

2012-01-01

Roč. 79, č. 2 (2012), s. 212-217 ISSN 1125-0003 Institutional support: RVO:68081766 Keywords : Great reed warbler * sex ratio * social polygyny Subject RIV: EG - Zoology Impact factor: 0.890, year: 2012

Wüstehubové. Ďáblovo plémě nebo tvůrcové kulturní krajiny?

Czech Academy of Sciences Publication Activity Database

Kouřil, Pavel; Wihoda, M.

2001-01-01

Roč. 50, č. 3 (2001), s. 205-217 ISSN 0323-0678 Institutional research plan: CEZ:AV0Z8001916 Keywords : Moravia, Silesia * colonisation * castles and material culture Subject RIV: AC - Archeology, Anthropology, Ethnology

No evidence for cumulative effects in a Dnmt3b hypomorph across multiple generations

Czech Academy of Sciences Publication Activity Database

Youngson, N.A.; Epp, Trevor; Roberts, A.R.; Daxinger, L.; Ashe, A.; Huang, E.; Lester, K.L.; Harten, S.K.; Kay, G.F.; Cox, T.; Matthews, J.M.; Chong, S.; Whitelaw, E.

2013-01-01

Roč. 24, 5-6 (2013), s. 206-217 ISSN 0938-8990 Institutional support: RVO:68378050 Keywords : epigenetic inheritance * mammalian development * transgenerational Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.883, year: 2013

Synthesis and characterization of NiFe2O4 electrocatalyst for the hydrogen evolution reaction in alkaline water electrolysis using different polymer binders

Czech Academy of Sciences Publication Activity Database

Chanda, D.; Hnát, J.; Paidar, M.; Schauer, Jan; Bouzek, K.

2015-01-01

Roč. 285, 1 July (2015), s. 217-226 ISSN 0378-7753 Institutional support: RVO:61389013 Keywords : alkaline water electrolysis * spinel oxides * polymer binder Subject RIV: CG - Electrochemistry Impact factor: 6.333, year: 2015

Multiple courses of antenatal corticosteroids for preterm birth study: outcomes in children at 5 years of age (MACS-5).

Science.gov (United States)

Asztalos, Elizabeth V; Murphy, Kellie E; Willan, Andrew R; Matthews, Stephen G; Ohlsson, Arne; Saigal, Saroj; Armson, B Anthony; Kelly, Edmond N; Delisle, Marie-France; Gafni, Amiram; Lee, Shoo K; Sananes, Renee; Rovet, Joanne; Guselle, Patricia; Amankwah, Kofi; Saleem, Mariam; Sanchez, Johanna

2013-12-01

A single course of antenatal corticosteroid therapy is recommended for pregnant women at risk of preterm birth between 24 and 33 weeks' gestational age. However, 50% of women remain pregnant 7 to 14 days later, leading to the question of whether additional courses should be given to women remaining at risk for preterm birth. The Multiple Courses of Antenatal Corticosteroids for Preterm Birth Study (MACS) was an international randomized clinical trial that compared multiple courses of antenatal corticosteroids with a single course in women at risk of preterm birth. To determine the effects of single vs multiple courses of antenatal corticosteroid therapy on death or neurodevelopmental disability (neuromotor, neurosensory, or neurocognitive/neurobehavioral function) at 5 years of age in children whose mothers participated in MACS. Our secondary aims were to determine the effect on height, weight, head circumference, blood pressure, intelligence, and specific cognitive (visual, spatial, and language) skills. Cohort follow-up study of children seen between June 2006 and May 2012 at 55 centers. In total, 1724 women (2141 children) were eligible for the study, of whom 1728 children (80.7% of the 2141 eligible children) participated and 1719 children contributed to the primary outcome. Single and multiple courses of antenatal corticosteroid therapy. The primary outcome was death or survival with a neurodevelopmental disability in 1 of the following domains: neuromotor (nonambulatory cerebral palsy), neurosensory (blindness, deafness, or need for visual/hearing aids), or neurocognitive/neurobehavioral function (abnormal attention, memory, or behavior). There was no significant difference between the groups in the risk of death or neurodevelopmental disability: 217 of 871 children (24.9%) in the multiple-courses group vs 210 of 848 children (24.8%) in the single-course group (odds ratio, 1.02 [95% CI, 0.81 to 1.29]; P = .84). Multiple courses, compared with a single

Hydraulic Conductivity Measurements with HTU at Eurajoki, Olkiluoto, Boreholes OL-KR16, 16B, 17, 17B, 18 and 18B, Year 2004

Energy Technology Data Exchange (ETDEWEB)

Haemaelaeinen, H.

2005-07-01

As a part of the site investigations for the disposal of spent nuclear fuel, hydraulic con- ductivity measurements were carried out in boreholes OL-KR16, 16B, 17, 17 B, 18 and 18B at Eurajoki, Olkiluoto. The objective was to investigate the distribution of the hydraulic conductivity in the surrounding bedrock volume. Measurements were carried out during spring-summer 2004. The total lengths of the boreholes are: OL-KR16 170,20 m, OL-KR17 157,13 m and OL-KR18 125,49 m. Corresponding B-holes are around 45 m deep, parallel and adjacent to their 'parent' holes so representing the cased sections of them. The conbined measurable length of the holes is about 453,57 m, of which 429,15 m was covered with 217 standard tests at 2 m packer separation as specified in the research plan. 246 tests were initiated, but some had to be cancelled due to errors or unsuitable control parameters. Double-packer constant-head method was used throughout with nominal 200 kPa overpressure. Injection stage lasted normally 20 minutes and fall-off stage 10 minutes. The tests were often shortened if there were clear indications that the hydraulic conductivity is below the measuring range of the system. The pressure in the test section was let to stabilise at least 5 min before injection. In some test sections the stabilisation, injection or fall-off stage lasted several hours. Two transient (Horner and 1/Q) interpretations and one stationary-state (Moye) interpretation were made in-situ immediately after the test. The Hydraulic Testing Unit (HTU-system) is owned by Posiva Oy and it was operated by Geopros Oy. (orig.)

