In vivo stimulus presentation to the mouse vomeronasal system: Surgery, experiment, setup, and software.

Science.gov (United States)

Yoles-Frenkel, Michal; Cohen, Oksana; Bansal, Rohini; Horesh, Noa; Ben-Shaul, Yoram

2017-06-15

Achieving controlled stimulus delivery is a major challenge in the physiological analysis of the vomeronasal system (VNS). We provide a comprehensive description of a setup allowing controlled stimulus delivery into the vomeronasal organ (VNO) of anesthetized mice. VNO suction is achieved via electrical stimulation of the sympathetic nerve trunk (SNT) using cuff electrodes, followed by flushing of the nasal cavity. Successful application of this methodology depends on several aspects including the surgical preparation, fabrication of cuff electrodes, experimental setup modifications, and the stimulus delivery and flushing. Here, we describe all these aspects in sufficient detail to allow other researchers to readily adopt it. We also present a custom written MATLAB based software with a graphical user interface that controls all aspects of the actual experiment, including trial sequencing, hardware control, and data logging. The method allows measurement of stimulus evoked sensory responses in brain regions that receive vomeronasal inputs. An experienced investigator can complete the entire surgical procedure within thirty minutes. This is the only approach that allows repeated and controlled stimulus delivery to the intact VNO, employing the natural mode of stimulus uptake. The approach is economical with respect to stimuli, requiring stimulus volumes as low as 1-2μl. This comprehensive description will allow other investigators to adapt this setup to their own experimental needs and can thus promote our physiological understanding of this fascinating chemosensory system. With minor changes it can also be adapted for other rodent species. Copyright © 2017 Elsevier B.V. All rights reserved.

The vomeronasal cortex - afferent and efferent projections of the posteromedial cortical nucleus of the amygdala in mice.

Science.gov (United States)

Gutiérrez-Castellanos, Nicolás; Pardo-Bellver, Cecília; Martínez-García, Fernando; Lanuza, Enrique

2014-01-01

Most mammals possess a vomeronasal system that detects predominantly chemical signals of biological relevance. Vomeronasal information is relayed to the accessory olfactory bulb (AOB), whose unique cortical target is the posteromedial cortical nucleus of the amygdala. This cortical structure should therefore be considered the primary vomeronasal cortex. In the present work, we describe the afferent and efferent connections of the posteromedial cortical nucleus of the amygdala in female mice, using anterograde (biotinylated dextranamines) and retrograde (Fluorogold) tracers, and zinc selenite as a tracer specific for zinc-enriched (putative glutamatergic) projections. The results show that the posteromedial cortical nucleus of the amygdala is strongly interconnected not only with the rest of the vomeronasal system (AOB and its target structures in the amygdala), but also with the olfactory system (piriform cortex, olfactory-recipient nuclei of the amygdala and entorhinal cortex). Therefore, the posteromedial cortical nucleus of the amygdala probably integrates olfactory and vomeronasal information. In addition, the posteromedial cortical nucleus of the amygdala shows moderate interconnections with the associative (basomedial) amygdala and with the ventral hippocampus, which may be involved in emotional and spatial learning (respectively) induced by chemical signals. Finally, the posteromedial cortical nucleus of the amygdala gives rise to zinc-enriched projections to the ventrolateral septum and the ventromedial striatum (including the medial islands of Calleja). This pattern of intracortical connections (with the olfactory cortex and hippocampus, mainly) and cortico-striatal excitatory projections (with the olfactory tubercle and septum) is consistent with its proposed nature as the primary vomeronasal cortex. © 2013 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

Synchronized Activity in The Main and Accessory Olfactory Bulbs and Vomeronasal Amygdala Elicited by Chemical Signals in Freely Behaving Mice.

Science.gov (United States)

Pardo-Bellver, Cecília; Martínez-Bellver, Sergio; Martínez-García, Fernando; Lanuza, Enrique; Teruel-Martí, Vicent

2017-08-30

Chemosensory processing in mammals involves the olfactory and vomeronasal systems, but how the activity of both circuits is integrated is unknown. In our study, we recorded the electrophysiological activity in the olfactory bulbs and the vomeronasal amygdala in freely behaving mice exploring a battery of neutral and conspecific stimuli. The exploration of stimuli, including a neutral stimulus, induced synchronic activity in the olfactory bulbs characterized by a dominant theta rhythmicity, with specific theta-gamma coupling, distinguishing between vomeronasal and olfactory structures. The correlated activation of the bulbs suggests a coupling between the stimuli internalization in the nasal cavity and the vomeronasal pumping. In the amygdala, male stimuli are preferentially processed in the medial nucleus, whereas female cues induced a differential response in the posteromedial cortical amygdala. Thus, particular theta-gamma patterns in the olfactory network modulates the integration of chemosensory information in the amygdala, allowing the selection of an appropriate behaviour.

Deterioration of the Gαo vomeronasal pathway in sexually dimorphic mammals.

Directory of Open Access Journals (Sweden)

Rodrigo Suárez

Full Text Available In mammals, social and sexual behaviours are largely mediated by the vomeronasal system (VNS. The accessory olfactory bulb (AOB is the first synaptic locus of the VNS and ranges from very large in Caviomorph rodents, small in carnivores and ungulates, to its complete absence in apes, elephants, most bats and aquatic species. Two pathways have been described in the VNS of mammals. In mice, vomeronasal neurons expressing Gαi2 protein project to the rostral portion of the AOB and respond mostly to small volatile molecules, whereas neurons expressing Gαo project to the caudal AOB and respond mostly to large non-volatile molecules. However, the Gαo-expressing pathway is absent in several species (horses, dogs, musk shrews, goats and marmosets but no hypotheses have been proposed to date to explain the loss of that pathway. We noted that the species that lost the Gαo pathway belong to Laurasiatheria and Primates lineages, both clades with ubiquitous sexual dimorphisms across species. To assess whether similar events of Gαo pathway loss could have occurred convergently in dimorphic species we studied G-protein expression in the AOB of two species that independently evolved sexually dimorphic traits: the California ground squirrel Spermophilus beecheyi (Rodentia; Sciurognathi and the cape hyrax Procavia capensis (Afrotheria; Hyracoidea. We found that both species show uniform expression of Gαi2-protein throughout AOB glomeruli, while Gαo expression is restricted to main olfactory glomeruli only. Our results suggest that the degeneration of the Gαo-expressing vomeronasal pathway has occurred independently at least four times in Eutheria, possibly related to the emergence of sexual dimorphisms and the ability of detecting the gender of conspecifics at distance.

Role of the vomeronasal system in intersexual attraction in female mice.

Science.gov (United States)

Martínez-Ricós, J; Agustín-Pavón, C; Lanuza, E; Martínez-García, F

2008-05-02

Although it is generally accepted that rodents' sociosexual behavior relies mainly on chemosignals, the specific roles played by the vomeronasal and olfactory systems in detecting these signals are presently unclear. This work reports the results of three experiments aimed at clarifying the role of the vomeronasal system on gender recognition and intersexual attraction, by analyzing the effects of lesions of the accessory olfactory bulbs (AOB) in chemically naïve female mice. The first experiment demonstrates that lesions of the AOB abolish the preference that females show for male-soiled bedding in tests in which the females can contact the bedding, thus having access to both volatile and involatile male chemosignals. The second experiment shows that airborne male-derived chemosignals are not attractive to intact, chemically naïve females but tend to be preferentially explored by females whose AOB has been lesioned. However, repeated exposure to male-soiled bedding has opposite effects in sham-operated and AOB-lesioned female mice. Whereas after this experience sham-operated females show an (acquired) attraction toward male airborne chemosignals, in AOB-lesioned females the same experience makes male-derived volatiles aversive. Finally, in the third experiment we have confirmed that our AOB-lesioned females are able to detect urine-borne male odorants, as well as to discriminate them from the synthetic terpene geraniol. These findings strongly suggest that in mice, the involatile male sexual pheromone that is intrinsically attractive is detected by the vomeronasal system of the females. In addition, the repeated experience of females with male-soiled bedding would probably allow the association of this pheromone, acting as unconditioned stimulus, with olfactory stimuli (odorants) that therefore would become conditioned attractors to the females.

Purification and characterization of a chemoattractant from electric shock-induced earthworm secretion, its receptor binding, and signal transduction through the vomeronasal system of garter snakes.

Science.gov (United States)

Jiang, X C; Inouchi, J; Wang, D; Halpern, M

1990-05-25

Following shocks with low voltage electric current, earthworms, Lumbricus terrestris, secrete a yellow mucus that has alarm properties for conspecifics and chemoattractive properties for garter snakes, Thamnophis sirtalis. A proteinaceous chemoattractant for garter snakes has been isolated and purified to homogeneity from such secretions by means of permeation chromatography and semipreparative nondenaturing polyacrylamide gel electrophoresis. The purified protein is highly attractive to garter snakes; it loses its activity after proteolytic digestion. It is a glycoprotein consisting of a single polypeptide chain with an NH2-terminal alanine. This chemoattractant has a minimum molecular mass of 15.4 kDa calculated from its amino acid and carbohydrate contents and an apparent molecular mass of about 20 kDa as estimated from sodium dodecyl sulfate-polyacrylamide gel electrophoresis. It has a pI of about 4.0, and it binds wheat germ agglutinin but not concanavalin A. This chemoattractant shows a protein to carbohydrate ratio of 2.0 +/- 0.08 (n = 5) and a ratio of total sugar to amino sugar of 1.9 +/- 0.08 (n = 3). The sequence of its NH2-terminal 15 amino acid residues has been determined. Studies were also conducted on the chemosignal transduction through the vomeronasal sensory system of the garter snake. Dot blot analysis showed that the purified chemoattractant bound to snake vomeronasal sensory epithelial membrane fractions. It did not bind to membrane extracts of the nonsensory epithelium of the vomeronasal mushroom body. The chemoattractant also bound specifically to vomeronasal sensory epithelial membrane in a reversible and saturable fashion with Kd and Bmax values of about 0.3 microM and 0.4 nmol/mg of protein, respectively. In electrophysiological studies, the chemoattractant applied to the vomeronasal epithelium caused an increase in firing rate of individual neurons in the accessory olfactory bulb of garter snakes, the projection site for vomeronasal

Neurogenesis in the vomeronasal epithelium of adult garter snakes: 3. Use of 3H-thymidine autoradiography to trace the genesis and migration of bipolar neurons

International Nuclear Information System (INIS)

Wang, R.T.; Halpern, M.

1988-01-01

Use of 3H-thymidine autoradiography and unilateral vomeronasal (VN) axotomy has permitted us to demonstrate directly the existence of VN stem cells in the adult garter snake and to trace continuous bipolar neuron development and migration in the normal VN and deafferentated VN epithelium in the same animal. The vomeronasal epithelium and olfactory epithelium of adult garter snakes are both capable of incorporating 3H-thymidine. In the sensory epithelium of the vomeronasal organ, 3H-thymidine-labeled cells were initially restricted to the base of the undifferentiated cell layer in animals surviving 1 day following 3H-thymidine injection. With increasing survival time, labeled cells progressively migrated vertically within the receptor cell column toward the apex of the bipolar neuron layer. In both the normal and denervated VN epithelium, labeled cells were observed through the 56 days of postoperative survival. In the normal epithelium, labeled cells were always located within the matrix of the intact receptor cell columns. However, labeled cells of the denervated epithelium were always located at the apical front of the newly formed cell mass following depletion of the original neuronal cell population. In addition, at postoperative days 28 and 56, labeled cells of the denervated VN epithelium achieved neuronal differentiation and maturation by migrating much farther away from the base of the receptor cell column than the labeled cells on the normal, unoperated contralateral side. This study directly demonstrates that basal cells initially incorporating 3H-thymidine are indeed stem cells of the VN epithelium in adult garter snakes

The TRPC2 channel forms protein-protein interactions with Homer and RTP in the rat vomeronasal organ

Directory of Open Access Journals (Sweden)

Brann Jessica H

2010-05-01

Full Text Available Abstract Background The signal transduction cascade operational in the vomeronasal organ (VNO of the olfactory system detects odorants important for prey localization, mating, and social recognition. While the protein machinery transducing these external cues has been individually well characterized, little attention has been paid to the role of protein-protein interactions among these molecules. Development of an in vitro expression system for the transient receptor potential 2 channel (TRPC2, which establishes the first electrical signal in the pheromone transduction pathway, led to the discovery of two protein partners that couple with the channel in the native VNO. Results Homer family proteins were expressed in both male and female adult VNO, particularly Homer 1b/c and Homer 3. In addition to this family of scaffolding proteins, the chaperones receptor transporting protein 1 (RTP1 and receptor expression enhancing protein 1 (REEP1 were also expressed. RTP1 was localized broadly across the VNO sensory epithelium, goblet cells, and the soft palate. Both Homer and RTP1 formed protein-protein interactions with TRPC2 in native reciprocal pull-down assays and RTP1 increased surface expression of TRPC2 in in vitro assays. The RTP1-dependent TRPC2 surface expression was paralleled with an increase in ATP-stimulated whole-cell current in an in vitro patch-clamp electrophysiological assay. Conclusions TRPC2 expression and channel activity is regulated by chaperone- and scaffolding-associated proteins, which could modulate the transduction of chemosignals. The developed in vitro expression system, as described here, will be advantageous for detailed investigations into TRPC2 channel activity and cell signalling, for a channel protein that was traditionally difficult to physiologically assess.

Functional promiscuity in a mammalian chemosensory system: extensive expression of vomeronasal receptors in the main olfactory epithelium of mouse lemurs

Directory of Open Access Journals (Sweden)

Philipp eHohenbrink

2014-09-01

Full Text Available The vomeronasal organ (VNO is functional in most terrestrial mammals, though progressively reduced in the primate lineage, and is used for intraspecific communication and predator recognition. Vomeronasal receptor (VR genes comprise two families of chemosensory genes (V1R and V2R that have been considered to be specific for the VNO. However, recently a large number of VRs were reported to be expressed in the main olfactory epithelium (MOE of mice, but there is little knowledge of the expression of these genes outside of rodents. To explore the function of VR genes in mammalian evolution, we analyzed and compared the expression of 64 V1R and 2 V2R genes in the VNO and the MOE of the grey mouse lemur (Microcebus murinus, the primate with the largest known VR repertoire. We furthermore compared expression patterns in adults of both sexes and seasons, and in an infant. A large proportion (83% – 97% of the VR loci was expressed in the VNO of all individuals. The repertoire in the infant was as rich as in adults, indicating reliance on olfactory communication from early postnatal development onwards. In concordance with mice, we also detected extensive expression of VRs in the MOE, with proportions of expressed loci in individuals ranging from 29% to 45%. TRPC2, which encodes a channel protein crucial for signal transduction via VRs, was co-expressed in the MOE in all individuals indicating likely functionality of expressed VR genes in the MOE. In summary, the large VR repertoire in mouse lemurs seems to be highly functional. Given the differences in the neural pathways of MOE and VNO signals, which project to higher cortical brain centers or the limbic system, respectively, this raises the intriguing possibility that the evolution of MOE-expression of VRs enabled mouse lemurs to adaptively diversify the processing of VR-encoded olfactory information.

A candidate subspecies discrimination system involving a vomeronasal receptor gene with different alleles fixed in M. m. domesticus and M. m. musculus.

Directory of Open Access Journals (Sweden)

Robert C Karn

2010-09-01

Full Text Available Assortative mating, a potentially efficient prezygotic reproductive barrier, may prevent loss of genetic potential by avoiding the production of unfit hybrids (i.e., because of hybrid infertility or hybrid breakdown that occur at regions of secondary contact between incipient species. In the case of the mouse hybrid zone, where two subspecies of Mus musculus (M. m. domesticus and M. m. musculus meet and exchange genes to a limited extent, assortative mating requires a means of subspecies recognition. We based the work reported here on the hypothesis that, if there is a pheromone sufficiently diverged between M. m. domesticus and M. m. musculus to mediate subspecies recognition, then that process must also require a specific receptor(s, also sufficiently diverged between the subspecies, to receive the signal and elicit an assortative mating response. We studied the mouse V1R genes, which encode a large family of receptors in the vomeronasal organ (VNO, by screening Perlegen SNP data and identified one, Vmn1r67, with 24 fixed SNP differences most of which (15/24 are nonsynonymous nucleotide substitutions between M. m. domesticus and M. m. musculus. We observed substantial linkage disequilibrium (LD between Vmn1r67 and Abpa27, a mouse salivary androgen-binding protein gene that encodes a proteinaceous pheromone (ABP capable of mediating assortative mating, perhaps in conjunction with its bound small lipophilic ligand. The LD we observed is likely a case of association rather than residual physical linkage from a very recent selective sweep, because an intervening gene, Vmn1r71, shows significant intra(subspecific polymorphism but no inter(subspecific divergence in its nucleotide sequence. We discuss alternative explanations of these observations, for example that Abpa27 and Vmn1r67 are coevolving as signal and receptor to reinforce subspecies hybridization barriers or that the unusually divergent Vmn1r67 allele was not a product of fast positive

El sistema vomeronasal y su posible funcionalidad en larvas de anuros

Directory of Open Access Journals (Sweden)

Pozzi, Andrea Gabriela

2012-12-01

Full Text Available El sistema vomeronasal (SVN es un sistema olfatorio accesorio presente en la mayoría de los tetrápodos. Clásicamente se lo ha asociado con el paso de los vertebrados al ambiente terrestre; sin embargo las evidencias surgidas en los últimos años indican que el SVN apareció tempranamente en la evolución de los tetrápodos y sería funcional en ambientes acuáticos. Este sistema sensorial ha sido descripto en etapas larvales de anuros. Pero ¿es funcional el SVN en renacuajos? No existen experimentos en donde se evalúe la participación del SVN en la quimiodetección en renacuajos. Sin embargo, un número considerable de evidencias indican que este sistema sensorial podría ser funcional en larvas de anuros: 1 El órgano vomeronasal (OVN aparece durante el desarrollo embrionario y está presente durante toda la etapa larval. 2 El OVN contiene neuronas bipolares cuyos axones proyectan al bulbo olfatorio accesorio (BOA donde establecen conexiones sinápticas con neuronas telencefálicas. 3 Las neuronas del OVN expresan los receptores de membrana descriptos en tetrápodos, así como la proteína G involucrada en la señalización intracelular. 4 Los análisis de microscopía electrónica demuestran que el OVN posee neuronas con microvellosidades apicales como se describe para otros grupos y sus características ultraestructurales no se modifican durante la metamorfosis. Más aún, no hay diferencias en la ultraestructura de las conexiones sinápticas entre larvas y adultos a nivel del BOA. Los renacuajos presentan una gran cantidad de comportamientos mediados por quimiodetección. Conocer si el SVN participa en la detección de alguno/s de estos estímulos ayudaría no sólo a dilucidar aspectos relacionados con la comunicación química y el comportamiento en renacuajos sino también a comprender aspectos evolutivos de los sistemas quimiosensoriales en vertebrados.

Refining the dual olfactory hypothesis: pheromone reward and odour experience.

Science.gov (United States)

Martínez-García, Fernando; Martínez-Ricós, Joana; Agustín-Pavón, Carmen; Martínez-Hernández, Jose; Novejarque, Amparo; Lanuza, Enrique

2009-06-25

In rodents, sexual advertisement and gender recognition are mostly (if not exclusively) mediated by chemosignals. Specifically, there is ample evidence indicating that female mice are 'innately' attracted by male sexual pheromones that have critical non-volatile components and are detected by the vomeronasal organ. These pheromones can only get access to the vomeronasal organ by active pumping mechanisms that require close contact with the source of the stimulus (e.g. urine marks) during chemoinvestigation. We have hypothesised that male sexual pheromones are rewarding to female mice. Indeed, male-soiled bedding can be used as a reinforcer to induce conditioned place preference, provided contact with the bedding is allowed. The neural mechanisms of pheromone reward seem, however, different from those employed by other natural reinforcers, such as the sweetness or postingestive effects of sucrose. In contrast to vomeronasal-detected male sexual pheromones, male-derived olfactory stimuli (volatiles) are not intrinsically attractive to female mice. However, after repeated exposure to male-soiled bedding, intact female mice develop an acquired preference for male odours. On the contrary, in females whose accessory olfactory bulbs have been lesioned, exposure to male-soiled bedding induces aversion to male odorants. These considerations, together with data on the different properties of olfactory and vomeronasal receptors, lead us to make a proposal for the complementary roles that the olfactory and vomeronasal systems play in intersexual attraction and in other forms of intra- or inter-species communication.

Molecular Mechanisms of Odor Recognition

National Research Council Canada - National Science Library

Anholt, Robert

2000-01-01

.... We characterized the transduction pathway for the recognition of pheromones in the vomeronasal organ and also characterized subpopulations of olfactory neurons expressing different axonal G proteins...

Ancestral amphibian v2rs are expressed in the main olfactory epithelium

Science.gov (United States)

Syed, Adnan S.; Sansone, Alfredo; Nadler, Walter; Manzini, Ivan; Korsching, Sigrun I.

2013-01-01

Mammalian olfactory receptor families are segregated into different olfactory organs, with type 2 vomeronasal receptor (v2r) genes expressed in a basal layer of the vomeronasal epithelium. In contrast, teleost fish v2r genes are intermingled with all other olfactory receptor genes in a single sensory surface. We report here that, strikingly different from both lineages, the v2r gene family of the amphibian Xenopus laevis is expressed in the main olfactory as well as the vomeronasal epithelium. Interestingly, late diverging v2r genes are expressed exclusively in the vomeronasal epithelium, whereas “ancestral” v2r genes, including the single member of v2r family C, are restricted to the main olfactory epithelium. Moreover, within the main olfactory epithelium, v2r genes are expressed in a basal zone, partially overlapping, but clearly distinct from an apical zone of olfactory marker protein and odorant receptor-expressing cells. These zones are also apparent in the spatial distribution of odor responses, enabling a tentative assignment of odor responses to olfactory receptor gene families. Responses to alcohols, aldehydes, and ketones show an apical localization, consistent with being mediated by odorant receptors, whereas amino acid responses overlap extensively with the basal v2r-expressing zone. The unique bimodal v2r expression pattern in main and accessory olfactory system of amphibians presents an excellent opportunity to study the transition of v2r gene expression during evolution of higher vertebrates. PMID:23613591

NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0131 ref|NP_444459.1| vomeronasal 1 receptor, B8 [Mus musculus] sp|Q9EQ45|VN1B8_MOUSE Vomeronas...al type-1 receptor B8 (Vomeronasal type-1 receptor A13) gb|AAG42088.1|AF291494_1 vomeronasa...l receptor V1RB8 [Mus musculus] dbj|BAB79220.1| vomeronasal receptor 1 A13 [Mus musculus] gb|AAI40252.1| Vomeronasa...l 1 receptor, B8 [synthetic construct] gb|EDK99274.1| vomeronasal ...1 receptor, B8 [Mus musculus] gb|AAI46525.1| Vomeronasal 1 receptor, B8 [synthetic construct] NP_444459.1 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0122 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-OCUN-01-1141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1141 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

Anatomy, histochemistry and immunohistochemistry of the olfactory subsystems in mice

Directory of Open Access Journals (Sweden)

Arthur William Barrios

2014-07-01

Full Text Available The four regions of the murine nasal cavity featuring olfactory neurons were studied anatomically and by labelling with lectins and relevant antibodies with a view to establishing criteria for the identification of olfactory subsystems that are readily applicable to other mammals. In the main olfactory epithelium and the septal organ the olfactory sensory neurons (OSNs are embedded in quasi-stratified columnar epithelium; vomeronasal OSNs are embedded in epithelium lining the medial interior wall of the vomeronasal duct and do not make contact with the mucosa of the main nasal cavity; and in Grüneberg’s ganglion a small isolated population of OSNs lies adjacent to, but not within, the epithelium. With the exception of Grüneberg’s ganglion, all the tissues expressing olfactory marker protein (OMP (the above four nasal territories, the vomeronasal and main olfactory nerves, and the main and accessory olfactory bulbs are also labelled by Lycopersicum esculentum agglutinin, while Ulex europaeus agglutinin I labels all and only tissues expressing Gi2 (the apical sensory neurons of the vomeronasal organ, their axons, and their glomerular destinations in the anterior accessory olfactory bulb. These staining patterns of UEA-I and LEA may facilitate the characterization of olfactory anatomy in other species. A 710-section atlas of the anatomy of the murine nasal cavity has been made available on line.

NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0928 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0928 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 1e-81 52% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0428 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0428 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 2e-82 51% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 7e-78 52% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0143 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0143 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 4e-85 55% ...

NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

NCBI nr-aa BLAST: CBRC-MMUS-07-0085 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-07-0085 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-01-0219 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-01-0219 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-01-0216 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-01-0216 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

NCBI nr-aa BLAST: CBRC-STRI-01-2691 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2691 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-74 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2568 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2568 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-49 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2291 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2291 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-79 50% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0474 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0474 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-81 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0722 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0722 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-65 49% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2741 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2741 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-83 53% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2574 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2574 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 2e-85 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-0161 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-0161 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 3e-84 52% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2502 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2502 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-70 49% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1147 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1147 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-0933 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0130 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0130 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-1973 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1973 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9E...Q46|VN1B7_MOUSE RecName: Full=Vomeronasal type-1 receptor B7; AltName: Full=Vomeronasal type-1 receptor A11 ...gb|AAG42087.1|AF291493_1 vomeronasal receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A1...1 [Mus musculus] gb|AAI41627.1| Vomeronasal 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-OCUN-01-1001 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-1001 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-1277 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1277 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0137 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0137 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2495 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2495 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2240 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-STRI-01-2627 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2627 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

NCBI nr-aa BLAST: CBRC-CPOR-01-1167 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1167 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0138 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0138 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

NCBI nr-aa BLAST: CBRC-MMUS-06-0124 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0124 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

Gene : CBRC-MMUS-06-0104 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0104 6 A Pheromone receptors V1A16_RAT 2e-53 39% ref|NP_598931.1| vomeronasa...l 1 receptor, C15 [Mus musculus] gb|AAL47876.1| vomeronasal receptor V1RC15 [Mus musculus] dbj|BAC2634...7.1| unnamed protein product [Mus musculus] gb|AAI19598.1| Vomeronasal 1 receptor, C15 [Mus musculus] gb|AAI19597.1| Vomeronasa...l 1 receptor, C15 [Mus musculus] gb|EDK98787.1| vomeronasal 1 ...l-length enriched library, clone:4831417D05 product:similar to VOMERONASAL RECEPTOR V1RC3 [Mus musculus], fu

NCBI nr-aa BLAST: CBRC-RNOR-04-0246 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0246 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-125 75% ...

NCBI nr-aa BLAST: CBRC-CPOR-01-1266 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-CPOR-01-1266 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 6e-64 44% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0249 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0249 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-134 76% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0238 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-133 80% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0255 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0255 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-120 74% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0243 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0243 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0244 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0244 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-175 100% ...

NCBI nr-aa BLAST: CBRC-OCUN-01-0923 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-OCUN-01-0923 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 8e-74 48% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0259 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-126 74% ...

NCBI nr-aa BLAST: CBRC-RNOR-04-0240 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0240 ref|NP_775419.2| vomeronasal 1 receptor, B9 [Rattus norvegicus] s...p|Q5J3M9|VN1B9_RAT Vomeronasal type-1 receptor B9 (Vomeronasal type-1 receptor B12) (Vomeronasal receptor 5)... (Pheromone receptor VN5) gb|AAR87948.1| vomeronasal V1r-type receptor V1rb12 [Rattus norvegicus] NP_775419.2 1e-132 76% ...

NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

Chemosensory function of the amygdala.

Science.gov (United States)

Gutiérrez-Castellanos, Nicolás; Martínez-Marcos, Alino; Martínez-García, Fernando; Lanuza, Enrique

2010-01-01

The chemosensory amygdala has been traditionally divided into two divisions based on inputs from the main (olfactory amygdala) or accessory (vomeronasal amygdala) olfactory bulbs, supposedly playing different and independent functional roles detecting odors and pheromones, respectively. Recently, there has been increased anatomical evidence of convergence inputs from the main and accessory bulbs in some areas of the amygdala, and this is correlated with functional evidence of interrelationships between the olfactory and the vomeronasal systems. This has lead to the characterization of a third division of the chemosensory amygdala, the mixed chemosensory amygdala, providing a new perspective of how chemosensory information is processed in the amygdaloid complex, in particular in relation to emotional behaviors. In this chapter, we analyze the anatomical and functional organization of the chemosensory amygdala from this new perspective. Finally, the evolutionary changes of the chemosensory nuclei of the mammalian amygdala are discussed, paying special attention to the case of primates, including humans. Copyright © 2010 Elsevier Inc. All rights reserved.

Lack of spatial segregation in the representation of pheromones and kairomones in the mouse medial amygdala.

Directory of Open Access Journals (Sweden)

Vinicius Miessler de Andrade Carvalho

2015-08-01

Full Text Available The nervous system is organized to detect, internally represent and process sensory information to generate appropriate behaviors. Despite the crucial importance of odors that elicit instinctive behaviors, such as pheromones and kairomones, their neural representation remains little characterized in the mammalian brain. Here we used expression of the immediate early gene product c-Fos as a marker of neuronal activity to find that a wide range of pheromones and kairomones produces activation in the medial nucleus of the amygdala, a brain area anatomically connected with the olfactory sensory organs. We see that activity in this nucleus depends on vomeronasal organ input, and that distinct vomeronasal stimuli activate a dispersed ensemble of cells, without any apparent spatial segregation. This activity pattern does not reflect the chemical category of the stimuli, their valence or the induced behaviors. These findings will help build a complete understanding of how odor information is processed in the brain to generate instinctive behaviors.

Olfaction and Pheromones: Uncanonical Sensory Influences and Bulbar Interactions

Directory of Open Access Journals (Sweden)

Víctor Vargas-Barroso

2017-11-01

Full Text Available The rodent main and accessory olfactory systems (AOS are considered functionally and anatomically segregated information-processing pathways. Each system is devoted to the detection of volatile odorants and pheromones, respectively. However, a growing number of evidences supports a cooperative interaction between them. For instance, at least four non-canonical receptor families (i.e., different from olfactory and vomeronasal receptor families have been recently discovered. These atypical receptor families are expressed in the sensory organs of the nasal cavity and furnish parallel processing-pathways that detect specific stimuli and mediate specific behaviors as well. Aside from the receptor and functional diversity of these sensory modalities, they converge into a poorly understood bulbar area at the intersection of the main- main olfactory bulb (MOB and accessory olfactory bulb (AOB that has been termed olfactory limbus (OL. Given the intimate association the OL with specialized glomeruli (i.e., necklace and modified glomeruli receiving uncanonical sensory afferences and its interactions with the MOB and AOB, the possibility that OL is a site of non-olfactory and atypical vomeronasal sensory decoding is discussed.

Differently Structured Advance Organizers Lead to Different Initial Schemata and Learning Outcomes

Science.gov (United States)

Gurlitt, Johannes; Dummel, Sebastian; Schuster, Silvia; Nuckles, Matthias

2012-01-01

Does the specific structure of advance organizers influence learning outcomes? In the first experiment, 48 psychology students were randomly assigned to three differently structured advance organizers: a well-structured, a well-structured and key-concept emphasizing, and a less structured advance organizer. These were followed by a sorting task, a…

Gene : CBRC-MMUS-06-0060 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-MMUS-06-0060 6 A Pheromone receptors V1A16_RAT 2e-54 41% ref|NP_598937.1| vomeronasa...l 1 receptor, C21 [Mus musculus] gb|AAL47882.1| vomeronasal receptor V1RC21 [Mus musculus] gb|AAI32387.1| Vomeronasa...-length enriched library, clone:C230065D10 product:similar to VOMERONASAL RECEPTOR V1RC3 [Mus musculus], ful

Differences between insurance organizations: do consumers perceive differences in important areas?

NARCIS (Netherlands)

Delnoij, D.M.J.; Hendriks, M.; Brouwer, W.; Spreeuwenberg, P.

2006-01-01

Background: Competition on the insurance market assumes that insurance organizations differ in what they offer, that the consumers of insurance products perceive differences, and that information about differences is available in a transparent way. With the introduction of the insurance reform in

Data and Decision Making: Same Organization, Different Perceptions; Different Organizations, Different Perceptions

Science.gov (United States)

Maxwell, Nan L.; Rotz, Dana; Garcia, Christina

2016-01-01

This study examines the perceptions of data-driven decision making (DDDM) activities and culture in organizations driven by a social mission. Analysis of survey information from multiple stakeholders in each of eight social enterprises highlights the wide divergence in views of DDDM. Within an organization, managerial and nonmanagerial staff…

Digging deeper: How do different types of organic consumers influence the increasing organic market share?

DEFF Research Database (Denmark)

Andersen, Laura Mørch; Lund, Thomas Bøker

2014-01-01

Purpose – This article aims to investigate how sub-markets with different degrees of maturity develop during a period of general organic growth, and how different consumer segments behave on these sub-markets. Design/methodology/approach – This paper uses actual purchasing behaviour of six consumer...... segments with different attitudes towards food in general, and organic production and products in particular. The data is from the Danish market for organic foods, which is one of the most mature markets in the world. Findings – The segmentation splits consumers into a positive and a non-positive half......, each half consisting of three different segments. The estimations show that the development in general organic consumption varies between segments, and that their behaviour varies between sub-markets. The positive half of the population has driven the overall growth in organic budget share...

Gene : CBRC-RNOR-04-0153 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-RNOR-04-0153 4 A Pheromone receptors V1A16_RAT 1e-51 40% ref|NP_001009531.1| vomeronasa...l V1r-type receptor V1rc40 [Rattus norvegicus] gb|AAR87997.1| vomeronasal V1r-type receptor V1rc40 ...[Rattus norvegicus] 1e-169 100% gnl|UG|Rn#S22668978 Rattus norvegicus vomeronasal V1r-type receptor V1rc40 m...LSVFQAITISPSTSLMARFKHKLKRYVINALFYIWVFNLSASSDAILSVGGFTNVSEIKQVKITKTCSLFPMNYIIRGLTFILSSSRDVFFVGVMLNASAYMVIILHR

Morphological characterization of the nasopalatine region in human fetuses and its association to pathologies

Directory of Open Access Journals (Sweden)

Saulo Gabriel Moreira FALCI

2013-06-01

Full Text Available The nasopalatine region is composed of structures such as the vomeronasal organ and nasopalatine duct. The nasopalatine duct may provide the communication of the mouth to the nasal cavity in human fetuses and can be obliterated in an adult human. Knowledge on the development of the nasopalatine region and nasopalatine duct in humans is necessary for understanding the morphology and etiopathogenesis of lesions that occur in this region. Objective The aim of the present study was to describe the morphological aspects of the nasopalatine region in human fetuses and correlate these aspects with the development of pathologies in this region. Material and Methods Five human fetuses with no facial or palatine abnormalities were used for the acquisition of specimens from the nasopalatine region. After demineralization, the specimens were histologically processed. Histological cuts were stained with methylene blue to orient the cutting plane and hematoxylin-eosin for the descriptive histological analysis. Results The age of the fetuses was 8.00, 8.25, 9.00 and 9.25 weeks, and it was not possible to determine the age in the last one. The incisive canal was observed in all specimens as an opening delimited laterally by the periosteum and connecting oral and nasal cavity. The nasopalatine duct is an epithelial structure with the greatest morphological variation, with either unilateral or bilateral occurrence and total patent, partial patent and islet forms. The vomeronasal organ is a bilateral epithelized structure located alongside the nasal septum above the incisive canal in all the fetuses. Conclusions The incisive canal, nasopalatine duct and vomeronasal organ are distinct anatomic structures. The development of nasopalatine duct cysts may occur in all forms of the nasopalatine duct.

Trpc2-deficient lactating mice exhibit altered brain and behavioral responses to bedding stimuli.

Science.gov (United States)

Hasen, Nina S; Gammie, Stephen C

2011-03-01

The trpc2 gene encodes an ion channel involved in pheromonal detection and is found in the vomeronasal organ. In tprc2(-/-) knockout (KO) mice, maternal aggression (offspring protection) is impaired and brain Fos expression in females in response to a male are reduced. Here we examine in lactating wild-type (WT) and KO mice behavioral and brain responses to different olfactory/pheromonal cues. Consistent with previous studies, KO dams exhibited decreased maternal aggression and nest building, but we also identified deficits in nighttime nursing and increases in pup weight. When exposed to the bedding tests, WT dams typically ignored clean bedding, but buried male-soiled bedding from unfamiliar males. In contrast, KO dams buried both clean and soiled bedding. Differences in brain Fos expression were found between WT and KO mice in response to either no bedding, clean bedding, or soiled bedding. In the accessory olfactory bulb, a site of pheromonal signal processing, KO mice showed suppressed Fos activation in the anterior mitral layer relative to WT mice in response to clean and soiled bedding. However, in the medial and basolateral amygdala, KO mice showed a robust Fos response to bedding, suggesting that regions of the amygdala canonically associated with pheromonal sensing can be active in the brains of KO mice, despite compromised signaling from the vomeronasal organ. Together, these results provide further insights into the complex ways by which pheromonal signaling regulates the brain and behavior of the maternal female. Copyright © 2010 Elsevier B.V. All rights reserved.

Structure of Masera's Septal Olfactory Organ in Cat (Felis silvestris f. catus - Light Microscopy in Selected Stages of Ontogeny

Directory of Open Access Journals (Sweden)

I. Kociánová

2006-01-01

Full Text Available The septal organ /SO/ (Masera's organ /MO/ is a chemoreceptor presently considered one of three types of olfactory organs (along with the principal olfactory region and vomeronasal organ. Notwithstanding the septal organ having been first described by Rodolfo Masera in 1943, little is known of the properties of sensory neurons or of its functional significance in chemoreception. Until now the septal organ has been described only in laboratory rodents and some marsupials. This work refers to its existence in the domestic cat (Felis silvestris f. catus. The septal organ can be identified at the end of embryonic period - 27 or 28 days of ontogenesis in cats (the 6th developmental stage of Štěrba - coincident with formation of the principal olfactory region in nasal cavity. At 45 days of ontogenesis (the 9th developmental stage of Štěrba, this septal olfactory organ is of circular or oval shape, 120 μm in diameter, in ventral part of septum nasi, lying caudally to the opening of ductus incisivus. The structure of the epithelium of septal olfactory organ is clearly distinct from the respiratory epithelium of the nasal cavity. It varies in thickness, cellular composition, as well as free surface appearance, and even lack the typical structure of sensory epithelium, in this developmental period. Nerve bundles and glandular acini are lacking in the lamina propria mucosae of the septal organ and in the adjacent tissues. Glands appear as the single non-luminized cords of epithelia extending from the surface. The adjacent respiratory epithelium contains numerous goblet cells.

Integration and test planning patterns in different organizations

NARCIS (Netherlands)

Jong, de I.S.M.; Boumen, R.; Mortel - Fronczak, van de J.M.; Rooda, J.E.; Tretmans, J.

2007-01-01

Planning an integration and test phase is often done by experts in the visited organizations. These experts have a thorough knowledge about the system, integration and testing and the business drivers of an organization. An integration and test plan developedfor an airplane is different than the

Different implications for enterprises of an organic production

OpenAIRE

Fajardo Puentes, Barbara Dominicq

2015-01-01

This paper reviews the concept of “organic”, its meaning and emphasizes a comparison with conventional goods. It develops the background of organic goods in the past 20 years, quotations different definitions of organic and developing a main definition. Also it states certain criteriab and variables in order to develop a deeper business analysis. And it has the objective to define the advantages, disadvantages, key points and strategies for companies that want to venture an organic production...

Do Employees Behave Differently in Public - Vs Private-Sector Organizations?

NARCIS (Netherlands)

Baarspul, Hayo Christiaan; Wilderom, Celeste P.M.

2012-01-01

Governmental, public-sector organizations are known to operate differently than private, for-profit organizations. But do sector differences exist at the individual level as well? In this article we review twenty-eight hypothesis-driven empirical studies on this question. Most of the single studies

Comparative investigation of two different self-organizing map ...

African Journals Online (AJOL)

Purpose: To demonstrate the ability and investigate the performance of two different wavelength selection approaches based on self-organizing map (SOM) technique in partial least-squares (PLS) regression for analysis of pharmaceutical binary mixtures with strongly overlapping spectra. Methods: Two different variable ...

The structure of the nasal chemosensory system in squamate ...

Indian Academy of Sciences (India)

Jatin Shah

†Present address: Department of Biology, Slippery Rock University, Slippery Rock, PA .... tional differences in the vomeronasal system within squamate ... At least one of each sex per species ..... reptiles: a phylogenetic approach; Brain Behav.

Observations on the effects of odours on the homeopathic response.

Science.gov (United States)

McGuigan, Moira

2014-07-01

Samuel Hahnemann described incidences where the homeopathic response was disrupted by noxious smells in the environment. An earlier paper proposed that homeopathic medicines may be sensed by vomeronasal cells (VNCs) i.e. microvillus or brush cells in the vomeronasal organ (VNO), the taste buds and associated with the trigeminal nerve and nervus terminalis. This paper proposes an extension to the theory and suggests that a subset of solitary chemosensory cells (SCCs) in the diffuse chemosensory system (DCS) that is morphologically similar to VNCs might also be receptive to homeopathic medicines. The types of odours that may interfere with this process are described. Two clinical cases of disruption of the homeopathic response are given as examples, showing that successful re-establishment of remedy action can be produced by timely repetition of the medicine. The ramifications on clinical homeopathic practice are discussed. Copyright © 2014 The Faculty of Homeopathy. Published by Elsevier Ltd. All rights reserved.

Effect of different combining patterns of radionuclides in marine organisms

International Nuclear Information System (INIS)

Ueda, T.; Suzuki, Y.; Nakamura, R.; Nakahara, M.

1981-01-01

Information on the environmental factors (level of radioactivity in sea water, salinity, temperature, etc.), the biological factors (growth stage, species of organism, etc.), and the metabolism of radionuclides in marine organisms should be taken into account so as to understand the mechanism of radioactive contamination of marine organisms. From this viewpoint, the combining of radionuclides with constituents in marine organisms was studied, indicating the differences as follows: (a) Different appearances of radioactive cobalt in the liver of the abalone due to chemical forms: From the gel filtration profiles on Sephadex it was observed that 57 Co accumulated in the liver of the abalone from sea water labelled by complexed 57 Co combines with a constituent in the liver that has a molecular weight of about 40,000. However, 60 Co taken up from sea water containing ionic 60 Co combines with other constituents in the liver. (b) Appearance of radionuclides in fish due to pathways (sea water and food): In fish liver, most 137 Cs from both sea water and food combines with only one constituent substance; the molecular weight of this substance was estimated at 1100-1300. Cobalt-60 from both sea water and food associates with two different molecular weight constituents, but 65 Zn made a considerable difference in the gel filtration profiles between sea water and food. These results indicate that the metabolism of radionuclides in marine organisms may possibly be varied by the chemical forms of radionuclides in sea water and the pathways of radionuclides. (author)

[Effects of different cultivation patterns on soil aggregates and organic carbon fractions].

Science.gov (United States)

Qiu, Xiao-Lei; Zong, Liang-Gang; Liu, Yi-Fan; Du, Xia-Fei; Luo, Min; Wang, Run-Chi

2015-03-01

Combined with the research in an organic farm in the past 10 years, differences of soil aggregates composition, distribution and organic carbon fractions between organic and conventional cultivation were studied by simultaneous sampling analysis. The results showed that the percentages of aggregates (> 1 mm, 1-0.5 mm, 0.5-0.25 mm and organic cultivation were 9.73%, 18.41%, 24.46% and 43.90%, respectively. The percentage of organic cultivation than that in conventional cultivation. Organic cultivation increased soil organic carbon (average of 17.95 g x kg(-1)) and total nitrogen contents (average of 1.51 g x kg(-1)). Among the same aggregates in organic cultivation, the average content of heavy organic carbon fraction was significantly higher than that in conventional cultivation. This fraction accumulated in organic carbon. In organic cultivation, the content of labile organic carbon in > 1 mm macro-aggregates was significantly higher than that in conventional cultivation, while no significant difference was found among the other aggregates, indicating that the labile organic carbon was enriched in > 1 mm macro-aggregates. Organic cultivation increased the amounts of organic carbon and its fractions, reduced tillage damage to aggregates, and enhanced the stability of organic carbon. Organic cultivation was therefore beneficial for soil carbon sequestration. The findings of this research may provide theoretical basis for further acceleration of the organic agriculture development.

Local and/or organic: A study on consumer preferences for organic food and food from different origins

OpenAIRE

Feldmann , Corinna; Hamm, Ulrich

2014-01-01

The purpose of this paper is to get a deeper insight into consumer preferences for different food products varying in their places of origin (i.e. local, Germany, neighbouring country, non-EU country) and production practices (i.e. organic vs. non-organic). Therefore, consumer surveys combined with choice experiments were conducted with 641 consumers in eight supermarkets in different parts of Germany. Multinomial and mixed logit models were estimated to draw conclusions on the preference str...