Genotype-specific pathogenic effects in human dilated cardiomyopathy.

Science.gov (United States)

Bollen, Ilse A E; Schuldt, Maike; Harakalova, Magdalena; Vink, Aryan; Asselbergs, Folkert W; Pinto, Jose R; Krüger, Martina; Kuster, Diederik W D; van der Velden, Jolanda

2017-07-15

Mutations in genes encoding cardiac troponin I (TNNI3) and cardiac troponin T (TNNT2) caused altered troponin protein stoichiometry in patients with dilated cardiomyopathy. TNNI3 p.98trunc resulted in haploinsufficiency, increased Ca 2+ -sensitivity and reduced length-dependent activation. TNNT2 p.K217del caused increased passive tension. A mutation in the gene encoding Lamin A/C (LMNA p.R331Q ) led to reduced maximal force development through secondary disease remodelling in patients suffering from dilated cardiomyopathy. Our study shows that different gene mutations induce dilated cardiomyopathy via diverse cellular pathways. Dilated cardiomyopathy (DCM) can be caused by mutations in sarcomeric and non-sarcomeric genes. In this study we defined the pathogenic effects of three DCM-causing mutations: the sarcomeric mutations in genes encoding cardiac troponin I (TNNI3 p.98truncation ) and cardiac troponin T (TNNT2 p.K217deletion ; also known as the p.K210del) and the non-sarcomeric gene mutation encoding lamin A/C (LMNA p.R331Q ). We assessed sarcomeric protein expression and phosphorylation and contractile behaviour in single membrane-permeabilized cardiomyocytes in human left ventricular heart tissue. Exchange with recombinant troponin complex was used to establish the direct pathogenic effects of the mutations in TNNI3 and TNNT2. The TNNI3 p.98trunc and TNNT2 p.K217del mutation showed reduced expression of troponin I to 39% and 51%, troponin T to 64% and 53%, and troponin C to 73% and 97% of controls, respectively, and altered stoichiometry between the three cardiac troponin subunits. The TNNI3 p.98trunc showed pure haploinsufficiency, increased Ca 2+ -sensitivity and impaired length-dependent activation. The TNNT2 p.K217del mutation showed a significant increase in passive tension that was not due to changes in titin isoform composition or phosphorylation. Exchange with wild-type troponin complex corrected troponin protein levels to 83% of controls in the TNNI3

Association between blood pressure and magnesium and uric acid levels in indigenous Argentinean children at high altitude.

Science.gov (United States)

Hirschler, Valeria; González, Claudio; Maccallini, Gustavo; Molinari, Claudia; Castano, Luis

2017-07-08

To determine the association between nontraditional risk factors such as magnesium and uric acid with blood pressure (BP) in Indigenous children. A total of 263 school-aged indigenous children living at high altitude were enrolled in a cross-sectional study in November 2011. Prehypertension (preHTN) and hypertension (HTN) were defined by systolic and/or diastolic BP ≥ 90th to magnesium levels were identified in 21.7% (57/263): 28.1% (16/57) of the children with low magnesium levels had preHTN versus 9.7% (20/206) with normal magnesium values. Furthermore, 21.8% (12/57) of the children with low magnesium levels had HTN versus 4.5% (20/206) with normal magnesium values. There was a significant association between mean arterial pressure and magnesium (r = -026), uric acid (r = 0.20), phosphorus (r = -0.17), z-BMI (r = 0.22), potassium (r = -0.10), HOMA-IR (r = 0.17), calcium (r = -0.10), and sodium (r = -0.13). Multiple linear regression analysis showed that mean arterial pressure was associated significantly and directly with BMI, age, gender, and uric acid; and inversely with magnesium, adjusted for sodium, calcium, phosphorus, potassium, and HOMA-IR (R 2  = 0.43). Furthermore, multiple logistic regression analyses showed that magnesium (OR = 0.015) and uric acid (OR = 2.95) were significantly associated with preHTN. Similar results were obtained when preHTN was replaced by HTN. Our results indicate that HTN was associated inversely with magnesium and positively with uric acid in indigenous school children. © 2017 Wiley Periodicals, Inc.

FastStats: Oral and Dental Health

Science.gov (United States)

... What's this? Submit Button NCHS Home Oral and Dental Health Recommend on Facebook Tweet Share Compartir Data ... States, 2016, table 60 [PDF – 9.8 MB] Dental visits Percent of children aged 2-17 years ...

2015-2016 Travel and Hospitality Expense Reports for Jean Lebel ...

International Development Research Centre (IDRC) Digital Library (Canada)

Ruxandra Staicu

14. Destination(s):. Montreal. Airfare: $0.00. Other. Transportation: $217.23. Accommodation: $200.34. Meals and. Incidentals: $89.25. Other: $0.00. Total: $506.82. Comments: In connection with meeting on Grand Challenges in health.

Emergency centre investigation of first-onset seizures in adults in the ...

African Journals Online (AJOL)

Subgroup analyses were conducted regarding HIV status and inter-facility variation. ... Lumbar puncture (LP) was performed in 67 (21.7%) patients, with normal cerebrospinal fluid findings in 51 (76.1%). ..... There are clear indications for.

Diabetic Retinopathy.

African Journals Online (AJOL)

AmL

diabetic foot were significantly associated with DR. Within patients' practice, regular .... Major limb complications included foot ulcer, claudication .... Flat. 217 44.5 66 30.6. Family income / month (KD). 1500. 45 9.2 24 ...