Economic aspects of the application of different organic materials as N-sources in organic production of lettuce

OpenAIRE

Cabilovski, dipl ing Ranko; Manojlovic, Prof Maja; Bogdanovic, Prof Darinka; Bavec, Prof Martina

2008-01-01

In a field experiment on a farm registered for organic production, we studied the effect of the application of different organic materials (OM): farmyard manure (FYM), guano (G), soybean seed (S), forage pea seed (P) on lettuce yield. Besides yield, we also analyzed the economic profitability of the application of different OM. Fresh lettuce yield was significantly higher with OM treatments than with the treatments without fertilization. The highest yield was obtained with the FYM treatment (...

When the Nose Doesn’t Know: Canine Olfactory Function Associated With Health, Management, and Potential Links to Microbiota

OpenAIRE

Eileen K. Jenkins; Mallory T. DeChant; Erin B. Perry

2018-01-01

The impact of health, management, and microbiota on olfactory function in canines has not been examined in review. The most important characteristic of the detection canine is its sense of smell. Olfactory receptors are primarily located on the ethmoturbinates of the nasal cavity. The vomeronasal organ is an additional site of odor detection that detects chemical signals that stimulate behavioral and/or physiological changes. Recent advances in the genetics of olfaction suggest that genetic c...

Expression of taste receptors in Solitary Chemosensory Cells of rodent airways

OpenAIRE

Tizzano, Marco; Cristofoletti, Mirko; Sbarbati, Andrea; Finger, Thomas E

2011-01-01

Abstract Background Chemical irritation of airway mucosa elicits a variety of reflex responses such as coughing, apnea, and laryngeal closure. Inhaled irritants can activate either chemosensitive free nerve endings, laryngeal taste buds or solitary chemosensory cells (SCCs). The SCC population lies in the nasal respiratory epithelium, vomeronasal organ, and larynx, as well as deeper in the airway. The objective of this study is to map the distribution of SCCs within the airways and to determi...

Recycling of Different Available Organic Wastes through Vermicomposting

Directory of Open Access Journals (Sweden)

S. Karmakar

2012-01-01

Full Text Available Generation of organic wastes has been increased in an unprecedented rate in India with rapid population expansion, leading to disposal problems. These organic wastes can be converted into valuable wealth by applying vermicomposting technology. Vermicompost which provides macro and micro nutrients to the plants, also reduces pollution by providing a valuable substitute for chemical fertilizers. Present paper deals with vermicomposting of organic wastes from seven different sources and evaluation of nutrient in those vermicomposts following chemical analyses. These seven sources include coconut coir, water hyacinth, mixed materials, cabbage, banana pseudostem, cow dung, and rice husk. Three composting species of earthworms e.g. Eisenia. fetida, Eudrilus. eugeniae, and Perionyx excavatus were chosen for the experiment. Chemical analysis of vermicomposts under study clearly showed that the vermicompost from water hyacinth contained maximum amount of organic C, total N, and total K though the phosphorous content was maximum in vermicompost from mixed materials. Lowest nutrient content was observed in vermicompost of coconut coir. Vermicomposts from mixed materials, cabbage, banana pseudostem were at per in their chemical properties. It can be concluded that among the seven sources, vermicompost from water hyacinth is best for its nutrient value.

Organizing Construction Practices in Different Cultural Contexts

DEFF Research Database (Denmark)

Thuesen, Christian; Rasmussen, Christian K. S.

2013-01-01

a number of characteristics and challenges related to the cultural context have been identified highlighting a central issue in existing and future construction practices due to the globalization and thereby increasing importance of cultural understanding in project-based organizing. The empirical findings......This paper presents in-depth case studies of construction practices with a specific focus on understanding the emergent and dynamic nature of construction management in different cultural contexts. The cases are based on actual working-experiences by the author as an assistant project manager...... participating in the construction management on site working for three different contractors in different cultural contexts: (1) Construir Futuro S.A. in Quito, Ecuador; (2) Anker Hansen & co. A/S in Copenhagen, Denmark; and (3) E. Pihl & Soen A/S in Stockholm, Sweden. Based on these explorative case studies...

Differences in temperature, organic carbon and oxygen consumption among lowland streams

DEFF Research Database (Denmark)

Sand-Jensen, K.; Pedersen, N. L.

2005-01-01

1. Temperature, organic carbon and oxygen consumption were measured over a year at 13 sites in four lowlands streams within the same region in North Zealand, Denmark with the objectives of determining: (i) spatial and seasonal differences between open streams, forest streams and streams with or w......1. Temperature, organic carbon and oxygen consumption were measured over a year at 13 sites in four lowlands streams within the same region in North Zealand, Denmark with the objectives of determining: (i) spatial and seasonal differences between open streams, forest streams and streams...... the exponential increase of oxygen consumption rate between 4 and 20 °C averaged 0.121 °C-1 (Q10 of 3.35) in 70 measurements and showed no significant variations between seasons and stream sites or correlations with ambient temperature and organic content. 5. Oxygen consumption rate was enhanced downstream...... at ambient temperature by 30-40% and 80-130%, respectively. Faster consumption of organic matter and dissolved oxygen downstream of point sources should increase the likelihood of oxygen stress of the stream biota and lead to the export of less organic matter but more mineralised nutrients to the coastal...

Gender-related differences in adolescent hypertension and in target organ effects.

Science.gov (United States)

Juhász, Mária; Katona, Eva; Settakis, Georgios; Paragh, György; Molnár, Csilla; Fülesdi, Béla; Páll, Dénes

2010-04-01

To assess whether a gender difference exists in adolescent hypertension and its target organ damage and to compare potential confounding factors and target organ damage in hypertensive and normotensive adolescent girls. From the Debrecen Hypertension Study, the anthropometric, blood pressure, and laboratory data as well as intima-media thickness (IMT) and left ventricular mass index (LVMI) of 58 hypertensive boys, 56 hypertensive girls, and 30 normotensive girls were analyzed. Both systolic and mean blood pressure values were higher in adolescent hypertensive boys than in girls. This difference was also present when comparing 24-hour average blood pressure values. Plasma concentrations of nitric oxide (NO) and endothelin-1 were not different in the two gender groups. IMT of the carotid arteries were similar in hypertensive boys and girls, but a significantly higher LVMI was detected in boys. A significant difference was detected in anthropometric data (height, weight, and body mass index [BMI]), plasma concentration of NO (lower levels in hypertensives), and IMT in hypertensive and normotensive girls (higher IMT in hypertensive girls). There is a difference between the severity of hypertension between hypertensive adolescent girls and boys. Hypertensive girls differ from normotensive girls not only in blood pressure values but also in risk factors and subclinical target organ effects. Further studies are needed to explain the gender differences in adolescent hypertension. The potential role of sex hormones in hypertensive teenagers also needs to be clarified in future works.

A Comparative Study of Accounting Entities Under Different Business Organizations

Institute of Scientific and Technical Information of China (English)

LUO Hong-lan; XU Guo-xin; FAN Jin

2001-01-01

In terms of accounting, all types of business enterprises regardless of their organizational form are separate accounting entities. But different types of organization forms entail remarkable differences in the establishments, legal positions, liabilities, taxation obligations and accounting practices of the business enterprises as accounting entities. A good knowledge of such difference is beneficial to the promotion of the development of all types of business enterprises in China.

Antifeedant Activty Of Different Organic Solvent Crude Extracts Of ...

African Journals Online (AJOL)

The antifeedant activity of different organic solvents (acetone, carbon tetrachloride, chloroform, diethyl ether and ethyl alcohol) crude extracts of latex of Euphorbia hirta (family Euphobiaceae) against Limicolaria aurora was investigated, and compared with a control, using pawpaw, (Carica papaya) as bait, at a concentration ...

Gender Differences in Cognitive and Noncognitive Factors Related to Achievement in Organic Chemistry

Science.gov (United States)

Turner, Ronna C.; Lindsay, Harriet A.

2003-05-01

For many college students in the sciences, organic chemistry poses a difficult challenge. Indeed, success in organic chemistry has proven pivotal in the careers of a vast number of students in a variety of science disciplines. A better understanding of the factors that contribute to achievement in this course should contribute to efforts to increase the number of students in the science disciplines. Further, an awareness of gender differences in factors associated with achievement should aid efforts to bolster the participation of women in chemistry and related disciplines. Using a correlation research design, the individual relationships between organic chemistry achievement and each of several cognitive variables and noncognitive variables were assessed. In addition, the relationships between organic chemistry achievement and combinations of these independent variables were explored. Finally, gender- and instructor-related differences in the relationships between organic chemistry achievement and the independent variables were investigated. Cognitive variables included the second-semester general chemistry grade, the ACT English, math, reading, and science-reasoning scores, and scores from a spatial visualization test. Noncognitive variables included anxiety, confidence, effectance motivation, and usefulness. The second-semester general chemistry grade was found to be the best indicator of performance in organic chemistry, while the effectiveness of other predictors varied between instructors. In addition, gender differences were found in the explanations of organic chemistry achievement variance provided by this study. In general, males exhibited stronger correlations between predictor variables and organic chemistry achievement than females.

Light fraction of soil organic matter under different management ...

African Journals Online (AJOL)

A study on light fraction organic matter was carried out on the soil from three different management systems namely; Gmelina arborea, Tectona grandis and Leucaena leucocephala plantations in the University of Agriculture, Abeokuta Nigeria. Soil samples were collected in each of the three management site at five auger ...

Characterization of Soil Organic Matter in Peat Soil with Different Humification Levels using FTIR

Science.gov (United States)

Teong, I. T.; Felix, N. L. L.; Mohd, S.; Sulaeman, A.

2016-07-01

Peat soil is defined as an accumulation of the debris and vegetative under the water logging condition. Soil organic matter of peat soil was affected by the environmental, weather, types of vegetative. Peat soil was normally classified based on its level of humification. Humification can be defined as the transformation of numerous group of substances (proteins, carbohydrates, lipids, etc.) and individual molecules present in living organic matter into group of substances with similar properties (humic substances). During the peat transformation process, content of soil organic matter also will change. Hence, that is important to determine out the types of the organic compound. FTIR (Fourier Transform Infrared) is a machine which is used to differential soil organic matter by using infrared. Infrared is a types of low energy which can determine the organic minerals. Hence, FTIR can be suitable as an indicator on its level of humification. The main objective of this study is to identify an optimized method to characterization of the soil organic content in different level of humification. The case study areas which had been chosen for this study are Parit Sulong, Batu Pahat and UCTS, Sibu. Peat soil samples were taken by every 0.5 m depth until it reached the clay layer. However, the soil organic matter in different humification levels is not significant. FTIR is an indicator which is used to determine the types of soil, but it is unable to differentiate the soil organic matter in peat soil FTIR can determine different types of the soil based on different wave length. Generally, soil organic matter was found that it is not significant to the level of humification.

Differences in species richness patterns between unicellular and multicellular organisms.

Science.gov (United States)

Hillebrand, Helmut; Watermann, Frank; Karez, Rolf; Berninger, Ulrike-G

2001-01-01

For unicellular organisms, a lack of effects of local species richness on ecosystem function has been proposed due to their locally high species richness and their ubiquitous distribution. High dispersal ability and high individual numbers may enable unicellular taxa to occur everywhere. Using our own and published data sets on uni- and multicellular organisms, we conducted thorough statistical analyses to test whether (1) unicellular taxa show higher relative local species richness compared to multicellular taxa, (2) unicellular taxa show lower slopes of the species:area relationships and species:individuals relationships, and (3) the species composition of unicellular taxa is less influenced by geographic distance compared to multicellular taxa. We found higher local species richness compared to the global species pool for unicellular organisms than for metazoan taxa. The difference was significant if global species richness was conservatively estimated but not if extrapolated, and therefore higher richness estimates were used. Both microalgae and protozoans showed lower slopes between species richness and sample size (area or individuals) compared to macrozoobenthos, also indicating higher local species richness for unicellular taxa. The similarity of species composition of both benthic diatoms and ciliates decreased with increasing geographic distance. This indicated restricted dispersal ability of protists and the absence of ubiquity. However, a steeper slope between similarity and distance was found for polychaetes and corals, suggesting a stronger effect of distance on the dispersal of metazoans compared to unicellular taxa. In conclusion, we found partly different species richness patterns among uni- and multicellular eukaryotes, but no strict ubiquity of unicellular taxa. Therefore, the effect of local unicellular species richness on ecosystem function has to be reanalyzed. Macroecological patterns suggested for multicellular organisms may differ in

The Organization. Space Symbolic Construction of Sexual Difference

Directory of Open Access Journals (Sweden)

Elvia Espinosa

2012-12-01

Full Text Available The current work is done under the gender perspective within organizational studies. Gender is used in the social sciences as a category of analysis with a specific meaning: The symbolic and cultural construction of the sexual difference. This construction establishes what is masculine and what is feminine. It sets the “public” space where a paid job could be found and education is ascribed to men, as well as the “private” space where domestic duties are found, maternity, and all that is ascribed to women. This symbolic and cultural construction can be found in the organizational world, but the interactions, result from administrative practices, can modify this gender identity. It is necessary to point out that this article is part of a more general investigation. This investigation was done using a qualitative methodology in which the life histories of female administrators with decision-making positions in their organizations were taken into account. But all research work requires a theoretical reflection. The current work answers such theoretical reflection and showcases some elements to understand the gender category, the organization, and offers also some elements for the possible understanding of gender within the organization and the possibility for reimagining gender identity.

Soil Organic Carbon assessment on two different forest management

Science.gov (United States)

Fernández Minguillón, Alex; Sauras Yera, Teresa; Vallejo Calzada, Ramón

2017-04-01

Soil Organic Carbon assessment on two different forest management. A.F. Minguillón1, T. Sauras1, V.R: Vallejo1. 1 Departamento de Biología Evolutiva, Ecología y Ciencias Ambientales, Universidad de Barcelona, Avenida Diagonal 643, 03080 Barcelona, Spain. Soils from arid and semiarid zones are characterized by a low organic matter content from scarce plant biomass and it has been proposed that these soils have a big capacity to carbon sequestration. According to IPCC ARS WG2 (2014) report and WG3 draft, increase carbon storage in terrestrial ecosystems has been identified such a potential tool for mitigation and adaptation to climate change. In ecological restoration context improve carbon sequestration is considered a management option with multiple benefits (win-win-win). Our work aims to analyze how the recently developed restoration techniques contributed to increases in terrestial ecosystem carbon storage. Two restoration techniques carried out in the last years have been evaluated. The study was carried out in 6 localities in Valencian Community (E Spain) and organic horizons of two different restoration techniques were evaluated; slash brush and thinning Aleppo pine stands. For each technique, carbon stock and its physical and chemical stability has been analysed. Preliminary results point out restoration zones acts as carbon sink due to (1) the relevant necromass input produced by slash brush increases C stock on the topsoil ;(2) Thinning increase carbon accumulation in vegetation.

Performance of different tomato cultivars under organic and inorganic regimes

International Nuclear Information System (INIS)

Ali, I.; Khattak, A. M.; Ali, M.; Ullah, K.

2015-01-01

To study the performance of different tomato cultivars under organic and inorganic regimes an experiment was conducted at New Developmental Farm, The University of Agriculture, Peshawar, Pakistan during the summer 2013-14. The experiment was laid out in RCBD with split plot arrangement having four replications. Organic regimes (FYM, poultry manure and mushroom compost) and inorganic (NPK) regimes were allotted to main plot, while cultivars (Roma VF, Roma, Super Classic, Bambino and Rio Grande) were subjected to sub plots. Organic and Inorganic regimes significantly (P ≤ 0.01) influenced all the studied attributes of tomato cultivars. Among different cultivars, Roma gave maximum plant survival (93.8 percentage), number of leaves plant (84.1), number of flower inflorescence (5.4), number of fruits inflorescence (4.3), number of fruit plant (25.4), fruit size (63.9 cm) fruit weight plant (9.1 kg) and total yield (22.9 t ha). However, it was closely followed by cultivar Rio Grande for number of leaves plant (79.6), number of flower inflorescence (5.1), number of fruits inflorescence (4.0) and number of fruits plant (24.9). Cultivar Super Classic produced minimum number of leaves plant (67.7), flower inflorescence (4.8), fruit size (60.6 cm), fruit weight plant (8.6 kg) and total yield (21.7 t ha). Similarly, highest plant survival (90.0 percentage), number of flower inflorescence (5.1), number of fruits inflorescence (4.0), number of fruit plant (25.4), fruit size (62.4 ml), fruit weight plant (8.90 kg) and total yield (22.9 t ha) were recorded in plants provided with organic conditions Roma cultivar performed better than other cultivars under the agro climatic condition of Peshawar followed by cultivar Rio Grande. Therefore, organic tomato production, and these two cultivars are recommended to be grown in Peshawar area. (author)

[Effects of different types of litters on soil organic carbon mineralization].

Science.gov (United States)

Shi, Xue-Jun; Pan, Jian-Jun; Chen, Jin-Ying; Yang, Zhi-Qiang; Zhang, Li-Ming; Sun, Bo; Li, Zhong-Pei

2009-06-15

Using litter incubation experiment in laboratory, decomposition discrepancies of four typical litters from Zijin Mountain were analyzed. The results show that organic carbon mineralization rates of soil with litters all involve fast and slow decomposition stages, and the differences are that the former has shorter duration,more daily decomposition quantity while the latter is opposite. Organic carbon mineralization rates of soil with litters rapidly reached maximum in the early days of incubation, and the order is soil with Cynodon dactylon litter (CK + BMD) (23.88 +/- 0.62) mg x d(-1), soil with Pinus massoniana litter (CK+ PML) (17.93 +/- 0.99) mg x d(-1), soil with Quercus acutissima litter (CK+ QAC) (15.39 +/- 0.16) mg x d(-1) and soil with Cyclobalanopsis glauca litter (CK + CGO) (7.26 +/- 0.34) mg x d(-1), and with significant difference between each other (p litter initial chemical elements. The amount of organic carbon mineralized accumulation within three months incubation is (CK + BMD) (338.21 +/- 6.99) mg, (CK + QAC) (323.48 +/- 13.68) mg, (CK + PML) (278.34 +/- 13.91) mg and (CK + CGO) (245.21 +/- 4.58) mg. 198.17-297.18 mg CO2-C are released during litter incubation, which occupies 20.29%-31.70% of the total litter organic carbon amounts. Power curve model can describe the trends of organic carbon mineralization rate and mineralized accumulation amount,which has a good correlation with their change.

Evolution of organic matter during composting of different organic wastes assessed by CPMAS 13C NMR spectroscopy

International Nuclear Information System (INIS)

Caricasole, P.; Provenzano, M.R.; Hatcher, P.G.; Senesi, N.

2011-01-01

In this paper, the evolution of organic matter (OM) during composting of different mixtures of various organic wastes was assessed by means of chemical analyses and CPMAS 13 C NMR spectroscopy measured during composting. The trends of temperatures and C/N ratios supported the correct evolution of the processes. The CPMAS 13 C NMR spectra of all composting substrates indicated a reduction in carbohydrates and an increase in aromatic, phenolic, carboxylic and carbonylic C which suggested a preference by microorganisms for easily degradable C molecules. The presence of hardly degradable pine needles in one of the substrates accounted for the lowest increase in alkyl C and the lowest reduction in carbohydrates and carboxyl C as opposite to another substrate characterized by the presence of a highly degradable material such as spent yeast from beer production, which showed the highest increase of the alkyl C/O-alkyl C ratio. The highest increase of COOH deriving by the oxidative degradation of cellulose was shown by a substrate composed by about 50% of plant residues. The smallest increases in alkyl C/O-alkyl C ratio and in polysaccharides were associated to the degradation of proteins and lipids which are major components of sewage sludge. Results obtained were related to the different composition of fresh organic substrates and provided evidence of different OM evolution patterns as a function of the initial substrate composition.

Temporal Response Properties of Accessory Olfactory Bulb Neurons: Limitations and Opportunities for Decoding.

Science.gov (United States)

Yoles-Frenkel, Michal; Kahan, Anat; Ben-Shaul, Yoram

2018-05-23

The vomeronasal system (VNS) is a major vertebrate chemosensory system that functions in parallel to the main olfactory system (MOS). Despite many similarities, the two systems dramatically differ in the temporal domain. While MOS responses are governed by breathing and follow a subsecond temporal scale, VNS responses are uncoupled from breathing and evolve over seconds. This suggests that the contribution of response dynamics to stimulus information will differ between these systems. While temporal dynamics in the MOS are widely investigated, similar analyses in the accessory olfactory bulb (AOB) are lacking. Here, we have addressed this issue using controlled stimulus delivery to the vomeronasal organ of male and female mice. We first analyzed the temporal properties of AOB projection neurons and demonstrated that neurons display prolonged, variable, and neuron-specific characteristics. We then analyzed various decoding schemes using AOB population responses. We showed that compared with the simplest scheme (i.e., integration of spike counts over the entire response period), the division of this period into smaller temporal bins actually yields poorer decoding accuracy. However, optimal classification accuracy can be achieved well before the end of the response period by integrating spike counts within temporally defined windows. Since VNS stimulus uptake is variable, we analyzed decoding using limited information about stimulus uptake time, and showed that with enough neurons, such time-invariant decoding is feasible. Finally, we conducted simulations that demonstrated that, unlike the main olfactory bulb, the temporal features of AOB neurons disfavor decoding with high temporal accuracy, and, rather, support decoding without precise knowledge of stimulus uptake time. SIGNIFICANCE STATEMENT A key goal in sensory system research is to identify which metrics of neuronal activity are relevant for decoding stimulus features. Here, we describe the first systematic

Differences in the Financial Management of Conventional, Organic, and Biodynamic Farms

Directory of Open Access Journals (Sweden)

Vlašicová Eliška

2015-09-01

Full Text Available The financial management of conventional, organic, and biodynamic farms was evaluated and compared. It is a highly specific issue filling in the gap namely in the area of economic research of biodynamic agriculture. Biodynamic agriculture is a less widespread concept of agriculture, the management of which meets the requirements of organic agriculture. Organic agriculture has still been gaining in importance in the Czech Republic, the number of organic farms has been growing, and availability of organic products has increased, too. Of the Czech farms receiving subsidies from the EU or state subsidies in 2007-2012, a total of 389 were selected for analysis (273 of which were conventional farms, 112 organic farms, and 4 farms were engaged in biodynamic agriculture. Subsidies, Total Costs, Operating Revenue, Profit and Gross Value Added indicators were selected for evaluation. The individual indicators within groups of companies were compared by means of a t-test. The analysis revealed significant differences in the economic indicators of individual types of farms. It was observed that organic enterprises have better economic results than conventional and biodynamic businesses. Subsidies help all types of farms achieve better results. We may hence assume dependence of these farms on subsidies.

ORGANIC CARBON AND TOTAL NITROGEN IN THE DENSIMETRIC FRACTIONS OF ORGANIC MATTER UNDER DIFFERENT SOIL MANAGEMEN

Directory of Open Access Journals (Sweden)

MARCELO RIBEIRO VILELA PRADO

2016-01-01

Full Text Available The evaluation of land use and management by the measurement of soil organic matter and its fractions has gained attention since it helps in the understanding of the dynamics of their contribution to soil productivity, especially in tropical environments. This study was conducted in the municipality of Colorado do Oeste, state of Rondônia, Brazil and its aim was to determinethe quantity of organic carbon and total nitrogen in the light and heavy fractions of organic matter in the surface layers of a typic hapludalf under different land use systems: Native Forest: open evergreen forest, reference environment; Agroforestry System 1: teak (Tectona grandis LF and kudzu (Pueraria montana; Agroforestry System 2: coffee (Coffea canephora, marandu palisade grass (Brachiaria brizantha cv. Marandu, “pinho cuiabano” (Parkia multijuga, teak and kudzu.; Agroforestry System 3: teak and cocoa (Theobroma cacao; Silvopasture System: teak, cocoa and marandu palisade grass; and Extensive Grazing System: marandu palisade grass. The experimental design was a randomized block in split-split plots (use systems versus soil layers of 0-0.05 and 0.05-0.10 m with three replications. The results showed that relative to Native Forest, the Agroforestry System 2 had equal- and greater amounts of organic carbon and total nitrogen respectively (light and heavy fractions in the soil organic matter, with the light fraction being responsible for storage of approximately 45% and 70% of the organic carbon and total nitrogen, respectively. Therefore, the light densimetric fraction proved to be useful in the early identification of the general decline of the soil organic matter in the land use systems evaluated.

Interarm blood pressure difference and target organ damage in the general population.

Science.gov (United States)

Johansson, Jouni K; Puukka, Pauli J; Jula, Antti M

2014-02-01

The objective of the study was to investigate interarm differences of blood pressure (BP) and its determinants, and to clarify whether both arms are equally good in assessing BP and target organ damage in the general population. We studied a representative sample of Finnish adult population with 484 study participants, ages 25-74 years. BP was measured twice by an oscillometric monitor simultaneously on both arms. Study participants underwent a clinical examination including measurements of serum lipids, glucose and indicators of target organ damage. BP was 2.3/0.2 mmHg higher on right than on left arm (P differences). SBP and DBP measured on right and left arms correlated equally with left ventricular mass index (LVMI), interventricular septal thickness (IVST), posterior wall thickness (PWT), pulse wave velocity (PWV) and albuminuria. Higher SBP level was an independent determinant of both greater systolic and diastolic interarm BP difference. Exaggerated absolute diastolic interarm BP difference (>5 mmHg) was associated with higher BMI, arm circumference, LVMI, IVST and PWT, whereas exaggerated absolute systolic interarm BP difference (>10 mmHg) was not associated with any clinical variables. There was only a small difference in BP between arms in a healthy general population. Both arms are equally good determinants of target organ damage. BP should be measured at least once on both arms and prefer the arm with higher BP readings in the future BP measurements.

Position-specific isotope modeling of organic micropollutants transformation through different reaction pathways

DEFF Research Database (Denmark)

Jin, Biao; Rolle, Massimo

2016-01-01

The degradation of organic micropollutants occurs via different reaction pathways. Compound specific isotope analysis is a valuable tool to identify such degradation pathways in different environmental systems. We propose a mechanism-based modeling approach that provides a quantitative framework ...

Experimental research on the structural characteristics of high organic soft soil in different deposition ages

Science.gov (United States)

Liu, Fei; Lin, Guo-he

2018-03-01

High organic soft soil, which is distributed at Ji Lin province in China, has been studied by a lot of scholars. In the paper, structural characteristics with different deposition ages have been researched by experimental tests. Firstly, the characteristics of deposition age, degree of decompositon, high-pressure consolidation and microstructure have been measured by a series of tests. Secondly, structural strengths which were deposited in different ages, have been carried out to test the significant differences of stress-strain relations between remoulded and undisturbed high organic soft soil samples. Results showed that high organic soft soil which is deposited at different ages will influence its structural characteristics.

In Silico Characterization of Pectate Lyase Protein Sequences from Different Source Organisms

Directory of Open Access Journals (Sweden)

Amit Kumar Dubey

2010-01-01

Full Text Available A total of 121 protein sequences of pectate lyases were subjected to homology search, multiple sequence alignment, phylogenetic tree construction, and motif analysis. The phylogenetic tree constructed revealed different clusters based on different source organisms representing bacterial, fungal, plant, and nematode pectate lyases. The multiple accessions of bacterial, fungal, nematode, and plant pectate lyase protein sequences were placed closely revealing a sequence level similarity. The multiple sequence alignment of these pectate lyase protein sequences from different source organisms showed conserved regions at different stretches with maximum homology from amino acid residues 439–467, 715–816, and 829–910 which could be used for designing degenerate primers or probes specific for pectate lyases. The motif analysis revealed a conserved Pec_Lyase_C domain uniformly observed in all pectate lyases irrespective of variable sources suggesting its possible role in structural and enzymatic functions.

Position-specific isotope modeling of organic micropollutants transformation through different reaction pathways

International Nuclear Information System (INIS)

Jin, Biao; Rolle, Massimo

2016-01-01

The degradation of organic micropollutants occurs via different reaction pathways. Compound specific isotope analysis is a valuable tool to identify such degradation pathways in different environmental systems. We propose a mechanism-based modeling approach that provides a quantitative framework to simultaneously evaluate concentration as well as bulk and position-specific multi-element isotope evolution during the transformation of organic micropollutants. The model explicitly simulates position-specific isotopologues for those atoms that experience isotope effects and, thereby, provides a mechanistic description of isotope fractionation occurring at different molecular positions. To demonstrate specific features of the modeling approach, we simulated the degradation of three selected organic micropollutants: dichlorobenzamide (BAM), isoproturon (IPU) and diclofenac (DCF). The model accurately reproduces the multi-element isotope data observed in previous experimental studies. Furthermore, it precisely captures the dual element isotope trends characteristic of different reaction pathways as well as their range of variation consistent with observed bulk isotope fractionation. It was also possible to directly validate the model capability to predict the evolution of position-specific isotope ratios with available experimental data. Therefore, the approach is useful both for a mechanism-based evaluation of experimental results and as a tool to explore transformation pathways in scenarios for which position-specific isotope data are not yet available. - Highlights: • Mechanism-based, position-specific isotope modeling of micropollutants degradation. • Simultaneous description of concentration and primary and secondary isotope effects. • Key features of the model are demonstrated with three illustrative examples. • Model as a tool to explore reaction mechanisms and to design experiments. - We propose a modeling approach incorporating mechanistic information and

Characteristics of organic acids in the fruit of different pumpkin species.

Science.gov (United States)

Nawirska-Olszańska, Agnieszka; Biesiada, Anita; Sokół-Łętowska, Anna; Kucharska, Alicja Z

2014-04-01

The aim of the research was to determine the composition of organic acids in fruit of different cultivars of three pumpkin species. The amount of acids immediately after fruit harvest and after 3 months of storage was compared. The content of organic acids in the examined pumpkin cultivars was assayed using the method of high performance liquid chromatography (HPLC). Three organic acids (citric acid, malic acid, and fumaric acid) were identified in the cultivars, whose content considerably varied depending on a cultivar. Three-month storage resulted in decreased content of the acids in the case of cultivars belonging to Cucurbita maxima and Cucurbita pepo species, while a slight increase was recorded for Cucurbita moschata species. Crown Copyright © 2013. Published by Elsevier Ltd. All rights reserved.

Relationships between colored dissolved organic matter and dissolved organic carbon in different coastal gradients of the Baltic Sea

OpenAIRE

Harvey, E. Therese; Kratzer, Susanne; Andersson, Agneta

2015-01-01

Due to high terrestrial runoff, the Baltic Sea is rich in dissolved organic carbon (DOC), the light-absorbing fraction of which is referred to as colored dissolved organic matter (CDOM). Inputs of DOC and CDOM are predicted to increase with climate change, affecting coastal ecosystems. We found that the relationships between DOC, CDOM, salinity, and Secchi depth all differed between the two coastal areas studied; the W Gulf of Bothnia with high terrestrial input and the NW Baltic Proper with ...

Visualization of amino acid composition differences between processed protein from different animal species by self-organizing feature maps

Directory of Open Access Journals (Sweden)

Xingfan ZHOU,Zengling YANG,Longjian CHEN,Lujia HAN

2016-06-01

Full Text Available Amino acids are the dominant organic components of processed animal proteins, however there has been limited investigation of differences in their composition between various protein sources. Information on these differences will not only be helpful for their further utilization but also provide fundamental information for developing species-specific identification methods. In this study, self-organizing feature maps (SOFM were used to visualize amino acid composition of fish meal, and meat and bone meal (MBM produced from poultry, ruminants and swine. SOFM display the similarities and differences in amino acid composition between protein sources and effectively improve data transparency. Amino acid composition was shown to be useful for distinguishing fish meal from MBM due to their large concentration differences between glycine, lysine and proline. However, the amino acid composition of the three MBMs was quite similar. The SOFM results were consistent with those obtained by analysis of variance and principal component analysis but more straightforward. SOFM was shown to have a robust sample linkage capacity and to be able to act as a powerful means to link different sample for further data mining.

THE DIFFERENCE IN COLOR AND SENSORY OF ORGANIC QUALITY WINE AND WINE FROM CONVENTIONAL CULTIVATION

Directory of Open Access Journals (Sweden)

Viera Šottníková

2014-02-01

Full Text Available This work deals with the colour and sensory evaluation of wines and organic wines from conventional cultivation. 6 organic wines and 6 wines from conventional cultivation were evaluated. The methodology describes colour measurements using spectrophotometry and sensory 20-point-scale system of scoring. The colour evaluation of different varieties did not clearly demonstrate impact of growing on lightness or hue and saturation of wine. Conclusive differences in colour (P <0.05 were established, especially for Pinot Blanc and Malverina from white varieties and Medina from red grapes. The greatest colour stability was demonstrated by Moravian Muscat. Sensory evaluation did not show any noticeable differences between the wines of conventional and organic production, there were, however, differences among varieties.

Performance analysis of organic Rankine cycles using different working fluids

Directory of Open Access Journals (Sweden)

Zhu Qidi

2015-01-01

Full Text Available Low-grade heat from renewable or waste energy sources can be effectively recovered to generate power by an organic Rankine cycle (ORC in which the working fluid has an important impact on its performance. The thermodynamic processes of ORCs using different types of organic fluids were analyzed in this paper. The relationships between the ORC’s performance parameters (including evaporation pressure, condensing pressure, outlet temperature of hot fluid, net power, thermal efficiency, exergy efficiency, total cycle irreversible loss, and total heat-recovery efficiency and the critical temperatures of organic fluids were established based on the property of the hot fluid through the evaporator in a specific working condition, and then were verified at varied evaporation temperatures and inlet temperatures of the hot fluid. Here we find that the performance parameters vary monotonically with the critical temperatures of organic fluids. The values of the performance parameters of the ORC using wet fluids are distributed more dispersedly with the critical temperatures, compared with those of using dry/isentropic fluids. The inlet temperature of the hot fluid affects the relative distribution of the exergy efficiency, whereas the evaporation temperature only has an impact on the performance parameters using wet fluid.

Sexual differences in the excretion of organic and inorganic mercury by methyl mercury-treated rats

International Nuclear Information System (INIS)

Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Mushak, P.; Hall, L.L.

1987-01-01

Adult male and female Long Evans rats received 1 mumole of methyl ( 203 Hg) mercuric chloride per kilogram sc. Whole-body retention of mercury and excretion of organic and inorganic mercury in urine and feces were monitored for 98 days after dosing. Females cleared mercury from the body more rapidly than did males. The major route of mercury excretion was feces. By 98 days after dosing, cumulative mercury excretion in feces accounted for about 51% of the dose in males and about 54% of the dose in females. For both sexes, about 33% of the dose was excreted in feces as inorganic mercury. Cumulative excretion of organic mercury in feces accounted for about 18 and 21% of the dose in males and females, respectively. Urinary excretion of mercury was quantitatively a smaller route for mercury clearance but important sexual differences in loss by this route were found. Over the 98-day experimental period, males excreted in urine about 3.2% of the dose and females excreted 7.5%. Cumulative organic Hg excretion in urine accounted for 1.8% of the dose in males and 5.3% of the dose in females. These sexual differences in urinary and fecal excretion of organic and inorganic mercury following methyl mercury treatment were consistent with previous reports of sexual differences in mercury distribution and retention in methyl mercury-treated rats, particularly sexual differences in organic mercury uptake and retention in the kidney. Relationships between body burdens of organic or inorganic Hg and output of these forms of Hg in urine and feces were also found to be influenced by the interval after MeHg treatment and by sex. Relationship between concentration of Hg in liver and feces and in kidney and urine differed for organic and inorganic Hg and depended upon sexual status and interval after MeHg treatment

Sensory, yield and quality differences between organically and conventionally grown winter wheat.

Science.gov (United States)

Arncken, Christine M; Mäder, Paul; Mayer, Jochen; Weibel, Franco P

2012-11-01

Consumers expect organic produce to have higher environmental, health and sensory related qualities than conventional produce. In order to test sensory differences between bio-dynamically, bio-organically and conventionally grown winter wheat (Triticum aestivum L., cv. Runal), we performed double-blinded triangle tests with two panels on dry wholemeal flour from the harvest years 2006, 2007 and 2009 and from two field replicates of the 'DOK' long-term farming system comparison field trial near Basel, Switzerland. Yield and quality parameters were also assessed. Significant farming system effects were found for yield (up to 42% reduction in the organic system), thousand kernel weight, hectolitre weight and crude protein content across the three years. In the triangle tests one out of 12 pair-wise farming system comparisons (PFSCs) on wholemeal flour made from the different wheat samples showed significant sensory differentiation (between bio-dynamically and conventionally grown wheat). When all data from the three harvest years and two panels were aggregated, a statistically significant effect (P = 0.045) of PFSCs on the number of correct answers became evident. Although testing of dry wholemeal flour was very challenging for panellists, we were able to show that sensory differences between farming systems can occur. Copyright © 2012 Society of Chemical Industry.

Motion-based, high-yielding, and fast separation of different charged organics in water.

Science.gov (United States)

Xuan, Mingjun; Lin, Xiankun; Shao, Jingxin; Dai, Luru; He, Qiang

2015-01-12

We report a self-propelled Janus silica micromotor as a motion-based analytical method for achieving fast target separation of polyelectrolyte microcapsules, enriching different charged organics with low molecular weights in water. The self-propelled Janus silica micromotor catalytically decomposes a hydrogen peroxide fuel and moves along the direction of the catalyst face at a speed of 126.3 μm s(-1) . Biotin-functionalized Janus micromotors can specifically capture and rapidly transport streptavidin-modified polyelectrolyte multilayer capsules, which could effectively enrich and separate different charged organics in water. The interior of the polyelectrolyte multilayer microcapsules were filled with a strong charged polyelectrolyte, and thus a Donnan equilibrium is favorable between the inner solution within the capsules and the bulk solution to entrap oppositely charged organics in water. The integration of these self-propelled Janus silica micromotors and polyelectrolyte multilayer capsules into a lab-on-chip device that enables the separation and analysis of charged organics could be attractive for a diverse range of applications. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Transformation of organic N newly added to red soil treated with different cultural practices

Institute of Scientific and Technical Information of China (English)

ZhangQin－Zheng; YeQing－Fu; 等

1998-01-01

By using 15N tracer method,transformation of organic N,which wqas newly added to red soil treated with different cultural practices,was studied under thelaboratory incubation condition.The experimental results showed that the transformation of N from newly added organic matter and soil native pool during incubation was influenced by cultural practice treatment beforeincubation.Fallow was favorable to the mineralization of newly added organic N and soil N compared with the planting wheat treatment.Planting wheat greatly increased the loss of soil N.Application of fertilizers stimulated the mineralization of newly added organic N and application of organic matter reduced the mineralization,but stimulated microbialtransformation of newly adde4d organic N.

A multiple index integrating different levels of organization.

Science.gov (United States)

Cortes, Rui; Hughes, Samantha; Coimbra, Ana; Monteiro, Sandra; Pereira, Vítor; Lopes, Marisa; Pereira, Sandra; Pinto, Ana; Sampaio, Ana; Santos, Cátia; Carrola, João; de Jesus, Joaquim; Varandas, Simone

2016-10-01

Many methods in freshwater biomonitoring tend to be restricted to a few levels of biological organization, limiting the potential spectrum of measurable of cause-effect responses to different anthropogenic impacts. We combined distinct organisational levels, covering biological biomarkers (histopathological and biochemical reactions in liver and fish gills), community based bioindicators (fish guilds, invertebrate metrics/traits and chironomid pupal exuviae) and ecosystem functional indicators (decomposition rates) to assess ecological status at designated Water Framework Directive monitoring sites, covering a gradient of human impact across several rivers in northern Portugal. We used Random Forest to rank the variables that contributed more significantly to successfully predict the different classes of ecological status and also to provide specific cut levels to discriminate each WFD class based on reference condition. A total of 59 Biological Quality Elements and functional indicators were determined using this procedure and subsequently applied to develop the integrated Multiple Ecological Level Index (MELI Index), a potentially powerful bioassessment tool. Copyright © 2016 Elsevier Inc. All rights reserved.

Do differences in food web structure between organic and conventional farms affect the ecosystem service of pest control?

Science.gov (United States)

Macfadyen, Sarina; Gibson, Rachel; Polaszek, Andrew; Morris, Rebecca J; Craze, Paul G; Planqué, Robert; Symondson, William O C; Memmott, Jane

2009-03-01

While many studies have demonstrated that organic farms support greater levels of biodiversity, it is not known whether this translates into better provision of ecosystem services. Here we use a food-web approach to analyse the community structure and function at the whole-farm scale. Quantitative food webs from 10 replicate pairs of organic and conventional farms showed that organic farms have significantly more species at three trophic levels (plant, herbivore and parasitoid) and significantly different network structure. Herbivores on organic farms were attacked by more parasitoid species on organic farms than on conventional farms. However, differences in network structure did not translate into differences in robustness to simulated species loss and we found no difference in percentage parasitism (natural pest control) across a variety of host species. Furthermore, a manipulative field experiment demonstrated that the higher species richness of parasitoids on the organic farms did not increase mortality of a novel herbivore used to bioassay ecosystem service. The explanation for these differences is likely to include inherent differences in management strategies and landscape structure between the two farming systems.

Differences in sheep and goats milk fatty acid profile between conventional and organic farming systems.

Science.gov (United States)

Tsiplakou, Eleni; Kotrotsios, Vaios; Hadjigeorgiou, Ioannis; Zervas, George

2010-08-01

The objective of this study was to investigate whether there is a difference in chemical composition and particularly in fatty acid (FA) profile, with emphasis on cis-9, trans-11 CLA, of milk obtained from conventional and organic dairy sheep and goats farms under the farming conditions practiced in Greece. Four dairy sheep and four dairy goat farms, representing common conventional production systems and another four dairy sheep and four dairy goat farms, organically certified, representing organic production and feeding systems were selected from all over Greece. One hundred and sixty two individual milk samples were collected from those farms in January-February 2009, about three months after parturition. The milk samples were analyzed for their main chemical constituents and their FA profile. The results showed that the production system affected milk chemical composition: in particular fat content was lower in the organic sheep and goats milk compared with the corresponding conventional. Milk from organic sheep had higher content in MUFA, PUFA, alpha-LNA, cis-9, trans-11 CLA, and omega-3 FA, whereas in milk from organic goats alpha-LNA and omega-3 FA content was higher than that in conventional one. These differences are, mainly, attributed to different feeding practices used by the two production systems. The results of this study show that the organic milk produced under the farming conditions practiced in Greece has higher nutritional value, due to its FA profile, compared with the respective conventional milk.

Is there any difference in anesthetic management of different post-OLT stage patients undergoing nontransplant organ surgery?

Science.gov (United States)

Feng, Zhi-Ying; Zhang, Jian; Zhu, Sheng-Mei; Zheng, Shu-Sen

2006-08-01

Little information is available about anesthesia management of nontransplant organ surgery of recipients after adult liver transplantation. The aim of this study was to discuss the anesthesia management of recipients for different stages after liver transplantation. The medical records of 16 patients were reviewed after OLT scheduled for elective nontransplant organ surgery at our institution from September 2002 to October 2005. The patients were divided into perioperative stage (group A) and mid-term and long-term stage (group B) groups according to post-OLT time. The data of 16 patients preoperation, intraoperation and postoperation were analyzed. The measurements of alanine transaminase (ALT), total bilirubin (TB), prothrombin time (PT), and lung infection were significantly higher in group A than in group B (POLT recipients except for contraindications. Special considerations include protection of the function of important organs, correction of hemodynamic instability in perioperative stage patients after OLT, and measurement of the side-effects of immunosuppression in mid-term and long-term stage patients.

Assessing two different peroxidases´ potential for application in recalcitrant organic compound bioremediation

Directory of Open Access Journals (Sweden)

Nelson Caicedo

2001-07-01

Full Text Available This work shows the promising future presented by the following enzymes: Chloroperoxidase (CPO from Caldariomyces fumago and royal palm peroxidase (Roystonea regia, PPR. These peroxidases were obtained from different sources (microbial and vegetable and used as biocatalysts for applicating them in bioremediation of recalcitrant organic compounds. Each one of the enzymes' peroxidase catalytic activity was evaluated in organic phase systems, using different model compounds such as: PAHs (pyrene and anthracene, organic-nitrogenated compounds (diphenylamine, monoaromatic phenolic molecules (guayacol and dyes (methyl orange and ABTS. The reaction systems were composed of mono-phase water mixtures and organic miscible solvent (methanol, ethanol, isopropanol, acetonitrile, tetrahydrofuran, dimethyl sulfoxide and dimethyl formamide, on which both peroxidases' catalytic activity was evaluated. The two enzymes' catalytic activity was observed on the evaluated substrates in most of these assays. However, PPR did not show biocatalytic oxidation for methyl orange dye and some PAHs. This enzyme did show the best tolerance to the evaluated solvents. Its catalytic activity was appreciably enhanced when low hydrophobic solvents were used. The kcat was calculated from this experimental data (as kinetic parameter leading to each enzyme's biocatalytic performance on substrates being compared.

Position-specific isotope modeling of organic micropollutants transformations through different reaction pathways

Science.gov (United States)

Jin, Biao; Rolle, Massimo

2016-04-01

Organic compounds are produced in vast quantities for industrial and agricultural use, as well as for human and animal healthcare [1]. These chemicals and their metabolites are frequently detected at trace levels in fresh water environments where they undergo degradation via different reaction pathways. Compound specific stable isotope analysis (CSIA) is a valuable tool to identify such degradation pathways in different environmental systems. Recent advances in analytical techniques have promoted the fast development and implementation of multi-element CSIA. However, quantitative frameworks to evaluate multi-element stable isotope data and incorporating mechanistic information on the degradation processes [2,3] are still lacking. In this study we propose a mechanism-based modeling approach to simultaneously evaluate concentration as well as bulk and position-specific multi-element isotope evolution during the transformation of organic micropollutants. The model explicitly simulates position-specific isotopologues for those atoms that experience isotope effects and, thereby, provides a mechanistic description of isotope fractionation occurring at different molecular positions. We validate the proposed approach with the concentration and multi-element isotope data of three selected organic micropollutants: dichlorobenzamide (BAM), isoproturon (IPU) and diclofenac (DCF). The model precisely captures the dual element isotope trends characteristic of different reaction pathways and their range of variation consistent with observed multi-element (C, N) bulk isotope fractionation. The proposed approach can also be used as a tool to explore transformation pathways in scenarios for which position-specific isotope data are not yet available. [1] Schwarzenbach, R.P., Egli, T., Hofstetter, T.B., von Gunten, U., Wehrli, B., 2010. Global Water Pollution and Human Health. Annu. Rev. Environ. Resour. doi:10.1146/annurev-environ-100809-125342. [2] Jin, B., Haderlein, S.B., Rolle, M

Regional Differences in Communication Process and Outcomes of Requests for Solid Organ Donation.

Science.gov (United States)

Traino, H M; Molisani, A J; Siminoff, L A

2017-06-01

Although federal mandate prohibits the allocation of solid organs for transplantation based on "accidents of geography," geographic variation of transplantable organs is well documented. This study explores regional differences in communication in requests for organ donation. Administrative data from nine partnering organ procurement organizations and interview data from 1339 family decision makers (FDMs) were compared across eight geographically distinct US donor service areas (DSAs). Authorization for organ donation ranged from 60.4% to 98.1% across DSAs. FDMs from the three regions with the lowest authorization rates reported the lowest levels of satisfaction with the time spent discussing donation and with the request process, discussion of the least donation-related topics, the highest levels of pressure to donate, and the least comfort with the donation decision. Organ procurement organization region predicted authorization (odds ratios ranged from 8.14 to 0.24), as did time spent discussing donation (OR = 2.11), the number of donation-related topics discussed (OR = 1.14), and requesters' communication skill (OR = 1.14). Standardized training for organ donation request staff is needed to ensure the highest quality communication during requests, optimize rates of family authorization to donation in all regions, and increase the supply of organs available for transplantation. © 2016 The American Society of Transplantation and the American Society of Transplant Surgeons.

[Vermicomposting of different organic materials and three-dimensional excitation emission matrix fluorescence spectroscopic characterization of their dissolved organic matter].

Science.gov (United States)

Yang, Wei; Wang, Dong-sheng; Liu, Man-qiang; Hu, Feng; Li, Hui-xin; Huang, Zhong-yang; Chang, Yi-jun; Jiao, Jia-guo

2015-10-01

In this experiment, different proportions of the cattle manure, tea-leaf, herb and mushroom residues, were used as food for earthworm (Eisenia fetida) to study the growth of the earth-worm. Then the characteristics and transformation of nutrient content and three-dimensional excitation emission matrix fluorescence (3DEEM) of dissolved organic matter (DOM) during vermistabilization were investigated by means of chemical and spectroscopic methods. The result showed that the mixture of different ratios of cattle manure with herb residue, and cattle manure with tea-leaf were conducive to the growth of earthworm, while the materials compounded with mushroom residue inhibited the growth of earthworm. With the increasing time of verimcomposting, the pH in vermicompost tended to be circumneutral and weakly acidic, and there were increases in electrical conductivity, and the contents of total nitrogen, total phosphorus, available nitrogen, and available phosphorus, while the total potassium and available potassium increased first and then decreased, and the organic matter content decreased. 3DEEM and fluorescence regional integration results indicated that, the fluorescence of protein-like fluorescence peaks declined significantly, while the intensity of humic-like fluorescence peak increased significantly in DOM. Vermicomposting process might change the compositions of DOM with elevated concentrations of humic acid and fulvic acid in the organics. In all, this study suggested the suitability of 3DEEM for monitoring the organics transformation and assessing the maturity in the vermicomposting.

Gene : CBRC-TTRU-01-0332 [SEVENS

Lifescience Database Archive (English)

Full Text Available 2| PREDICTED: similar to vomeronasal 1 receptor, k1 [Equus caballus] 5e-51 40% MTEVWSSLDCCTKFLRIRYSTVTILEIFF...LKPQTSTCVLPSFLFFWVINMLICIWIITNNETVTNASAAQPGYSPVYCKTKRGDYRESAVFQSAMLIRVFLCINLTVWTS

Debts, Differently: Alternative Finance Organizations in Italy and France

Directory of Open Access Journals (Sweden)

Arianna Lovera

2015-07-01

Full Text Available The main purpose of this article is to analyze the possibility of implementing financial practices that, in the principles that guide them, are different from and question the functioning of most banks in capitalist societies. In particular, the article describes the ways in which credit relationships (i.e. relationships between credit institutions and their borrowers are conceived and shaped by some “alternative” banks and financial cooperatives. The findings are based on ethnographic fieldwork, including observations and in-depth interviews, focused on three financial organizations: Banca Etica (Italy, MAG6 (Italy, and La Nef (France. While striving to establish “another kind of finance”, different from the capitalistic, speculative form, these banks and financial cooperatives aim to create more cooperative and solidarity-based credit relationships.

Gene : CBRC-TTRU-01-1304 [SEVENS

Lifescience Database Archive (English)

Full Text Available 1| PREDICTED: similar to vomeronasal 1 receptor, K1 [Bos taurus] 2e-45 50% MILMHLTLANIMTILFRGIQDAMSSFGIWPIMG...DIGCKSLLYIHRVTQGISLCTISVLNTFQAIRISPRNSKRAWLKPQISTCILPSFLFFWVINMLIYFWIITNNKAVTNASAAQPGYSLAYCTTKQGGYRVSAVFQSAMLI*NFLCINLMIWTSGYMVMLLYNHHKTVQNLRGNNFSPRLSPETKLPTPFCS ...

Accumulation of different metals in apple trees organs from an unfertilized orchard

International Nuclear Information System (INIS)

Stanica, F.

1999-01-01

Working in an unfertilized apple orchard, planted on brown-reddish soil in Baneasa - Bucuresti, the accumulation of different metals in trees organs was studied: leaves, vegetative branches, fruit branches and fruits. The samples were taken from 'Golden delicious' variety, planted at 10 meters, 'Idared' variety, planted at 100 meters and 'Akane' variety, planted at 200 meters from the Bucuresti-Ploiesti motorway. Lead accumulation depended on the distance to the pollution source and organ type. In leaves, lead was found even at 100 m from the road border (11.7 ppm in 'Idared' variety). At 10 m the leaves content was much higher (306 ppm, 'Golden delicious'). Because of the specific metabolism selectivity apple trees didn't accumulate lead into fruit branches and fruits. Copper leaves content varied between 5.85 ppm ('Golden delicious') and 16.2 ppm ('Akane') being lower than the fruits content (8.36 ppm 'Idared' - 23.0 ppm 'Golden delicious'). In apple tree fruit branches the Cu accumulation was 2-3 times higher than in the vegetative branches. The same fruit branches accumulated the highest quantity of zinc (between 67.5 and 83.9 ppm). Fruit contents in zinc (10.0-16.9 ppm) were close to the normal value: 15 ppm, but leave contents (43.3-48.7 ppm) were more than doubled compared to the normal range: 15-20 ppm. The 'Idared' variety accumulated the lowest quantity of nickel in all analyzed organs. Iron accumulation was different in function of the analyzed organ, variety and ion type (Fe 2+ , Fe 3+ ). The highest Fe 3+ content was found in 'Golden delicious' leaves: 547 ppm and the highest Fe 2+ content in 'Idared' leaves: 96.0 ppm. The lowest iron content was found in fruits. The manganese content of the analyzed organs varied from 8.32 to 130 ppm. Refs. 4 (author)

Surface plasmon enhanced organic light emitting diodes by gold nanoparticles with different sizes

Energy Technology Data Exchange (ETDEWEB)

Gao, Chia-Yuan; Chen, Ying-Chung [Department of Electrical Engineering, National Sun Yat-Sen University, Kaohsiung, Taiwan (China); Chen, Kan-Lin [Department of Electronic Engineering, Fortune Institute of Technology, Kaohsiung, Taiwan (China); Huang, Chien-Jung, E-mail: chien@nuk.edu.tw [Department of Applied Physics, National University of Kaohsiung, Kaohsiung, Taiwan (China)

2015-11-30

Highlights: • Different varieties, sizes, and shapes for nanoparticles will generate different surface plasmon resonance effects in the devices. • The red-shift phenomenon for absorption peaks is because of an increasing contribution of higher-order plasmon modes for the larger gold nanoparticles. • The mobility of electrons in the electron-transport layer of organic light-emitting diodes is a few orders of magnitude lower than that of holes in the hole-transport layer of organic light-emitting diodes. - Abstract: The influence of gold nanoparticles (GNPs) with different sizes doped into (poly(3,4-ethylenedioxythiophene) poly(styrenesulfonate)) (PEDOT:PSS) on the performance of organic light-emitting diodes is investigated in this study. The current efficiency of the device, at a current density of 145 mA/cm, with PEDOT:PSS doped with GNPs of 8 nm is about 1.57 times higher than that of the device with prime PEDOT:PSS because the absorption peak of GNPs is closest to the photoluminescence peak of the emission layer, resulting in maximum surface plasmon resonance effect in the device. In addition, the surface-enhanced Raman scattering spectroscopy also reveals the maximum surface plasmon resonance effect in the device when the mean particle size of GNPs is 8 nm.

Exocrine Gland-Secreting Peptide 1 Is a Key Chemosensory Signal Responsible for the Bruce Effect in Mice.

Science.gov (United States)

Hattori, Tatsuya; Osakada, Takuya; Masaoka, Takuto; Ooyama, Rumi; Horio, Nao; Mogi, Kazutaka; Nagasawa, Miho; Haga-Yamanaka, Sachiko; Touhara, Kazushige; Kikusui, Takefumi

2017-10-23

The Bruce effect refers to pregnancy termination in recently pregnant female rodents upon exposure to unfamiliar males [1]. This event occurs in specific combinations of laboratory mouse strains via the vomeronasal system [2, 3]; however, the responsible chemosensory signals have not been fully identified. Here we demonstrate that the male pheromone exocrine gland-secreting peptide 1 (ESP1) is one of the key factors that causes pregnancy block. Female mice exhibited high pregnancy failure rates upon encountering males that secreted different levels of ESP1 compared to the mated male. The effect was not observed in mice that lacked the ESP1 receptor, V2Rp5, which is expressed in vomeronasal sensory neurons. Prolactin surges in the blood after mating, which are essential for maintaining luteal function, were suppressed by ESP1 exposure, suggesting that a neuroendocrine mechanism underlies ESP1-mediated pregnancy failure. The single peptide pheromone ESP1 conveys not only maleness to promote female receptivity but also the males' characteristics to facilitate memorization of the mating partner. Copyright © 2017 Elsevier Ltd. All rights reserved.

Sexual differences in the distribution and retention of organic and inorganic mercury in methyl mercury-treated rats

International Nuclear Information System (INIS)

Thomas, D.J.; Fisher, H.L.; Sumler, M.R.; Marcus, A.H.; Mushak, P.; Hall, L.L.

1986-01-01

At 56 days of age, male and female Long-Evans rats received 1 μmole of 203 Hg-labeled mercuric chloride per kilogram sc and total, organic, and inorganic mercury contents and concentrations in tissues were determined for up to 98 days postdosing. When expressed on a concentration basis, the only significant sexual difference was in the higher average concentration of organic mercury in the kidneys of females. When expressed on a tissue content basis, significant male-female differences in the kinetics (sex x time interactions) of organic mercury retention were found in kidney, brain, skeletal muscle, pelt, and whole body. Significant sex x time interactions in the concentrations of organic mercury were found in kidney, skeletal muscle, and whole body. Kinetics of retention and concentration of inorganic Hg in the pelt differed significantly for males and females. Discordance of degree of statistical significance of differences in mercury contents and concentrations reflected in part differences in relative body composition of males and females. Differences in integrated exposure were estimated by the female-to-male ratio of areas under retention curves. Reconstruction of whole body organic and inorganic mercury burdens from constituent tissues indicated that integrated exposures of males and females to inorganic mercury were equal but females had a lower integrated exposure to organic mercury. Integrated exposure of liver to either form of mercury was about equal in males and females. However, the integrated exposure of the brain of females to inorganic mercury was 2.19 times that of males suggest'ing a sexual difference in accumulation or retention of inorganic mercury in the nervous system

Effect of different substrates for organic agriculture in seedling development of traditional species of Solanaceae

Energy Technology Data Exchange (ETDEWEB)

Olaria, M.; Nebot, J.F.; Molina, H.; Troncho, P.; Lapeña, P.; Llorens, E.

2016-11-01

Sowing of seedlings is one of the most critical processes on the establishment of a crop, since the future development of the plant depends largely on its health when is planted on the field. Moreover, organic agriculture has to deal with the low application of fertilizers and pesticides, which hinder the growth of seedlings. In this work, we studied the big influence of different mixtures of substrates suitable for organic agriculture based on peat, coconut husk and vermicompost in traditional varieties of tomato, pepper and eggplant. Our results indicate that the use of coconut husk based substrates in organic agriculture can reduce the growth of seedlings between 20 and 30% compared with peat-based substrates. Moreover, the plants growth in this substrate showed lower levels of chlorophyll and lower weight, but the results are strongly dependent on the species tested. Comparison between traditional plants demonstrates that traditional varieties are strongly influenced by the substrate, whereas the growth of a commercial variety of tomato barely differs when different substrates are used. The election of the substrate in organic agriculture is critical to the correct development of the plant, especially when traditional plant varieties are used. (Author)

Effect of different substrates for organic agriculture in seedling development of traditional species of Solanaceae

Directory of Open Access Journals (Sweden)

Hector Molina

2016-03-01

Full Text Available Sowing of seedlings is one of the most critical processes on the establishment of a crop, since the future development of the plant depends largely on its health when is planted on the field. Moreover, organic agriculture has to deal with the low application of fertilizers and pesticides, which hinder the growth of seedlings. In this work, we studied the big influence of different mixtures of substrates suitable for organic agriculture based on peat, coconut husk and vermicompost in traditional varieties of tomato, pepper and eggplant. Our results indicate that the use of coconut husk based substrates in organic agriculture can reduce the growth of seedlings between 20 and 30% compared with peat-based substrates. Moreover, the plants growth in this substrate showed lower levels of chlorophyll and lower weight, but the results are strongly dependent on the species tested. Comparison between traditional plants demonstrates that traditional varieties are strongly influenced by the substrate, whereas the growth of a commercial variety of tomato barely differs when different substrates are used. The election of the substrate in organic agriculture is critical to the correct development of the plant, especially when traditional plant varieties are used.

Productkwaliteit zuivel: verschil tussen biologisch en gangbaar = Diary product quality : difference between organic and regular

NARCIS (Netherlands)

Slaghuis, B.A.; Wit, de J.

2007-01-01

In each season of 2006 six samples organic and six samples regular milk and cheese were investigated for fatty acid composition, biophotones and crystallisation degree. Significant differences were found between organic and regular milk and cheese for polyunsaturated acids, omega-3-fatty acids and

Mycorrhizal associations of trees have different indirect effects on organic matter decomposition

Science.gov (United States)

Melanie K. Taylor; Richard A. Lankau; Nina Wurzburger; Franciska de Vries

2016-01-01

1. Organic matter decomposition is the main process by which carbon (C) is lost from terrestrialecosystems, and mycorrhizal associations of plants (i.e. arbuscular mycorrhizas (AM) and ectomycorrhizas(ECM)) may have different indirect effects on this loss pathway. AM and ECM plants differin the soil...

Differential Evolutionary Constraints in the Evolution of Chemoreceptors: A Murine and Human Case Study

Directory of Open Access Journals (Sweden)

Ricardo D’Oliveira Albanus

2014-01-01

Full Text Available Chemoreception is among the most important sensory modalities in animals. Organisms use the ability to perceive chemical compounds in all major ecological activities. Recent studies have allowed the characterization of chemoreceptor gene families. These genes present strikingly high variability in copy numbers and pseudogenization degrees among different species, but the mechanisms underlying their evolution are not fully understood. We have analyzed the functional networks of these genes, their orthologs distribution, and performed phylogenetic analyses in order to investigate their evolutionary dynamics. We have modeled the chemosensory networks and compared the evolutionary constraints of their genes in Mus musculus, Homo sapiens, and Rattus norvegicus. We have observed significant differences regarding the constraints on the orthologous groups and network topologies of chemoreceptors and signal transduction machinery. Our findings suggest that chemosensory receptor genes are less constrained than their signal transducing machinery, resulting in greater receptor diversity and conservation of information processing pathways. More importantly, we have observed significant differences among the receptors themselves, suggesting that olfactory and bitter taste receptors are more conserved than vomeronasal receptors.

[Effects of land use type on the distribution of organic carbon in different sized soil particles effects of land use type on the distribution of organic carbon in different sized soil particles and its relationships to herb biomass in hilly red soil region of South China].

Science.gov (United States)

Li, Zhong-Wu; Guo, Wang; Wang, Xiao-Yan; Shen, Wei-Ping; Zhang, Xue; Chen, Xiao-Lin; Zhang, Yue-Nan

2012-04-01

The changes in organic carbon content in different sized soil particles under different land use patterns partly reflect the variation of soil carbon, being of significance in revealing the process of soil organic carbon cycle. Based on the long-term monitoring of soil erosion, and by the methods of soil particle size fractionation, this paper studied the effects of different land use types (wasteland, pinewood land, and grassland) on the distribution of organic carbon content in different sized soil particles and its relationships to the herb biomass. Land use type and slope position had obvious effects on the organic carbon content in different sized soil particles, and the organic carbon content was in the order of grassland > pinewood land > wasteland. The proportion of the organic carbon in different sized soil particles was mainly depended on the land use type, and had little relationships with slope position. According to the analysis of the ratio of particle-associated organic carbon to mineral-associated organic carbon (POC/MOC), the soil organic carbon in grassland was easily to be mineralized, whereas that in wasteland and pinewood land was relatively stable. On the slopes mainly in hilly red soil region, the soil organic carbon in sand fraction had great effects on herb biomass.

Homologous subfamilies of human alphoid repetitive DNA on different nucleolus organizing chromosomes

International Nuclear Information System (INIS)

Joergensen, A.L.; Bostock, C.J.; Bak, A.L.

1987-01-01

The organization of alphoid repeated sequences on human nucleolus-organizing (NOR) chromosomes 13, 21, and 22 has been investigated. Analysis of hybridization of alphoid DNA probes to Southern transfers of restriction enzyme-digested DNA fragments from hybrid cells containing single human chromosomes shows that chromosomes 13 and 21 share one subfamily of alphoid repeats, whereas a different subfamily may be held in common by chromosomes 13 and 22. The sequences of cloned 680-base-pair EcoRI fragments of the alphoid DNA from chromosomes 13 and 21 show that the basic unit of this subfamily is indistinguishable on each chromosome. The sequence of cloned 1020-base-pair Xba I fragments from chromosome 22 is related to, but distinguishable from, that of the 680-base-pair EcoRI alphoid subfamily of chromosomes 13 and 21. These results suggest that, at some point after they originated and were homogenized, different subfamilies of alphoid sequences must have exchanged between chromosomes 13 and 21 and separately between chromosomes 13 and 22

Differences on soil organic carbon stock estimation according to sampling type in Mediterranean areas

Science.gov (United States)

Parras-Alcántara, Luis; Lozano-García, Beatriz

2016-04-01

Soil organic carbon (SOC) is an important part of the global carbon (C) cycle. In addition, SOC is a soil property subject to changes and highly variable in space and time. Consequently, the scientific community is researching the fate of the organic carbon in the ecosystems. In this line, soil organic matter configuration plays an important role in the Soil System (Parras-Alcántara and Lozano García, 2014). Internationally it is known that soil C sequestration is a strategy to mitigate climate change. In this sense, many soil researchers have studied this parameter (SOC). However, many of these studies were carried out arbitrarily using entire soil profiles (ESP) by pedogenetic horizons or soil control sections (SCS) (edaphic controls to different thickness). As a result, the indiscriminate use of both methodologies implies differences with respect to SOC stock (SOCS) quantification. This scenario has been indicated and warned for different researchers (Parras-Alcántara et al., 2015a; Parras-Alcántara et al., 2015b). This research sought to analyze the SOC stock (SOCS) variability using both methods (ESP and SCS) in the Cardeña and Montoro Natural Park (Spain). This nature reserve is a forested area with 385 km2 in southern Spain. Thirty-seven sampling points were selected in the study zone. Each sampling point was analyzed in two different ways, as ESP (by horizons) and as SCS with different depth increments (0-25, 25-50, 50-75 and 75-100 cm). The major goal of this research was to study the SOCS variability at regional scale. The studied soils were classified as Phaeozems, Cambisols, Regosols and Leptosols. The results obtained show an overestimation of SOCS when SCS sampling approach is used compared to ESP. This supports that methodology selection is very important to SOCS quantification. This research is an assessment for modeling SOCS at the regional level in Mediterranean natural areas. References Parras-Alcántara, L., Lozano-García, B., 2014

Investigating different cultural factors on establishment of knowledge management in educational organization

Directory of Open Access Journals (Sweden)

Ali Makhsousi

2013-02-01

Full Text Available Knowledge management plays an essential role on developing efficient systems in educational systems. However, there are different factors influencing the success of knowledge management. In this paper, we present an empirical study to measure the impact of six cultural based factors including management support, organizational affiliation, employee participation in decision-making, staff welfare organization and establishment, adaptation of new policies and organizational and internal organizational climate on establishment of knowledge management. The proposed study of this paper is implemented in 114 selected educational organizations in city of Tehran, Iran. A questionnaire is designed in Likert scale, it is distributed among experts, and using regressions analysis and structural equation modeling, we have analyzed the data. The results of regression analysis indicate that management support, staff welfare organization and internal organizational climate are among the most important factors while other component did not represent any significance on knowledge management implementation.

MODERN PRINCIPLES OF DIET ORGANIZATION IN CHILDREN IN DIFFERENT AGE WITH PHENYLKETONURIA

Directory of Open Access Journals (Sweden)

T.V. Bushuyeva

2010-01-01

Full Text Available The article reports questions of diet organization in children with phenylketonuria in different age with the use of modern specialized food. Authors give examples of calculation of diet based on new norms of needs in energy and food for different groups of population in Russian Federation, and present recommendations on optimization of nutrition in schoolchildren with phenylketonuria.Key words: children, schoolchildren, phenylketonuria, phenylalanine, dietotherapy.(Voprosy sovremennoi pediatrii — Current Pediatrics. 2010;9(2:124-129

Large differences in the genome organization of different plant Trypanosomatid parasites (Phytomonas spp.) reveal wide evolutionary divergences between taxa.

Science.gov (United States)

Marín, C; Dollet, M; Pagès, M; Bastien, P

2009-03-01

All currently known plant trypanosomes have been grouped in the genus Phytomonas spp., although they can differ greatly in terms of both their biological properties and effects upon the host. Those parasitizing the phloem sap are specifically associated with lethal syndromes in Latin America, such as, phloem necrosis of coffee, 'Hartrot' of coconut and 'Marchitez sorpresiva' of oil palm, that inflict considerable economic losses in endemic countries. The genomic organization of one group of Phytomonas (D) considered as representative of the genus has been published previously. The present work presents the genomic structure of two representative isolates from the pathogenic phloem-restricted group (H) of Phytomonas, analyzed by pulsed field gel electrophoresis followed by hybridization with chromosome-specific DNA markers. It came as a surprise to observe an extremely different genomic organization in this group as compared with that of group D. Most notably, the chromosome number is 7 in this group (with a genome size of 10 Mb) versus 21 in the group D (totalling 25 Mb). These data unravel an unsuspected genomic diversity within plant trypanosomatids, that may justify a further debate about their division into different genera.

STABILITY OF ORGANIC MATER OF HAPLIC CHERNOZEM AND HAPLIC LUVISOL OF DIFFERENT ECOSYSTEMS

Directory of Open Access Journals (Sweden)

ERIKA TOBIAŠOVÁ

2013-12-01

Full Text Available In this study, the changes in soil organic matter (SOM and the possibilities of their monitoring in a shorter period of time by means of carbon parameters were followed. The experiment includes four ecosystems (forest, meadow, urban, and agro-ecosystem on Haplic Chernozem (Močenok, Horná Kráľová, Trnava and Haplic Luvisol (Ludanice, Veľké Zálužie, Lovce of different localities. The objectives of this study were assessment of the differences in the stability of soil organic matter in different ecosystems and in soil types using labile forms of carbon and nitrogen, and also with dependence on particle size distribution. The highest contents of total organic carbon (TOC and labile carbon (CL were in a forest ecosystem, but in case of other ecosystems, the differences were determined only in the contents of CL. After forest ecosystem, the highest content of CL was in agro-ecosystem > meadow ecosystem > urban ecosystem. Based on parameter of lability of carbon (LC, the most labile carbon can be evaluated also in the forest ecosystem (0.209 > agro-ecosystem (0.178 > meadow ecosystem (0.119 and urban ecosystem (0.116. In the case of nitrogen, the differences were observed between the soils. Higher contents of NT and NL were recorded in Haplic Chernozen than in Haplic Luvisol. Contents of TOC (P < 0.05; r = -0.480, CNL (P < 0.05; r = -0.480, and NL (P < 0.01; r = -0.545 were in a negative correlation with the content of sand fraction. The values of studied parameters in meadow and urban ecosystems were relatively balanced, because in both cases, the vegetation cover were grass, pointing to a significant influence of vegetation on the parameters of SOM.

Effects of Different Organic Materials and Exogenous Zn on Zn Distribution in Soil

OpenAIRE

HAO Jia-li; BU Yu-shan; JIA Zheng-rong; XI Ji-long; YAO Jing-zhen; DUAN Chao

2015-01-01

A pot experiment with a complete combinatorial design of two factors was conducted to study the effects of different organic materials and different concentrations of exogenous zinc on the soil total zinc, available zinc, zinc forms and zinc content distribution of pak-choi. The results showed that the total zinc, available zinc, and different forms of zinc contents in soil all increased as the concentration of exogenous zinc increased. Both lawn grass and maize straw decreased the total zinc...

Structure and chemical organization of the accessory olfactory bulb in the goat.

Science.gov (United States)

Mogi, Kazutaka; Sakurai, Katsuyasu; Ichimaru, Toru; Ohkura, Satoshi; Mori, Yuji; Okamura, Hiroaki

2007-03-01

The structure and chemical composition of the accessory olfactory bulb (AOB) were examined in male and female goats. Sections were subjected to either Nissl staining, Klüver-Barrera staining, lectin histochemistry, or immunohistochemistry for nitric oxide synthase (NOS), neuropeptide Y (NPY), tyrosine hydroxylase (TH), dopamine beta-hydroxylase (DBH), and glutamic acid decarboxylase (GAD). The goat AOB was divided into four layers: the vomeronasal nerve layer (VNL), glomerular layer (GL), mitral/tufted (M/T) cell layer (MTL), and granule cell layer (GRL). Quantitative and morphometric analyses indicated that a single AOB contained 5,000-8,000 putative M/T cells with no sex differences, whereas the AOB was slightly larger in males. Of the 21 lectins examined, 7 specifically bound to the VNL and GL, and 1 bound not only to the VNL, but also to the MTL and GRL. In either of these cases, no heterogeneity of lectin staining was observed in the rostrocaudal direction. NOS-, TH-, DBH-, and GAD-immunoreactivity (ir) were observed in the MTL and GRL, whereas NPY-ir was present only in the GRL. In the GL, periglomerular cells with GAD-ir were found in abundance, and a subset of periglomerular cells containing TH-ir was also found. Double-labeling immunohistochemistry revealed that virtually all periglomerular cells containing TH-ir were colocalized with GAD-ir.

Differences between elemental composition of orange juices and leaves from organic and conventional production systems

International Nuclear Information System (INIS)

Turra, C.; Fernandes, E.A.N.; Bacchi, M.A.; Tagliaferro, F.S.; Franca, E.J.

2006-01-01

A comprehensive sampling of organic and conventional oranges was carried out in Bebedouro, an important citrus producing region of Brazil. The soils, leaves and fruits of the variety Valencia (Citrus sinensis [L.] Osbeck) budded on Rangpur lime (Citrus limonia Osbeck) were analyzed. The chemical characterization was accomplished by instrumental neutron activation analysis (INAA). Indications for a difference between organic and conventional orange juices and leaves were obtained by applying univariate and multivariate statistical analysis. There were differences between samples for Br, Co, Cs, La and Rb from both systems. (author)

Hierarchical organization versus self-organization

OpenAIRE

Busseniers, Evo

2014-01-01

In this paper we try to define the difference between hierarchical organization and self-organization. Organization is defined as a structure with a function. So we can define the difference between hierarchical organization and self-organization both on the structure as on the function. In the next two chapters these two definitions are given. For the structure we will use some existing definitions in graph theory, for the function we will use existing theory on (self-)organization. In the t...

of Effect of different organic materials on plant growth

Directory of Open Access Journals (Sweden)

mehrnosh eskandari

2009-06-01

Full Text Available Using organic matter, such as, peat and vermicompost as soil amendment, increases aeration, water infiltration, water holding capacity and nutrients of soil . A greenhouse experiment was performed to study the effect of organic materials on plant growth characteristics, total biomass and grain weight of chickpea with four treatments; 1 Soil + 3% peat (PS, 2 Sterile soil + 3% peat (SPS, 3 Soil + vermicompost (1:6 (VCS, 4 control (C in a completely randomized design with four replications. The results showed that the maximum germination percentage, number of branch and number of pod per plant were observed in SPS treatment due to the avoidance of harmful microbial impacts. Plant height in this treatment reduced, whereas, no significant differences in total dry matter per plant and dry weight of chickpea per plant were observed compared to control. Plant growth consist of plant height, number of branch and number of pod per plant in vermicompost and soil + peat treatment reduced in the early stages probably because of plant - microbes interaction effects. Application of vermicompost increased fresh and dry weight, pod dry weight and single grain weight, probably due to more plant nutrient availability in this treatment when compared with other treatments.

Gene : CBRC-OANA-01-1685 [SEVENS

Lifescience Database Archive (English)

Full Text Available | PREDICTED: similar to vomeronasal V1r-type receptor V1rg7 [Ornithorhynchus anatinus] 1e-148 100% gnl|UG|Oa...LSIFQAITISPSTSWWAGRKTKLPKCILPSFVIFWILNMLIDFHTLIVVTGPHNARIHQDMKYCSLGNASARATLIFSVVLSLRDLFFVGLMSVASVYMVFVLYSHHR

Nitrogen removal capacity and bacterial community dynamics of a Canon biofilter system at different organic matter concentrations.

Science.gov (United States)

García-Ruiz, María J; Maza-Márquez, Paula; González-López, Jesús; Osorio, Francisco

2018-02-01

Three Canon bench-scale bioreactors with a volume of 2 L operating in parallel were configured as submerged biofilters. In the present study we investigated the effects of a high ammonium concentration (320 mgNH 4 + · L -1 ) and different concentrations of organic matter (0, 100 and 400 mgCOD·L -1 ) on the nitrogen removal capacity and the bacterial community structure. After 60 days, the Canon biofilters operated properly under concentrations of 0 and 100 mgCOD·L -1 of organic matter, with nitrogen removal efficiencies up to 85%. However, a higher concentration of organic matter (400 mgCOD·L -1 ) produced a partial inhibition of nitrogen removal (68.1% efficiency). The addition of higher concentrations of organic matter a modified the bacterial community structure in the Canon biofilter, increasing the proliferation of heterotrophic bacteria related to the genera of Thauera, Longilinea, Ornatilinea, Thermomarinilinea, unclassified Chlorobiales and Denitratisoma. However, heterotrophic bacteria co-exist with Nitrosomonas and Candidatus Scalindua. Thus, our study confirms the co-existence of different microbial activities (AOB, Anammox and denitrification) and the adaptation of a fixed-biofilm system to different concentrations of organic matter. Copyright © 2017 Elsevier Ltd. All rights reserved.

The osteology of the basal archosauromorph Tasmaniosaurus triassicus from the Lower Triassic of Tasmania, Australia.

Directory of Open Access Journals (Sweden)

Martín D Ezcurra

Full Text Available Proterosuchidae are the most taxonomically diverse archosauromorph reptiles sampled in the immediate aftermath of the Permo-Triassic mass extinction and represent the earliest radiation of Archosauriformes (archosaurs and closely related species. Proterosuchids are potentially represented by approximately 15 nominal species collected from South Africa, China, Russia, Australia and India, but the taxonomic content of the group is currently in a state of flux because of the poor anatomic and systematic information available for several of its putative members. Here, the putative proterosuchid Tasmaniosaurus triassicus from the Lower Triassic of Hobart, Tasmania (Australia, is redescribed. The holotype and currently only known specimen includes cranial and postcranial remains and the revision of this material sheds new light on the anatomy of the animal, including new data on the cranial endocast. Several bones are re-identified or reinterpreted, contrasting with the descriptions of previous authors. The new information provided here shows that Tasmaniosaurus closely resembles the South African proterosuchid Proterosuchus, but it differed in the presence of, for example, a slightly downturned premaxilla, a shorter anterior process of maxilla, and a diamond-shaped anterior end of interclavicle. Previous claims for the presence of gut contents in the holotype of Tasmaniosaurus are considered ambiguous. The description of the cranial endocast of Tasmaniosaurus provides for the first time information about the anatomy of this region in proterosuchids. The cranial endocast preserves possibly part of the vomero-nasal ( = Jacobson's system laterally to the olfactory bulbs. Previous claims of the absence of the vomero-nasal organs in archosaurs, which is suggested by the extant phylogenetic bracket, are questioned because its absence in both clades of extant archosaurs seems to be directly related with the independent acquisition of a non-ground living

Investigation of organic matter migrating from polymeric pipes into drinking water under different flow manners.

Science.gov (United States)

Zhang, Ling; Liu, Shuming; Liu, Wenjun

2014-02-01

Polymeric pipes, such as unplasticized polyvinyl chloride (uPVC) pipes, polypropylene random (PPR) pipes and polyethylene (PE) pipes are increasingly used for drinking water distribution lines. Plastic pipes may include some additives like metallic stabilizers and other antioxidants for the protection of the material during its production and use. Thus, some compounds can be released from those plastic pipes and cast a shadow on drinking water quality. This work develops a new procedure to investigate three types of polymer pipes (uPVC, PE and PPR) with respect to the migration of total organic carbon (TOC) into drinking water. The migration test was carried out in stagnant conditions with two types of migration processes, a continuous migration process and a successive migration process. These two types of migration processes are specially designed to mimic the conditions of different flow manners in drinking water pipelines, i.e., the situation of continuous stagnation with long hydraulic retention times and normal flow status with regular water renewing in drinking water networks. The experimental results showed that TOC release differed significantly with different plastic materials and under different flow manners. The order of materials with respect to the total amount of TOC migrating into drinking water was observed as PE > PPR > uPVC under both successive and continuous migration conditions. A higher amount of organic migration from PE and PPR pipes was likely to occur due to more organic antioxidants being used in pipe production. The results from the successive migration tests indicated the trend of the migration intensity of different pipe materials over time, while the results obtained from the continuous migration tests implied that under long stagnant conditions, the drinking water quality could deteriorate quickly with the consistent migration of organic compounds and the dramatic consumption of chlorine to a very low level. Higher amounts of TOC

Differences in sheep and goats milk microbiological profile between conventional and organic farming systems in Greece.

Science.gov (United States)

Malissiova, Eleni; Papadopoulos, Theofilos; Kyriazi, Aikaterini; Mparda, Maria; Sakorafa, Christina; Katsioulis, Antonios; Katsiaflaka, Anna; Kyritsi, Maria; Zdragas, Antonios; Hadjichristodoulou, Christos

2017-05-01

The aim of this study was to examine differences in the microbiological profile and antimicrobial resistance of bacteria isolated from milk from organic and conventional sheep and goat farms. Twenty-five organic and 25 conventional sheep and goat farms in the region of Thessaly, Greece participated in this study. A standardised detailed questionnaire was used to describe farming practices. A total of 50 samples were collected and analysed for total viable count (TVC), total coliform count (TCC) and somatic cell count (SCC), while Staphylococcus aureus and Escherichia coli were isolated using standard methods. Isolates were identified at species level by Api-test and Matrix-Assisted Laser Desorption/Ionisation-Time of Flight Mass Spectrometry (MALDI-TOF MS). Susceptibility to a panel of 20 for E. coli and 16 for S. aureus antimicrobials was determined by the agar dilution method. Pulsed Field Gel Electrophoresis (PFGE) was performed for S. aureus and E. coli isolates to determine predominant clones. Lower counts of TVC, TCC and SCC were identified in milk from the organic farms, possibly due to differences in the hygienic farming practices found on those farms. API-tests and MALDI-TOF MS showed no significant differences in the S. aureus and E. coli isolates. Overall, antimicrobial resistance rates were low, while a statistically higher percentage was estimated among strains originating from conventional farms in comparison with organic farms, possibly due to the restriction of antibiotic use in organic farming. PFGE revealed diversity among S. aureus and E. coli populations in both organic and conventional farms indicating circulation of 2-3 main clones changing slightly during their evolution. Consequently, there is evidence that milk from the organic farms presents a better microbiological profile when compared with milk from conventional farms.

Identifying different methods for creating knowledge from lessons learned in project oriented organizations

Directory of Open Access Journals (Sweden)

Ahmad Norang

2016-01-01

Full Text Available Nowadays, the increase in competition has increased the relative importance of innovation for most firms and many managers believe a good innovation must be knowledge oriented. This paper has tried to determine different methods for creating knowledge in project oriented organizations. The study designs a questionnaire in Likert scale and distributes it among 32 experts who were well informed about different methods of knowledge creation and lessons learned. Cronbach alphas for all components of the survey were well above the desirable level. The study has detected 11 methods for knowledge creation and lessons learned. In terms of preliminary assessment, business transactions has received the highest impact while knowledge team has received the highest effect in terms of necessary assessment. The results of this survey have indicated that although there are several methods for detecting knowledge within organizations, in most cases, it is not easy to gain value added knowledge within an organization, quickly. The people who participated in our survey have indicated that organizational commitment, brainstorming, Delphi and storytelling also have played important role for creation of knowledge. The results have also shown that brainstorming, knowledge brokers, map knowledge and work experience were easier to use for knowledge creation and lessons learned compared with other forms of knowledge creation.

Medically important carotenoids from Momordica charantia and their gene expressions in different organs.

Science.gov (United States)

Cuong, Do Manh; Arasu, Mariadhas Valan; Jeon, Jin; Park, Yun Ji; Kwon, Soon-Jae; Al-Dhabi, Naif Abdullah; Park, Sang Un

2017-12-01

Carotenoids, found in the fruit and different organs of bitter melon ( Momordica charantia ), have attracted great attention for their potential health benefits in treating several major chronic diseases. Therefore, study related to the identification and quantification of the medically important carotenoid metabolites is highly important for the treatment of various disorderes. The present study involved in the identification and quantification of the various carotenoids present in the different organs of M. charantia and the identification of the genes responsible for the accumulation of the carotenoids with respect to the transcriptome levels were investigated. In this study, using the transcriptome database of bitter melon, a partial-length cDNA clone encoding geranylgeranyl pyrophosphate synthase ( McGGPPS2 ), and several full-length cDNA clones encoding geranylgeranyl pyrophosphate synthase ( McGGPPS1 ), zeta-carotene desaturase ( McZDS ), lycopene beta-cyclase ( McLCYB ), lycopene epsilon cyclases ( McLCYE1 and McLCYE2 ), beta-carotene hydroxylase ( McCHXB ), and zeaxanthin epoxidase ( McZEP ) were identified in bitter melon . The expression levels of the mRNAs encoding these eight putative biosynthetic enzymes, as well as the accumulation of lycopene, α-carotene, lutein, 13Z-β-carotene, E-β-carotene, 9Z-β-carotene, β-cryptoxanthin, zeaxanthin, antheraxanthin, and violaxanthin were investigated in different organs from M. charantia as well as in the four different stages of its fruit maturation. Transcripts were found to be constitutively expressed at high levels in the leaves where carotenoids were also found at the highest levels . Collectively, these results indicate that the putative McGGPPS2, McZDS, McLCYB, McLCYE1, McLCYE2, and McCHXB enzymes might be key factors in controlling carotenoid content in bitter melon . In conclusion, the over expression of the carotenoid biosynthetic genes from M. charantia crops to increase the yield of these

Environmental risk assessment of the use of different organic wastes as soil amendments

Science.gov (United States)

Alvarenga, Paula; Palma, Patrícia; Mourinha, Clarisse; Farto, Márcia; Cunha-Queda, Ana Cristina; Natal-da-Luz, Tiago; Sousa, José Paulo

2013-04-01

The use of organic wastes in agriculture is considered a way of maintaining or restoring the quality of soils, enlarging the slow cycling soil organic carbon pool. However, a wide variety of undesired substances, such as potentially trace elements and organic contaminants, can have adverse effects on the environment. That fact was highlighted by the Proposal for a Soil Framework Directive, which recognized that "soil degradation or soil improvements have a major impact on other areas, (…) such as surface waters and groundwater, human health, climate change, protection of nature and biodiversity, and food safety". Taking that into account, the research project "ResOrgRisk" aims to assess the environmental risk involved in the use of different organic wastes as soil amendments, evidencing their benefits and constraints, and defining the most suitable tests to reach such assessment. The organic wastes selected for this purpose were: sewage sludge, limed, not limed, and co-composted with agricultural wastes, agro-industrial sludge, mixed municipal solid waste compost, compost produced from organic farming residues, and pig slurry digestate. Whereas threshold values for heavy metals in sludge used for agriculture have been set by the European Commission, actually there is no definitive European legislation for organic contaminants. Guide values for some organic contaminants (e.g. polychlorinated biphenyls - PCBs, and polycyclic aromatic hydrocarbons - PAHs) have been adopted at national level by many European countries, such as Portugal. These values should be taken into account when assessing the risk involved in the use of organic wastes as soil amendments. However, chemical analysis of organic waste often gives scarce information because it does not include possible interactions between chemicals. Furthermore, an exhaustive identification and quantification of all substances is impractical. In this study, ecotoxicological tests (comprising solid and aquatic phases

Manipulating the dipole layer of polar organic molecules on metal surfaces via different charge-transfer channels

Science.gov (United States)

Lin, Meng-Kai; Nakayama, Yasuo; Zhuang, Ying-Jie; Wang, Chin-Yung; Pi, Tun-Wen; Ishii, Hisao; Tang, S.-J.

The key properties of organic films such as energy level alignment (ELA), work functions, and injection barriers are closely linked to this dipole layer. Using angle resolved photoemission spectroscopy (ARPES), we systemically investigate the coverage-dependent work functions and spectra line shapes of occupied molecular orbital states of a polar molecule, chloroaluminium phthalocyanine (ClAlPc), grown on Ag(111) to show that the orientations of the first ClAlPc layer can be manipulated via the molecule deposition rate and post annealing, causing ELA at organic-metal interface to differ for about 0.3 eV between Cl-up and Cl-down configuration. Moreover, by comparing the experimental results with the calculations based on both gas-phase model and realistic model of ClAlPc on Ag(111) , we evidence that the different orientations of ClAlPc dipole layers lead to different charge-transfer channels between ClAlPc and Ag, a key factor that controls the ELA at organic-metal interface.

Micro-cultural differences in Switzerland: The effectiveness of targeted promotional messages in the field of organ donation

OpenAIRE

Dunkel, Anke; Schulz, Peter

2012-01-01

Public information campaigns have played an important role in increasing awareness of organ donation and the need for more organ donors. In a recent study, it was found that awareness and knowledge, regarding organ donation, represented only two of several factors in people’s decisions to engage in organ donation-related behaviors (Schulz et al., 2006). In addition, it was noted that the three main language groups in Switzerland differ substantially with respect to the influential factors ...

Emission of Carbon Dioxide Influenced by Different Water Levels from Soil Incubated Organic Residues

Science.gov (United States)

Hossain, M. B.; Puteh, A. B.

2013-01-01

We studied the influence of different organic residues and water levels on decomposition rate and carbon sequestration in soil. Organic residues (rice straw, rice root, cow dung, and poultry litter) including control were tested under moistened and flooding systems. An experiment was laid out as a complete randomized design at 25°C for 120 days. Higher CO2-C (265.45 mg) emission was observed in moistened condition than in flooding condition from 7 to 120 days. Among the organic residues, poultry litter produced the highest CO2-C emission. Poultry litter with soil mixture increased 121% cumulative CO2-C compared to control. On average, about 38% of added poultry litter C was mineralized to CO2-C. Maximum CO2-C was found in 7 days after incubation and thereafter CO2-C emission was decreased with the increase of time. Control produced the lowest CO2-C (158.23 mg). Poultry litter produced maximum cumulative CO2-C (349.91 mg). Maximum organic carbon was obtained in cow dung which followed by other organic residues. Organic residues along with flooding condition decreased cumulative CO2-C, k value and increased organic C in soil. Maximum k value was found in poultry litter and control. Incorpored rice straw increased organic carbon and decreased k value (0.003 g d−1) in soil. In conclusion, rice straw and poultry litter were suitable for improving soil carbon. PMID:24163626

Relationships between colored dissolved organic matter and dissolved organic carbon in different coastal gradients of the Baltic Sea.

Science.gov (United States)

Harvey, E Therese; Kratzer, Susanne; Andersson, Agneta

2015-06-01

Due to high terrestrial runoff, the Baltic Sea is rich in dissolved organic carbon (DOC), the light-absorbing fraction of which is referred to as colored dissolved organic matter (CDOM). Inputs of DOC and CDOM are predicted to increase with climate change, affecting coastal ecosystems. We found that the relationships between DOC, CDOM, salinity, and Secchi depth all differed between the two coastal areas studied; the W Gulf of Bothnia with high terrestrial input and the NW Baltic Proper with relatively little terrestrial input. The CDOM:DOC ratio was higher in the Gulf of Bothnia, where CDOM had a greater influence on the Secchi depth, which is used as an indicator of eutrophication and hence important for Baltic Sea management. Based on the results of this study, we recommend regular CDOM measurements in monitoring programmes, to increase the value of concurrent Secchi depth measurements.

Focal lesions within the ventral striato-pallidum abolish attraction for male chemosignals in female mice.

Science.gov (United States)

Agustín-Pavón, Carmen; Martínez-García, Fernando; Lanuza, Enrique

2014-02-01

In rodents, socio-sexual behaviour is largely mediated by chemosensory cues, some of which are rewarding stimuli. Female mice display an innate attraction towards male chemosignals, dependent on the vomeronasal system. This behaviour likely reflects the hedonic value of sexual chemosignals. The anteromedial aspect of the olfactory tubercle, along with its associated islands of Calleja, receives vomeronasal inputs and sexually-dimorphic vasopressinergic innervation. Thus, we hypothesised that this portion of the ventral striato-pallidum, known to be involved in reward processing, might be important for sexual odorant-guided behaviours. In this study, we demonstrate that lesions of this region, but not of regions in the posterolateral striato-pallidum, abolish the attraction of female mice for male chemosignals, without affecting significantly their preference for a different natural reward (a sucrose solution). These results show that, at least in female mice, the integrity of the anterior aspect of the medioventral striato-pallidum, comprising a portion of the olfactory tubercle and associated islands of Calleja, is necessary for the attraction for male chemosignals. We suggest that this region contributes to the processing of the hedonic properties of biologically significant odorants. Copyright © 2013 Elsevier B.V. All rights reserved.

Substantial Differences between Organ and Muscle Specific Tracer Incorporation Rates in a Lactating Dairy Cow.

Directory of Open Access Journals (Sweden)

Nicholas A Burd

Full Text Available We aimed to produce intrinsically L-[1-(13C]phenylalanine labeled milk and beef for subsequent use in human nutrition research. The collection of the various organ tissues after slaughter allowed for us to gain insight into the dynamics of tissue protein turnover in vivo in a lactating dairy cow. One lactating dairy cow received a constant infusion of L-[1-(13C]phenylalanine (450 µmol/min for 96 h. Plasma and milk were collected prior to, during, and after the stable isotope infusion. Twenty-four hours after cessation of the infusion the cow was slaughtered. The meat and samples of the various organ tissues (liver, heart, lung, udder, kidney, rumen, small intestine, and colon were collected and stored. Approximately 210 kg of intrinsically labeled beef (bone and fat free with an average L-[1-(13C]phenylalanine enrichment of 1.8±0.1 mole percent excess (MPE was obtained. The various organ tissues differed substantially in L-[1-(13C]phenylalanine enrichments in the tissue protein bound pool, the highest enrichment levels were achieved in the kidney (11.7 MPE and the lowest enrichment levels in the skeletal muscle tissue protein of the cow (between 1.5-2.4 MPE. The estimated protein synthesis rates of the various organ tissues should be regarded as underestimates, particularly for the organs with the higher turnover rates and high secretory activity, due to the lengthened (96 h measurement period necessary for the production of the intrinsically labeled beef. Our data demonstrates that there are relatively small differences in L-[1-(13C]phenylalanine enrichments between the various meat cuts, but substantial higher enrichment values are observed in the various organ tissues. We conclude that protein turnover rates of various organs are much higher when compared to skeletal muscle protein turnover rates in large lactating ruminants.

Effect of different conductivity between the spin polarons on spin injection in a ferromagnet/organic semiconductor system

International Nuclear Information System (INIS)

Mi Yilin; Zhang Ming; Yan Hui

2008-01-01

Spin injection across ferromagnet/organic semiconductor system with finite width of the layers was studied theoretically considering spin-dependent conductivity in the organic-semiconductor. It was found that the spin injection efficiency is directly dependent on the difference between the conductivity of the up-spin and down-spin polarons in the spin-injected organic system. Furthermore, the finite width of the structure, interfacial electrochemical-potential and conductivity mismatch have great influence on the spin injection process across ferromagnet/organic semiconductor interface

Radiation sensitivity of organisms of different organization level: an approach including DNA strand breakage

International Nuclear Information System (INIS)

Kampf, G.

1983-01-01

The mean numbers of DNA double-strand breaks (DSB) suggested to be necessary to lead to the loss of reproductive capacity are compared with bacteriophages, bacteria, and cells of the Chinese hamster after the influence of several radiation qualities. The results suggest that the critical target for the inactivating action of radiations may not be the entire DNA of all organisms but a structure unit of it designed as membrane-attached super structure unit. With organisms having only one of these structures (bacteria) the inactivation probability of one DSB will be near unity, with their multiplication in higher cells it will become lower. This means, eukaryotic cells are able to tolerate more DSB before being inactivated than organisms of a lower organization level, and consequently are more ''lesion resistant''. This behavior represents an evolutionary stabilization of higher cells towards the lethal action of severe DNA lesions such as DSB. (author)

DNA loop domain organization in nucleoids from cells of different types.

Science.gov (United States)

Afanasieva, Katerina; Chopei, Marianna; Lozovik, Alexandra; Semenova, Anastasia; Lukash, Lyubov; Sivolob, Andrei

2017-01-29

The loop domain organization of chromatin plays an important role in transcription regulation and thus may be assumed to vary in cells of different types. We investigated the kinetics of DNA loop migration during single cell gel electrophoresis (the comet assay) for nucleoids obtained from human lymphocytes, lymphoblasts and glioblastoma T98G cells. The results confirm our previous observation that there are three parts of DNA in nucleoids: DNA on the nucleoid surface, loops up to ∼150 kb inside the nucleoid, and larger loops that cannot migrate. However, the relative amounts of the three parts were found to be very different for different cell types. The distributions of the loop length up to 150 kb were shown to be exponential, with the distribution parameter, the loop density, to be dependent on the cell type. Copyright © 2016 Elsevier Inc. All rights reserved.

Study and assessment of compost of different organic mixtures and effect of organic compost tea on plant diseases

OpenAIRE

Znaïdi, Akram; Daami, Megda; Ben Kheder, Mohamed; Mahjoub, Mohamed

2002-01-01

Four compost treatments representing different organic mixtures were studied: - Treatment T1: 100% cattle manure - Treatment T2: 80% cattle manure and 20% sheep manure - Treatment T3: 70% cattle manure, 20% sheep manure and 10% poultry manure. - Treatment T4: 50% cattle manure, 20% sheep manure, 20% poultry manure and 10% crushed wheat straw. The results showed that the temperature was higher for the 4th treatment which was richer in carbon than the other treat...

Tick Haller’s Organ, a New Paradigm for Arthropod Olfaction: How Ticks Differ from Insects

Directory of Open Access Journals (Sweden)

Ann L. Carr

2017-07-01

Full Text Available Ticks are the vector of many human and animal diseases; and host detection is critical to this process. Ticks have a unique sensory structure located exclusively on the 1st pairs of legs; the fore-tarsal Haller’s organ, not found in any other animals, presumed to function like the insect antennae in chemosensation but morphologically very different. The mechanism of tick chemoreception is unknown. Utilizing next-generation sequencing and comparative transcriptomics between the 1st and 4th legs (the latter without the Haller’s organ, we characterized 1st leg specific and putative Haller’s organ specific transcripts from adult American dog ticks, Dermacentor variabilis. The analysis suggested that the Haller’s organ is involved in olfaction, not gustation. No known odorant binding proteins like those found in insects, chemosensory lipocalins or typical insect olfactory mechanisms were identified; with the transcriptomic data only supporting a possible olfactory G-protein coupled receptor (GPCR signal cascade unique to the Haller’s organ. Each component of the olfactory GPCR signal cascade was identified and characterized. The expression of GPCR, Gαo and β-arrestin transcripts identified exclusively in the 1st leg transcriptome, and putatively Haller’s organ specific, were examined in unfed and blood-fed adult female and male D. variabilis. Blood feeding to repletion in adult females down-regulated the expression of all three chemosensory transcripts in females but not in males; consistent with differences in post-feeding tick behavior between sexes and an expected reduced chemosensory function in females as they leave the host. Data are presented for the first time of the potential hormonal regulation of tick chemosensation; behavioral assays confirmed the role of the Haller’s organ in N,N-diethyl-meta-toluamide (DEET repellency but showed no role for the Haller’s organ in host attachment. Further research is needed to understand

Cultural Anchors and the Organization of Differences: A Multi-method Analysis of LGBT Marches on Washington

Science.gov (United States)

Ghaziani, Amin; Baldassarri, Delia

2013-01-01

Social scientists describe culture as either coherent or incoherent and political dissent as either unifying or divisive. This article moves beyond such dichotomies. Content, historical, and network analyses of public debates on how to organize four lesbian, gay, bisexual, and transgender (LGBT) Washington marches provide evidence for an integrative position. Rather than just describe consistencies or contradictions, we contend that the key analytic challenge is to explain the organization of differences. We propose one way of doing this using the mechanism of a cultural anchor. Within and across marches, a small collection of ideas remains fixed in the national conversation, yet in a way that allows activists to address their internal diversity and respond to unfolding historical events. These results suggest that activists do not simply organize around their similarities but, through cultural anchors, they use their commonalities to build a thinly coherent foundation that can also support their differences. Situated at the nexus of culture, social movements, sexualities, and networks, this article demonstrates how the anchoring mechanism works in the context of LGBT political organizing. PMID:23661809

Photoelectrochemical properties of N-doped self-organized titania nanotube layers with different thicknesses

OpenAIRE

Macak, Jan M.; Ghicov, Andrei; Hahn, Robert; Tsuchiya, Hiroaki; Schmuki, Patrik

2013-01-01

The present work reports nitrogen doping of self-organized TiO2 nanotubular layers. Different thicknesses of the nanotubular layer architecture were formed by electrochemical anodization of Ti in different fluoride-containing electrolytes; tube lengths were 500 nm, 2.5 μm, and 6.1 μm. As-formed nanotube layers were annealed to an anatase structure and treated in ammonia environment at 550 °C to achieve nitrogen doping. The crystal structure, morphology, composition and photoresponse of the N-...

Measurement of organic carbon stable isotope composition of different soil types by EA-IRMS system

International Nuclear Information System (INIS)

Qi Biao; Ding Lingling; Cui Jiehua; Wang Yanhong

2009-01-01

Element analyzer-isotope ratio mass spectrometers (EA-IRMS) is a rapid and precise method for measuring stable carbon isotope. Pure CO 2 reference gas was calibrated via international standard-Urea, and the δ 13 C us PDB value of pure CO 2 is (-29.523 ± 0.0181)%. Stability and linearity of the EA-IRMS system, precision of δ 13 C measurement for samples were tested through experimental comparison. Moreover, determination method of organic carbon stable isotope in soil was based on the system. The EA-IRMS system had well linearity when ion intensity ranged from 1.0 to 7.0V, and it excelled the total linearity when the ion intensity was from 1.5 to 5.0V, and the accurate result of δ 13 C for sample analysis could be obtained with precision of 0.015%. If carbon content in sample is more than 5μg, the requirement for analyzing accurate result of δ 13 C could be achieved. The organic carbon stable isotope was measured in 18 different types soil samples, the average natural abundance of 13 C was 1.082%, and the organic carbon stable isotope composition was significantly different among different type soils. (authors)

Characterization of the organic fraction of earthworm humus and composts taken place starting from different substrates

International Nuclear Information System (INIS)

Melgarejo, M.R.; Ballesteros, M.I.; Bendeck L, M.

1998-01-01

In order to evaluate the quality and the humification degree of different composted materials, the organic fraction of earthworm humus obtained from kitchen and farm residues, coffee pulp, biodegradable garbage and roses residues and of composts from roses and carnation residues were characterized chemically. Thus, determination and analysis of the C/N ratio, as well as the fractionation of the organic matter and the purification and characterization of the humic acids by C, H, N, 0 elemental analysis, UV-VIS spectroscopy were done and different humification parameters were found. The fractionation of the organic matter showed a low content of extracted carbon with respect to the normal content found in the soil humus. The elemental analysis data of the humic acids from the composts and the earthworm humus did not reveal important differences between these materials, while the E4/E6 ratio provided more evident changes. The results showed that the C/N ratio is not an absolute indicative of the Maturity State of the studied materials. The best parameters to estimate the maturity degree of the composts and the earthworm humus turned out to be the polymerization ratio, the humification index and the extracted carbon/non extracted carbon ratio. Among the evaluated materials, the earthworm of roses residues showed the best conditions with respect to content and quality of the organic matter to be added to a soil

Differences in soil quality between organic and conventional farming over a maize crop season

Science.gov (United States)

Ferreira, Carla; Veiga, Adelcia; Puga, João; Kikuchi, Ryunosuke; Ferreira, António

2017-04-01

Land degradation in agricultural areas is a major concern. The large number of mechanical interventions and the amount of inputs used to assure high crop productivity, such as fertilizers and pesticides, have negative impacts on soil quality and threaten crop productivity and environmental sustainability. Organic farming is an alternative agriculture system, based on organic fertilizers, biological pest control and crop rotation, in order to mitigate soil degradation. Maize is the third most important cereal worldwide, with 2008 million tons produced in 2013 (IGN, 2016). In Portugal, 120000 ha of arable land is devoted to maize production, leading to annual yields of about 930000 ton (INE, 2015). This study investigates soil quality differences in maize farms under organic and conventional systems. The study was carried out in Coimbra Agrarian Technical School (ESAC), in central region of Portugal. ESAC campus comprises maize fields managed under conventional farming - Vagem Grande (32 ha), and organic fields - Caldeirão (12 ha), distancing 2.8 km. Vagem Grande has been intensively used for grain maize production for more than 20 years, whereas Caldeirão was converted to organic farming in 2008, and is being used to select regional maize varieties. The region has a Mediterranean climate. The maize fields have Eutric Fluvisols, with gentle slopes (analyses. Additional soil samples were also collected with soil ring samplers (137 cm3) for bulk density analyses after sowing. Surface water infiltration was also measured with tension infiltrometer (membrane of 20cm), using different tensions (0 cm, -3cm, -6 cm e -15cm). Decomposition rate and litter stabilisation was assessed over a 3-month period through the Tea Bag Index (Keuskamp et al., 2013). The number and diversity of earthworms were also measured at the surface (0-20cm), through extraction, and at the subsurface (>20cm), using mustard solution.

DISTRIBUTION OF ORGANIC CARBON IN DIFFERENT SOIL FRACTIONS IN ECOSYSTEMS OF CENTRAL AMAZONIA

Directory of Open Access Journals (Sweden)

Jean Dalmo de Oliveira Marques

2015-02-01

Full Text Available Organic matter plays an important role in many soil properties, and for that reason it is necessary to identify management systems which maintain or increase its concentrations. The aim of the present study was to determine the quality and quantity of organic C in different compartments of the soil fraction in different Amazonian ecosystems. The soil organic matter (FSOM was fractionated and soil C stocks were estimated in primary forest (PF, pasture (P, secondary succession (SS and an agroforestry system (AFS. Samples were collected at the depths 0-5, 5-10, 10-20, 20-40, 40-60, 60-80, 80-100, 100-160, and 160-200 cm. Densimetric and particle size analysis methods were used for FSOM, obtaining the following fractions: FLF (free light fraction, IALF (intra-aggregate light fraction, F-sand (sand fraction, F-clay (clay fraction and F-silt (silt fraction. The 0-5 cm layer contains 60 % of soil C, which is associated with the FLF. The F-clay was responsible for 70 % of C retained in the 0-200 cm depth. There was a 12.7 g kg-1 C gain in the FLF from PF to SS, and a 4.4 g kg-1 C gain from PF to AFS, showing that SS and AFS areas recover soil organic C, constituting feasible C-recovery alternatives for degraded and intensively farmed soils in Amazonia. The greatest total stocks of carbon in soil fractions were, in decreasing order: (101.3 Mg ha-1 of C - AFS > (98.4 Mg ha-1 of C - FP > (92.9 Mg ha-1 of C - SS > (64.0 Mg ha-1 of C - P. The forms of land use in the Amazon influence C distribution in soil fractions, resulting in short- or long-term changes.

Environmental impacts of organic and conventional agricultural products--are the differences captured by life cycle assessment?

Science.gov (United States)

Meier, Matthias S; Stoessel, Franziska; Jungbluth, Niels; Juraske, Ronnie; Schader, Christian; Stolze, Matthias

2015-02-01

Comprehensive assessment tools are needed that reliably describe environmental impacts of different agricultural systems in order to develop sustainable high yielding agricultural production systems with minimal impacts on the environment. Today, Life Cycle Assessment (LCA) is increasingly used to assess and compare the environmental sustainability of agricultural products from conventional and organic agriculture. However, LCA studies comparing agricultural products from conventional and organic farming systems report a wide variation in the resource efficiency of products from these systems. The studies show that impacts per area farmed land are usually less in organic systems, but related to the quantity produced impacts are often higher. We reviewed 34 comparative LCA studies of organic and conventional agricultural products to analyze whether this result is solely due to the usually lower yields in organic systems or also due to inaccurate modeling within LCA. Comparative LCAs on agricultural products from organic and conventional farming systems often do not adequately differentiate the specific characteristics of the respective farming system in the goal and scope definition and in the inventory analysis. Further, often only a limited number of impact categories are assessed within the impact assessment not allowing for a comprehensive environmental assessment. The most critical points we identified relate to the nitrogen (N) fluxes influencing acidification, eutrophication, and global warming potential, and biodiversity. Usually, N-emissions in LCA inventories of agricultural products are based on model calculations. Modeled N-emissions often do not correspond with the actual amount of N left in the system that may result in potential emissions. Reasons for this may be that N-models are not well adapted to the mode of action of organic fertilizers and that N-emission models often are built on assumptions from conventional agriculture leading to even greater

Theme and variations: The development of differences in Polynesian socio-political organizations

Directory of Open Access Journals (Sweden)

Martin A. van Bakel

2008-12-01

Full Text Available This article discusses the development of differences in the socio-political organization on the various Polynesian islands. Such differences were observed by early European visitors. Most of their descriptions date from the last quarter of the eighteenth century, but a few sources date back to the early seventeenth century, including the journals of the Dutch voyagers Schouten and Le Maire, Tasman, and somewhat later Roggeveen. The voyagers’ logs and journals often contain lengthy and detailed descriptions of the Polynesian peoples and cultures they encountered. And, though they often did not understand what they observed, they carefully described what they saw — or what they thought they saw.

Conventional, organic and biodynamic farming: differences in polyphenol content and antioxidant activity of Batavia lettuce.

Science.gov (United States)

Heimler, Daniela; Vignolini, Pamela; Arfaioli, Paola; Isolani, Laura; Romani, Annalisa

2012-02-01

Lactuca sativa L. ssp. acephala L., cv. Batavia red Mohican plants were cultivated under intensive conventional, organic and biodynamic farming and were analyzed for their polyphenol content and antiradical activity in order to demonstrate the influence of farming on yield, polyphenol content and antiradical activity. The yield of plants from conventional farming was the highest (2.89 kg m⁻²), while polyphenol content, measured by spectrophotometry, of these plants was lower at P flavonoid and hydroxycinnamic acid contents. Flavonoid, hydroxycinnamic acid and anthocyan patterns were not affected by the type of cultivation, while quantitative differences were demonstrated and some differences were found between conventional farming and organic or biodynamic farming. The yield of conventionally grown salads was the highest. Copyright © 2011 Society of Chemical Industry.

Study of different roles phosphorescent material played in different positions of organic light emitting diodes

Science.gov (United States)

Keke, Gu; Jian, Zhong; Jiule, Chen; Yucheng, Chen; Ming, Deng

2013-09-01

Phosphorescent materials are crucial to improve the luminescence and efficiency of organic light emitting diodes (OLED), because its internal quantum efficiency can reach 100%. So the studying of optical and electrical properties of phosphorescent materials is propitious for the further development of phosphorescent OLED. Phosphorescent materials were generally doped into different host materials as emitting components, not only played an important role in emitting light but also had a profound influence on carrier transport properties. We studied the optical and electrical properties of the blue 4,4'-bis(2,2-diphenylvinyl)-1,1'-biphenyl (DPVBi)-based devices, adding a common yellow phosphorescent material bis[2-(4- tert-butylphenyl)benzothiazolato- N,C2'] iridium(acetylacetonate) [( t-bt)2Ir(acac)] in different positions. The results showed ( t-bt)2Ir(acac) has remarkable hole-trapping ability. Especially the ultrathin structure device, compared to the device without ( t-bt)2Ir(acac), had increased the luminance by about 60%, and the efficiency by about 97%. Then introduced thin 4,4'-bis(carbazol-9-yl)biphenyl (CBP) host layer between DPVBi and ( t-bt)2Ir(acac), and got devices with stable white color.

Investigation of the Entrance Surface Dose and Dose to Different Organs in Lumbar Spine Imaging

Science.gov (United States)

Sina, S; Zeinali, B; Karimipoorfard, M; Lotfalizadeh, F; Sadeghi, M; Zamani, E; Faghihi, R

2014-01-01

Background: Dose assessment using proper dosimeters is especially important in radiation protection optimization and imaging justification in diagnostic radiology. Objective: The aim of this study is to obtain the Entrance Skin Dose (ESD) of patients undergoing lumbar spine imaging using two thermoluminescence dosimeters TLD-100 (LiF: Mg, Ti) and GR-200 (LiF: Mg, Cu, P) and also to obtain the absorbed dose to different organs in lumbar spine imaging with several views. Methods: To measure the ESD values of the patients undergoing lumbar spine imaging, the two TLD types were put on their skin surface. The ESD values for different views of lumbar spine imaging were also measured by putting the TLDs at the surface of the Rando phantom. Several TLD chips were inserted inside different organs of Rando phantom to measure the absorbed dose to different organs in lumbar spine imaging. Results: The results indicate that there is a close agreement between the results of the two dosimeters. Based on the results of this experiment, the ESD dose of the 16 patients included in this study varied between 2.71 mGy and 26.29 mGy with the average of 11.89 mGy for TLD-100, and between 2.55 mGy and 27.41 mGy with the average of 12.32 mGy for GR-200 measurements. The ESDs obtained by putting the two types of TLDs at the surface of Rando phantom are in close agreement. Conclusion: According to the results, the GR200 has greater sensitivity than the TLD-100. PMID:25599058

Investigation of the Entrance Surface Dose and Dose to Different Organs in Lumbar Spine Imaging

Directory of Open Access Journals (Sweden)

Sina S

2014-12-01

Full Text Available Background: Dose assessment using proper dosimeters is especially important in radiation protection optimization and imaging justification in diagnostic radiology. Objective: The aim of this study is to obtain the Entrance Skin Dose (ESD of patients undergoing lumbar spine imaging using two thermoluminescence dosimeters TLD-100 (LiF: Mg, Ti and GR-200 (LiF: Mg, Cu, P and also to obtain the absorbed dose to different organs in lumbar spine imaging with several views. Methods: To measure the ESD values of the patients undergoing lumbar spine imaging, the two TLD types were put on their skin surface. The ESD values for different views of lumbar spine imaging were also measured by putting the TLDs at the surface of the Rando phantom. Several TLD chips were inserted inside different organs of Rando phantom to measure the absorbed dose to different organs in lumbar spine imaging. Results: The results indicate that there is a close agreement between the results of the two dosimeters. Based on the results of this experiment, the ESD dose of the 16 patients included in this study varied between 2.71 mGy and 26.29 mGy with the average of 11.89 mGy for TLD-100, and between 2.55 mGy and 27.41 mGy with the average of 12.32 mGy for GR-200 measurements. The ESDs obtained by putting the two types of TLDs at the surface of Rando phantom are in close agreement. Conclusion: According to the results, the GR200 has greater sensitivity than the TLD-100.

Investigation of radioisotopes in different organisms around Paks NPP

International Nuclear Information System (INIS)

Janovics, R.; Bihari, A.; Major, Z.; Palcsu, L.; Papp, L.; Veres, M.

2010-01-01

Complete text of publication follows. The Paks Nuclear Power Plant is a pressurised water reactor, therefore, it requires a large amount of cooling water. Cooling water is pumped from the Danube, and used water is also discharged back to the river through the warm-water channel. In the study Danube water and various aquatic organisms (a snail, Viviparus Acerosus, a mussel Unio Tumidus, a predatory fish Stizostedion lucioperca and a non-predatory fish Leuciscus idus) were collected upstream and downstream of the inlet of the channel. After freeze-drying both from the interstitial water and the dry matter of the aquatic organisms collected, tritium measurements were performed by the T- 3 He method to gain information about the ratio of the tritium concentration of the organically bound and the not-bound hydrogen, as well. The activity of the organically bound tritium reflects the mean activity of the environment of the organism, while the tritium activity of the interstitial water shows the actual activity of the aquatic environment. The activity of gamma emitters in the dry matter was also measured by gamma spectrometry. In case of the mussel and snail samples gamma spectrometry measurements were performed separately from the calciferous skeleton and the tissues. Besides the aquatic organisms, soil and plant samples (Scots Pine Pinus sylvestris, Common Milkweed Asclepias syriaca L., giant goldenrod Solidago gigantea) were collected in the vicinity of the nuclear power plant and in a background site, as well. These samples were analysed by gamma spectrometry and for tritium concentration, and the results were compared with a background site. On the basis of the gamma spectrometry results significant amount of artificial gamma emitter isotopes do not get to the Danube through the warm-water channel. Only 60 Co occurred in certain mussel, snail and sludge in a measurable activity concentration, however, it is not of power plant origin, as it was present even in the

Effect of organic matter on the uptake of phosphorus by rice plants under different moisture conditions

International Nuclear Information System (INIS)

Ghosh, Geetanjali

1974-01-01

In studies on the effect of three levels of moisture and two levels of organic matter in two alluvial soils, the uptake of P by rice plant both from soil and fertilizer sources was the highest and Eh the lowest under submerged conditions. No marked difference in total uptake of P was observed in upland and alternate submerged condition; organic matter application showed an appreciable effect under submerged condition. (author)

Effects of different tillage and straw return on soil organic carbon in a rice-wheat rotation system.

Directory of Open Access Journals (Sweden)

Liqun Zhu

Full Text Available Soil management practices, such as tillage method or straw return, could alter soil organic carbon (C contents. However, the effects of tillage method or straw return on soil organic C (SOC have showed inconsistent results in different soil/climate/cropping systems. The Yangtze River Delta of China is the main production region of rice and wheat, and rice-wheat rotation is the most important cropping system in this region. However, few studies in this region have been conducted to assess the effects of different tillage methods combined with straw return on soil labile C fractions in the rice-wheat rotation system. In this study, a field experiment was used to evaluate the effects of different tillage methods, straw return and their interaction on soil total organic C (TOC and labile organic C fractions at three soil depths (0-7, 7-14 and 14-21 cm for a rice-wheat rotation in Yangzhong of the Yangtze River Delta of China. Soil TOC, easily oxidizable C (EOC, dissolved organic C (DOC and microbial biomass C (MBC contents were measured in this study. Soil TOC and labile organic C fractions contents were significantly affected by straw returns, and were higher under straw return treatments than non-straw return at three depths. At 0-7 cm depth, soil MBC was significantly higher under plowing tillage than rotary tillage, but EOC was just opposite. Rotary tillage had significantly higher soil TOC than plowing tillage at 7-14 cm depth. However, at 14-21 cm depth, TOC, DOC and MBC were significantly higher under plowing tillage than rotary tillage except for EOC. Consequently, under short-term condition, rice and wheat straw both return in rice-wheat rotation system could increase SOC content and improve soil quality in the Yangtze River Delta.

Effects of different sources of organic waste application on the growth and biomass production of kenaf (hibiscus cannabinus L.)

International Nuclear Information System (INIS)

Shahariara, M.S.; Tahsina, S.; Muhammad, S.; Gani, M.N.; Huq, I.

2012-01-01

The growth and biomass productivity of kenaf (Hibiscus cannabinus L.) grown with different sources of organic waste viz. sewage sludge, poultry litter, cow dung and rice straw application were observed in a field experiment. Organic wastes were applied at the rate of 5 t/ha and were compared with recommended dose of fertilizers and control. The plants were harvested at 120 days after sowing (at the flowering stage). Different sources of organic wastes had a significant effect (P cow dung>poultry litter > rice straw treatments. Among the four sources of organic wastes, sewage sludge treated plot produced the highest mean biomass of 23.33 t/ha (dry weight basis) which was 14.64% higher than the mean biomass production from control plot. (author)

Effects of different sources of organic waste application on the growth and biomass production of kenaf (hibiscus cannabinus L.)

International Nuclear Information System (INIS)

Shahariar, M.S.; Tashin, S.; Gani, N.; Muhammad, S.; Huq, I.

2012-01-01

The growth and biomass productivity of kenaf(Hibiscus cannabinus L.) grown with different sources of organic waste viz. sewage sludge, poultry litter, cow dung and rice straw application were observed in a field experiment. Organic wastes were applied at the rate of 5 t/ha and were compared with recommended dose of fertilizers and control. The plants were harvested at 120 days after sowing (at the flowering stage). Different sources of organic wastes had a significant effect (P cow dung>poultry litter> rice straw treatments. Among the four sources of organic wastes, sewage sludge treated plot produced the highest mean biomass of 23.33 t/ha (dry weight basis) which was 14.64% higher than the mean biomass production from control plot. (author)

Comparing the Effect of Diets Treated with Different Organic Acids ...

African Journals Online (AJOL)

An experiment was conducted to compare the growth and economics of adding organic acids to diets of broiler chickens. The organic acids were sorbic benzoic lactic and propionic acids. 150 day old Hubbard chicks were used. There were five treatments. Diet 1 which served as control contained no organic acid. Diets 2, 3 ...

The effects of anthropogenic organic matter inputs on stable carbon and nitrogen isotopes in organisms from different trophic levels in a southern Mediterranean coastal area

International Nuclear Information System (INIS)

Vizzini, Salvatrice; Mazzola, Antonio

2006-01-01

Stable isotope ratios were used to determine the impact of anthropogenically derived organic matter from onshore and offshore fish farming and a sewage outfall on organisms at different trophic levels (primary producers and consumers) on the south-east coast of Sicily (Italy, Mediterranean). Representative macroalgae and consumers were collected in three sampling locations: 'Impact' and two putative 'Controls' sited to the north of the impacted location. While δ 13 C values of both organic matter sources and consumers varied little between locations, δ 15 N spatial variability was higher and δ 15 N was shown to be a good descriptor of organic enrichment and uptake of anthropogenically derived material within coastal food webs. Isotopic data were analysed using a multivariate approach. Organic matter sources and benthic components were more sensitive to pollution than nektobenthic species and revealed that the effects of anthropogenic activities seem to be detectable over a wide area. The study site is characterised by wide waste dispersal, which brings a reduction in impact in the area directly affected by organic matter inputs and enlarges the area of moderate impact

THE EXTENT OF CLONAL STRUCTURE IN DIFFERENT LYMPHOID ORGANS

NARCIS (Netherlands)

HERMANS, MHA; WUBBENA, A; KROESE, FGM; HUNT, SV; COWAN, R; OPSTELTEN, D

1992-01-01

To gain insight into the clonal organization of lymphoid organs, we studied the distribution in situ of donor-derived cells in near-physiological chimeras. We introduced RT7b fetal liver cells into nonirradiated congenic RT7a neonatal rats. The chimerism 6-20 wk after injection ranged from 0.3 to

Workload differences across command levels and emergency response organizations during a major joint training exercise.

Science.gov (United States)

Prytz, Erik G; Rybing, Jonas; Jonson, Carl-Oscar

2016-01-01

This study reports on an initial test using a validated workload measurement method, the NASA Task Load Index (TLX), as an indicator of joint emergency exercise effectiveness. Prior research on emergency exercises indicates that exercises must be challenging, ie, result in high workload, to be effective. However, this is often problematic with some participants being underloaded and some overloaded. The NASA TLX was used to test for differences in workload between commanders and subordinates and among three different emergency response organizations during a joint emergency exercise. Questionnaire-based evaluation with professional emergency responders. The study was performed in conjunction with a large-scale interorganizational joint emergency exercise in Sweden. A total of 20 participants from the rescue services, 12 from the emergency medical services, and 12 from the police participated in the study (N=44). Ten participants had a command-level role during the exercise and the remaining 34 were subordinates. The main outcome measures were the workload subscales of the NASA TLX: mental demands, physical demands, temporal demands, performance, effort, and frustration. The results showed that the organizations experienced different levels of workload, that the commanders experienced a higher workload than the subordinates, and that two out of three organizations fell below the twenty-fifth percentile of average workload scores compiled from 237 prior studies. The results support the notion that the NASA TLX could be a useful complementary tool to evaluate exercise designs and outcomes. This should be further explored and verified in additional studies.

Earthworm-induced distribution of organic matter in macro-aggregates from differently managed arable fields.

NARCIS (Netherlands)

Marinissen, J.C.Y.; Hillenaar, S.I.

1997-01-01

To study the influence of soil structure on organic matter decomposition, and the possible role of earthworms therein, aggregates of the size of earthworm casts (3-4.8 mm) were sieved from air-dry soil of three arable fields. Due to different management histories (in terms of manuring and pesticide

Assessment of soil organic matter persistence under different land uses applying a physical fractionation procedure

Science.gov (United States)

Giannetta, Beatrice; Plaza, César; López-de-Sá, Esther G.; Vischetti, Costantino; Zaccone, Claudio

2017-04-01

The understanding of the mechanisms involved in the build-up of soil organic matter (SOM) pools with long residence time is tightly linked to the comprehension of C dynamics. Organo-mineral associations are known to be strongly correlated with the accumulation of selective preserved C forms. Adsorption to minerals, as well as occlusion within aggregates, may affect SOM protection in different ways depending on its molecular structure and pedo-climatic conditions. In this research, we investigated changes in quantity and quality of SOM pools characterized by different protection mechanisms in coniferous and broadleaved forest soils, grassland soils, technosols and an agricultural soil with different organic amendments, in order to evaluate the influence of both land use and organic matter nature on physical and/or chemical stabilization of SOM. In particular, free (FR), intra-macroaggregate (MA), intra-microaggregate (MI), and mineral-associated (Min) fractions were separated in order to define physical and chemical mechanisms responsible for the SOM protection against degradation. All these SOM fractions were analyzed for organic C and total N concentration, and their stability assessed by thermogravimetric analysis (TD-TGA). Preliminary data show that, for all land uses, most of the organic C (40-60%) is found in the Min pool, followed by FR (20-40%)>MI MA. With the only exception of the FR, no significant correlations were found between the C/N ratio and a thermal stability index (H550-400/400-250) of each fraction; at the same time, a highly significant and positive correlation was found between these two parameters in all fractions isolated from agricultural soils. In particular, the thermal stability index measured in all Min fractions may be related to the more marked presence of labile compounds in this pool relative to recalcitrant compounds. Conversely, FR OM could not always represent a fresh and readily decomposable fraction.Furthermore, OM associated

Similarities and differences in borderline and organic personality disorder.

Science.gov (United States)

Mathiesen, Birgit B; Simonsen, Erik; Soegaard, Ulf; Kvist, Kajsa

2014-01-01

Previous research has shown that brain injury patients with Organic Personality Disorder (OPD) may display "borderline" traits due to prefrontal damage, and their personality structure may be unstable and close to a borderline personality organisation. They may have few general neuropsychological dysfunctions but specific executive deficits. Similar deficits have been found in patients with Borderline Personality Disorder (BPD). The objective of this study was to identify differences and similarities between the neuropsychological and personality profiles of BPD and OPD patients. Twenty BPD patients and 24 OPD patients were assessed with the Structured Clinical Interview for DSM-IV Axis II Disorders (SCID-II), the Karolinska Psychodynamic Profile (KAPP), and a comprehensive neuropsychological test battery. Very few neuropsychological differences were found between the two patient groups. However, the verbal fluency, verbal intelligence, verbal memory, and immediate auditory memory/attention of the BPD patients were significantly poorer than the OPD patients'. The KAPP profiles of the BPD patients showed significantly poorer functioning in three areas: frustration tolerance, the body as a factor of self-esteem, and overall personality organisation. These results support our clinical experience and expectations concerning the severity of symptoms of both patient groups. We suggest considering in depth assessments of both neuropsychological and personality-related problems for each of these patients in order to inform treatment.

Characterization of volatile organic compounds from different cooking emissions

Science.gov (United States)

Cheng, Shuiyuan; Wang, Gang; Lang, Jianlei; Wen, Wei; Wang, Xiaoqi; Yao, Sen

2016-11-01

Cooking fume is regarded as one of the main sources of urban atmospheric volatile organic compounds (VOCs) and its chemical characteristics would be different among various cooking styles. In this study, VOCs emitted from four different Chinese cooking styles were collected. VOCs concentrations and emission characteristics were analyzed. The results demonstrated that Barbecue gave the highest VOCs concentrations (3494 ± 1042 μg/m3), followed by Hunan cuisine (494.3 ± 288.8 μg/m3), Home cooking (487.2 ± 139.5 μg/m3), and Shandong cuisine (257.5 ± 98.0 μg/m3). The volume of air drawn through the collection hood over the stove would have a large impact on VOCs concentration in the exhaust. Therefore, VOCs emission rates (ER) and emission factors (EF) were also estimated. Home cooking had the highest ER levels (12.2 kg/a) and Barbecue had the highest EF levels (0.041 g/kg). The abundance of alkanes was higher in Home cooking, Shandong cuisine and Hunan cuisine with the value of 59.4%-63.8%, while Barbecue was mainly composed of alkanes (34.7%) and alkenes (39.9%). The sensitivity species of Home cooking and Hunan cuisine were alkanes, and that of Shandong cuisine and Barbecue were alkenes. The degree of stench pollution from cooking fume was lighter.

Modification of mesoporous silica SBA-15 with different organic molecules to gain chemical sensors: a review

Directory of Open Access Journals (Sweden)

Negar Lashgari

2016-01-01

Full Text Available The recognition of the biologically and environmentally important ions is of great interest in the field of chemical sensors in recent years. The fluorescent sensors as a powerful optical analytical technique for the detection of low level of various analytes such as anions and metal cations have been progressively developed due to the simplicity, cost effective, and selectivity for monitoring specific analytes in various systems. Organic-inorganic hybrid nanomaterials have important advantages as solid chemosensors and various innovative hybrid materials modified by fluorescence molecules were recently prepared. On the other hand, the homogeneous porosity and large surface area of mesoporous silica make it a promising inorganic support. SBA-15 as a two-dimensional hexagonal mesoporous silica material with stable structure, thick walls, tunable pore size, and high specific surface area is a valuable substrate for modification with different organic chelating groups. This review highlights the fluorescent chemosensors for ionic species based on modification of the mesoporous silica SBA-15 with different organic molecules, which have been recently developed from our laboratory.

The Effect of Different Fertilizer Applications on Plant and Fruit Yield in Greenhouse Organic Tomato Growing

Directory of Open Access Journals (Sweden)

Funda Ulusu

2017-12-01

Full Text Available Greenhouse tomato production is in the first place in Turkey, 34% of total tomato production (3.614.472 tonnes is under greenhouse conditions. The increase in yield in Turkey is due to the spread of undergrowth cultivation besides the use of qualified varieties and seeds. Synthetic fertilizers can’t be used to obtain economic efficiency in underground organic tomato growing Therefore, the application of alternative fertilizers (barn stubble, green manure, organic fertilizer, vermicompost etc. needs to be improved. For this purpose, effect of the eight different fertilizer combination including organic and worm liquid fertilizer, humic acid and mycorrhizae applications on tomato plant and fruit yield were investigated in the study. Negative check without any fertilizer application growing and a positive check; a synthetic liquid fertilizer application was included. Experiment was set up according to completely randomised block design with 3 replications under greenhouse conditions. Tomato fruit length, diameter and weight was determined as fruit yield and fresh and dry weight as plant yield. There was not any statistical difference among fertilizer applications for fruit and plant yield. However, the highest tomato fruit yield was obtained in the treatments of organic (7.17 kg/ plot and worm fertilizers (4,80 kg/ plot in combination with mycorrhizae. The results were similar for fruit diameter and length. Plant fresh and dry weight was between 2.01 to 5.92 and 0.368 to 1.153 kg, respectively. The highest plant weight was belong to mycorrhizae and organic fertilizer application.

Еvaluation of health status of children attending primary schools with different organization of physical education lessons

Science.gov (United States)

Kondratiuk, Oleksandra S.; Korshun, Maria M.; Garkavyi, Serhii I.; Garkavyi, Serhii S.

2018-01-01

The mandatory swimming lesson in primary schools, equipped with swimming pools, was introduced without studying of its health-saving effectiveness. The purpose of this study was to evaluate the health status of pupils studying in schools with different organization of physical education lessons. Cross-sectional study was organized in two schools with different organization of physical education lessons. The experimental group (E) consisted of 408 children of 1‑4 year of study (210 girls and 198 boys) who during one of the lessons of physical education were engaged in swimming in the school basin. Control group (C) consisted of 279 primary school children (210 girls and 156 boys) from a neighboring educational institution where all physical education lessons were organized in the gym. The health status was evaluated using classical method of complex assessment of the state of health with the subsequent assignment of each child to one of the health groups. In result of evaluation of state of health there was established that among pupils from E group the proportion of boys with harmonious anthropometric parameters is higher (pprimary school has positive effect on health status of children.

Transparent organic light-emitting diodes with different bi-directional emission colors using color-conversion capping layers

Energy Technology Data Exchange (ETDEWEB)

Lee, Jonghee, E-mail: jonghee.lee@etri.re.kr [OLED Research Center, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Institut für Angewandte Photophysik, Technische Universität Dresden, George-Bähr-Straße 1, 01062 Dresden (Germany); Koh, Tae-Wook [Department of Electrical Engineering, Korea Advanced Institute of Science and Technology (KAIST), Daejeon 305-701 (Korea, Republic of); Cho, Hyunsu [OLED Research Center, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Department of Electrical Engineering, Korea Advanced Institute of Science and Technology (KAIST), Daejeon 305-701 (Korea, Republic of); Schwab, Tobias [Institut für Angewandte Photophysik, Technische Universität Dresden, George-Bähr-Straße 1, 01062 Dresden (Germany); Lee, Jae-Hyun [Department School of Global Convergence Studies, Hanbat National University, San 16-1, Duckmyoung-dong, Daejeon 305-719 (Korea, Republic of); Hofmann, Simone [Institut für Angewandte Photophysik, Technische Universität Dresden, George-Bähr-Straße 1, 01062 Dresden (Germany); Lee, Jeong-Ik [OLED Research Center, Electronics and Telecommunications Research Institute (ETRI), Daejeon 305-700 (Korea, Republic of); Yoo, Seunghyup [Department of Electrical Engineering, Korea Advanced Institute of Science and Technology (KAIST), Daejeon 305-701 (Korea, Republic of); and others

2015-06-15

We report a study on transparent organic light-emitting diodes (OLEDs) with different bi-directional emission colors, enabled by color-conversion organic capping layers. Starting from a transparent blue OLED with an uncapped Ag top electrode exhibiting an average transmittance of 33.9%, a 4-(dicyanomethylene)-2-methyl-6-(4-dimethylaminostyryl)-4H-pyran (DCM)-doped tris-(8-hydroxy-quinolinato)-aluminum (Alq3) capping layer is applied to achieve color-conversion from blue to orange-red on the top side while maintaining almost unchanged device transmittance. This color-conversion capping layer does not only change the color of the top side emission, but also enhances the overall device efficiency due to the optical interaction of the capping layer with the primary blue transparent OLED. Top white emission from the transparent bi-directional OLED exhibits a correlated color temperature around 6000–7000 K, with excellent color stability as evidenced by an extremely small variation in color coordinate of Δ(x,y)=(0.002, 0.002) in the forward luminance range of 100–1000 cd m{sup −2}. At the same time, the blue emission color of bottom side is not influenced by the color conversion capping layer, which finally results in different emission colors of the two opposite sides of our transparent OLEDs. - Highlights: • We report transparent organic light-emitting diodes (OLEDs) with different bi-directional emission colors. • Transparent blue OLED with color-conversion organic capping layers (CCL) shows orange top side emission. • Top white emission exhibits a CCT around 7000 K, with excellent color stability on a driving voltage.

Transparent organic light-emitting diodes with different bi-directional emission colors using color-conversion capping layers

International Nuclear Information System (INIS)

Lee, Jonghee; Koh, Tae-Wook; Cho, Hyunsu; Schwab, Tobias; Lee, Jae-Hyun; Hofmann, Simone; Lee, Jeong-Ik; Yoo, Seunghyup

2015-01-01

We report a study on transparent organic light-emitting diodes (OLEDs) with different bi-directional emission colors, enabled by color-conversion organic capping layers. Starting from a transparent blue OLED with an uncapped Ag top electrode exhibiting an average transmittance of 33.9%, a 4-(dicyanomethylene)-2-methyl-6-(4-dimethylaminostyryl)-4H-pyran (DCM)-doped tris-(8-hydroxy-quinolinato)-aluminum (Alq3) capping layer is applied to achieve color-conversion from blue to orange-red on the top side while maintaining almost unchanged device transmittance. This color-conversion capping layer does not only change the color of the top side emission, but also enhances the overall device efficiency due to the optical interaction of the capping layer with the primary blue transparent OLED. Top white emission from the transparent bi-directional OLED exhibits a correlated color temperature around 6000–7000 K, with excellent color stability as evidenced by an extremely small variation in color coordinate of Δ(x,y)=(0.002, 0.002) in the forward luminance range of 100–1000 cd m −2 . At the same time, the blue emission color of bottom side is not influenced by the color conversion capping layer, which finally results in different emission colors of the two opposite sides of our transparent OLEDs. - Highlights: • We report transparent organic light-emitting diodes (OLEDs) with different bi-directional emission colors. • Transparent blue OLED with color-conversion organic capping layers (CCL) shows orange top side emission. • Top white emission exhibits a CCT around 7000 K, with excellent color stability on a driving voltage

Response of tomato cultivars to different organic fertilizers under agro-climatic conditions of mingora, Swat

International Nuclear Information System (INIS)

Yousafzai, S.K.; Khan, S.M.; Khan, J.; Khan, S.A.; Hussain, I.; Naz, I.

2016-01-01

An experiment was conducted at Agricultural Research Institute (ARI) Mingora, Swat during 2013 to study the effect of different organic fertilizers of tomato cultivars under the agro-climatic conditions of Mingora, Swat. The experiment was conducted in randomized complete block design with split plot arrangements having four treatments with three replications. Almost all the traits showed significant differences for organic fertilizers and varieties, while their interactions had a varied response. The analyzed data showed that poultry manure gave maximum yield (24.65 t ha/sup -1/), followed by FYM (24.38 t ha/sup -1/) and mushroom compost (24.11 t ha/sup -1/ ) while minimum was recorded in plots where no organic fertilizer was used. The results revealed that cultivar, Rio Grand showed maximum number of plant survival percentage (98.33 percent), days to flowering (40.73), number of flowers plant/sup -1/ (6.23), number of fruit plant (25.67), fruit 3 weight (8.84 kg), number of leaves plant/sup -1/ (83.66), fruit size (64.70 cm/sup 3/) and total yield (25.67 t ha/sup -1/ ) in Farm Yard Manure (FYM). Considering the overall performance, it was found that the tomato cultivar Rio Grand was promising for yield and other characters where FYM was applied. (author)

Changes in gravitational force affect gene expression in developing organ systems at different developmental times

Directory of Open Access Journals (Sweden)

Moorman Stephen J

2005-05-01

Full Text Available Abstract Background Little is known about the affect of microgravity on gene expression, particularly in vivo during embryonic development. Using transgenic zebrafish that express the gfp gene under the influence of a β-actin promoter, we examined the affect of simulated-microgravity on GFP expression in the heart, notochord, eye, somites, and rohon beard neurons. We exposed transgenic zebrafish to simulated-microgravity for different durations at a variety of developmental times in an attempt to determine periods of susceptibility for the different developing organ systems. Results The developing heart had a period of maximum susceptibility between 32 and 56 hours after fertilization when there was an approximately 30% increase in gene expression. The notochord, eye, somites, and rohon beard neurons all showed periods of susceptibility occurring between 24 and 72 hours after fertilization. In addition, the notochord showed a second period of susceptibility between 8 and 32 hours after fertilization. Interestingly, all organs appeared to be recovering by 80 hours after fertilization despite continued exposure to simulated-microgravity. Conclusion These results support the idea that exposure to microgravity can cause changes in gene expression in a variety of developing organ systems in live embryos and that there are periods of maximum susceptibility to the effects.

Comparison of Two Different Presentations of Graphic Organizers in Recalling Information in Expository Texts with Intellectually Disabled Students

Science.gov (United States)

Ozmen, Ruya Guzel

2011-01-01

The purpose of this study was to compare the effectiveness of two different presentations of graphic organizers on recalling information from compare/contrast text which is a kind of expository text in intellectually disabled students. The first presentation included graphic organizers which were presented before reading whereas in the second…

Effect on tomato (Solanum lycopersicum L. of different doses of organic fertilizer bocashi under agroecological conditions

Directory of Open Access Journals (Sweden)

Ana Boudet Antomarchi

2017-10-01

Full Text Available The research work was carried out in areas of the Agricultural Production Cooperative "Carlos Bastida Argüello" in Cauto Cristo municipality of Cuban province of Granma in the period between November 2013 and February 2014, on a fluvisol soil at a plantation distance of 0.90 x 0.30 m, in order to evaluate the effect of different doses of organic manure bocashi on the productive response of tomato (Solanum lycopersicum L. variety "Vyta". The treatments consisted of the application of three doses of manure "bocashi" and a control without application. A randomized complete block design with three repetitions was used and the evaluated variables were: the yield and its components (number of bunches per plant, number of fruits per plant, mass of fruits per plant, polar and equatorial diameter of the fruit and mesocarp thickness. The data obtained were submitted to a variance analysis of double classification with the use of SPSS version 22. In case of significant differences between treatments a Tukey test was performed for comparison of means. The results showed that treatment with application of organic manure had a positive influence on the yield and majority of yield components values. The yields values were higher in the three doses of organic manure than in the control treatment and yield increased with the increase of dosage of organic manure.

Age difference in deposition of plutonium in organs of rats and the estimation of distribution in humans

Energy Technology Data Exchange (ETDEWEB)

Fukuda, Satoshi; Iida, Haruzo [National Inst. of Radiological Sciences, Chiba (Japan)

2000-05-01

Differences in plutonium distribution in various organs, particularly the bones, of rats injected at different ages were examined in order to aid in estimating plutonium distribution in humans. Comparisons were made between rats and humans based on the bone histomorphometric and mineral density data. Male and female rats of three ages (3, 12, and 24 months old), respectively, received an injection of plutonium nitrate by two dose modalities; a fixed amount of plutonium without regard to age, sex, or body weight; per g of body weight. The rats were killed 2 weeks after the injection of plutonium. The amounts of plutonium deposited in the organs varied without regard to the body or organ weight; those in the skeleton increased from 3 to 12 months, reaching a peak at 12 months, but then decreased, along with the age-related changes in the bone surface, volume, and mineral density. Those in the liver, spleen and kidney decreased despite the body weight gain with age in both sexes. Age-related differences in the deposition of plutonium in humans were estimated based on the bone data characteristics obtained from the histomorphometry and bone mineral density for corresponding of ages between rats and humans. The results indicate that age is the most important factor in estimating the distribution of plutonium deposition in the early period after plutonium exposure, and that body or organ weight is not always a useful indicator, particularly in the aged. (author)

The feasibility of a scanner-independent technique to estimate organ dose from MDCT scans: Using CTDIvol to account for differences between scanners

International Nuclear Information System (INIS)

Turner, Adam C.; Zankl, Maria; DeMarco, John J.; Cagnon, Chris H.; Zhang Di; Angel, Erin; Cody, Dianna D.; Stevens, Donna M.; McCollough, Cynthia H.; McNitt-Gray, Michael F.

2010-01-01

Purpose: Monte Carlo radiation transport techniques have made it possible to accurately estimate the radiation dose to radiosensitive organs in patient models from scans performed with modern multidetector row computed tomography (MDCT) scanners. However, there is considerable variation in organ doses across scanners, even when similar acquisition conditions are used. The purpose of this study was to investigate the feasibility of a technique to estimate organ doses that would be scanner independent. This was accomplished by assessing the ability of CTDI vol measurements to account for differences in MDCT scanners that lead to organ dose differences. Methods: Monte Carlo simulations of 64-slice MDCT scanners from each of the four major manufacturers were performed. An adult female patient model from the GSF family of voxelized phantoms was used in which all ICRP Publication 103 radiosensitive organs were identified. A 120 kVp, full-body helical scan with a pitch of 1 was simulated for each scanner using similar scan protocols across scanners. From each simulated scan, the radiation dose to each organ was obtained on a per mA s basis (mGy/mA s). In addition, CTDI vol values were obtained from each scanner for the selected scan parameters. Then, to demonstrate the feasibility of generating organ dose estimates from scanner-independent coefficients, the simulated organ dose values resulting from each scanner were normalized by the CTDI vol value for those acquisition conditions. Results: CTDI vol values across scanners showed considerable variation as the coefficient of variation (CoV) across scanners was 34.1%. The simulated patient scans also demonstrated considerable differences in organ dose values, which varied by up to a factor of approximately 2 between some of the scanners. The CoV across scanners for the simulated organ doses ranged from 26.7% (for the adrenals) to 37.7% (for the thyroid), with a mean CoV of 31.5% across all organs. However, when organ doses

The basic circuit of the IC: tectothalamic neurons with different patterns of synaptic organization send different messages to the thalamus

Science.gov (United States)

Ito, Tetsufumi; Oliver, Douglas L.

2012-01-01

The inferior colliculus (IC) in the midbrain of the auditory system uses a unique basic circuit to organize the inputs from virtually all of the lower auditory brainstem and transmit this information to the medial geniculate body (MGB) in the thalamus. Here, we review the basic circuit of the IC, the neuronal types, the organization of their inputs and outputs. We specifically discuss the large GABAergic (LG) neurons and how they differ from the small GABAergic (SG) and the more numerous glutamatergic neurons. The somata and dendrites of LG neurons are identified by axosomatic glutamatergic synapses that are lacking in the other cell types and exclusively contain the glutamate transporter VGLUT2. Although LG neurons are most numerous in the central nucleus of the IC (ICC), an analysis of their distribution suggests that they are not specifically associated with one set of ascending inputs. The inputs to ICC may be organized into functional zones with different subsets of brainstem inputs, but each zone may contain the same three neuron types. However, the sources of VGLUT2 axosomatic terminals on the LG neuron are not known. Neurons in the dorsal cochlear nucleus, superior olivary complex, intermediate nucleus of the lateral lemniscus, and IC itself that express the gene for VGLUT2 only are the likely origin of the dense VGLUT2 axosomatic terminals on LG tectothalamic neurons. The IC is unique since LG neurons are GABAergic tectothalamic neurons in addition to the numerous glutamatergic tectothalamic neurons. SG neurons evidently target other auditory structures. The basic circuit of the IC and the LG neurons in particular, has implications for the transmission of information about sound through the midbrain to the MGB. PMID:22855671

Effects of some organic materials on bicarbonate extractable phosphate content of soils having different pH

Directory of Open Access Journals (Sweden)

Nutullah Özdemir

2016-10-01

Full Text Available This study was carried out to determine the effects of rice husk compost (RC, town waste compost (TW and tobacco waste (TB on bicarbonate extractable phosphate content (P in soils having different pH levels under greenhouse conditions. Soil samples used in this study were taken from surfaces (0-20 cm of agricultural fields around Samsun, Northern Anatolia. The experiment was conducted according to split plot design with four doses of organic matterials (0, 2.5, 5.0 and 7.5, %. After a month of mixing organic matterials into soils, lettuce were grown in the medias. According to the results, RC, TW and TB applications into acidic (Tepecik, neutral (Kampüs and alkaline (Çetinkaya soils increased extractable P content. It was observed that effectiveness of organic matterials changed depend on soil reaction, type and dose of organic matterials. All organic wastes were more effective on increment of bicarbonate extractable phosphate content in neutral soil pH when compared the other soil pH levels.

Effect of Different Organic Wastes on Soil Propertie s and Plant Growth and Yield: a Review

Directory of Open Access Journals (Sweden)

Hossain M. Z.

2017-12-01

Full Text Available The use of organic wastes in agriculture plays a great role in recycling essential plant nutrients, sustaining soil security as well as protecting the environment from unwanted hazards. This review article deals with the effect of different kinds of organic wastes on soil properties and plant growth and yield. Municipal solid waste is mainly used as a source of nitrogen and organic matter, improving soil properties and microbial activity that are closely related to soil fertility. Biowaste and food waste increase pH, nitrogen content, cation exchange capacity, water holding capacity, and microbial biomass in soil. Sewage sludge contains various amounts of organic matter and huge amounts of plant nutrients. Manure is a common waste which improves soil properties by adding nutrients and increases microbial and enzyme activity in soil. It also reduces toxicity of some heavy metals. These organic wastes have a great positive impact on soil physical, chemical, and biological properties as well as stimulate plant growth and thus increase the yield of crops.

Organizing design work

DEFF Research Database (Denmark)

Scheuer, John Damm

2016-01-01

The aim of this paper is to demonstrate the importance of the kind of understanding of organizing that is implied by design theories for project managers' understanding and organizing of design work. Five theories and their organizing consequences for project managers organizing of design work...... are analyzed. The paper contributes to design research and organization studies by putting the organizing of design projects on the research agenda. It also contributes by demonstrating the importance of being aware of the ontological and epistemological assumptions and organizing consequences of different...... design theories. The selected theories of design thus represent different views on what design is, address different design areas and are based on different ontological and epistemological assumptions that influence their views on how design processes should be organized....

[Effect of inorganic fluorine on living organisms of different phylogenetic level].

Science.gov (United States)

Agalakova, N I; Gusev, G P

2011-01-01

The presented review summarizes literature data on pathways of the inorganic fluoride intake into the plant, animal, and human organisms, on its metabolism, distribution, and accumulation in the organism, forms of fluoride in biological tissues, toxic effects of fluoride on physiological and reproductive functions of living organisms of various phylogenetic groups, as well as clinical symptoms of deficient and excessive fluoride intake into the human organism.

Impact on the Fe redox cycling of organic ligands released by Synechococcus PCC 7002, under different iron fertilization scenarios. Modeling approach

Science.gov (United States)

Samperio-Ramos, Guillermo; González-Dávila, Melchor; Santana-Casiano, J. Magdalena

2018-06-01

The kinetics of Fe redox transformations are of crucial importance in determining the bioavailability of iron, due to inorganic Fe(II) and Fe weakly organic complexes being the most easily assimilated species by phytoplankton. The role played by the natural organic ligands excreted by the cyanobacteria Synecococcus PCC 7002 on the iron redox chemistry was studied at different stages of growth, considering changes in the organic exudation of the cyanobacteria, associated with growth under two different scenarios of iron availability. The oxidation/reduction processes of iron were studied at nanomolar levels and under different physicochemical conditions of pH (7.2- 8.2), temperature (5- 35 °C) and salinity (10- 37). The presence of natural organic exudates of Synechococcus affected the redox behavior of iron. A pH-dependent and photo-induced Fe(III) reduction process was detected in the presence of exudates produced under Fe-Low conditions. Photolytic reactions also modified the reactivity of those exudates with respect to Fe(II), increasing its lifetime in seawater. Without light mediated processes, organic ligands excreted under iron deficient conditions intensified the Fe(II) oxidation at pH redox constants between iron and the major ligands present in solution. Two organic type ligands for the exudates of Synechococcus PCC 7002, with different iron-chelation properties were included in the model. The Fe(II) speciation was radically affected when organic ligands were considered. The individual contributions to the overall Fe(II) oxidation rate demonstrated that these organic ligands played a key role in the oxidation process, although their contributions were dependent on the prescribed iron conditions. The study, therefore, suggests that the variability in the composition and nature of organic exudates released, due to iron availability conditions, might determine the redox behaviour of iron in seawater.

Organic vs. conventional grassland management: do (15)N and (13)C isotopic signatures of hay and soil samples differ?

Science.gov (United States)

Klaus, Valentin H; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Fischer, Markus; Kleinebecker, Till

2013-01-01

Distinguishing organic and conventional products is a major issue of food security and authenticity. Previous studies successfully used stable isotopes to separate organic and conventional products, but up to now, this approach was not tested for organic grassland hay and soil. Moreover, isotopic abundances could be a powerful tool to elucidate differences in ecosystem functioning and driving mechanisms of element cycling in organic and conventional management systems. Here, we studied the δ(15)N and δ(13)C isotopic composition of soil and hay samples of 21 organic and 34 conventional grasslands in two German regions. We also used Δδ(15)N (δ(15)N plant - δ(15)N soil) to characterize nitrogen dynamics. In order to detect temporal trends, isotopic abundances in organic grasslands were related to the time since certification. Furthermore, discriminant analysis was used to test whether the respective management type can be deduced from observed isotopic abundances. Isotopic analyses revealed no significant differences in δ(13)C in hay and δ(15)N in both soil and hay between management types, but showed that δ(13)C abundances were significantly lower in soil of organic compared to conventional grasslands. Δδ(15)N values implied that management types did not substantially differ in nitrogen cycling. Only δ(13)C in soil and hay showed significant negative relationships with the time since certification. Thus, our result suggest that organic grasslands suffered less from drought stress compared to conventional grasslands most likely due to a benefit of higher plant species richness, as previously shown by manipulative biodiversity experiments. Finally, it was possible to correctly classify about two third of the samples according to their management using isotopic abundances in soil and hay. However, as more than half of the organic samples were incorrectly classified, we infer that more research is needed to improve this approach before it can be efficiently

Organic vs. Conventional Grassland Management: Do 15N and 13C Isotopic Signatures of Hay and Soil Samples Differ?

Science.gov (United States)

Klaus, Valentin H.; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Fischer, Markus; Kleinebecker, Till

2013-01-01

Distinguishing organic and conventional products is a major issue of food security and authenticity. Previous studies successfully used stable isotopes to separate organic and conventional products, but up to now, this approach was not tested for organic grassland hay and soil. Moreover, isotopic abundances could be a powerful tool to elucidate differences in ecosystem functioning and driving mechanisms of element cycling in organic and conventional management systems. Here, we studied the δ15N and δ13C isotopic composition of soil and hay samples of 21 organic and 34 conventional grasslands in two German regions. We also used Δδ15N (δ15N plant - δ15N soil) to characterize nitrogen dynamics. In order to detect temporal trends, isotopic abundances in organic grasslands were related to the time since certification. Furthermore, discriminant analysis was used to test whether the respective management type can be deduced from observed isotopic abundances. Isotopic analyses revealed no significant differences in δ13C in hay and δ15N in both soil and hay between management types, but showed that δ13C abundances were significantly lower in soil of organic compared to conventional grasslands. Δδ15N values implied that management types did not substantially differ in nitrogen cycling. Only δ13C in soil and hay showed significant negative relationships with the time since certification. Thus, our result suggest that organic grasslands suffered less from drought stress compared to conventional grasslands most likely due to a benefit of higher plant species richness, as previously shown by manipulative biodiversity experiments. Finally, it was possible to correctly classify about two third of the samples according to their management using isotopic abundances in soil and hay. However, as more than half of the organic samples were incorrectly classified, we infer that more research is needed to improve this approach before it can be efficiently used in practice

Short-term effects of different organic amendments on soil chemical, biochemical and biological indicators

Science.gov (United States)

Mondelli, Donato; Aly, Adel; Yirga Dagnachew, Ababu; Piscitelli, Lea; Dumontet, Stefano; Miano, Teodoro

2014-05-01

The limited availability of animal manure and the high cost of good quality compost lead to difficult soil quality management under organic agriculture. Therefore, it is important to find out alternative organic soil amendments and more flexible strategies that are able to sustain crop productivity and maintain and enhance soil quality. A three years study was carried out in the experimental fields of the Mediterranean Agronomic Institute of Bari located in Valenzano, Italy. The main objective of this research is to investigate the effects of different fertility management strategies on soil quality in order to estimate the role of innovative matrices for their use in organic farming. The experiment consists of seven treatments applied to a common crop rotation. The treatments include alternative organic amendments (1- olive mill wastewater OMW, 2- residues of mushroom cultivation MUS, 3- coffee chaff COF), common soil amendments (4- compost COM, 5- faba bean intercropping LEG, 6- cow manure - MAN) and as a reference treatment (7- mineral fertilizer COV). The soil quality was assessed before and after the application of the treatments, through biological (microbial biomass carbon and nitrogen, soil respiration and metabolic quotient), biochemical (soil enzymatic activities: β-glucosidase, alkaline phospatase, urease, fluorescein diacetate (FDA) hydrolysis), and chemical (pH, soil organic carbon, soil organic matter, total nitrogen, available phosphorous, exchangeable potassium, dissolved organic carbon and total dissolved nitrogen) indicators. Based on the results obtained after the second year, all treatments were able to improve various soil chemical parameters as compared to mineral fertilizer. The incorporation of COF and OMW seemed to be more effective in improving soil total N and exchangeable K, while MAN significantly increased available P. All the amendments enhance dissolved organic C, soil respiration, microbial biomass and metabolic quotient as

Assessment of anaerobic biodegradability of five different solid organic wastes

Science.gov (United States)

Kristanto, Gabriel Andari; Asaloei, Huinny

2017-03-01

The concept of waste to energy emerges as an alternative solution to increasing waste generation and energy crisis. In the waste to energy concept, waste will be used to produce renewable energy through thermochemical, biochemical, and physiochemical processes. In an anaerobic digester, organic matter brake-down due to anaerobic bacteria produces methane gas as energy source. The organic waste break-down is affected by various characteristics of waste components, such as organic matter content (C, N, O, H, P), solid contents (TS and VS), nutrients ratio (C/N), and pH. This research aims to analyze biodegradability and potential methane production (CH4) from organic waste largely available in Indonesia. Five solid wastes comprised of fecal sludge, cow rumen, goat farm waste, traditional market waste, and tofu dregs were analyzed which showed tofu dregs as waste with the highest rate of biodegradability compared to others since the tofu dregs do not contain any inhibitor which is lignin, have 2.7%VS, 14 C/N ratios and 97.3% organic matter. The highest cumulative methane production known as Biochemical Methane Potential was achieved by tofu dregs with volume of 77 ml during 30-day experiment which then followed by cow rumen, goat farm waste, and traditional market waste. Subsequently, methane productions were calculated through percentage of COD reduction, which showed the efficiency of 99.1% that indicates complete conversion of the high organic matter into methane.

Does Social Capital Explain Community-Level Differences in Organ Donor Designation?

Science.gov (United States)

Ladin, Keren; Wang, Rui; Fleishman, Aaron; Boger, Matthew; Rodrigue, James R

2015-09-01

The growing shortage of life-saving organs has reached unprecedented levels, with more than 120,000 Americans waiting for them. Despite national attempts to increase organ donation and federal laws mandating the equitable allocation of organs, geographic disparities remain. A better understanding of the contextual determinants of organ donor designation, including social capital, may enhance efforts to increase organ donation by raising the probability of collective action and fostering norms of reciprocity and cooperation while increasing costs to defectors. Because community-level factors, including social capital, predict more than half the variation in donor designation, future interventions should tailor strategies to specific communities as the unit of intervention. The growing shortage of organs has reached unprecedented levels. Despite national attempts to increase donation and federal laws mandating the equitable allocation of organs, their availability and waiting times vary significantly nationwide. Organ donor designation is a collective action problem in public health, in which the regional organ supply and average waiting times are determined by the willingness of individuals to be listed as organ donors. Social capital increases the probability of collective action by fostering norms of reciprocity and cooperation while increasing costs to defectors. We examine whether social capital and other community-level factors explain geographic variation in organ donor designation rates in Massachusetts. We obtained a sample of 3,281,532 registered drivers in 2010 from the Massachusetts Department of Transportation Registry of Motor Vehicles (MassDOT RMV). We then geocoded the registry data, matched them to 4,466 census blocks, and linked them to the 2010 US Census, the American Community Survey (ACS), and other sources to obtain community-level sociodemographic, social capital (residential segregation, voter registration and participation, residential

Do US Consumers’ Perceive Local and Organic Food Differently? An Analysis Based on Means‐End Chain Analysis and Word Association

Directory of Open Access Journals (Sweden)

Rainer Haas

2013-11-01

Full Text Available The market of local and organic food is still a niche market in the USA, despite its strong growth rates. Both offer consumers an alternative to a globalized anonymous food supply chain. Yet local food and organic food seem to beoverlapping and to some degree competing food concepts. While the organic food market somehow has managed to “mature”, being widely distributed in national supermarket chains, local food in the US still seems to be tied to a“grassroots food movement”, being mainly distributed over short food supply chains. With several trends indicating sustained growth for local and organic consumption, this paper first addresses different connotations of local foodand compares them to standard definitions of organic food. The main focus is to explore the perception of US consumers towards local and organic food, using results from two different studies. Both studies use laddering techniques and word association tests, which were undertaken at Cornell University in New York State and at the University of Florida in the city of Gainesville. These findings are used to achieve a better understanding of the image of local and organic food, and the motives and values of local and organic food consumers.

[Characteristics of soil organic carbon and enzyme activities in soil aggregates under different vegetation zones on the Loess Plateau].

Science.gov (United States)

Li, Xin; Ma, Rui-ping; An, Shao-shan; Zeng, Quan-chao; Li, Ya-yun

2015-08-01

In order to explore the distribution characteristics of organic carbon of different forms and the active enzymes in soil aggregates with different particle sizes, soil samples were chosen from forest zone, forest-grass zone and grass zone in the Yanhe watershed of Loess Plateau to study the content of organic carbon, easily oxidized carbon, and humus carbon, and the activities of cellulase, β-D-glucosidase, sucrose, urease and peroxidase, as well as the relations between the soil aggregates carbon and its components with the active soil enzymes were also analyzed. It was showed that the content of organic carbon and its components were in order of forest zone > grass zone > forest-grass zone, and the contents of three forms of organic carbon were the highest in the diameter group of 0.25-2 mm. The content of organic carbon and its components, as well as the activities of soil enzymes were higher in the soil layer of 0-10 cm than those in the 10-20 cm soil layer of different vegetation zones. The activities of cellulase, β-D-glucosidase, sucrose and urease were in order of forest zone > grass zone > forest-grass zone. The peroxidase activity was in order of forest zone > forest-grass zone > grass zone. The activities of various soil enzymes increased with the decreasing soil particle diameter in the three vegetation zones. The activities of cellulose, peroxidase, sucrose and urease had significant positive correlations with the contents of various forms of organic carbon in the soil aggregates.

On the front and back side quantum efficiency differences in semi-transparent organic solar cells and photodiodes

Science.gov (United States)

Bouthinon, B.; Clerc, R.; Verilhac, J. M.; Racine, B.; De Girolamo, J.; Jacob, S.; Lienhard, P.; Joimel, J.; Dhez, O.; Revaux, A.

2018-03-01

The External Quantum Efficiency (EQE) of semi-transparent Bulk Hetero-Junction (BHJ) organic photodiodes processed in air shows significant differences when measured from the front or back side contacts. This difference was found significantly reduced when decreasing the active layer thickness or by applying a negative bias. This work brings new elements to help understanding this effect, providing a large set of experiments featuring different applied voltages, active layers, process conditions, and electron and hole layers. By means of detailed electrical simulations, all these measurements have been found consistent with the mechanisms of irreversible photo-oxidation, modeled as deep trap states (and not as p-type doping). The EQE measurement from front and back sides is thus a simple and efficient way of monitoring the presence and amplitude of oxygen contamination in BHJ organic solar cells and photodiodes.

Cryochemistry: freezing effect on peptide coupling in different organic solutions.

Science.gov (United States)

Vajda, T; Szókán, G; Hollósi, M

1998-06-01

The freezing effect on peptide coupling in organic solutions of different polarity has been investigated and compared with the results obtained in liquid phase. The model reaction of DCC-activated coupling of Boc-Ala-Phe-OH with H-Ala-OBu(t) has been carried out in dioxane, dimethylsulfoxide and formamide, as well as in mixtures (90%/10%, v/v) of dioxane with acetonitrile, dimethylformamide, dimethylsulfoxide and formamide. The reactions have been traced and evaluated by RP-HPLC analysis. Freezing the reaction mixture resulted in all cases in a significant suppression of the N-dipeptidylurea side-product formation together with a slight decrease of tripeptide epimerization. The coupling yields and the side effects depended on the solvent, with the dioxane and dioxane/acetonitrile mixture produced the best results. The role of freezing and solvent in the improved results is discussed.

TRPM5, a taste-signaling transient receptor potential ion-channel, is a ubiquitous signaling component in chemosensory cells

Directory of Open Access Journals (Sweden)

Hofmann Thomas

2007-07-01

Full Text Available Abstract Background A growing number of TRP channels have been identified as key players in the sensation of smell, temperature, mechanical forces and taste. TRPM5 is known to be abundantly expressed in taste receptor cells where it participates in sweet, amino acid and bitter perception. A role of TRPM5 in other sensory systems, however, has not been studied so far. Results Here, we systematically investigated the expression of TRPM5 in rat and mouse tissues. Apart from taste buds, where we found TRPM5 to be predominantly localized on the basolateral surface of taste receptor cells, TRPM5 immunoreactivity was seen in other chemosensory organs – the main olfactory epithelium and the vomeronasal organ. Most strikingly, we found solitary TRPM5-enriched epithelial cells in all parts of the respiratory and gastrointestinal tract. Based on their tissue distribution, the low cell density, morphological features and co-immunostaining with different epithelial markers, we identified these cells as brush cells (also known as tuft, fibrillovesicular, multivesicular or caveolated cells. In terms of morphological characteristics, brush cells resemble taste receptor cells, while their origin and biological role are still under intensive debate. Conclusion We consider TRPM5 to be an intrinsic signaling component of mammalian chemosensory organs, and provide evidence for brush cells being an important cellular correlate in the periphery.

Distribution of tritium in the different organs of calves and pigs after ingestion of various tritiated feeds

International Nuclear Information System (INIS)

Kirchmann, R.; Charles, P.; Bruwaene, R. van; Remy, J.; Koch, G.; Hoek, J. van den

1978-01-01

The studies reported here are related to the distribution of tritium in the organs of farm animals contaminated in various ways. Two young male calves ingested tritiated milk; the daily intake of 3 H-organic form was about 15 μCi for each calf and the total activity ingested until the sacrifice was 482 μCi. Three male pigs from the same litter and about 7 weeks old were used for each experiment of the administration of tritium under different forms. It was verified that the chemical form of 3 H present in the food is of great importance for the incorporation of 3 H in the organic matter of the animal organs. The total incorporation increases by a factor 5.6 when 3 H is ingested as tritiated milkpowder by pigs as compared to HTO and with a factor 15 for calves. When tritiated potatoes were ingested by pigs a factor 15.6 was found. The transfer of 3 H from HTO and milk feed ingested in the organic fraction of organs is lower for pig than for calf. (Auth.)

Role of a Ubiquitously Expressed Receptor in the Vertebrate Olfactory System

Science.gov (United States)

DeMaria, Shannon; Berke, Allison P.; Van Name, Eric; Heravian, Anisa; Ferreira, Todd

2013-01-01

Odorant cues are recognized by receptors expressed on olfactory sensory neurons, the primary sensory neurons of the olfactory epithelium. Odorant receptors typically obey the “one receptor, one neuron” rule, in which the receptive field of the olfactory neuron is determined by the singular odorant receptor that it expresses. Odor-evoked receptor activity across the population of olfactory neurons is then interpreted by the brain to identify the molecular nature of the odorant stimulus. In the present study, we characterized the properties of a C family G-protein-coupled receptor that, unlike most other odorant receptors, is expressed in a large population of microvillous sensory neurons in the zebrafish olfactory epithelium and the mouse vomeronasal organ. We found that this receptor, OlfCc1 in zebrafish and its murine ortholog Vmn2r1, is a calcium-dependent, low-sensitivity receptor specific for the hydrophobic amino acids isoleucine, leucine, and valine. Loss-of-function experiments in zebrafish embryos demonstrate that OlfCc1 is required for olfactory responses to a diverse mixture of polar, nonpolar, acidic, and basic amino acids. OlfCc1 was also found to promote localization of other OlfC receptor family members to the plasma membrane in heterologous cells. Together, these results suggest that the broadly expressed OlfCc1 is required for amino acid detection by the olfactory system and suggest that it plays a role in the function and/or intracellular trafficking of other olfactory and vomeronasal receptors with which it is coexpressed. PMID:24048853

Nucleolar chromatin organization at different activities of soybean root meristematic cell nucleoli.

Science.gov (United States)

Stępiński, Dariusz

2013-06-01

Nucleolar chromatin, including nucleolus-associated chromatin as well as active and inactive condensed ribosomal DNA (rDNA) chromatin, derives mostly from secondary constrictions known as nucleolus organizer regions containing rDNA genes on nucleolus-forming chromosomes. This chromatin may occupy different nucleolar positions being in various condensation states which may imply different rDNA transcriptional competence. Sections of nucleoli originating from root meristematic cells of soybean seedlings grown at 25 °C (the control), then subjected to chilling stress (10 °C), and next transferred again to 25 °C (the recovery) were used to measure profile areas occupied by nucleolar condensed chromatin disclosed with sodium hydroxide methylation-acetylation plus uranyl acetate technique. The biggest total area of condensed chromatin was found in the nucleoli of chilled plants, while the smallest was found in those of recovered plants in relation to the amounts of chromatin in the control nucleoli. The condensed nucleolar chromatin, in the form of different-sized and different-shaped clumps, was mainly located in fibrillar centers. One can suppose that changes of condensed rDNA chromatin amounts might be a mechanism controlling the number of transcriptionally active rDNA genes as the nucleoli of plants grown under these experimental conditions show different transcriptional activity and morphology.

Performance of sulphate- and selenium-reducing biochemical reactors using different ratios of labile to recalcitrant organic materials.

Science.gov (United States)

Mirjafari, Parissa; Baldwin, Susan A

2015-01-01

Successful operation of sulphate-reducing bioreactors using complex organic materials depends on providing a balance between more easily degrading material that achieves reasonable kinetics and low hydraulic retention times, and more slowly decomposing material that sustains performance in the long term. In this study, two organic mixtures containing the same ingredients typical of bioreactors used at mine sites (woodchips, hay and cow manure) but with different ratios of wood (recalcitrant) to hay (labile) were tested in six continuous flow bioreactors treating synthetic mine-affected water containing 600 mg/L of sulphate and 15 μg/L of selenium. The reactors were operated for short (5-6 months) and long (435-450 days) periods of time at the same hydraulic retention time of 15 days. There were no differences in the performance of the bioreactors in terms of sulphate-reduction over the short term, but the wood-rich bioreactors experienced variable and sometimes unreliable sulphate-reduction over the long term. Presence of more hay in the organic mixture was able to better sustain reliable performance. Production of dissolved organic compounds due to biodegradation within the bioreactors was detected for the first 175-230 days, after which their depletion coincided with a crash phase observed in the wood-rich bioreactors only.

Similarities and differences of alkali metal chlorides applied in organic light-emitting diodes

International Nuclear Information System (INIS)

Lü, Zhaoyue; Deng, Zhenbo; Hou, Ying; Xu, Haisheng

2012-01-01

The similarities and differences of alkali metal chlorides (sodium chloride (NaCl), potassium chloride (KCl), rubidium chloride (RbCl) and cesium chloride (CsCl)) applied in organic light-emitting diodes (OLEDs) are investigated. The behavior is similar for the OLEDs with these four chlorides as electron injection layer (EIL). Their maximum luminance and efficiency at 100 mA/cm 2 are within the ranges of 18 550 ± 600 (cd/m 2 ) with an error of 3.23% and 4.09 ± 0.15 (cd/A) within an error of 3.67%, respectively. The similar performance is due to almost identical electron injection barrier for NaCl, KCl, RbCl and CsCl as EIL. Interestingly, the properties are different for devices with chlorides inserted inside tris (8-hydroxyquinoline) aluminum at the position of 20 nm away from aluminum cathode, labeled as NaCl-, KCl-, RbCl- and CsCl- devices. The relation of luminance is CsCl- > RbCl- = KCl- > NaCl-, where “>” and “=” mean “better than” and “the same as”, respectively. And the device efficiencies are decreased from CsCl to NaCl. That is, the sort order of the efficiencies is CsCl- > RbCl- > KCl- > NaCl-. The mechanism is explained by tunneling model in terms of various energy gaps estimated by optical electronegativity of NaCl, KCl, RbCl and CsCl. - Highlights: ► Effects of NaCl, KCl, RbCl and CsCl in organic light-emitting diodes are compared. ► The similar performance is due to almost identical electron injection barrier. ► The different behavior of chlorides inside Alq 3 is explained by tunneling model. ► The different behavior is attributed to various energy gaps of different chlorides. ► The efficiency of device with chlorides inside Alq 3 is decreased from CsCl to NaCl.

An application of DEMATEL technique to find the effect of different factors influencing outsourcing activities in water and switch organization

Directory of Open Access Journals (Sweden)

Fatimah Hemati

2012-10-01

Full Text Available Outsourcing plays an important role on reducing unnecessary activities in any organization and helps focus only on value added activities. Water resource organization in each city is responsible to supply fresh and clean water and dispose switch as efficiently as possible and all citizens normally benefit from these organizations. The proposed model of this paper uses DEMATEL to prioritize 14 different factors influencing on outsourcing activities. The survey was performed from October, 2011 to May, 2012 among employees on work for water resource organization in city of Semnan, Iran. The survey chooses a sample of 92 employees out of 120 people who worked for this organization. Cronbach alpha is calculated as 90%, which is well above the minimum acceptable level. The results of the survey indicate that expediting work process is the most important factor while reducing the cost is considered as the least important factors among 14 different items.

Topological Organization of Functional Brain Networks in Healthy Children: Differences in Relation to Age, Sex, and Intelligence

OpenAIRE

Wu, Kai; Taki, Yasuyuki; Sato, Kazunori; Hashizume, Hiroshi; Sassa, Yuko; Takeuchi, Hikaru; Thyreau, Benjamin; He, Yong; Evans, Alan C.; Li, Xiaobo; Kawashima, Ryuta; Fukuda, Hiroshi

2013-01-01

Recent studies have demonstrated developmental changes of functional brain networks derived from functional connectivity using graph theoretical analysis, which has been rapidly translated to studies of brain network organization. However, little is known about sex- and IQ-related differences in the topological organization of functional brain networks during development. In this study, resting-state fMRI (rs-fMRI) was used to map the functional brain networks in 51 healthy children. We then ...

The fifth leaf and spike organs of barley (Hordeum vulgare L.) display different physiological and metabolic responses to drought stress.

Science.gov (United States)

Hein, Jordan A; Sherrard, Mark E; Manfredi, Kirk P; Abebe, Tilahun

2016-11-09

Photosynthetic organs of the cereal spike (ear) provide assimilate for grain filling, but their response to drought is poorly understood. In this study, we characterized the drought response of individual organs of the barley spike (awn, lemma, and palea) and compared them with a vegetative organ (fifth leaf). Understanding differences in physiological and metabolic responses between the leaf and spike organs during drought can help us develop high yielding cultivars for environments where terminal drought is prevalent. We exposed barley plants to drought by withholding water for 4 days at the grain filling stage and compared changes in: (1) relative water content (RWC), (2) osmotic potential (Ψ s ), (3) osmotic adjustment (OA), (4) gas exchange, and (5) metabolite content between organs. Drought reduced RWC and Ψ s in all four organs, but the decrease in RWC was greater and there was a smaller change in Ψ s in the fifth leaf than the spike organs. We detected evidence of OA in the awn, lemma, and palea, but not in the fifth leaf. Rates of gas exchange declined more rapidly in the fifth leaf than awn during drought. We identified 18 metabolites but, only ten metabolites accumulated significantly during drought in one or more organs. Among these, proline accumulated in all organs during drought while accumulation of the other metabolites varied between organs. This may suggest that each organ in the same plant uses a different set of osmolytes for drought resistance. Our results suggest that photosynthetic organs of the barley spike maintain higher water content, greater osmotic adjustment, and higher rates of gas exchange than the leaf during drought.

Solubility studies of inorganic–organic hybrid nanoparticle photoresists with different surface functional groups

KAUST Repository

Li, Li

2016-01-01

© 2016 The Royal Society of Chemistry. The solubility behavior of Hf and Zr based hybrid nanoparticles with different surface ligands in different concentrations of photoacid generator as potential EUV photoresists was investigated in detail. The nanoparticles regardless of core or ligand chemistry have a hydrodynamic diameter of 2-3 nm and a very narrow size distribution in organic solvents. The Hansen solubility parameters for nanoparticles functionalized with IBA and 2MBA have the highest contribution from the dispersion interaction than those with tDMA and MAA, which show more polar character. The nanoparticles functionalized with unsaturated surface ligands showed more apparent solubility changes after exposure to DUV than those with saturated ones. The solubility differences after exposure are more pronounced for films containing a higher amount of photoacid generator. The work reported here provides material selection criteria and processing strategies for the design of high performance EUV photoresists.

Structure and organic matter under different soil management conditions in the center of Argentina

International Nuclear Information System (INIS)

Bricchi, E.

2004-01-01

In Central Argentina, Cordoba Province, as in different parts of the world, the equilibrium state of soil under natural condition has been modified by both the replacement of natural vegetation and by tillage. With time, these two disturbing factors have led to a new soil state whose main characteristic is an important decrease of chemical, physical and biological soil functions. The degree of these changes is directly related to soil resistance according to soil genesis. The soil organic matter and the structure of the superficial profile of soil are suitable indicators mainly for physical functions. Recently, it became necessary to look for a combination of technologies leading to an energy input throughout conservation tillage systems, soil covering and agro-chemicals which tend to improve soil quality in order to obtain a sustainable production. The removal of natural vegetation and tillage systems have caused the following effects on the first centimetres of soils: A 77 to 80% loss of organic matter during a period of about 80 years. Changes in the water stable aggregates distribution. A 77% loss of large aggregates and a 55% gain of fine aggregates. Our results would indicate that the disturbance level was higher to the natural resistance of soil. The organic carbon content in the first centimetres of soil is increased when all crop stubble remains on the field and conservationist tillage is applied. Conservation tillages are more efficient in the lower position of relief, meaning the beginning of a change of organic matter tendency that would possibly tend to new equilibrium state. On the other hand, the percentage of water stable aggregates would also be increased as consequence of a higher organic carbon content

Does the Organization of Instruction Differ in Charter Schools? Ability Grouping and Students' Mathematics Gains

Science.gov (United States)

Berends, Mark; Donaldson, Kristi

2016-01-01

Background: Although we have learned a good deal from lottery-based and quasi-experimental studies of charter schools, much of what goes on inside of charter schools remains a "black box" to be unpacked. Grounding our work in neoclassical market theory and institutional theory, we examine differences in the social organization of schools…

Comparison of mass balance, energy consumption and cost of composting facilities for different types of organic waste

International Nuclear Information System (INIS)

Zhang Huijun; Matsuto, Toshihiko

2011-01-01

Mass balance, energy consumption and cost are basic pieces of information necessary for selecting a waste management technology. In this study, composting facilities that treat different types of organic waste were studied by questionnaire survey and via a chemical analysis of material collected at the facilities. The mass balance was calculated on a dry weight basis because the moisture content of organic waste was very high. Even though the ratio of bulking material to total input varied in the range 0-65% on a dry basis, the carbon and ash content, carbon/nitrogen ratio, heavy metal content and inorganic nutrients in the compost were clearly influenced by the different characteristics of the input waste. The use of bulking material was not correlated with ash or elemental content in the compost. The operating costs were categorised into two groups. There was some economy of scale for wages and maintenance cost, but the costs for electricity and fuel were proportional to the amount of waste. Differences in operating costs can be explained by differences in the process characteristics.

Metabolic responses of Eisenia fetida after sub-lethal exposure to organic contaminants with different toxic modes of action

Energy Technology Data Exchange (ETDEWEB)

McKelvie, Jennifer R.; Wolfe, David M.; Celejewski, Magda A. [Department of Physical and Environmental Sciences, University of Toronto, 1265 Military Trail Toronto, ON M1C 1A4 (Canada); Alaee, Mehran [Environment Canada, 867 Lakeshore Rd., P.O. Box 5050, Burlington, ON L7R 4A6 (Canada); Simpson, Andre J. [Department of Physical and Environmental Sciences, University of Toronto, 1265 Military Trail Toronto, ON M1C 1A4 (Canada); Simpson, Myrna J., E-mail: myrna.simpson@utoronto.ca [Department of Physical and Environmental Sciences, University of Toronto, 1265 Military Trail Toronto, ON M1C 1A4 (Canada)

2011-12-15

Nuclear magnetic resonance (NMR) - based metabolomics has the potential to identify toxic responses of contaminants within a mixture in contaminated soil. This study evaluated the metabolic response of Eisenia fetida after exposure to an array of organic compounds to determine whether contaminant-specific responses could be identified. The compounds investigated in contact tests included: two pesticides (carbaryl and chlorpyrifos), three pharmaceuticals (carbamazephine, estrone and caffeine), two persistent organohalogens (Aroclor 1254 and PBDE 209) and two industrial compounds (nonylphenol and dimethyl phthalate). Control and contaminant-exposed metabolic profiles were distinguished using principal component analysis and potential contaminant-specific biomarkers of exposure were found for several contaminants. These results suggest that NMR-based metabolomics offers considerable promise for differentiating between the different toxic modes of action (MOA) associated with sub-lethal toxicity to earthworms. - Highlights: > NMR-based earthworm metabolomic analysis of the toxic mode of action of various environmental contaminants. > Organic chemicals with different toxic modes of action resulted in varied metabolomic responses for E. fetida. > NMR-based metabolomics differentiates between the different modes of action associated with sub-lethal toxicity. - {sup 1}H NMR metabolomics was used to identify potential biomarkers of organic contaminant exposure in Eisenia fetida earthworms.

Tritium ingestion as organically bound tritium (OBT) - incorporation in different organs of pregnant and non-pregnant rats

International Nuclear Information System (INIS)

Bhatia, A.L.; Pollaris, K.; Vandecasteele, C.M.; Kowalska, M.

1998-01-01

For a better understanding of the hazard of tritium, its bound form in the food constituents (organically bound tritium (OBT)) has not been investigated though study on tritiated water are many. Hence an evaluation of the uptake of tritium incorporated in basic constituents of food viz, proteins, carbohydrates and lipids is warranted. Present study cells with the incorporated three organically bound tritium components separated from tritiated milk powder (casein, butter and lactose). This is further compared in the organs of pregnant (after parturition) and non-pregnant rats

Acidity and origin of dissolved organic carbon in different vegetation zones

Science.gov (United States)

Hruška, Jakub; Oulehle, Filip; Myška, Oldřích; Chuman, Tomáš

2016-04-01

The acid/base character of aquatic dissolved organic carbon (DOC) has been studied intensively during recent decades with regard to the role of DOC in stream water acidity and the balance between natural acidity and anthropogenic acidification. Recently, DOC has been shown to play an important role in preindustrial surface waters. Studies focused on the acid/base properties of DOC have been carried out in mainly in Europe and North America and paint a conflicting picture. Some studies reported large differences in acid base properties, sometimes between quite similar and nearby localities, or between seasons at the same site. Other studies, however, found similar acid/base properties in waters from a variety of sites, sometimes far from each other as well as stable acid/base properties at the same site through different seasons or runoff events. Site density of DOC (amount of carboxylic groups per milligram of DOC) and SUVA was measured for streams (or small tundra ponds respectively) from the tundra in northern Alaska, boreal zone of Sweden, western Czech Republic (temperate region), and tropical Congo rain forest in central Africa. At least 10 samples from each region were taken from surface waters during the growing season. Titration of carboxylic groups after proton saturation on cation-exchange resin was used for site density determination. Despite very different climatic and vegetation properties and internal variation within a region, there was no statistically significant difference among regions for site density (it varied between 10.2-10.5 ueq/mg DOC) as well as for SUVA (tested by ANOVA). Results suggest that different vegetation and climate produced generally the same DOC in respect of acid/base character and SUVA. It also suggests that use of the one analytical technique was more important than differences between climatic zones itself.

[Effects of different organic fertilizers on the microbes in rhizospheric soil of flue-cured tobacco].

Science.gov (United States)

Zhang, Yun-Wei; Xu, Zhi; Tang, Li; Li, Yan-Hong; Song, Jian-Qun; Xu, Jian-Qin

2013-09-01

A field experiment was conducted to study the effects of applying different organic fertilizers (refined organic fertilizer and bio-organic fertilizer) and their combination with 20% reduced chemical fertilizers on the microbes in rhizospheric soil of flue-cured tobacco, the resistance of the tobacco against bacterial wilt, and the tobacco yield and quality. As compared with conventional chemical fertilization (CK), applying refined organic fertilizer (ROF) or bio-organic fertilizer (BIO) in combining with 20% reduced chemical fertilization increased the bacterial number and the total microbial number in the rhizospheric soil significantly. Applying BIO in combining with 20% reduced chemical fertilization also increased the actinomyces number in the rhizospheric soil significantly, with an increment of 44.3% as compared with that under the application of ROF in combining with 20% reduced chemical fertilization, but decreased the fungal number. As compared with CK, the ROF and BIO increased the carbon use capacity of rhizospheric microbes significantly, and the BIO also increased the capacity of rhizospheric microbes in using phenols significantly. Under the application of ROF and BIO, the disease incidence and the disease index of bacterial wilt were decreased by 4% and 8%, and 23% and 15.9%, and the proportions of high grade tobacco leaves increased significantly by 10.5% and 9.7%, respectively, as compared with those in CK. BIO increased the tobacco yield and its output value by 17.1% and 18.9% , respectively, as compared with ROF.

Ecotoxicological assessment of glyphosate-based herbicides: Effects on different organisms.

Science.gov (United States)

de Brito Rodrigues, Laís; de Oliveira, Rhaul; Abe, Flávia Renata; Brito, Lara Barroso; Moura, Diego Sousa; Valadares, Marize Campos; Grisolia, Cesar Koppe; de Oliveira, Danielle Palma; de Oliveira, Gisele Augusto Rodrigues

2017-07-01

Glyphosate-based herbicides are the most commonly used worldwide because they are effective and relatively nontoxic to nontarget species. Unlimited and uncontrolled use of such pesticides can have serious consequences for human health and ecological balance. The present study evaluated the acute toxicity and genotoxicity of 2 glyphosate-based formulations, Roundup Original (Roundup) and Glyphosate AKB 480 (AKB), on different organisms: cucumber (Cucumis sativus), lettuce (Lactuca sativa), and tomato (Lycopersicon esculentum) seeds, and microcrustacean Artemia salina and zebrafish (Danio rerio) early life stages. For the germination endpoint, only L. esculentum presented significant sensitivity to AKB and L. sativa to Roundup, whereas both formulations significantly inhibited the root growth of all species tested. Both AKB and Roundup induced significant toxicity to A. salina; both are classified as category 3, which indicates a hazard for the aquatic environment, according to criteria of the Globally Harmonized Classification System. However, Roundup was more toxic than AKB, with 48-h median lethal concentration (LC50) values of 14.19 mg/L and 37.53 mg/L, respectively. For the embryo-larval toxicity test, Roundup proved more toxic than AKB for the mortality endpoint (96-h LC50 values of 10.17 mg/L and 27.13 mg/L, respectively), whereas for the hatching parameter, AKB was more toxic than Roundup. No significant genotoxicity to zebrafish larvae was found. We concluded that AKB and Roundup glyphosate-based formulations are phytotoxic and induce toxic effects in nontarget organisms such as A. salina and zebrafish early life stages. Environ Toxicol Chem 2017;36:1755-1763. © 2016 SETAC. © 2016 SETAC.

The effect of radiofrequency ablation on different organs: Ex vivo and in vivo comparative studies

Energy Technology Data Exchange (ETDEWEB)

Kim, Yoo Na [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Rhim, Hyunchul, E-mail: rhimhc@skku.edu [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of); Choi, Dongil; Kim, Young-sun; Lee, Min Woo; Chang, Ilsoo; Lee, Won Jae; Lim, Hyo K. [Department of Radiology and Center for Imaging Science, Samsung Medical Center, Sungkyunkwan University School of Medicine, 50 Ilwon-dong, Kangnam-Ku, Seoul 135-710 (Korea, Republic of)

2011-11-15

Objective: The purposes of this study are to evaluate the ex vivo and in vivo efficacy of radiofrequency ablation (RFA) on different porcine tissues by the ablation of three different sites simultaneously. Materials and methods: A multichannel RFA system, enables three separate tumors to be ablated simultaneously, was used. RFA procedures were applied to normal porcine liver, kidney, and muscle together ex vivo (n = 12) and in vivo (n = 17). Pre-impedances, defined as baseline systemic impedances of tissues before beginning RFA, and the areas of ablation zones were measured and compared. Results: The areas of ablation zones among three organs had a significant difference in decreasing order as follows: liver, muscle, and kidney in the ex vivo study (p = 0.001); muscle, liver, and kidney in the in vivo study (p < 0.0001). The areas of ablation zones between ex vivo and in vivo had a significant difference in the liver and muscle (each p < 0.05). There was no significant correlation between the areas of ablation zones and pre-impedances in both studies. Conclusions: Renal RFA produced the smallest ablation zone in both in vivo and ex vivo studies. Muscular RFA demonstrated the largest ablation zone in the in vivo study, and hepatic RFA showed the largest ablation zone in the ex vivo study. This variability in the tissues should be considered for performing an optimized RFA for each organ site.

Communication, Relationships, and Religious Difference in the Northern Ireland Workplace: A Study of Private and Public Sector Organizations

Science.gov (United States)

Dickson, David; Hargie, Owen; Wilson, Noel

2008-01-01

Four large organizations, two each from the private and public sectors of the Northern Ireland economy, were selected for this study which, first, explored the effects of religion-based workforce difference on intergroup relationships, second, investigated the contribution of organizational sector to communicative differences, and third, gauged…

Evaporation behaviour of different organic effluents from open surfaces.

Science.gov (United States)

Jhorar, B S; Malik, R S

1993-01-01

Production of large quantities of effluents from different industrial units and the problems of their disposal necessitated this evaporation study. The evaporation of water, sewage water, oil refinery effluent, papermill effluent and liquor distillery effluent was observed in glass beakers when placed (i) in an oven at 60 degrees C and (ii) in screen house for 30 days, by periodically weighing of the beakers. In other experiments, the effect of increasing the frequency of stirring on increasing the evaporation efficiency of the liquor distillery effluent (ELD) was examined in detail. All of the organic effluents except ELD had similar evaporation behaviours as water, but formation of a self-forming film caused the evaporation of ELD to be considerably lower. Resistance to evaporation caused by this film was found to be a decreasing function of the frequency of stirring. This study has a bearing on improving the efficiency of evaporation lagoons, and three stirrings in a day with a manually drawn stirrer in a full-scale lagoon are proposed as a practical and economically viable technique to save 44% of lagoon land in arid and semi-arid regions of the world.

Organic food consumption during pregnancy is associated with different consumer profiles, food patterns and intake: the KOALA Birth Cohort Study.

Science.gov (United States)

Simões-Wüst, Ana Paula; Moltó-Puigmartí, Carolina; van Dongen, Martien Cjm; Dagnelie, Pieter C; Thijs, Carel

2017-08-01

To find out how the consumption of organic food during pregnancy is associated with consumer characteristics, dietary patterns and macro- and micronutrient intakes. Cross-sectional description of consumer characteristics, dietary patterns and macro- and micronutrient intakes associated with consumption of organic food during pregnancy. Healthy, pregnant women recruited to a prospective cohort study at midwives' practices in the southern part of the Netherlands; to enrich the study with participants adhering to alternative lifestyles, pregnant women were recruited through various specific channels. Participants who filled in questionnaires on food frequency in gestational week 34 (n 2786). Participant groups were defined based on the share of organic products within various food types. Consumers of organic food more often adhere to specific lifestyle rules, such as vegetarianism or anthroposophy, than do participants who consume conventional food only (reference group). Consumption of organic food is associated with food patterns comprising more products of vegetable origin (soya/vegetarian products, vegetables, cereal products, bread, fruits, and legumes) and fewer animal products (milk and meat), sugar and potatoes than consumed in conventional diets. These differences translate into distinct intakes of macro- and micronutrients, including higher retinol, carotene, tocopherol and folate intakes, lower intakes of vitamin D and B12 and specific types of trans-fatty acids in the organic groups. These differences are seen even in groups with low consumption of organic food. Various consumer characteristics, specific dietary patterns and types of food intake are associated with the consumption of organic food during pregnancy.

Different molecular organization of two carotenoids, lutein and zeaxanthin, in human colon epithelial cells and colon adenocarcinoma cells

Science.gov (United States)

Grudzinski, Wojciech; Piet, Mateusz; Luchowski, Rafal; Reszczynska, Emilia; Welc, Renata; Paduch, Roman; Gruszecki, Wieslaw I.

2018-01-01

Two cell lines, human normal colon epithelial cells (CCD 841 CoTr) and human colon adenocarcinoma cells (HT-29) were cultured in the presence of exogenous carotenoids, either zeaxanthin or lutein. Both carotenoids demonstrated cytotoxicity with respect to cancer cells but not to normal cells. Cells from both the cell lines were analyzed with application of fluorescence lifetime imaging microscopy and Raman scattering microscopy. Both imaging techniques show effective incorporation of carotenoid molecules into growing cells. Comparison of the Raman scattering and fluorescence lifetime characteristics reveals different molecular organization of carotenoids in the carcinoma and normal cells. The main difference consists in a carotenoid aggregation level which is substantially lower in the carcinoma cells as compared to the normal cells. Different molecular organization of carotenoids was interpreted in terms of a different metabolism of normal and carcinoma cells and has been concluded to provide a possibility of cancer diagnosis based on spectroscopic analyses.

Study of the influence of different organic pollutants on Cu accumulation by Halimione portulacoides

Science.gov (United States)

Almeida, C. Marisa R.; Claúdia Dias, A.; Mucha, Ana P.; Bordalo, A. A.; Vasconcelos, M. Teresa S. D.

2009-12-01

The influence of each of four organic pollutants selected from among those commonly found in coastal areas, 1,1-dichloro-2,2-bis(p-chlorophenyl) ethylene (DDE), monobutyltin (MBT), Triton X-100 and polycyclic aromatic hydrocarbons (PAHs), on Cu accumulation by Halimione portulacoides was investigated. Experiments were carried out in a laboratory setting, either in hydroponics (sediment elutriate) or in a salt marsh sediment ( Cávado River, NW Portugal) soaked in elutriate. Groups of H. portulacoides were exposed to media for 6 days spiked with 10 mg/L Cu(II) and with one of the selected pollutants, at an environmentally realistic concentration. DDE and MBT did not cause any major change on Cu accumulation by H. portulacoides, whereas PAHs slightly increased accumulation only in hydroponics i.e. in the absence of sediment. On the other hand, the non-ionic surfactant Triton X-100 markedly favoured Cu accumulation on plant roots both in the presence and absence of sediment. The addition of DDE, MBT and Triton X-100 also favoured Cu solubility from sediments. Therefore, the simultaneous presence of pollutants from different nature (inorganic and organic) in the estuarine environment may result in a composition of water column, pore water, sediment or biota different of that expected considering the effect of each individual pollutant.

Organic carbon stocks in Mediterranean soil types under different land uses (Southern Spain)

Energy Technology Data Exchange (ETDEWEB)

Munoz-Rojas, M. [CSIC Spin-off, Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain). Evenor-Tech; Sevilla Univ. (Spain). MED Soil Research Group; Jordan, A.; Zavala, L.M. [Sevilla Univ. (Spain). MED Soil Research Group; Rosa, D. de la [Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain); Abd-Elmabod, S.K. [Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain); National Research Centre, Cairo (Egypt). Dept. of Soil and Water Use; Anaya-Romero, M. [CSIC Spin-off, Instituto de Recursos Naturales y Agrobiologia de Sevilla (CSIC), Seville (Spain). Evenor-Tech

2012-07-01

Soil C sequestration through changes in land use and management is one of the sustainable and long-term strategies to mitigate climate change. This research explores and quantifies the role of soil and land use as determinants of the ability of soils to store C along Mediterranean systems. Detailed studies of soil organic C (SOC) dynamics are necessary in order to identify factors determining fluctuations and intensity of changes. In this study, SOC contents from different soil and land use types have been investigated in Andalusia (Southern Spain). We have used soil information from different databases, as well as land use digital maps, climate databases and digital elevation models. The average SOC content for each soil control section (0-25, 25-50 and 50-75 cm) was determined and SOC stocks were calculated for each combination of soil and land use type, using soil and land cover maps. The total organic C stocks in soils of Andalusia is 415 Tg for the upper 75 cm, with average values ranging from 15.9 MgC ha{sup -1} (Solonchaks under ''arable land'') to 107.6 MgC ha{sup -1} (Fluvisols from ''wetlands''). Up to 55% of SOC accumulates in the top 25 cm of soil (229.7 Tg). This research constitutes a preliminary assessment for modelling SOC stock under scenarios of land use and climate change. (orig.)

Aging, neurogenesis, and caloric restriction in different model organisms.

Science.gov (United States)

Arslan-Ergul, Ayca; Ozdemir, A Tugrul; Adams, Michelle M

2013-08-01

Brain aging is a multifactorial process that is occurring across multiple cognitive domains. A significant complaint that occurs in the elderly is a decrement in learning and memory ability. Both rodents and zebrafish exhibit a similar problem with memory during aging. The neurobiological changes that underlie this cognitive decline are complex and undoubtedly influenced by many factors. Alterations in the birth of new neurons and neuron turnover may contribute to age-related cognitive problems. Caloric restriction is the only non-genetic intervention that reliably increases life span and healthspan across multiple organisms although the molecular mechanisms are not well-understood. Recently the zebrafish has become a popular model organism for understanding the neurobiological consequences but to date very little work has been performed. Similarly, few studies have examined the effects of dietary restriction in zebrafish. Here we review the literature related to memory decline, neurogenesis, and caloric restriction across model organisms and suggest that zebrafish has the potential to be an important animal model for understanding the complex interactions between age, neurobiological changes in the brain, and dietary regimens or their mimetics as interventions.

Computer ranking of the sequence of appearance of 40 features of the brain and related structures in staged human embryos during the seventh week of development.

Science.gov (United States)

O'Rahilly, R; Müller, F; Hutchins, G M; Moore, G W

1988-08-01

The sequence of events in the development of the brain in human embryos, already published for stages 8-17, is here continued for stages 18 and 19. With the aid of a computerized bubble-sort algorithm, 58 individual embryos were ranked in ascending order of the features present. The increasing structural complexity provided 40 new features in these two stages. The chief characteristics of stage 18 (approximately 44 postovulatory days) are rapidly growing basal nuclei; appearance of the extraventricular bulge of the cerebellum (flocculus), of the superior cerebellar peduncle, and of follicles in the epiphysis cerebri; and the presence of vomeronasal organ and ganglion, of the bucconasal membrane, and of isolated semicircular ducts. The main features of stage 19 (approximately 48 days) are the cochlear nuclei, the ganglion of the nervus terminalis, nuclei of the prosencephalic septum, the appearance of the subcommissural organ, the presence of villi in the choroid plexuses of the fourth and lateral ventricles, and the stria medullaris thalami.

IMPORTANCE OF DIFFERENT MODELS IN DECISION MAKING, EXPLAINING THE STRATEGIC BEHAVIOR IN ORGANIZATIONS

Directory of Open Access Journals (Sweden)

Cristiano de Oliveira Maciel

2006-11-01

Full Text Available This study is about the different models of decision process analyzing the organizational strategy. The article presents the strategy according to a cognitive approach. The discussion about that approach has three models of decision process: rational actor model, organizational behavior, and political model. These models, respectively, present some improvement in the decision making results, search for a good decision facing the cognitive restrictions of the administrator, and lots of talks for making a decision. According to the emphasis of each model, the possibilities for analyzing the strategy are presented. The article also shows that it is necessary to take into account the three different ways of analysis. That statement is justified once the analysis as well as the decision making become more complex, mainly those which are more important for the organizations.

Organic matter characterization during the anaerobic digestion of different biomasses by means of CPMAS 13C NMR spectroscopy

International Nuclear Information System (INIS)

Tambone, Fulvia; Adani, Fabrizio; Gigliotti, Giovanni; Volpe, Daniela; Fabbri, Claudio; Provenzano, Maria Rosaria

2013-01-01

The aim of this work was to characterize ingestates and their corresponding digestates obtained in two full-scale biogas production plants processing a) mixtures of organic wastes in co-digestion, and b) pig slurry in order to assess the organic matter transformation during anaerobic digestion by means of chemical analysis and 13 CPMAS-NMR spectroscopy. Results proved that digestates obtained by different organic substrates exhibited significant chemical differences related to the different initial composition of substrates. We proposed the use of the aliphaticity index in order to highlight the different chemical nature of ingestates and their corresponding digestates. In order to verify whether the AD process leads to stabilized final products regardless the initial composition of biomass in view of a possible agronomical use of digestate, a comparison of CPMAS 13 C NMR data of a number of ingestates and digestates available in literature was carried out. Results indicated that most of the aromatic structures present in the substrate tend to degrade during the process and that anaerobic digestion proceeds through preferential degradation of carbohydrates such as cellulose and hemicellulose and, as a consequence, concentration of more chemically recalcitrant aliphatic molecules occurs. -- Highlights: ► We studied anaerobic digestion by means of chemical analysis and 13 CPMAS-NMR spectroscopy. ► Significant chemical differences in digestates were highlighted. ► We proposed the use of the aliphaticity index in order to differentiate digestates. ► Most of the aromatic structures tend to degrade. ► Carbohydrates are degraded and recalcitrant aliphatic molecules concentrate

Organic and inorganic speciation of particulate matter formed during different combustion phases in an improved cookstove.

Science.gov (United States)

Leavey, Anna; Patel, Sameer; Martinez, Raul; Mitroo, Dhruv; Fortenberry, Claire; Walker, Michael; Williams, Brent; Biswas, Pratim

2017-10-01

Residential solid fuel combustion in cookstoves has established health impacts including bladder and lung cancers, cataracts, low birth weight, and pneumonia. The chemical composition of particulate matter (PM) from 4 commonly-used solid fuels (coal, dung, ambient/dry applewood, and oakwood pellets), emitted from a gasifier cookstove, as well as propane, were examined. Temporal changes between the different cookstove burn-phases were also explored. Normalized concentrations of non-refractory PM 1 , total organics, chloride, ammonium, nitrate, sulfate, and 41 particle-phase polycyclic aromatic hydrocarbons (PAHs) were measured using a High-Resolution Time-of-Flight Aerosol Mass Spectrometer (HR-ToF-AMS) and a Thermal desorption Aerosol Gas chromatograph (TAG), respectively. Coal demonstrated the highest fraction of organic matter in its particulate emission composition (98%), followed by dung (94%). Coal and dung also demonstrated the highest numbers and concentrations of PAHs. While dry applewood emitted ten times lower organic matter compared to ambient applewood, a higher fraction of these organics was composed of PAHs, especially the more toxic ones such as benzo(a)pyrene (9.63ng/L versus 0.04ng/L), and benzo(b)fluoranthene (31.32ng/L versus 0.19ng/L). Data from the AMS demonstrated no clear trends for any of the combustion fuels over the different combustion phases unlike the previously reported trends observed for the physical characteristics. Of the solid fuels, pellets demonstrated the lowest emissions. Emissions from propane were below the quantification limit of the instruments. This work highlights the benefits of incorporating additional metrics into the cookstove evaluation process, thus enriching the existing PM data inventory. Copyright © 2017. Published by Elsevier Inc.

Metabolic responses of Eisenia fetida after sub-lethal exposure to organic contaminants with different toxic modes of action

International Nuclear Information System (INIS)

McKelvie, Jennifer R.; Wolfe, David M.; Celejewski, Magda A.; Alaee, Mehran; Simpson, Andre J.; Simpson, Myrna J.

2011-01-01

Nuclear magnetic resonance (NMR) - based metabolomics has the potential to identify toxic responses of contaminants within a mixture in contaminated soil. This study evaluated the metabolic response of Eisenia fetida after exposure to an array of organic compounds to determine whether contaminant-specific responses could be identified. The compounds investigated in contact tests included: two pesticides (carbaryl and chlorpyrifos), three pharmaceuticals (carbamazephine, estrone and caffeine), two persistent organohalogens (Aroclor 1254 and PBDE 209) and two industrial compounds (nonylphenol and dimethyl phthalate). Control and contaminant-exposed metabolic profiles were distinguished using principal component analysis and potential contaminant-specific biomarkers of exposure were found for several contaminants. These results suggest that NMR-based metabolomics offers considerable promise for differentiating between the different toxic modes of action (MOA) associated with sub-lethal toxicity to earthworms. - Highlights: → NMR-based earthworm metabolomic analysis of the toxic mode of action of various environmental contaminants. → Organic chemicals with different toxic modes of action resulted in varied metabolomic responses for E. fetida. → NMR-based metabolomics differentiates between the different modes of action associated with sub-lethal toxicity. - 1 H NMR metabolomics was used to identify potential biomarkers of organic contaminant exposure in Eisenia fetida earthworms.

Characterisation of volatile organic compounds (VOCs) released by the composting of different waste matrices.

Science.gov (United States)

Schiavon, Marco; Martini, Luca Matteo; Corrà, Cesare; Scapinello, Marco; Coller, Graziano; Tosi, Paolo; Ragazzi, Marco

2017-12-01

The complaints arising from the problem of odorants released by composting plants may impede the construction of new composting facilities, preclude the proper activity of existing facilities or even lead to their closure, with negative implications for waste management and local economy. Improving the knowledge on VOC emissions from composting processes is of particular importance since different VOCs imply different odour impacts. To this purpose, three different organic matrices were studied in this work: dewatered sewage sludge (M1), digested organic fraction of municipal solid waste (M2) and untreated food waste (M3). The three matrices were aerobically biodegraded in a bench-scale bioreactor simulating composting conditions. A homemade device sampled the process air from each treatment at defined time intervals. The samples were analysed for VOC detection. The information on the concentrations of the detected VOCs was combined with the VOC-specific odour thresholds to estimate the relative weight of each biodegraded matrix in terms of odour impact. When the odour formation was at its maximum, the waste gas from the composting of M3 showed a total odour concentration about 60 and 15,000 times higher than those resulting from the composting of M1 and M2, respectively. Ethyl isovalerate showed the highest contribution to the total odour concentration (>99%). Terpenes (α-pinene, β-pinene, p-cymene and limonene) were abundantly present in M2 and M3, while sulphides (dimethyl sulphide and dimethyl disulphide) were the dominant components of M1. Copyright © 2017 Elsevier Ltd. All rights reserved.

Different Analytical Procedures for the Study of Organic Residues in Archeological Ceramic Samples with the Use of Gas Chromatography-mass Spectrometry.

Science.gov (United States)

Kałużna-Czaplińska, Joanna; Rosiak, Angelina; Kwapińska, Marzena; Kwapiński, Witold

2016-01-01

The analysis of the composition of organic residues present in pottery is an important source of information for historians and archeologists. Chemical characterization of the materials provides information on diets, habits, technologies, and original use of the vessels. This review presents the problem of analytical studies of archeological materials with a special emphasis on organic residues. Current methods used in the determination of different organic compounds in archeological ceramics are presented. Particular attention is paid to the procedures of analysis of archeological ceramic samples used before gas chromatography-mass spectrometry. Advantages and disadvantages of different extraction methods and application of proper quality assurance/quality control procedures are discussed.

Adsorption of ionizable organic contaminants on multi-walled carbon nanotubes with different oxygen contents

International Nuclear Information System (INIS)

Li Xiaona; Zhao Huimin; Quan Xie; Chen Shuo; Zhang Yaobin; Yu Hongtao

2011-01-01

Multi-walled carbon nanotubes (MWNTs), which are considered to be promising candidates for the adsorption of toxic organics, are released into aqueous environment with their increasing production and application. In this study, the adsorption behaviors of five structurally related ionizable organic contaminants namely perfluorooctane sulfonate (PFOS), perfluorooctanoic acid (PFOA), perfluorooctanesulfonamide (PFOSA), 2,4-dichlorophenoxyacetic acid (2,4-D) and 4-n-nonylphenol (4-NP) onto MWNTs with different oxygen contents (3.84-22.85%) were investigated. The adsorption kinetics was investigated and simulated with pseudo-second-order model. The adsorption isotherms were found to be fitted with Freundlich model and influenced by both the properties of organic chemicals and the oxygen contents of MWNTs. As adsorption capacity decreases dramatically with the increasing of oxygen contents, the MWNTs with the lowest oxygen contents possess the highest adsorption capacity among four MWNTs. For the MWNTs with the oxygen contents of 3.84%, the adsorption affinity related with hydrophobic interaction and π-electron polarizability decreased in the order of 4-NP > PFOSA > PFOS > 2,4-D > PFOA. Furthermore, the adsorption characters of five contaminants were affected by solution pH and solute pK a considering electrostatic repulse force and hydrogen bonding, which showed the adsorption of MWNTs with lower oxygen content is much sensitive to solution chemistry.

Investigation on I-V for Different Heating Temperatures of Nanocomposited MEH-PPV:CNTs Organic Solar Cells

Directory of Open Access Journals (Sweden)

M. S. P. Sarah

2012-01-01

Full Text Available This paper discussed the effect of different thermal evaporation treatments for nanocomposited MEH-PPV:CNTs thin films towards the performance of organic solar cells. The configuration of the organic solar cells is ITO/MEH-PPV:CNTs/Au. The heating temperature was varied from, as deposited, 50°C, 75°C, and 100°C. From the results, we observed that the efficiency increase slightly before decreasing back at 100°C. The highest efficiency was solar cells heated at 75°C with efficiency 0.001% which is supported by the I-V characteristics and also by the absorption spectra.

Different ways to organize the processes of financial administration : a field study of medium-sized Finnish companies

OpenAIRE

Nummela, Maria

2011-01-01

This research concentrates on exploring the ways how financial administration is currently organized in medium-sized companies in Finland. Decentralization, centralization and outsourcing are options that are available to different-sized companies. The study was executed as a field study in seven medium-sized Finnish companies that represent different branches. Furthermore, the research method was qualitative theme interview. As large companies have already established their financial service...

[Effects of Different Kinds of Organic Materials on Soil Heavy Metal Phytoremediation Efficiency by Sedum alfredii Hance].

Science.gov (United States)

Yao, Gui-hua; Xu, Hai-zhou; Zhu, Lin-gang; Ma, Jia-wei; Liu, Dan; Ye, Zheng-qian

2015-11-01

In this study, a pot experiment was conducted to investigate the effect of clean organic materials i. e., biogas residue (BR), mushroom residue (MR), and bamboo shell (BS) on phytoextraction remediation of two heavy metal contaminated soils (collected from Wenzhou and Fuyang, which referred to "Wenzhou soil" and "Fuyang soil", respectively.) using a cadmium (Cd) and zinc (Zn) hyperaccumulator Sedum alfredii Hance. The results indicated that the effects of organic materials on availabilities of soil heavy metals were different due to different kinds of heavy metals, organic materials, and the application rates of the organic materials. Addition with 5% BR showed the greatest activation to copper (Cu), Zn in Wenzhou soil, and in Fuyang soil 1% BS had the highest activation for Cu, Zn, lead ( Ph) and Cd. Growth of shoot biomass of Sedum alfredii Hance increased with the addition rate of organic materials, and the plant dry weights were increased by 23.7%-93.0%. In Wenzhou soil, only 1% BS treatment had the best effect on Cd uptake and accumulation in shoots of Sedum alfredii Hance, increased by 22.6%, while other treatments were inferior to the control. For Zn, MR treatments were inferior to the control, while other treafments were superior to the control, of which 5% BR, 1% BS and 5% BS exceeded the control by 39. 6%, 32.6% and 23.8%, respectively. In Fuyang soil, for Cd, the treatment effects of 5% BS, 1% BR and 5% BR were the greatest, of which Cd accumulation in shoots exceeded the control by 12.9%, 12.8% and 6.2%, respectively, while Cd accumulations in shoots in all other treatments were less than that of control. For Zn, the treatments of adding organic materials promoted Zn accumulation in shoots of Sedum alfredii Hance, and the best treatments were as follows: 5% BS. 5% BR and 5% MR, exceeded the control by 38.4%, 25.7% and 22.4%, respectively.

Characterization of nonstarch polysaccharides content from different edible organs of some vegetables, determined by GC and HPLC: comparative study.

Science.gov (United States)

Villanueva-Suárez, M J; Redondo-Cuenca, A; Rodríguez-Sevilla, M D; de las Heras Martínez, M

2003-09-24

Content and composition of dietary fiber as nonstarch polysaccharides (NSP) was determined in vegetables belonging to different types of edible organs, using GC and HPLC. Samples analyzed were subterranean organs (radish and leek), leaves (celery, swiss chard, and lettuce), stalks (celery, swiss chard, and asparagus), inflorescence (broccoli), and fruits (tomato, green pepper, and marrow). The results indicate that though the monomeric profile is similar in all these samples quantitative differences were found for neutral sugars and uronic acids among samples of the same type of vegetal organ. The NSP values determined using CG method were in good agreement with HPLC method (R(2) = 0.9005). However, arabinose, mannose, and galactose plus rhamnose are more influenced by the analytical method used than the rest of the monomers in nearly all the samples analyzed. Final values of NSP depend on the method used in celery stalks, broccoli, and green pepper.

Orientation on electron transport system activity measurement in different organisms (training for Indonesian-Dutch Snellius II-expedition in 1984-1985)

NARCIS (Netherlands)

Ruyitno; Pauptit, E.; Vosjan, J.H.

1984-01-01

Preliminary experiments about ETS-activity were done in different organisms and different ecosystems; a vertebrate, an invertebrate, yeast, bacteria, methane forming consortia, suspended matter and sediment. It proved that the method is useful for the different systems but research has to be done

EFFECT OF DIFFERENT TYPES AND LEVELS OF ORGANIC ...

African Journals Online (AJOL)

DR. AMINU

2014-06-01

Jun 1, 2014 ... 10.0 tons/ha) of three types of organic manures (poultry droppings (P.D), farm yard manure (FYM) and cow dung (CD) laid out in a ... spread to all parts of the world and is widely grown in. India, Philippines, China, Ethiopia, Kenya ..... Sokoto Rima Valley Journal of Sustainable. Development in Agriculture & ...

Production of camu camu plants with different organic substrates in conventional nursery bed

Directory of Open Access Journals (Sweden)

Carlos Abanto Rodriguez

2013-12-01

Full Text Available The aim was to verify the initial development of camu camu plants with different organic substrates in conventional nursery bedding microsprinkler irrigation and shade management Chromatine® mesh with 50% red light. We used genetic material from mother plants Germplasm Bank of INIA-camu camu Iquitos, seeds were germinated in decomposed sawdust and kept for a period of 40 days after subculturing was performed with 10 cm in height in different substrates according treatments in nursery beds with dimensions of 1.20 m wide x 10 m long with a depth of 30 cm. After conducting assessments of height (cm and basal diameter (mm for a period of 120 days, it was found that the substrate manure has become the substrate for greater efficiency in plant development camu camu substrate followed by humus worm.

NMR studies of chemical structural variation of insoluble organic matter from different carbonaceous chondrite groups

Science.gov (United States)

Cody, George D.; Alexander, Conel M. O.'D.

2005-02-01

Solid-state 1H and 13C Nuclear Magnetic Resonance (NMR) spectroscopic experiments have been performed on isolated meteoritic Insoluble Organic Matter (IOM) spanning four different carbonaceous chondrite meteorite groups; a CR2 (EET92042), a CI1 (Orgueil), a CM2 (Murchison), and the unique C2 meteorite, Tagish Lake. These solid state NMR experiments reveal considerable variation in bulk organic composition across the different meteorite group's IOM. The fraction of aromatic carbon increases as CR2 meteorite groups. Single pulse (SP) 13C magic angle spinning (MAS) NMR experiments reveal the presence of nanodiamonds with an apparent concentration ranking in the IOM of CR2 IOM of all four meteoritic IOM fractions are highly substituted. Fast spinning SP 1H MAS NMR spectral data combined with other NMR experimental data reveal that the average hydrogen content of sp 3 bonded carbon functional groups is low, requiring a high degree of aliphatic chain branching in each IOM fraction. The variation in chemistry across the meteorite groups is consistent with alteration by low temperature chemical oxidation. It is concluded that such chemistry principally affected the aliphatic moieties whereas the aromatic moieties and nanodiamonds may have been largely unaffected.

Comparison of Organic and Chemical Inputs on Different Densities of Echium amoenum Fisch & Mey. in Mashhad Conditions

Directory of Open Access Journals (Sweden)

Mohamad Behzad Amiri

2017-02-01

of many studies on the effect of organic fertilizers and plant density on different crops, information on the effects of these factors for many medicinal plants is scarce. Therefore, in this study the effect of organic fertilizers and plant density on morphological characteristics and yield of Echium amoenum was studied in a low input cropping system. Materials and methods: In order to evaluate the plant density and comparison of organic and chemical fertilizers on Iranian Ox-Tongue (Echium amoenum, a split plots experiment in time based on RCBD design with three replications was conducted in 2011-2014 growing seasons, in Ferdowsi University of Mashhad, Iran. The main plots included factorial combination of 3 plant densities (3, 5 and 10 plants per m2 and 4 different types of organic and chemical fertilizers (compost, vermicompost, cow manure, nitrogen chemical fertilizer and control and the sub plots included agronomic years (2 and 3 agronomic years. Results and discussion:The results showed that the effect of plant density on dry flower yield was significant, so that the highest dry flower yield (816 kg.ha-1 obtained for 5 plants per m2 and in this treatment dry flower yield was 23% and 15% more than 3 and 10 plants per m2 treatments, respectively. In both of agronomic years, effect of different organic and chemical fertilizers was intensified in 5 plants per m2, for example in second agronomic year, compost in 5 plants per m2 increased seed yield 30 and 25% compared to 3 and 10 plants per m2 densities, respectively. Although the use of chemical fertilizers to improve yield and yield components of Iranian Ox-Tongue was no ineffective, its impacts was much less than organic fertilizers. In general, the results of this research showed that the use of organic fertilizers in optimal plant densities can be reducing environmental risks of chemical fertilizers and develop sustainable agriculture and protect the health of the products. Organic fertilizers are among the

Comparison of Organic and Chemical Inputs on Different Densities of Echium amoenum Fisch & Mey. in Mashhad Conditions

Directory of Open Access Journals (Sweden)

Mohamad Behzad Amiri

2017-09-01

of many studies on the effect of organic fertilizers and plant density on different crops, information on the effects of these factors for many medicinal plants is scarce. Therefore, in this study the effect of organic fertilizers and plant density on morphological characteristics and yield of Echium amoenum was studied in a low input cropping system. Materials and methods: In order to evaluate the plant density and comparison of organic and chemical fertilizers on Iranian Ox-Tongue (Echium amoenum, a split plots experiment in time based on RCBD design with three replications was conducted in 2011-2014 growing seasons, in Ferdowsi University of Mashhad, Iran. The main plots included factorial combination of 3 plant densities (3, 5 and 10 plants per m2 and 4 different types of organic and chemical fertilizers (compost, vermicompost, cow manure, nitrogen chemical fertilizer and control and the sub plots included agronomic years (2 and 3 agronomic years. Results and discussion:The results showed that the effect of plant density on dry flower yield was significant, so that the highest dry flower yield (816 kg.ha-1 obtained for 5 plants per m2 and in this treatment dry flower yield was 23% and 15% more than 3 and 10 plants per m2 treatments, respectively. In both of agronomic years, effect of different organic and chemical fertilizers was intensified in 5 plants per m2, for example in second agronomic year, compost in 5 plants per m2 increased seed yield 30 and 25% compared to 3 and 10 plants per m2 densities, respectively. Although the use of chemical fertilizers to improve yield and yield components of Iranian Ox-Tongue was no ineffective, its impacts was much less than organic fertilizers. In general, the results of this research showed that the use of organic fertilizers in optimal plant densities can be reducing environmental risks of chemical fertilizers and develop sustainable agriculture and protect the health of the products. Organic fertilizers are among the

Surgical treatment of metachronous metastases in different organs following radical nephrectomy

Directory of Open Access Journals (Sweden)

Carlos M. N. de Jesus

2003-06-01

Full Text Available Renal clear cell carcinoma (RCCC is a neoplasia resistant to radio and chemotherapy, with surgical treatment being the procedure that is recognized for its curative treatment. This case report demonstrates the success of an aggressive surgical treatment for consecutive and late metachronous metastases following radical nephrectomy. CASE REPORT: Asymptomatic 50-year old man. During a routine examination, an incidental mass was found by renal ultrasonography. He underwent right radical nephrectomy due to RCCC in June 1992. During the follow-up metastases were evidenced in cerebellum on the seventh year, and in left lung and pancreas on the eighth year following the radical nephrectomy, with all of them successfully treated by surgical excision. COMMENTS: The surgical excision of consecutive and late metachronous metastases in different organs arising from RCCC is feasible, being a good therapeutic alternative in selected cases.

[Blockade of the pheromonal effects in rat by central deafferentation of the accessory olfactory system].

Science.gov (United States)

Sánchez-Criado, J E

1979-06-01

Female rats reared without sex odours from male rats have a five day stral cycle. With exposure to male odour the estral cycle is shortened from five to four days. This pheromonal effect is blocked on deafferenting the vomeronasal system by electrolytically damaging both accessory olfactory bulbs.

Utilization of different waste proteins to create a novel PGPR-containing bio-organic fertilizer

Science.gov (United States)

Huang, Yan; Sun, Li; Zhao, Jianshu; Huang, Rong; Li, Rong; Shen, Qirong

2015-01-01

High-quality bio-organic fertilizers (BIOs) cannot be produced without the addition of some proteins, while many waste proteins are haphazardly disposed, causing serious environmental pollution. In this study, several waste proteins were used as additives to assist with the reproduction of the functional microbe (Bacillus amyloliquefaciens SQR9) inoculated into matured composts to produce BIOs. An optimized composition of solid-state fermentation (SSF) raw materials was predicted by response surface methodology and experimental validation. The results showed that 7.61% (w/w, DW, the same below) rapeseed meal, 8.85% expanded feather meal, 6.47% dewatered blue algal sludge and 77.07% chicken compost resulted in maximum biomass of strain SQR-9 and the maximum amount of lipopeptides 7 days after SSF. Spectroscopy experiments showed that the inner material structural changes in the novel SSF differed from the control and the novel BIO had higher dissolved organic matter. This study offers a high value-added utilization of waste proteins for producing economical but high-quality BIO.

Animal Board Invited Review: Comparing conventional and organic livestock production systems on different aspects of sustainability.

Science.gov (United States)

van Wagenberg, C P A; de Haas, Y; Hogeveen, H; van Krimpen, M M; Meuwissen, M P M; van Middelaar, C E; Rodenburg, T B

2017-10-01

To sustainably contribute to food security of a growing and richer world population, livestock production systems are challenged to increase production levels while reducing environmental impact, being economically viable, and socially responsible. Knowledge about the sustainability performance of current livestock production systems may help to formulate strategies for future systems. Our study provides a systematic overview of differences between conventional and organic livestock production systems on a broad range of sustainability aspects and animal species available in peer-reviewed literature. Systems were compared on economy, productivity, environmental impact, animal welfare and public health. The review was limited to dairy cattle, beef cattle, pigs, broilers and laying hens, and to Europe, North America and New Zealand. Results per indicators are presented as in the articles without performing additional calculations. Out of 4171 initial search hits, 179 articles were analysed. Studies varied widely in indicators, research design, sample size and location and context. Quite some studies used small samples. No study analysed all aspects of sustainability simultaneously. Conventional systems had lower labour requirements per unit product, lower income risk per animal, higher production per animal per time unit, higher reproduction numbers, lower feed conversion ratio, lower land use, generally lower acidification and eutrophication potential per unit product, equal or better udder health for cows and equal or lower microbiological contamination. Organic systems had higher income per animal or full time employee, lower impact on biodiversity, lower eutrophication and acidification potential per unit land, equal or lower likelihood of antibiotic resistance in bacteria and higher beneficial fatty acid levels in cow milk. For most sustainability aspects, sometimes conventional and sometimes organic systems performed better, except for productivity, which was

Impaired mastication reduced newly generated neurons at the accessory olfactory bulb and pheromonal responses in mice.

Science.gov (United States)

Utsugi, Chizuru; Miyazono, Sadaharu; Osada, Kazumi; Matsuda, Mitsuyoshi; Kashiwayanagi, Makoto

2014-12-01

A large number of neurons are generated at the subventricular zone (SVZ) even during adulthood. In a previous study, we have shown that a reduced mastication impairs both neurogenesis in the SVZ and olfactory functions. Pheromonal signals, which are received by the vomeronasal organ, provide information about reproductive and social states. Vomeronasal sensory neurons project to the accessory olfactory bulb (AOB) located on the dorso-caudal surface of the main olfactory bulb. Newly generated neurons at the SVZ migrate to the AOB and differentiate into granule cells and periglomerular cells. This study aimed to explore the effects of changes in mastication on newly generated neurons and pheromonal responses. Bromodeoxyuridine-immunoreactive (BrdU-ir; a marker of DNA synthesis) and Fos-ir (a marker of neurons excited) structures in sagittal sections of the AOB after exposure to urinary odours were compared between the mice fed soft and hard diets. The density of BrdU-ir cells in the AOB in the soft-diet-fed mice after 1 month was essentially similar to that of the hard-diet-fed mice, while that was lower in the soft-diet-fed mice for 3 or 6 months than in the hard-diet-fed mice. The density of Fos-ir cells in the soft-diet-fed mice after 2 months was essentially similar to that in the hard-diet-fed mice, while that was lower in the soft-diet-fed mice for 4 months than in the hard-diet-fed mice. The present results suggest that impaired mastication reduces newly generated neurons at the AOB, which in turn impairs olfactory function at the AOB. Copyright © 2014 Elsevier Ltd. All rights reserved.

The changing brain--insights into the mechanisms of neural and behavioral adaptation to the environment

DEFF Research Database (Denmark)

Bergersen, L H; Bramham, C R; Hugdahl, K

2013-01-01

level and behavior. Thus a single amino acid change in a transcriptional repressor can disrupt gene regulation through neural activity (Greenberg). Deep sequencing analysis of the neuropil transcriptome indicates that a large fraction of the synaptic proteome is synthesized in situ in axons...... and dendrites, permitting local regulation (Schuman). The nature of the 'reset' function that makes animals dependent of sleep is being revealed (Cirelli). Maternal behavior can cause changes in gene expression that stably modify behavior in the offspring (Meaney). Removal of a single sensory channel protein...... in the vomero-nasal organ can switch off male-specific and switch on female-specific innate behavior of mice in response to environmental stimulation (Dulac). Innate behaviors can be stably transmitted from parent to offspring through generations even when those behaviors cannot be expressed, as illustrated...

The pH-dependent photoluminescence of colloidal CdSe/ZnS quantum dots with different organic coatings

International Nuclear Information System (INIS)

Debruyne, David; Locquet, Jean-Pierre; Van Bael, Margriet J; Deschaume, Olivier; Bartic, Carmen; Coutiño-Gonzalez, Eduardo; Hofkens, Johan

2015-01-01

The photoluminescence (PL) of colloidal quantum dots (QDs) is known to be sensitive to the solution pH. In this work we investigate the role played by the organic coating in determining the pH-dependent PL. We compare two types of CdSe/ZnS QDs equipped with different organic coatings, namely dihydrolipoic acid (DHLA)-capped QDs and phospholipid micelle-encapsulated QDs. Both QD types have their PL intensity quenched at acidic pH values, but they differ in terms of the reversibility of the quenching process. For DHLA-capped QDs, the quenching is nearly irreversible, with a small reversible component visible only on short time scales. For phospholipid micelle-encapsulated QDs the quenching is notably almost fully reversible. We suggest that the surface passivation by the organic ligands is reversible for the micelle-encapsulated QDs. Additionally, both coatings display pH-dependent spectral shifts. These shifts can be explained by a combination of irreversible processes, such as photo-oxidation and acid etching, and reversible charging of the QD surface, leading to the quantum-confined Stark effect (QCSE), the extent of each effect being coating-dependent. At high ionic strengths, the aggregation of QDs also leads to a spectral (red) shift, which is attributable to the QCSE and/or electronic energy transfer. (paper)

Natural organic matter removal by ion exchange at different positions in the drinking water treatment lane

Directory of Open Access Journals (Sweden)

A. Grefte

2013-01-01

Full Text Available To guarantee a good water quality at the customers tap, natural organic matter (NOM should be (partly removed during drinking water treatment. The objective of this research was to improve the biological stability of the produced water by incorporating anion exchange (IEX for NOM removal. Different placement positions of IEX in the treatment lane (IEX positioned before coagulation, before ozonation or after slow sand filtration and two IEX configurations (MIEX® and fluidized IEX (FIX were compared on water quality as well as costs. For this purpose the pre-treatment plant at Loenderveen and production plant Weesperkarspel of Waternet were used as a case study. Both, MIEX® and FIX were able to remove NOM (mainly the HS fraction to a high extent. NOM removal can be done efficiently before ozonation and after slow sand filtration. The biological stability, in terms of assimilable organic carbon, biofilm formation rate and dissolved organic carbon, was improved by incorporating IEX for NOM removal. The operational costs were assumed to be directly dependent of the NOM removal rate and determined the difference between the IEX positions. The total costs for IEX for the three positions were approximately equal (0.0631 € m−3, however the savings on following treatment processes caused a cost reduction for the IEX positions before coagulation and before ozonation compared to IEX positioned after slow sand filtration. IEX positioned before ozonation was most cost effective and improved the biological stability of the treated water.

Desorption behaviors of BDE-28 and BDE-47 from natural soils with different organic carbon contents

International Nuclear Information System (INIS)

Liu Wenxin; Cheng Fangfang; Li Weibo; Xing Baoshan; Tao Shu

2012-01-01

Desorption kinetic and isothermal characteristics of BDE-28 and BDE-47 were investigated using natural soils with different organic carbon fractions. The results indicated that a two-compartment first-order model with dominant contribution of slow desorption could adequately describe the released kinetics of studied PBDEs. Desorption isotherms of different samples could be fitted well by linear distribution model or nonlinear Freundlich model. Moreover, most desorption procedures roughly exhibited hysteresis with respect to preceding sorption ones. At the statistically significant level of 0.05 or 0.1, total organic carbon content (f OC ) exhibited significant correlations with the fitted parameters by the isothermal models. The correlations of f OC and SOM fractions (e.g., fulvic acid and humin) with the single point desorption coefficients at lower aqueous concentrations of studied PBDEs were significant; while at higher aqueous concentrations, the relationships were less significant or insignificant. Our findings may facilitate a comprehensive understanding on behaviors of PBDEs in soil systems. - Highlights: ► A two-compartment first-order kinetic model for the PBDEs studied was established. ► Isotherm was fitted well by a linear distribution or a nonlinear Freundlich model. ► Desorption commonly exhibited somewhat hysteresis relative to sorption. ► Soil organic carbon fractions showed close correlations with the model parameters. - Two-compartment first-order model, and linear distribution model or nonlinear Freundlich model could well elucidate desorption kinetics and isotherms of PBDEs in natural soils, respectively.

Soil Organic Carbon and Its interaction with Minerals in Two Hillslopes with Different Climates and Erosion Processes

Science.gov (United States)

Wang, X.; Yoo, K.; Wackett, A. A.; Gutknecht, J.; Amundson, R.; Heimsath, A. M.

2017-12-01

Climate and topography have been widely recognized as important factors regulating soil organic carbon (SOC) dynamics but their interactive effects on SOC storage and its pools remain poorly constrained. Here we aimed to evaluate SOC storages and carbon-mineral interactions along two hillslope transects with moderately different climates (MAP: 549 mm vs. 816 mm) in Southeastern Australia. We sampled soil along the convex (eroding)-to-convergent (depositional) continuum at each hillslope transect and conducted size and density fractionation of these samples. In responses to the difference in climate factor, SOC inventories of eroding soils were twice as large at the wetter site compared with the drier site but showed little difference between two sites in depositional soils. These trends in SOC inventories were primarily controlled by SOC concentrations and secondarily by soil thicknesses. Similar patterns were observed for mineral associated organic carbon (MOC), and the abundances of MOC were controlled by the two independently operating processes affecting MOC concentration and fine-heavy fraction minerals. The contents and species of secondary clay and iron oxide minerals, abundances of particulate organic carbon, and bioturbation affected MOC concentrations. In contrast, the abundances of fine-heavy fraction minerals were impacted by erosion mechanisms that uniquely responded to regional- and micro- climate conditions. Consequently, topographic influences on SOC inventories and carbon-mineral interactions were more strongly pronounced in the drier climate where vegetation and erosion mechanisms were sensitive to microclimate. Our results highlight the significance of understanding topography and erosional processes in capturing climatic effects on soil carbon dynamics.

For optimum safety technologies: understanding relations between the different national authorities and the technical support organizations

International Nuclear Information System (INIS)

Mahmoud, N.S.; Mostafa Aziz, Mostafa

2010-01-01

TSOs describe expert independent organizations, which provide supports for government, regulatory authorities, utilities and industry. The TSO must dispose different competences and objectives in order to deliver to the four independent authorities the technical and scientific knowledge. This comprehensive knowledge, from TSO, should perform through the research and development activities (R and D). Concerning the government, TSOs consider the R and D on the management procedures to characterize the links, to differentiate roles to prevent the overlapping efforts, and finally to build a central data bank in nuclear technologies for the other three authorities. For regulatory organizations, R and D are involved in the regulatory requirements and surveillance processes. On the other side R and D, in case of utilities, activities should focus on the improvement of safety operations for nuclear power and its new generations, and for other nuclear/radiological facilities. Finally, the forth TSOs has R and D targets that should concentrate mainly on material, efficiency, and durability of different equipment and parts involved in the nuclear activities during manufacturing. (author)

The Most Prevalnet Organism in Diabetic Foot Ulcers and Its Drug Sensitivity and Resistance to Different Standard Antibiotics

International Nuclear Information System (INIS)

Nageen, A.

2016-01-01

Objective: To find the most prevalent organism in diabetic foot ulcers and its drug sensitivity and resistance to different standard antibiotics. Study Design: Adescriptive and cross-sectional study. Place and Duration of Study: Ward 7, Jinnah Postgraduate Medical Center, Karachi, from December 2010 to December 2012. Methodology: Ninety-five diabetic patients with infected foot wounds of Wegener grade 2 - 5 who had not received any previous antibiotics were included in the study by consecutive sampling. Pus culture specimen from wounds was taken and the organism isolated was identified. Also the most sensitive group of antibiotics and the most resistant one to that organism was noted. Results: Staphylococcus aureus was the most prevalent organism constituting 23.16% (n=22) of the organisms isolated; Escherichia coli with 17.89% (n=17) and Klebsiella with 12.63% (n=12) followed. Males presented more with diabetic foot (n=52) out of 95 patients. The most common age group affected was 41 - 60 years (73 patients). The organisms were most sensitive to Meropenem, effective in 90 (95%) patients and most resistant to Cotrimoxazole (80, 84% patients). Out of the 95 patients, 39 (41%) patients were hypertensive, 30 (31.5%) were obese and 14 (15%) were smokers. Staphylococcus aureus was the most prevalent organism overall irrespective to gender, age groups and co-morbidity of the patients. Conclusion: Staphylococcus aureus was the most frequent organism in diabetic foot ulcers; the most effective antibiotic is Meropenem and least effective is Cotrimoxazole. (author)

Organ doses, effective doses, and risk indices in adult CT: Comparison of four types of reference phantoms across different examination protocols

Energy Technology Data Exchange (ETDEWEB)

Zhang Yakun; Li Xiang; Paul Segars, W.; Samei, Ehsan [Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 and Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States); Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 and Department of Radiology, Duke University, Durham, North Carolina 27705 (United States); Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States) and Department of Radiology, Duke University, Durham, North Carolina 27705 (United States); Medical Physics Graduate Program, Duke University, Durham, North Carolina 27705 (United States); Carl E. Ravin Advanced Imaging Laboratories, Duke University, Durham, North Carolina 27705 (United States); Department of Radiology, Duke University, Durham, North Carolina 27705 (United States) and Departments of Physics, Biomedical Engineering, and Electrical and Computer Engineering, Duke University, Durham, North Carolina 27705 (United States)

2012-06-15

Purpose: Radiation exposure from computed tomography (CT) to the public has increased the concern among radiation protection professionals. Being able to accurately assess the radiation dose patients receive during CT procedures is a crucial step in the management of CT dose. Currently, various computational anthropomorphic phantoms are used to assess radiation dose by different research groups. It is desirable to better understand how the dose results are affected by different choices of phantoms. In this study, the authors assessed the uncertainties in CT dose and risk estimation associated with different types of computational phantoms for a selected group of representative CT protocols. Methods: Routinely used CT examinations were categorized into ten body and three neurological examination categories. Organ doses, effective doses, risk indices, and conversion coefficients to effective dose and risk index (k and q factors, respectively) were estimated for these examinations for a clinical CT system (LightSpeed VCT, GE Healthcare). Four methods were used, each employing a different type of reference phantoms. The first and second methods employed a Monte Carlo program previously developed and validated in our laboratory. In the first method, the reference male and female extended cardiac-torso (XCAT) phantoms were used, which were initially created from the Visible Human data and later adjusted to match organ masses defined in ICRP publication 89. In the second method, the reference male and female phantoms described in ICRP publication 110 were used, which were initially developed from tomographic data of two patients and later modified to match ICRP 89 organ masses. The third method employed a commercial dosimetry spreadsheet (ImPACT group, London, England) with its own hermaphrodite stylized phantom. In the fourth method, another widely used dosimetry spreadsheet (CT-Expo, Medizinische Hochschule, Hannover, Germany) was employed together with its associated

Organ doses, effective doses, and risk indices in adult CT: Comparison of four types of reference phantoms across different examination protocols

International Nuclear Information System (INIS)

Zhang Yakun; Li Xiang; Paul Segars, W.; Samei, Ehsan

2012-01-01

Purpose: Radiation exposure from computed tomography (CT) to the public has increased the concern among radiation protection professionals. Being able to accurately assess the radiation dose patients receive during CT procedures is a crucial step in the management of CT dose. Currently, various computational anthropomorphic phantoms are used to assess radiation dose by different research groups. It is desirable to better understand how the dose results are affected by different choices of phantoms. In this study, the authors assessed the uncertainties in CT dose and risk estimation associated with different types of computational phantoms for a selected group of representative CT protocols. Methods: Routinely used CT examinations were categorized into ten body and three neurological examination categories. Organ doses, effective doses, risk indices, and conversion coefficients to effective dose and risk index (k and q factors, respectively) were estimated for these examinations for a clinical CT system (LightSpeed VCT, GE Healthcare). Four methods were used, each employing a different type of reference phantoms. The first and second methods employed a Monte Carlo program previously developed and validated in our laboratory. In the first method, the reference male and female extended cardiac-torso (XCAT) phantoms were used, which were initially created from the Visible Human data and later adjusted to match organ masses defined in ICRP publication 89. In the second method, the reference male and female phantoms described in ICRP publication 110 were used, which were initially developed from tomographic data of two patients and later modified to match ICRP 89 organ masses. The third method employed a commercial dosimetry spreadsheet (ImPACT group, London, England) with its own hermaphrodite stylized phantom. In the fourth method, another widely used dosimetry spreadsheet (CT-Expo, Medizinische Hochschule, Hannover, Germany) was employed together with its associated

Phenotypic Changes in Different Spinach Varieties Grown and Selected under Organic Conditions

Directory of Open Access Journals (Sweden)

Nicolas Schermann

2011-09-01

Full Text Available Organic and low-input agriculture needs flexible varieties that can buffer environmental stress and adapt to the needs of farmers. We implemented an experiment to investigate the evolutionary capacities of a sample of spinach (Spinacia oleracea L. population varieties for a number of phenotypic traits. Three farmers cultivated, selected and multiplied one or several populations over two years on their farms. The third year, the versions of the varieties cultivated and selected by the different farmers were compared to the original seed lots they had been given. After two cycles of cultivation and on-farm mass selection, all the observed varieties showed significant phenotypic changes (differences between the original version and the version cultivated by farmers for morphological and phenological traits. When the divergence among versions within varieties was studied, the results show that the varieties conserved their identity, except for one variety, which evolved in such a way that it may now be considered two different varieties. The heterogeneity of the population varieties was assessed in comparison with a commercial F1 hybrid used as control, and we found no specific differences in phenotypic diversity between the hybrid and population varieties. The phenotypic changes shown by the population varieties in response to on-farm cultivation and selection could be useful for the development of specific adaptation. These results call into question the current European seed legislation and the requirements of phenotypic stability for conservation varieties.

Comparison of organic light emitting diodes with different mixed layer structures

Energy Technology Data Exchange (ETDEWEB)

Kee, Y.Y.; Siew, W.O. [Faculty of Engineering, Multimedia University, 63100 Cyberjaya (Malaysia); Yap, S.S. [Faculty of Engineering, Multimedia University, 63100 Cyberjaya (Malaysia); Faculty of Engineering, University of Malaya, 50603 Kuala Lumpur (Malaysia); Tou, T.Y., E-mail: tytou@mmu.edu.my [Faculty of Engineering, Multimedia University, 63100 Cyberjaya (Malaysia)

2014-11-03

A mixed-source thermal evaporation method was used to fabricate organic light emitting diodes (OLEDs) with uniformly mixed (UM), continuously graded mixed (CGM) and step-wise graded, mixed (SGM) light-emitting layers. N,N′-Bis(3-methylphenyl)-N,N′-diphenylbenzidine and Tris-(8-hydroxyquinoline)aluminum were used, respectively, as the hole- and electron-transport materials. As compared to the conventional, heterojunction OLED, the maximum brightness of UM-, CGM- and SGM-OLEDs without charge injection layers were improved by 2.2, 3.8 and 2.1 times, respectively, while the maximum power efficiencies improved by 1.5, 3.2 and 1.9 times. These improvements were discussed in terms of more distributed recombination zone and removal of interfacial barrier. - Highlights: • Fabrication of OLEDs using a mixed-source evaporation technique • Three different types of mixed-host OLEDs with better brightness • Improved electroluminescence and power efficiencies as compared to conventional OLED.

Investigation of the chemomarkers correlated with flower colour in different organs of Catharanthus roseus using NMR-based metabolomics.

Science.gov (United States)

Pan, Qifang; Dai, Yuntao; Nuringtyas, Tri Rini; Mustafa, Natali Rianika; Schulte, Anna Elisabeth; Verpoorte, Robert; Choi, Young Hae

2014-01-01

Flower colour is a complex phenomenon that involves a wide range of secondary metabolites of flowers, for example phenolics and carotenoids as well as co-pigments. Biosynthesis of these metabolites, though, occurs through complicated pathways in many other plant organs. The analysis of the metabolic profile of leaves, stems and roots, for example, therefore may allow the identification of chemomarkers related to the final expression of flower colour. To investigate the metabolic profile of leaves, stems, roots and flowers of Catharanthus roseus and the possible correlation with four flower colours (orange, pink, purple and red). (1) H-NMR and multivariate data analysis were used to characterise the metabolites in the organs. The results showed that flower colour is characterised by a special pattern of metabolites such as anthocyanins, flavonoids, organic acids and sugars. The leaves, stems and roots also exhibit differences in their metabolic profiles according to the flower colour. Plants with orange flowers featured a relatively high level of kaempferol analogues in all organs except roots. Red-flowered plants showed a high level of malic acid, fumaric acid and asparagine in both flowers and leaves, and purple and pink flowering plants exhibited high levels of sucrose, glucose and 2,3-dihydroxy benzoic acid. High concentrations of quercetin analogues were detected in flowers and leaves of purple-flowered plants. There is a correlation between the metabolites specifically associated to the expression of different flower colours and the metabolite profile of other plant organs and it is therefore possible to predict the flower colours by detecting specific metabolites in leaves, stems or roots. This may have interesting application in the plant breeding industry. Copyright © 2013 John Wiley & Sons, Ltd.

Tandem-type organic solar cells by stacking different heterojunction materials

International Nuclear Information System (INIS)

Triyana, Kuwat; Yasuda, Takeshi; Fujita, Katsuhiko; Tsutsui, Tetsuo

2005-01-01

Three layers of phthalocyanine/perylene heterojunction (HJ) components were stacked and sandwiched by an indium tin oxide (ITO) and a top metal electrode, which is denoted by a triple-HJ organic solar cell. The organic material in the middle-HJ component second from the ITO was varied to investigate the photovoltaic properties. The power conversion efficiency (PCE) was improved by the more balanced photo-generated carrier by use of the appropriate material for the second-HJ component. The optimized device showed higher PCE (1.38%) than the reference device (0.98%)

Espins are multifunctional actin cytoskeletal regulatory proteins in the microvilli of chemosensory and mechanosensory cells

Science.gov (United States)

Sekerková, Gabriella; Zheng, Lili; Loomis, Patricia A.; Changyaleket, Benjarat; Whitlon, Donna S.; Mugnaini, Enrico; Bartles, James R.

2010-01-01

Espins are associated with the parallel actin bundles of hair cell stereocilia and are the target of mutations that cause deafness and vestibular dysfunction in mice and humans. Here, we report that espins are also concentrated in the microvilli of a number of other sensory cells: vomeronasal organ sensory neurons, solitary chemoreceptor cells, taste cells and Merkel cells. Moreover, we show that hair cells and these other sensory cells contain novel espin isoforms that arise from a different transcriptional start site and differ significantly from other espin isoforms in their complement of ligand-binding activities and their effects on actin polymerization. The novel espin isoforms of sensory cells bundled actin filaments with high affinity in a Ca2+-resistant fashion, bound actin monomer via a WASP homology 2 domain, bound profilin via a single proline-rich peptide, and caused a dramatic elongation of microvillus-type parallel actin bundles in transfected epithelial cells. In addition, the novel espin isoforms of sensory cells differed from other espin isoforms in that they potently inhibited actin polymerization in vitro, did not bind the Src homology 3 domain of the adapter protein insulin receptor substrate p53 and did not bind the acidic, signaling phospholipid phosphatidylinositol 4,5- bisphosphate. Thus, the espins constitute a family of multifunctional actin cytoskeletal regulatory proteins with the potential to differentially influence the organization, dimensions, dynamics and signaling capabilities of the actin filament-rich, microvillus-type specializations that mediate sensory transduction in a variety of mechanosensory and chemosensory cells. PMID:15190118

Localization of α1-2 Fucose Glycan in the Mouse Olfactory Pathway.

Science.gov (United States)

Kondoh, Daisuke; Kamikawa, Akihiro; Sasaki, Motoki; Kitamura, Nobuo

2017-01-01

Glycoconjugates in the olfactory system play critical roles in neuronal formation, and α1-2 fucose (α1-2Fuc) glycan mediates neurite outgrowth and synaptic plasticity. Histochemical findings of α1-2Fuc glycan in the mouse olfactory system detected using Ulex europaeus agglutinin-I (UEA-I) vary. This study histochemically assessed the main olfactory and vomeronasal pathways in male and female ICR and C57BL/6J mice aged 3-4 months using UEA-I. Ulex europaeus agglutinin-I reacted with most receptor cells arranged mainly at the basal region of the olfactory epithelium. The olfactory nerve layer and glomerular layer of the main olfactory bulb were speckled with positive UEA-I staining, and positive fibers were scattered from the glomerular to the internal plexiform layer. The lateral olfactory tract and rostral migratory stream were also positive for UEA-I. We identified superficial short-axon cells, interneurons of the external plexiform layer, external, middle and internal tufted cells, mitral cells and granule cells as the origins of the UEA-I-positive fibers in the main olfactory bulb. The anterior olfactory nucleus, anterior piriform cortex and olfactory tubercle were negative for UEA-I. Most receptor cells in the vomeronasal epithelium and most glomeruli of the accessory olfactory bulb were positive for UEA-I. Our findings indicated that α1-2Fuc glycan is located within the primary and secondary, but not the ternary, pathways of the main olfactory system, in local circuits of the main olfactory bulb and within the primary, but not secondary, pathway of the vomeronasal system. © 2016 S. Karger AG, Basel.

The pros and cons of ecological risk assessment based on data from different levels of biological organization

Science.gov (United States)

Rohr, Jason R.; Salice, Christopher J.; Nisbet, Roger M.

2016-01-01

mathematical modeling approaches where possible to enhance ERA. Because top-down ERA is unconventional, we also offer some suggestions for how it might be implemented efficaciously. We hope this review helps researchers in the field of ERA fill key information gaps and helps risk assessors identify the best levels of biological organization to conduct ERAs with differing goals. PMID:27340745

The pros and cons of ecological risk assessment based on data from different levels of biological organization.

Science.gov (United States)

Rohr, Jason R; Salice, Christopher J; Nisbet, Roger M

2016-10-01

mathematical modeling approaches where possible to enhance ERA. Because top-down ERA is unconventional, we also offer some suggestions for how it might be implemented efficaciously. We hope this review helps researchers in the field of ERA fill key information gaps and helps risk assessors identify the best levels of biological organization to conduct ERAs with differing goals.

Different Approaches to investigate the interfacial interactions between Natural Organic Matter and Metal Oxide

KAUST Repository

Zaouri, Noor A.

2017-12-01

A variety of approaches were conducted to obtain a comprehensive understanding of the adsorption of Natural Organic Matter (NOM) isolates on metal oxides (MeO). Adsorption experiments with a series of small molecular weight (MW), oxygenated, aromatic organic acids were performed with Aluminum oxide (Al2O3), Titanium oxide (TiO2), and Zirconium oxide (ZrO2) surface. The experiments were conducted in batch mode at pH 4.2 and 7.6. The adsorption of simple organic acids was described by Langmuir model, and exhibited strong dependence on the relative abundance of carboxyl group, aliphaticity/aromaticity, length of alkyl chain, and the presence of hydroxyl group. The adsorption of the model compounds was high at low pH and decreased with increasing the pH. Isolated NOM fraction of strong humic character, i.e., hydrophobic (HPO) (high in MW, aromaticity, and acidity), i.e., Suwannee River fulvic acid (SRW HPO), showed strong adsorption on all MeO. However, fractions with similar acidic character, and lower MW exerted weak adsorption. NOM fraction that incorporated polysaccharides and proteins like structures (i.e., biopolymers) was not significantly adsorbed compared to HPO fractions. Interestingly, biopolymer adsorption on Heated Aluminum oxide particles (HAOP) was higher than that on Al2O3, TiO2, and ZrO2. These different adsorption profiles were related to their physicochemical characteristics of NOM and MeO, and thus, showed different interacting mechanisms and were studied by Atomic Force Microscopy (AFM). Hydrogen bonding was suggested as the main mechanism between NOM of strong hydrophilic character (i.e., biopolymers) and Al2O3, TiO2 and ZrO2 coated wafers. The strength of the hydrogen bonding was influenced by the hydrophilicity degree of MeO surface, ionic strength, and cation type. NOM fractions with strong humic character showed repulsive forces that are electrostatic in nature with MeO of high negative charge density. Hydrogen bonding and ligand exchange

Cultural diversity in organizations : Enhancing identification by valuing differences

NARCIS (Netherlands)

Luijters, Kyra; van der Zee, Karen I.; Otten, Sabine

The present research investigated the role of perceived similarity in cultural values (associated with diversity in cultural backgrounds) and an intercultural group climate in predicting identification with both the organization and the work team. The relevance of perceived similarity in cultural

Effects of nitrogen enrichment on soil organic matter in tropical forests with different ambient nutrient status

Science.gov (United States)

Vaughan, E.; Cusack, D. F.; McDowell, W. H.; Marin-Spiotta, E.

2017-12-01

Nitrogen (N) enrichment is a widespread and increasingly important human influence on ecosystems globally, with implications for net primary production and biogeochemical processes. Previous research has shown that N enrichment can alter soil carbon (C) cycling, although the direction and magnitude of the changes are not consistent across studies, and may change with time. Inconsistent responses to N additions may be due to differences in ambient nutrient status, and/or variable responses of plant C inputs and microbial decomposition. Although plant production in the tropics is not often limited by N, soil processes may respond differently to N enrichment. Our study uses a 15-year N addition experiment at two different tropical forest sites in the Luquillo Long-Term Ecological Research project site in Puerto Rico to address long-term changes in soil C pools due to fertilization. The two forests differ in elevation and ambient nutrient status. Soil sampling three and five years post-fertilization showed increased soil C concentrations under fertilization, driven by increases in mineral-associated C (Cusack et al. 2011). However, the longer-term trends at these sites are unknown. To this end, soil samples were collected following fifteen years of fertilization. Soils were sampled from 0-10 cm and 10-20 cm. Bulk soil C and N concentrations will be measured and compared to samples collected before fertilization (2002) and three years post fertilization (2005). We are using density fractionation to isolate different soil organic matter pools into a free light, occluded light, and dense, mineral associated fraction. These pools represent different mechanisms of soil organic matter stabilization, and provide more detailed insight into changes in bulk soil C. These data will provide insight into the effects of N enrichment on tropical forest soils, and how those effects may change through time with a unique long-term data set.

Changes in different organic matter fractions during conventional treatment and advanced treatment

Institute of Scientific and Technical Information of China (English)

Chao Chen; Xiaojian Zhang; Lingxia Zhu; Wenjie He; Hongda Han

2011-01-01

XAD-8 resin isolation of organic matter in water was used to divide organic matter into the hydrophobic and hydrophilic fractions.A pilot plant was used to investigate the change in both fractions during conventional and advanced treatment processes.The treatment of hydrophobic organics (HPO), rather than hydrophilic organicas (HPI), should carry greater emphasis due to HPO's higher trihalomethane formation potential (THMFP) and haloacetic acid formation potential (HAAFP).The removal of hydrophobic matter and its transmission into hydrophilic matter reduced ultimate DBP yield during the disinfection process.The results showed that sand filtration, ozonation, and biological activated carbon (BAC) filtration had distinct influences on the removal of both organic fractions.Additionally, the combination of processes changed the organic fraction proportions present during treatment.The use of ozonation and BAC maximized organic matter removal efficiency, especially for the hydrophobic fraction.In sum, the combination of pre-ozonation,conventional treatment, and O3-BAC removed 48％ of dissolved organic carbon (DOC), 60％ of HPO, 30％ of HPI, 63％ of THMFP,and 85％ of HAAFP.The use of conventional treatment and O3-BAC without pre-ozonation had a comparable performance, removing 51％ of DOC, 56％ of HPO, 45％ of HPI, 61％ of THMFP, and 72％ of HAAFP.The effectiveness of this analysis method indicated that resin isolation and fractionation should be standardized as an applicable test to help assess water treatment process efficiency.

Species and biogeochemical cycles of organic phosphorus in sediments from a river with different aquatic plants located in Huaihe River Watershed, China.

Science.gov (United States)

Yuan, He Zhong; Pan, Wei; Ren, Li Jun; Liu, Eeng Feng; Shen, Ji; Geng, Qi Fang; An, Shu Qing

2015-01-01

The results of phosphorus fractionation in the sediments from a contaminated river containing different aquatic plants, analyzed by solution 31P-NMR for Organic Phosphorus, showed that the concentration of Inorganic Phosphorus dominated in all species and Organic Phosphorus accounted for over 20% of Total Phosphorus. In general, orthophosphate was dominant in all the sampling sites. The proportion of Organic Phosphorus accounting for the Total Phosphorus in the sediments with different plant decreased in the following order: Paspalum distichum>Typha orientalis>Hydrilla verticillata. Phosphorus-accumulation ability of Paspalum distichum was obviously stronger than Typha orientalis and Hydrilla verticillata. The Organic Phosphorus was in aquatic plants dominated by humic-associated P (Hu-P), which converted to Inorganic Ohosphorus more significantly in submerged plants than in emerged plants. The sediment dominated by Paspalum distichum abundantly accumulated Organic Phosphorus in the orthophosphate monoester fraction. The degradation and mineralization of orthophosphate monoester was the important source of high Inorganic Phosphorus concentration and net primary productivity in Suoxu River. The Organic Phosphorus derived from Typha orientalis and Hydrilla verticillata was dramatically converted to Inorganic Phosphorus when the environmental factors varied.

Molecular and compound-specific hydrogen isotope analyses of insoluble organic matter from different carbonaceous chondrite groups

Science.gov (United States)

Wang, Yi; Huang, Yongsong; Alexander, Conel M. O.'D.; Fogel, Marilyn; Cody, George

2005-07-01

We have conducted the first systematic analyses of molecular distribution and δD values of individual compounds in pyrolysates of insoluble organic matter (IOM) from different carbonaceous chondrite groups, using flash pyrolysis coupled to gas chromatography-mass spectrometry and compound-specific D/H analysis. IOM samples from six meteorites of different classifications, Elephant Moraine (EET) 92042 (CR2), Orgueil (CI1), Allan Hills (ALH) 83100 (CM1/2), Murchison (CM2), ALH 85013 (CM2), and Tagish Lake (C2) were isolated and studied. Except for the pyrolysate of Tagish Lake IOM, pyrolysates of all five meteorite IOM samples were dominated by an extensive series of aromatic (C 1 to C 7 alkyl-substituted benzenes, C 0 to C 2 alkyl-substituted naphthalenes), with aliphatic (straight chain and branched C 10 to C 15 alkanes) hydrocarbons and several S- and O- containing compounds (C 1 to C 2 alkylthiophenes, benzothiophene, benzaldehyde) being also present. The strong similarity in the pyrolysates of different carbonaceous chondrites suggests certain common characteristics in the formation mechanisms of IOM from different meteorites. The Tagish Lake IOM sample is unique in that its pyrolysate lacks most of the alkyl-substituted aromatic hydrocarbons detected in other meteorite IOM samples, suggesting distinctively different formation processes. Both bulk δD values of meteorite IOMs and weighted-average δD values of individual compounds in pyrolysates show a decreasing trend: CR2 > CI1 > CM2 > C2 (Tagish Lake), with the EET 92042 (CR2) IOM having the highest δD values (˜2000‰ higher than other samples). We attribute the high D contents in the IOM to primitive interstellar organic sources.

Determination of doses to different organs and prediction of health detriment, after hypothetical accident in mtr reactor core

Energy Technology Data Exchange (ETDEWEB)

Amin, E A; Abd El-Ghani, A H [National Center of Nuclear Safety and Radiation Control Atomic Energy Authority, Cairo (Egypt)

1997-12-31

As a result of pypothetical accidents with release of high amount of fission products, the doses to different organs consequent upon inhalation of radioactive fission products are calculated. The processes are modeled using the ORIGIN and TIRION-4 codes: source term, containment and activity enclosure, time dependent activity behaviour in the building, and radiation exposure in the reactor building. Prediction of health detriments were calculated using ICRP-60 nominal probability coefficients and organ doses determined for bone, lung, and thyroid gland, after whole body exposure from internal inhalation and external emmersion. 11 tabs.

Associating Animations with Concrete Models to Enhance Students' Comprehension of Different Visual Representations in Organic Chemistry

Science.gov (United States)

Al-Balushi, Sulaiman M.; Al-Hajri, Sheikha H.

2014-01-01

The purpose of the current study is to explore the impact of associating animations with concrete models on eleventh-grade students' comprehension of different visual representations in organic chemistry. The study used a post-test control group quasi-experimental design. The experimental group (N = 28) used concrete models, submicroscopic…

Response of vegetable organisms to quasi-monochromatic light of different duration, intensity and wavelength

Energy Technology Data Exchange (ETDEWEB)

Budagovsky, A V; Solovykh, N V [I.V.Michurin All-Russian Recearch Institute of Fruit Crops Genetics and Breeding (Russian Federation); Budagovskaya, O N [I.V.Michurin All-Russia Research and Development Institute of Gardening, Michurinsk, Tambov region (Russian Federation); Budagovsky, I A [P N Lebedev Physics Institute, Russian Academy of Sciences, Moscow (Russian Federation)

2015-04-30

By the example of vegetable organisms differing in structure and functional properties it is shown that their response to the action of quasi-monochromatic light from laser sources does not obey the Bunsen – Roscoe dose law. The dependence of biological effect on the irradiation time has the multimodal (multiextremal) form with alternating maxima and minima of the stimulating effect. Such a property manifests itself in the spectral ranges, corresponding to photoinduced conversion of chromoproteins of photocontrol systems and is probably related to the cyclic variations of metabolic activity in vegetable cells. (biophotonics)

Spectroscopic study of the water-soluble organic matter isolated from atmospheric aerosols collected under different atmospheric conditions

International Nuclear Information System (INIS)

Duarte, Regina M.B.O.; Pio, Casimiro A.; Duarte, Armando C.

2005-01-01

The composition of the water-soluble organic matter from fine aerosols collected in a rural location during two different meteorological conditions (summer and autumn) was investigated by UV-vis, synchronous fluorescence (with Δλ = 20 nm), FT-IR and CPMAS- 13 C NMR spectroscopies. A seasonal variation in the concentration of total carbon, organic carbon and water-soluble organic carbon was confirmed, with higher values during the autumn and lower values during the summer season. The chemical characterisation of the water-soluble organic matter showed that both samples are dominated by a high content of aliphatic structures, carboxyl groups and aliphatic carbons single bonded to one oxygen or nitrogen atom. However, the autumn sample exhibits a higher aromatic content than the summer sample, plus signals due to carbons of phenol, ketones and methoxyl groups. These signals were attributed to lignin breakdown products which are likely to be released during wood combustion processes. The obtained results put into evidence the major contribution of biomass burning processes in domestic fireplaces during low temperature conditions into both the concentration and the bulk chemical properties of the WSOC from fine aerosols

Utilization of different waste proteins to create a novel PGPR-containing bio-organic fertilizer

Science.gov (United States)

Huang, Yan; Sun, Li; Zhao, Jianshu; Huang, Rong; Li, Rong; Shen, Qirong

2015-01-01

High-quality bio-organic fertilizers (BIOs) cannot be produced without the addition of some proteins, while many waste proteins are haphazardly disposed, causing serious environmental pollution. In this study, several waste proteins were used as additives to assist with the reproduction of the functional microbe (Bacillus amyloliquefaciens SQR9) inoculated into matured composts to produce BIOs. An optimized composition of solid-state fermentation (SSF) raw materials was predicted by response surface methodology and experimental validation. The results showed that 7.61% (w/w, DW, the same below) rapeseed meal, 8.85% expanded feather meal, 6.47% dewatered blue algal sludge and 77.07% chicken compost resulted in maximum biomass of strain SQR-9 and the maximum amount of lipopeptides 7 days after SSF. Spectroscopy experiments showed that the inner material structural changes in the novel SSF differed from the control and the novel BIO had higher dissolved organic matter. This study offers a high value-added utilization of waste proteins for producing economical but high-quality BIO. PMID:25586328

Organ-Specific Metabolic Shifts of Flavonoids in Scutellaria baicalensis at Different Growth and Development Stages

Directory of Open Access Journals (Sweden)

Jingyuan Xu

2018-02-01

Full Text Available Scutellaria baicalensis Georgi is a traditional Chinese herbal medicine mainly containing flavonoids that contribute to its bioactivities. In this study, the distributions and dynamic changes of flavonoid levels in various organs of S. baicalensis at different development stages were investigated by UHPLC-QTOF-MS/MS and HPLC-DAD methods. The results indicated that the metabolic profiles of S. baicalensis changed with growth and development. During the initial germination stage, the seeds mainly contained flavonols. With growth, the main kinds of flavonoids in S. baicalensis changed from flavonols to flavanones and flavones. The results also revealed that the accumulation of flavonoids in S. baicalensis is organ-specific. The flavones without 4′-OH groups mainly accumulate in the root and the flavanones mainly accumulate in aerial organs. Dynamic accumulation analysis showed that the main flavonoids in the root of S. baicalensis accumulated rapidly before the full-bloom stage, then changed to a small extent. The results suggested the proper harvest time for the aerial parts was at the initial stage of reproductive growth and the flower buds should be collected before flowering. This study deepening the knowledge of S. baicalensis should provide valuable information for guiding the scientific cultivation of this plant and the development and utilization of S. baicalensis.

Determination of Partition coefficients for a Mixture of Volatile Organic Compounds in Rats and Humans at Different Life Stages

National Research Council Canada - National Science Library

Mahle, Deidre A; Gearhart, Jeffrey M; Godfrey, Richard J; Mattie, David R; Cook, Robert S; Grisby, Claude C

2004-01-01

.... Partition coefficients (PCs) are an integral component of pharmacokinetic models and determining differences in tissue partitioning of volatile organic chemicals across life stages can help reduce the uncertainty in risk assessment...

Effects of different organic materials and chemical fertilizers on ...

African Journals Online (AJOL)

GREGORY

2010-09-20

Sep 20, 2010 ... 2The Chamber of Agricultural Engineers, Gaziantep, Turkey. Accepted 5 July, 2010. This study was conducted under greenhouse conditions to investigate the effects of applied nutrients such as ... Key words: Organic material, chemical fertilizer, Pistacia vera L., soil ... systematic approach of soil and plant.

Effect of dietary organic selenium and zinc on the internal egg quality of quail eggs for different periods and under different temperatures

Directory of Open Access Journals (Sweden)

IB Fernandez

2011-03-01

Full Text Available The objective of this study was to evaluate the internal quality of eggs of Japanese quails fed diets supplemented with chelated selenium and zinc. The experiment was carried out for 120 days, and 144 birds were divided in random blocks into four treatments (control; 0.3 ppm Se; 60 ppm Zn and 0.3 ppm Se + 60 ppm Zn. Ten, 14, 18, and 22 weeks after the beginning of lay, eggs were collected and stored under two different temperatures (environmental temperature or refrigeration and for 10, 20, and 30 days. Eggs were analyzed for: Haugh units (HU, albumen height (AH, yolk index (YI, and albumen index (AI. Parameters were only statistically influenced by the interaction between dietary treatment and storage time. It was concluded that the addition of organic Se and Zn influenced internal egg quality when eggs were stored up to 20 days, independently of storage temperature, suggesting that the combined supplementation of organic Se and Zn improve internal egg quality and extend egg shelf life.

Explaining differences between hospitals in number of organ donors.

NARCIS (Netherlands)

Friele, R.D.; Coppen, R.; Marquet, R.L.; Gevers, J.K.M.

2006-01-01

The shortage of donor organs calls for a careful examination of all improvement options. In this study, 80 Dutch hospitals were compared. They provided 868 donors in a 5-year period, constituting 91% of all donors in that period in The Netherlands. Multilevel regression analysis was used to explain

Detecting and quantifying ongoing decay of organic archaeological remains - a discussion of different approaches

DEFF Research Database (Denmark)

Matthiesen, Henning

2015-01-01

are well protected and are not undergoing rapid decay, and it requires a detailed knowledge of decay processes and rates. For instance it is well established that the presence of water is of paramount importance for the preservation of organic material, and there are several examples where archaeological....... Thus, for the management of archaeological sites it is necessary to develop tools and methods that allow us to discover ongoing decay as fast as possible. Furthermore, in order to prioritize between excavation, in situ preservation and mitigation the decay rate should be evaluated on a quantitative...... scale to determine if the archaeological remains can be preserved for centuries, decades or only a few years under different conditions. This is a challenging task as archaeological sites and materials are often heterogeneous and have been subjected to different site formation processes. This paper...

Expression of Genes Related to Phenylpropanoid Biosynthesis in Different Organs of Ixeris dentata var. albiflora.

Science.gov (United States)

Lee, Sang-Hoon; Park, Yun-Ji; Park, Sang Un; Lee, Sang-Won; Kim, Seong-Cheol; Jung, Chan-Sik; Jang, Jae-Ki; Hur, Yoonkang; Kim, Yeon Bok

2017-05-30

Members of the genus Ixeris have long been used in traditional medicines as stomachics, sedatives, and diuretics. Phenylalanine ammonia-lyase (PAL), cinnamate-4-hydroxylase (C4H), 4-coumarate: coenzyme-A (CoA) ligase (4CL), chalcone synthase (CHS), and dihydroflavonol 4-reductase (DFR) are important enzymes in the phenylpropanoid pathway. In this study, we analyzed seven genes from Ixeris dentata var. albiflora that are involved in phenylpropanoid biosynthesis, using an Illumina/Solexa HiSeq 2000 platform. The amino acid sequence alignments for IdPAL s, IdC4H, Id4CL s, IdCHS , and IdDFR showed high identity to sequences from other plants. We also investigated transcript levels using quantitative real-time PCR, and analyzed the accumulation of phenylpropanoids in different organs of I. dentata var. albiflora using high-performance liquid chromatography. The transcript levels of IdC4H, Id4CL1 , IdCHS , and IdDFR were highest in the leaf. The catechin, chlorogenic acid, ferulic acid, and quercetin contents were also highest in the leaf. We suggest that expression of IdC4H, Id4CL1 , IdCHS , and IdDFR is associated with the accumulation of phenylpropanoids. Our results may provide baseline information for elucidating the mechanism of phenylpropanoid biosynthesis in different organs of I. dentata var. albiflora .

Soil Organic Carbon (SOC) distribution in two differents soil types (Podzol and Andosol) under natural forest cover.

Science.gov (United States)

Álvarez-Romero, Marta; Papa, Stefania; Verstraeten, Arne; Cools, Nathalie; Lozano-García, Beatriz; Parras-Alcántara, Luis; Coppola, Elio

2017-04-01

Andosols are young soils that shall know a successive evolution towards pedological types where the dominant pedogenetic processes are more evident. Vegetation and climate influence Andosols evolution to other order of soils. In cold and wet climates or on acid vulcanite under heavy leaching young Andosols could change into Podzols (Van Breemn and Buurman, 1998). Were investigated a Podzol soil (World References Base, 2014) at Zoniën (Belgium), were and an Andosol soil (World References Base, 2014) at Lago Laceno (Avellino, Italy). This study shows the data on the SOC (Soil Organic Carbon) fractionation in two profiles from two natural pine forest soils. Together with the conventional activities of sampling and analysis of soil profile were examined surveys meant to fractionation and characterization of SOC, in particular: Total Organic Carbon (TOC) and Total Extractable Carbon (TEC) soil contents were determined by Italian official method of soil analysis (Mi.P.A.F. (2000)). Different soil C fractions were also determined: Humic Acid Carbon (HAC), Fulvic Acid Carbon (FAC), Not Humic Carbon (NHC) and Humin Carbon (Huc) fractions were obtained by difference. In the whole profile, therefore, were also assayed cellulose and lignin contents. The aim of this work was to compare the distribution of different soil organic components in a podzol and a soil with andic properties. The data show great similarity, among the selected profiles, in the organic components distribution estudied. References: - Mi.P.A.F. - Ministero per le Politiche Agricole e Forestali - Osservatorio Nazionale Pedologico e per la Qualità del Suolo (2000): Metodi Ufficiali di Analisi Chimica del Suolo. In: Franco Angeli (Editor), Collana di metodi analitici per l'agricoltura diretta da Paolo Sequi, n. 1124.2, Milano, Italy. - Van Breemn N. and Buurman P. (1998) Chapter 12 Formation of Andisols. In: Soil formation. Kluwer Ed., Wageningen, The Netherlands, 271-289. -Ussiri D.A.N., Johnson C

Repeated application of organic waste affects soil organic matter composition

DEFF Research Database (Denmark)

Peltre, Clément; Gregorich, Edward G.; Bruun, Sander

2017-01-01

Land application of organic waste is an important alternative to landfilling and incineration because it helps restore soil fertility and has environmental and agronomic benefits. These benefits may be related to the biochemical composition of the waste, which can result in the accumulation...... of different types of carbon compounds in soil. The objective of this study was to identify and characterise changes in soil organic matter (SOM) composition after repeated applications of organic waste. Soil from the CRUCIAL field experiment in Denmark was sampled after 12 years of annual application...... that there was accumulation in soil of different C compounds for the different types of applied organic waste, which appeared to be related to the degree to which microbial activity was stimulated and the type of microbial communities applied with the wastes or associated with the decomposition of applied wastes...

Differences in technetium-99 accumulation and distribution between organs in male and female lobsters collected from Norwegian coastal waters

Energy Technology Data Exchange (ETDEWEB)

Kolstad, Anne Kathrine; Gjelsvik, Runhild; Rudjord, Anne Liv

2006-07-01

In this report, {sup 99}Tc results for lobsters caught along the Norwegian coast between 2001 and 2005 are presented. The high accumulation of {sup 99}Tc in lobsters compared to other crustecea is confirmed in this report, as well as the clear differences between males and females. Concentration factors have been estimated for each gender and also for different organs. (author)

Differences in technetium-99 accumulation and distribution between organs in male and female lobsters collected from Norwegian coastal waters

International Nuclear Information System (INIS)

Kolstad, Anne Kathrine; Gjelsvik, Runhild; Rudjord, Anne Liv

2006-01-01

In this report, 99 Tc results for lobsters caught along the Norwegian coast between 2001 and 2005 are presented. The high accumulation of 99 Tc in lobsters compared to other crustecea is confirmed in this report, as well as the clear differences between males and females. Concentration factors have been estimated for each gender and also for different organs. (author)

Adsorption of Different Fractions of Organic Matter on the Surface of Metal Oxide

KAUST Repository

Zaouri, Noor A

2013-05-18

The adsorption of different fractions of organic matter on the surface of Al2O3 and ZrO2 were investigated. The aim was to study the affinity of these fractions on the surface of metal oxide and the effect of several factors. Batch adsorption experiments were conducted with Low molecular weight oxygenated compounds. These chemical compound have been chosen to investigate:1) the aliphatic and aromatic structurer;2)contribution of hydroxyl group and; 3) the number of carboxyl group. HPLC and IC analysis used for determent the concentration of these chemical in the working solution. ATR-FTIR used to distinguish the type of coordination structure with the surface of metal oxide. The results fitted with Langmuir equation. The results showed that the chemical structure and the type and number of attached functional have an impact on the adsorption. Which it was proved via ATR-FTIR where the result showed that each chemical have different coordination structure on the surface of ZrO2 and Al2O3. Different fractions and sources of NOM were used (hydrophobic fraction of Suwannee and Colorado River, biopolymers extracted for the exuded of 2 species of algae, and low molecular acids that do not adsorb in XAD-8 resin). Results showed that these different fractions have different affinity with the surface of Al2O3 and ZrO2. These adsorption behaviors were varying according to the difference in the component of each NOM. Biopolymers showed significant adsorption at acidic pH. These biopolymers are mainly comprised of polysaccharides and this result proved that polysaccharide adsorb on the surface of ZrO2 more than Al2O3.

Differences in abdominal organ movement between supine and prone positions measured using four-dimensional computed tomography

International Nuclear Information System (INIS)

Kim, Young Seok; Park, Sung Ho; Ahn, Seung Do; Lee, Jeong Eun; Choi, Eun Kyung; Lee, Sang-wook; Shin, Seong Soo; Yoon, Sang Min; Kim, Jong Hoon

2007-01-01

Background and purpose: To analyze the differences in intrafractional organ movement throughout the breathing cycles between the supine and prone positions using four-dimensional computed tomography (4D CT). Materials and methods: We performed 4D CT on nine volunteers in the supine and prone positions, with each examinee asked to breathe normally during scanning. The movement of abdominal organs in the cranio-caudal (CC), anterior-posterior (AP) and right-left (RL) directions was quantified by contouring on each phase between inspiration and expiration. Results: The mean intrafractional motions of the hepatic dome, lower tip, pancreatic head and tail, both kidneys, spleen, and celiac axis in the supine/prone position were 17.3/13.0, 14.4/11.0, 12.8/8.9, 13.0/10.0, 14.3/12.1, 12.3/12.6, 11.7/12.6 and 2.2/1.8 mm, respectively. Intrafractional movements of the liver dome and pancreatic head were reduced significantly in the prone position. The CC directional excursions were major determinants of the 3D displacements of the abdominal organs. Alteration from the supine to the prone position did not change the amount of intrafractional movements of kidneys, spleen, and celiac axis. Conclusion: There was a significant reduction in the movements of the liver and pancreas during the prone position, especially in the CC direction, suggesting possible advantage of radiotherapy to these organs in this position

Variations in Essential Oil Yield, Composition, and Antioxidant Activity of Different Plant Organs from Blumea balsamifera (L.) DC. at Different Growth Times.

Science.gov (United States)

Yuan, Yuan; Huang, Mei; Pang, Yu-Xin; Yu, Fu-Lai; Chen, Ce; Liu, Li-Wei; Chen, Zhen-Xia; Zhang, Ying-Bo; Chen, Xiao-Lu; Hu, Xuan

2016-08-05

Blumea balsamifera, also named Ainaxiang, is widely used as an ancient medicinal herb in tropical and subtropical Asia. It is rich in essential oils. In this work the essential oils of B. balsamifera from different plant organs and in different months were extracted, and then analyzed by gas chromatography-mass spectrometry. The results showed that essential oil yield of young leaves was the highest (0.65 mL/100 g), followed by mature leaves (0.57 mL/100 g), and the oil yield was higher in October (0.47 mL/100 g) than other months. A total of 44 compounds were identified, representing 92.64%-96.71% of the oil. Eighteen common chemical components were found among the six plant organs, representing >80% of the oil constituents. l-borneol was the main ingredient in leaves, and its content was the highest in senescent leaves and in December. In the essential oils of young shoots and young stems, the main component was dimethoxydurene. Antioxidant activity was also determined using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) and β-carotene bleaching (BCB) assays. The results indicated that the β-carotene bleaching activity was far stronger than the DPPH radical-scavenging capacity, and the young leaves and young shoots showed stronger antioxidant activity. Dimethoxydurene, β-caryophyllene, and α-caryophyllene play a positive role in good antioxidant activity, while β-eudesmol, phytol, and tetradecanal play a negative role. The antioxidant activity revealed in this study might help in developing this promising bioresource for use in the medicinal and cosmetic industries.

ORGANIC MATTER AND AGGREGATION OF A PLANOSOL UNDER DIFFERENT FOREST COVERINGS

Directory of Open Access Journals (Sweden)

Julia Kishida Bochner

2008-03-01

Full Text Available The litter quality can alter soil aggregation, modifying the transformation dynamics and allocation of soil carbon (Cin different compartments. This study evaluated the aggregate stability and its relation with litter chemical characteristics, organiccarbon and free light fraction (FLL from the organic matter under three different types of vegetation covering: secondary forest (FSand plantings of Mimosa Caesalpiniaefolia (PM and Carapa guianenses (PA with subsequently natural regeneration. Litter sampleswere characterized using polyfenols, lignin, suberine, tannin and holocelulose content and C/N relationship. Soil samples werecollected in two depths (0-10 and 10-20 cm and soil aggregation were estimate using mean weight diameter (DMP, mean geometricdiameter (DMG and index of aggregate stability (IEA analysis . Soil samples in the same depths were also characterized using C andFLL content. The highest suberine and polyfenols content of the litter found in the areas FS and PM reduced the speed of residuesdecomposition in the soil causing larger FLL content in both coverings. Those compositions contributed to the stabilization of C in themineral phase, because the highest C content was found in those areas. This fact is confirmed by the values of DMP, DMG and IEAamong the areas. They are higher in the coverings, PM and FS. It can be concluded that the polyfenols and suberine content weredecisive in the subdivision of C and in the aggregation of the soil in the areas of FS and PM.

Cross-national and lifestyle differences in consumer choice criteria and motives with regard to a processed organic food

DEFF Research Database (Denmark)

Thøgersen, John; Bredahl, Lone

Differences in consumer reasons and motives for choosing a processed organic food in four European countries are explored by means of a laddering study and controlled for food-related lifestyle (FRL). The main results are reported in the form of perceptual maps based on correspondence analysis...

Cross-national and lifestyle differences in consumer choice criteria and motives with regard to a processed organic food

DEFF Research Database (Denmark)

Thøgersen, John; Bredahl, Lone

2006-01-01

Differences in consumer reasons and motives for choosing a processed organic food in four European countries are explored by means of a laddering study and controlled for food-related lifestyle (FRL). The main results are reported in the form of perceptual maps based on correspondence analysis. C...

Anaerobic digestion of grain stillage at high organic loading rates in three different reactor systems

International Nuclear Information System (INIS)

Schmidt, Thomas; Pröter, Jürgen; Scholwin, Frank; Nelles, Michael

2013-01-01

In this study the anaerobic digestion of grain stillage in three different reactor systems (continuous stirred tank reactor, anaerobic sequencing batch reactor, fixed bed reactor) with and without immobilization of microorganisms was investigated to evaluate the performance during increase of the organic loading rate (OLR) from 1 to 10 g of volatile solids (VS) per liter reactor volume and day and decrease of the hydraulic retention time (HRT) from 40 to 6 days. No significant differences have been observed between the performances of the three examined reactor systems. The changes in OLR and HRT caused a reduction of the specific biogas production (SBP) of about 25% from about 650 to 550 L kg −1 of VS but would also diminish the necessary digester volume and investment costs of about 75% compared to the state of the art. -- Highlights: ► It was shown that without immobilization of microorganisms low HRT's are possible. ► No significant differences have been observed between different digester designs. ► Trace element supplementation is obligatory with grain stillage as substrate

Incorporating different vegetable oils into an aqueous dispersion of hybrid organic nanoparticles

Energy Technology Data Exchange (ETDEWEB)

Samyn, Pieter, E-mail: Pieter.Samyn@fobawi.uni-freiburg.de [Albert-Luedwigs-University Freiburg, Institute for Forest Utilization (Germany); Schoukens, Gustaaf [Ghent University, Department of Textiles (Belgium); Stanssens, Dirk; Vonck, Leo; Van den Abbeele, Henk [Topchim N.V. (Belgium)

2012-08-15

Different vegetable oils including soy oil, high-oleic sunflower oil, corn oil, castor oil (CO), rapeseed oil, and hydrogenated CO were added to the imidization reaction of poly(styrene-maleic anhydride) or SMA, with ammonium hydroxide in aqueous medium. The oils favorably reduce viscosity during ammonolysis of the anhydride moieties and increase the maximum solid content of the dispersed imidized SMA to at least 50 wt%, compared to a maximum of 35 wt% for pure imidized SMA. The viscosity of imidized SMA with polyunsaturated oils was generally larger than for monosaturated oils, but it was highest for COs due to high contents of hydroxyl groups. Depending on the oil reactivity, homogeneous or core-shell nanoparticles with 20-60 nm diameters formed. The interactions of oil and organic phase were studied by Fourier-transform infrared spectroscopy, indicating qualitative variances between different oils, the fraction imidized SMA and remaining fraction of ammonolyzed SMA without leakage of oil upon diluting the dispersion and precipitation at low pH. A quantitative analysis with calculation of imide contents, amounts of reacted oil and chemical interactions was made by Fourier-transform-Raman spectroscopy suggesting that most interactions take place around the unsaturated oil moieties and ammonolyzed anhydride.

Socioeconomic status moderates age-related differences in the brain's functional network organization and anatomy across the adult lifespan.

Science.gov (United States)

Chan, Micaela Y; Na, Jinkyung; Agres, Phillip F; Savalia, Neil K; Park, Denise C; Wig, Gagan S

2018-05-14

An individual's environmental surroundings interact with the development and maturation of their brain. An important aspect of an individual's environment is his or her socioeconomic status (SES), which estimates access to material resources and social prestige. Previous characterizations of the relation between SES and the brain have primarily focused on earlier or later epochs of the lifespan (i.e., childhood, older age). We broaden this work to examine the relationship between SES and the brain across a wide range of human adulthood (20-89 years), including individuals from the less studied middle-age range. SES, defined by education attainment and occupational socioeconomic characteristics, moderates previously reported age-related differences in the brain's functional network organization and whole-brain cortical structure. Across middle age (35-64 years), lower SES is associated with reduced resting-state system segregation (a measure of effective functional network organization). A similar but less robust relationship exists between SES and age with respect to brain anatomy: Lower SES is associated with reduced cortical gray matter thickness in middle age. Conversely, younger and older adulthood do not exhibit consistent SES-related difference in the brain measures. The SES-brain relationships persist after controlling for measures of physical and mental health, cognitive ability, and participant demographics. Critically, an individual's childhood SES cannot account for the relationship between their current SES and functional network organization. These findings provide evidence that SES relates to the brain's functional network organization and anatomy across adult middle age, and that higher SES may be a protective factor against age-related brain decline. Copyright © 2018 the Author(s). Published by PNAS.

Selective enhancement of main olfactory input to the medial amygdala by GnRH.

Science.gov (United States)

Blake, Camille Bond; Meredith, Michael

2010-03-04

In male hamsters mating behavior is dependent on chemosensory input from the main olfactory and vomeronasal systems, whose central pathways contain cell bodies and fibers of gonadotropin-releasing hormone (GnRH) neurons. In sexually naive males, vomeronasal organ removal (VNX), but not main olfactory lesions, impairs mating behavior. Intracerebroventricular (i.c.v.)-GnRH restores mating in sexually naive VNX males and enhances medial amygdala (Me) immediate-early gene activation by chemosensory stimulation. In sexually experienced males, VNX does not impair mating and i.c.v.-GnRH suppresses Me activation. Thus, the main olfactory system is sufficient for mating in experienced-VNX males, but not in naive-VNX males. We investigated the possibility that GnRH enhances main olfactory input to the amygdala in naive-VNX males using i.c.v.-GnRH and pharmacological stimulation (bicuculline/D,L-homocysteic acid mixture) of the main olfactory bulb (MOB). In sexually naive intact males there was a robust increase of Fos protein expression in the anteroventral medial amygdala (MeAv) with MOB stimulation, but no effect of GnRH. There was no effect of stimulation or GnRH in posterodorsal medial amygdala (MePd). In naive-VNX animals, GnRH increased Fos in MeAv and MePv. Only combined MOB stimulation and i.c.v.-GnRH produced a significant increase in Fos in the dorsal (reproduction-related) portion of MeP (MePd). When the animals were sexually experienced before VNX, a condition in which GnRH does not enhance mating, i.c.v.-GnRH combined with MOB stimulation suppressed Fos expression in MePd. This suggests a more selective effect of GnRH on olfactory input in MePd than elsewhere in medial amygdala of VNX males. 2009 Elsevier B.V. All rights reserved.

Characterization of Skeletonema costatum Intracellular Organic Matter and Study of Nanomechanical Properties under Different Solution Conditions

KAUST Repository

Gutierrez, Leonardo

2016-06-17

In the current investigation, a rigorous characterization of the high molecular weight (HMW) compounds of Skeletonema costatum (SKC) intracellular organic matter (IOM), including nanomechanical properties, was conducted. HMW SKC-IOM was characterized as a mixture of polysaccharides, proteins, and lipids. Atomic force microscopy (AFM) provided crucial information of this isolate at a nanoscale resolution. HMW SKC-IOM showed highly responsive to solution chemistry: fully extended chains at low ionic strength, and compressing structures with increasing electrolyte concentration in solution. Interestingly, two regions of different nanomechanical properties were observed: (a) Region #1: located farther from the substrate and showing extended polymeric chains, and (b) Region #2: located <10 nm above the substrate and presenting compressed structures. The polymer length, polymer grafting density, and compressibility of these two regions were highly influenced by solution conditions. Results suggest that steric interactions originating from HMW SKC-IOM polymeric structure would be a dominant interacting mechanism with surfaces. The current investigation has successfully applied models of polymer physics to describe the complex HMW SKC-IOM structural conformation at different solution conditions. The detailed methodology presented provides a tool to characterize and understand biopolymers interactions with surfaces, including filtration membranes, and can be extended to other environmentally relevant organic compounds.

Knowledge Organization = Information Organization?

DEFF Research Database (Denmark)

Hjørland, Birger

Are the terms ―information organization‖ (IO), ―organization of information‖ (OI) and ―information architecture‖ (IA) synonyms for knowledge organization (KO)? This study uses bibliometric methods, among others, to determine some relations between these terms and their meanings. Apparently the data...... shows that these terms should not be considered synonyms because each of the terms IO, OI, IA and KO produce a different set of high ranked authors, journals and papers. In many cases the terms are, however, used interchangeably (and thus indicating synonymity) and it is argued that the underlying...

A double stage dry-wet-fermentation process for a fast and safe digestion of different kinds of organic material

International Nuclear Information System (INIS)

Busch, G.; Sieber, M.; Buschmann, J.; Burkhardat, M.

2009-01-01

The fermentation of organic material is a four-step-process. It is admissible to merge the first two steps (hydrolysis and acidification) to hydrolysis in general and the last two steps (aceto genesis and methano genesis) to methano genesis. The Brandenburg University of Technology in Cottbus has devised a double stage dry-wet-fermentation process for fast and safe anaerobic degradation. Using these processes, it is possible to decompose different kinds of organic material like renewable material (e. g. maize silage), waste (e. g. household-waste) and industrial material (e. g. glycerine). (Author)

CRP and suPAR are differently related to anthropometry and subclinical organ damage

DEFF Research Database (Denmark)

Lyngbæk, Stig; Sehestedt, Thomas; Marott, Jacob L

2013-01-01

BACKGROUND: Low-grade inflammation is a marker for cardiovascular disease (CVD). The inflammatory biomarkers C-reactive protein (CRP) and soluble urokinase plasminogen activator receptor (suPAR) independently predict CVD. We tested the hypothesis that these biomarkers reflect different aspects...... of the inflammation associated with CVD. METHODS: We studied 2273 subjects without CVD. Log-transformed CRP and suPAR were included in general linear and logistic regression models to compare associations with measures of anthropometry and subclinical organ damage (SOD). Owing to interactions on body mass index (BMI......) (P3: 1.31 (1.16-1.47), whereas log-CRP was not (1.00 (0.89-1.11))). CONCLUSIONS: CRP is positively associated with anthropometric measures, whereas suPAR is linked to endothelial dysfunction and atherosclerosis....

Cancer screening in Portugal: sex differences in prevalence, awareness of organized programmes and perception of benefits and adverse effects.

Science.gov (United States)

Costa, Ana Rute; Silva, Susana; Moura-Ferreira, Pedro; Villaverde-Cabral, Manuel; Santos, Osvaldo; Carmo, Isabel do; Barros, Henrique; Lunet, Nuno

2017-04-01

Cancer screening has contributed to downward trends in cancer mortality, but is also associated with adverse effects, which highlights the importance of promoting the participation based on informed decisions. We aimed to describe the use of cancer screening (either in organized programmes or as opportunistic screening), awareness of organized programmes and perception of its potential benefits and adverse effects, depicting possible sex differences. We evaluated 1624 Portuguese-speaking dwellers, aged between 16 and 79 years, through face-to-face interviews. To quantify sex differences, adjusted prevalence ratios and respective 95% confidence intervals were computed using Poisson regression. Among eligible age groups, the lifetime prevalence of screening for breast and cervical cancers was 89.8 and 71.9%, respectively. The prevalence was 23.7% for colorectal cancer and no significant sex differences were observed. Prostate cancer screening was reported by 63.8% of men. Over half of the participants referred that cancers such as prostate, skin, lung and stomach should be screened for, in addition to those for which organized programmes are recommended. Reassurance by negative results was identified as the main potential benefit of screening by nearly one-third of men and women. Anxiety while waiting for results was the most mentioned potential adverse effect (60.4%); men refer less often this and financial costs, although statistical significance of these results was borderline. This study provides a benchmark to plan and monitor the effects of awareness-raising interventions, as well as for international comparisons across countries with different cancer prevention and control structures. © 2016 The Authors. Health Expectations Published by John Wiley & Sons Ltd.

Persistent organic pollutants (POPs) in fish with different feeding habits inhabiting a shallow lake ecosystem.

Science.gov (United States)

Barni, María F Silva; Ondarza, Paola M; Gonzalez, Mariana; Da Cuña, Rodrigo; Meijide, Fernando; Grosman, Fabián; Sanzano, Pablo; Lo Nostro, Fabiana L; Miglioranza, Karina S B

2016-04-15

The occurrence of persistent organic pollutants (POPs) in the environment can affect organisms inhabiting aquatic systems, in particular shallow lakes that are vulnerable to environmental stressors. This study aimed to assess POPs accumulation and changes at histological and physiological levels in tissues of three fish species with different trophic habits. Gills, brain, muscle, liver and gonads of Odontesthes bonariensis, Oligosarcus jenynsii and Cyphocharax voga were collected from the shallow lake La Peregrina, located in an agricultural area from Argentina. In addition, contaminant levels in surface water (SW), suspended particulate matter (SPM) and bottom sediments (BS) were assessed. Histological lesions were evaluated in fish tissues and levels of vitellogenin (VTG) were assessed in plasma of male fish in order to correlate these alterations with the presence of POPs in the environment. Organochlorine pesticides (OCPs), polychlorinated biphenyls (PCBs) and polybrominated diphenyl ethers (PBDEs) were determined by GC-ECD. Biotic and abiotic samples showed the same POPs distribution pattern: OCPs>PCBs>PBDEs. Although tissue distribution of OCPs was species-specific, muscle showed the lowest levels in all species. The most abundant contaminants were endosulfans, suggesting their widespread use in the area. O. bonariensis showed the highest endosulfans levels in liver (184.2-219ngg(-1)wet w), which was associated with the high SPM levels considering this species is a filter feeder. The occurrence of PCBs and PBDEs shows the ubiquity of these pollutants in the area. Histological lesions in gills and liver of O. bonariensis and O. jenynsii, might be related with the high levels of endosulfans in these organs. The detection of VTG in males warns about a possible exposure to estrogenic compounds in the environment. In conclusion, the simultaneous exposure of fish to multiple environmental pollutants leads to different alterations, so measures should be taken in

From sexual attraction to maternal aggression: when pheromones change their behavioural significance.

Science.gov (United States)

Martín-Sánchez, Ana; McLean, Lynn; Beynon, Robert J; Hurst, Jane L; Ayala, Guillermo; Lanuza, Enrique; Martínez-Garcia, Fernando

2015-02-01

This article is part of a Special Issue "Chemosignals and Reproduction". This paper reviews the role of chemosignals in the socio-sexual interactions of female mice, and reports two experiments testing the role of pup-derived chemosignals and the male sexual pheromone darcin in inducing and promoting maternal aggression. Female mice are attracted to urine-borne male pheromones. Volatile and non-volatile urine fractions have been proposed to contain olfactory and vomeronasal pheromones. In particular, the male-specific major urinary protein (MUP) MUP20, darcin, has been shown to be rewarding and attractive to females. Non-urinary male chemosignals, such as the lacrimal protein ESP1, promote lordosis in female mice, but its attractive properties are still to be tested. There is evidence indicating that ESP1 and MUPs are detected by vomeronasal type 2 receptors (V2R). When a female mouse becomes pregnant, she undergoes dramatic changes in her physiology and behaviour. She builds a nest for her pups and takes care of them. Dams also defend the nest against conspecific intruders, attacking especially gonadally intact males. Maternal behaviour is dependent on a functional olfactory system, thus suggesting a role of chemosignals in the development of maternal behaviour. Our first experiment demonstrates, however, that pup chemosignals are not sufficient to induce maternal aggression in virgin females. In addition, it is known that vomeronasal stimuli are needed for maternal aggression. Since MUPs (and other molecules) are able to promote intermale aggression, in our second experiment we test if the attractive MUP darcin also promotes attacks on castrated male intruders by lactating dams. Our findings demonstrate that the same chemosignal, darcin, promotes attraction or aggression according to female reproductive state. Copyright © 2014 Elsevier Inc. All rights reserved.

Main: FEB1 [TP Atlas

Lifescience Database Archive (English)

Full Text Available y in urban areas - Male peptide pheromone ESP1 regulates female reproductive behavior...male tear fluids Various social behaviors in mice are regulated by chemical signals called pheromones that a... and neural mechanisms that are involved in the decoding of ESP family signals in the vomeronasal system, which leads to behavior

Conifer reproductive development involves B-type MADS-box genes with distinct and different activities in male organ primordia.

Science.gov (United States)

Sundström, Jens; Engström, Peter

2002-07-01

The Norway spruce MADS-box genes DAL11, DAL12 and DAL13 are phylogenetically related to the angiosperm B-function MADS-box genes: genes that act together with A-function genes in specifying petal identity and with C-function genes in specifying stamen identity to floral organs. In this report we present evidence to suggest that the B-gene function in the specification of identity of the pollen-bearing organs has been conserved between conifers and angiosperms. Expression of DAL11 or DAL12 in transgenic Arabidopsis causes phenotypic changes which partly resemble those caused by ectopic expression of the endogenous B-genes. In similar experiments, flowers of Arabidopsis plants expressing DAL13 showed a different homeotic change in that they formed ectopic anthers in whorls one, two or four. We also demonstrate the capacity of the spruce gene products to form homodimers, and that DAL11 and DAL13 may form heterodimers with each other and with the Arabidopsis B-protein AP3, but not with PI, the second B-gene product in Arabidopsis. In situ hybridization experiments show that the conifer B-like genes are expressed specifically in developing pollen cones, but differ in both temporal and spatial distribution patterns. These results suggest that the B-function in conifers is dual and is separated into a meristem identity and an organ identity function, the latter function possibly being independent of an interaction with the C-function. Thus, even though an ancestral B-function may have acted in combination with C to specify micro- and megasporangia, the B-function has evolved differently in conifers and angiosperms.

Interactive effects of temperature and UVB radiation on methane emissions from different organs of pea plants grown in hydroponic system.

Science.gov (United States)

Abdulmajeed, Awatif M; Derby, Samantha R; Strickland, Samantha K; Qaderi, Mirwais M

2017-01-01

There is no information on variation of methane (CH 4 ) emissions from plant organs exposed to multiple environmental factors. We investigated the interactive effects of temperature and ultraviolet-B (UVB) radiation on CH 4 emissions from different organs of pea (Pisum sativum L. var. UT234 Lincoln). Plants were grown hydroponically under two temperatures (22/18°C and 28/24°C; 16h day/8h night) and two levels of UVB radiation [0 and 5kJm -2 d -1 ] in controlled-environment growth chambers for ten days, after two weeks of initial growth under ambient temperatures. Methane emission, dry mass, growth index, electrical conductivity (EC), pectin, total chlorophyll content, gas exchange and flavonoids were measured in the appropriate plant organs - leaf, stem and root. Higher temperatures increased CH 4 emissions, leaf mass ratio, and shoot: root mass ratio. Neither temperature nor UVB had significant effects on leaf, stem, root and total dry mass, EC, pectin, total chlorophyll, as well as specific leaf mass. Among plant organs, there were differences in CH 4 , EC, pectin and total chlorophyll. Methane and EC were highest for the stem and lowest for the leaf; leaf had highest, but stem had lowest, pectin content; total chlorophyll was highest in the leaf but lowest in the root. Higher temperatures decreased leaf flavonoids, net carbon dioxide assimilation, and water use efficiency. Overall, environmental stressors increased aerobic CH 4 emission rates, which varied with plant organs. Copyright © 2016 Elsevier B.V. All rights reserved.

Evaluation of absorbed dose in organs far from the target volume for different therapies of head and neck cancer

International Nuclear Information System (INIS)

Pletsch, Cristiana

2013-01-01

Many advances in radiotherapy are the result of innovations in technology and engineering as well as the information technology revolution applied to the treatment planning of patients. The intensity modulated radiation therapy (lMRT) is a sophisticated treatment technique that allows the concentration of the dose prescribed by radiotherapist in tumor volume, while sparing healthy tissues that surround it. However, the disadvantage of the technique is a potential induction of secondary cancers in distant organs related to the target volume due to leakage and scattered radiation, which generate these higher doses to the distant organs when compared to those measured in conventional treatments. These higher doses are is due to the greater use of monitor units and a larger amount of treatment fields. In this study the absorbed dose values in distant organs from the head and neck region were assessed, comparing conventional treatments and treatments using the IMRT techniques. The evaluation was made considering the assessment of dose in radiological significant organs distant from the treatment area. All measurements were performed using the RANDO Alderson anthropomorphic phantom that has internal components equivalent to muscle, bones and lungs and is sliced for placing thermoluminescent detectors in appropriate holes existing in the slices. This phantom, tilled with TLD-100 dosimeters, was submitted to a head and neck treatment with a cobalt-60 irradiator and a Trilogy linear accelerator. Three treatments were carried out with the accelerator, namely a conventional one and two treatments of IMRT with different complexities, all treatments using the 6MV beam. The results show that IMRT techniques generate large doses in distant organs when compared to those generated due to the conventional 6 MV beam treatment. However, these doses are not very different from those measured in the case of 60 Co treatment. (author)

Evaluation of Biogenic Amines in Organic and Non-Organic Wines by HPLC OPA Derivatization

Directory of Open Access Journals (Sweden)

Ali Üren

2007-01-01

Full Text Available Organic and non-organic wines, selected on the basis of consumers’ preference towards healthy products, were produced from the grapes of Vitis vinifera varieties Semillon, Colombard, Cabernet Sauvignon, Merlot and Carignan and possible effects of different wine making techniques were considered. Concentrations of histamine, tyramine, putrescine, cadaverine, ethylamine, methylamine, tryptamine, agmatine and β-phenylethylamine were quantified by HPLC fluorescence detection of o-phthaldialdehyde (OPA derivatives. The order of analyzed parameters in all wines from the highest to the lowest quantities was determined as follows: putrescine > histamine > ethylamine > methylamine > agmatine > tyramine > cadaverine > tryptamine. One of the analyzed compounds (β-phenylethylamine was not detected. The highest average values for organic and non-organic wines were found as follows (in mg/L: putrescine 5.55, ethylamine 0.825 and histamine 0.628 in organic wines, and putrescine 3.68, histamine 1.14 and agmatine 0.662 in non-organic wines. Considering the wine type (organic/non-organic, an important difference was determined for putrescine. Putrescine content in organic wines was significantly greater than in non-organic ones (p=0.008. Evaluating colour of wines (white/red, a statistically significant difference was obtained for methylamine (p=0.028. Taking into account only grape varieties, statistically significant differences were found for histamine, methylamine, tyramine and cadaverine (p<0.05. The results of principal component analysis demonstrated close relations between the following biogenic amines and wines: agmatine and non-organic Colombard; tryptamine or cadaverine and both organic and non-organic Cabernet Sauvignon wines.

ANALISIS TUMBUH SELADA (LACTUCA SATIVA L) PADA PERBEDAAN JENIS PUPUK ORGANIK CAIR ( Lettuce (Lactuca Sativa L) Growth Analysis At Different Type Of Liquid Organic Fertilizer)

OpenAIRE

Duaja, Made Deviani; Arzita, .; Redo, Yan

2012-01-01

The objectives of this research are to analysis the growth and yield of Lettuce (Lactuca sativa L) at different type of organic liquid fertilizers. The experiment has conducted at Agriculture Faculty Research Farm, Jambi University. Six treatments were arranged in Randomized Completed Block Design. The treatments are kinds of liquid organic fertilizers, they are P0 (none of liquid organic fertilizers), P1 (Golden Harvest liquid organic fertilizers), P2 (NASA liquid organic fertilizers), P3 (C...

Organ donations after death

Directory of Open Access Journals (Sweden)

Bernarda Logar

2003-09-01

Full Text Available The paper discusses public opinion on post-mortem organ donation, especially the difference between high support of public opinion to transplant activity, its general readiness to donate organs and the low number of signed organ donor cards. Through different approaches the article tries to point out possible factors relevant to the decision to donate organs. Early studies showed demographic variables and information as significant factors when deciding to donate organs after death. As there was not enough evidence that long-term effect through these factors is significant, the need for new investigation has grown. Social cognition theories helped understanding the difference mentioned above. It seems that the use of this approach might contribute to the understanding the problem and to delimit most useful factors when working with public.

Gender differences in Reasons for Sickness Presenteeism - a study among GPs in a Swedish health care organization.

Science.gov (United States)

Gustafsson Sendén, Marie; Schenck-Gustafsson, Karin; Fridner, Ann

2016-01-01

It is common that physicians go to work while sick and therefore it is important to understand the reasons behind. Previous research has shown that women and men differ in health and health related behavior. In this study, we examine gender differences among general practitioners who work while sick. General practitioners (GP's) working in outpatient care in a Swedish city participated in the study (n = 283; women = 63 %; response rate = 41 %). Data were obtained from a large web-based questionnaire about health and organization within primary care. Two questions about sickness presenteeism (going to work while sick) were included; life-long and during the past 12 months, and five questions about reasons. We controlled for general health, work-family conflict and demographic variables. Female physicians reported sickness presenteeism more often than male physicians. Work-family conflict mediated the association between gender and sickness presenteeism. Women reported reasons related with "concern for others" and "workload" more strongly than men. Men reported reasons related with "capacity" and "money" more strongly than women. These differences are likely effects of gender stereotyping and different family-responsibilities. Gender socialization and gender stereotypes may influence work and health-related behavior. Because sickness presenteeism is related with negative effects both on individuals and at organizational levels, it is important that managers of health organizations understand the reasons for this, and how gender roles may influence the prevalence of sickness presenteeism and the reasons that female and male GPs give for their behavior.

Performance and behaviour of chickens with different growing rate reared according to the organic system

Directory of Open Access Journals (Sweden)

Marcella Bernardini

2010-01-01

Full Text Available The performance and the behaviour of three different chicken strains, reared according to the EEC-Regulation 1804/1999  on organic system, were compared. The strains had very slow (Robusta maculata, slow (Kabir and fast (Ross growing  rates, respectively. The trial was carried out on 200 chickens (male and female per strain. Rearing lasted 81 days as  required by the EEC Regulation. At slaughter age, 20 birds per group were killed. Robusta maculata and Kabir chickens  showed more intense walking activity and better foraging aptitude; their antioxidant capacity was also superior. Ross  chickens had a good growth rate and feed conversion index, reaching an excellent body weight, but the mortality and  the culling rate were high indicating that fast-growing strains do not adapt well to organic production. Robusta macula-  ta showed the worst productive performance although the mortality was low and Kabir birds gave intermediate results.  The carcass traits were the best in Ross and the poorest in Robusta maculata. Male chickens were heavier and leaner  than females. 

Harnessing demographic differences in organizations: What moderates the effects of workplace diversity?

Science.gov (United States)

Dawson, Jeremy F.; Otaye‐Ebede, Lilian; Woods, Stephen A.; West, Michael A.

2015-01-01

Summary To account for the double‐edged nature of demographic workplace diversity (i.e,. relational demography, work group diversity, and organizational diversity) effects on social integration, performance, and well‐being‐related variables, research has moved away from simple main effect approaches and started examining variables that moderate these effects. While there is no shortage of primary studies of the conditions under which diversity leads to positive or negative outcomes, it remains unclear which contingency factors make it work. Using the Categorization‐Elaboration Model as our theoretical lens, we review variables moderating the effects of workplace diversity on social integration, performance, and well‐being outcomes, focusing on factors that organizations and managers have control over (i.e., strategy, unit design, human resource, leadership, climate/culture, and individual differences). We point out avenues for future research and conclude with practical implications. © 2015 The Authors. Journal of Organizational Behavior published by John Wiley & Sons, Ltd PMID:28239234

Harnessing demographic differences in organizations: What moderates the effects of workplace diversity?

Science.gov (United States)

Guillaume, Yves R F; Dawson, Jeremy F; Otaye-Ebede, Lilian; Woods, Stephen A; West, Michael A

2017-02-01

To account for the double-edged nature of demographic workplace diversity (i.e,. relational demography, work group diversity, and organizational diversity) effects on social integration, performance, and well-being-related variables, research has moved away from simple main effect approaches and started examining variables that moderate these effects. While there is no shortage of primary studies of the conditions under which diversity leads to positive or negative outcomes, it remains unclear which contingency factors make it work. Using the Categorization-Elaboration Model as our theoretical lens, we review variables moderating the effects of workplace diversity on social integration, performance, and well-being outcomes, focusing on factors that organizations and managers have control over (i.e., strategy, unit design, human resource, leadership, climate/culture, and individual differences). We point out avenues for future research and conclude with practical implications. © 2015 The Authors. Journal of Organizational Behavior published by John Wiley & Sons, Ltd.

Exploring network organization in practice

DEFF Research Database (Denmark)

Hu, Yimei; Sørensen, Olav Jull

Constructing a network organization for global R&D is presented as a common sense practice in existing literature. However, there are still queries about the network organization, such as the persistence of hierarchies which make a network organization merely a “bureaucracy-lite” organization....... Furthermore, in practice, we rarely see radical organizational change towards a network organization that adopts an internal market. The co-existence of market, hierarchy and network triggered research interest. A multiple case study of three transnational corporations’ global R&D organization shows...... that there are different logical considerations when designing a network organization to facilitate innovation. I identify three types of network organizations: market-led, directed and culture-led network organizations. Different types of network organizations show that organizations are dual and even ternary systems...

Strategic management and performance differences: nonprofit versus for-profit health organizations.

Science.gov (United States)

Reeves, Terrie C; Ford, Eric W

2004-01-01

Despite mixed and contradictory findings, for-profits (FPs) and nonprofits (NPs) are assumed to be similar health services organizations (HSOs). In this study, a fifteen-item scale assessing HSOs' strategic management capacity was developed and tested using fifty-seven FP and twenty NP organizations. Then, using item response theory, the items were hierarchically profiled to produce two strategic profile models, a general and an FP anchored model. We find that deviation from the general profile, but not capability attainment level, is related to two of three financial measures. We conclude that studying FPs and NPs together is appropriate.

Effect of vermicomposting on calcium, sulphur and some heavy metal content of different biodegradable organic wastes under liming and microbial inoculation.

Science.gov (United States)

Das, Debabrata; Bhattacharyya, Pradip; Ghosh, B C; Banik, Pabitra

2012-01-01

A study was conducted to evaluate the changes in total calcium and sulphur and some heavy metal (Zn, Cu, and Pb) concentration of different organic wastes affected by liming and microorganism inoculation. Vermicomposting was an effective technology for disposal of organic substrates like municipal solid wastes (MSW), possessing comparatively higher concentration of heavy metals. The addition of lime in initial organic substrates significantly (P ≤ 0.05) increased total calcium and total sulphur content of vermicomposts. Inoculation of microorganisms significantly (P ≤ 0.05) reduced the heavy metal content of final products as compared to control. Fungal strains were comparatively more effective in detoxification of heavy metals than B. polymyxa.

[Soil Microbial Respiration Under Different Soil Temperature Conditions and Its Relationship to Soil Dissolved Organic Carbon and Invertase].

Science.gov (United States)

Wu, Jing; Chen, Shu-tao; Hu, Zheng-hua; Zhang, Xu

2015-04-01

In order to investigate the soil microbial respiration under different temperature conditions and its relationship to soil dissolved organic carbon ( DOC) and invertase, an indoor incubation experiment was performed. The soil samples used for the experiment were taken from Laoshan, Zijinshan, and Baohuashan. The responses of soil microbial respiration to the increasing temperature were studied. The soil DOC content and invertase activity were also measured at the end of incubation. Results showed that relationships between cumulative microbial respiration of different soils and soil temperature could be explained by exponential functions, which had P values lower than 0.001. The coefficient of temperature sensitivity (Q10 value) varied from 1.762 to 1.895. The Q10 value of cumulative microbial respiration decreased with the increase of soil temperature for all soils. The Q10 value of microbial respiration on 27 days after incubation was close to that of 1 day after incubation, indicating that the temperature sensitivity of recalcitrant organic carbon may be similar to that of labile organic carbon. For all soils, a highly significant ( P = 0.003 ) linear relationship between cumulative soil microbial respiration and soil DOC content could be observed. Soil DOC content could explain 31.6% variances of cumulative soil microbial respiration. For the individual soil and all soils, the relationship between cumulative soil microbial respiration and invertase activity could be explained by a highly significant (P soil microbial respiration.

Human health implications of organic food and organic agriculture: a comprehensive review.

Science.gov (United States)

Mie, Axel; Andersen, Helle Raun; Gunnarsson, Stefan; Kahl, Johannes; Kesse-Guyot, Emmanuelle; Rembiałkowska, Ewa; Quaglio, Gianluca; Grandjean, Philippe

2017-10-27

This review summarises existing evidence on the impact of organic food on human health. It compares organic vs. conventional food production with respect to parameters important to human health and discusses the potential impact of organic management practices with an emphasis on EU conditions. Organic food consumption may reduce the risk of allergic disease and of overweight and obesity, but the evidence is not conclusive due to likely residual confounding, as consumers of organic food tend to have healthier lifestyles overall. However, animal experiments suggest that identically composed feed from organic or conventional production impacts in different ways on growth and development. In organic agriculture, the use of pesticides is restricted, while residues in conventional fruits and vegetables constitute the main source of human pesticide exposures. Epidemiological studies have reported adverse effects of certain pesticides on children's cognitive development at current levels of exposure, but these data have so far not been applied in formal risk assessments of individual pesticides. Differences in the composition between organic and conventional crops are limited, such as a modestly higher content of phenolic compounds in organic fruit and vegetables, and likely also a lower content of cadmium in organic cereal crops. Organic dairy products, and perhaps also meats, have a higher content of omega-3 fatty acids compared to conventional products. However, these differences are likely of marginal nutritional significance. Of greater concern is the prevalent use of antibiotics in conventional animal production as a key driver of antibiotic resistance in society; antibiotic use is less intensive in organic production. Overall, this review emphasises several documented and likely human health benefits associated with organic food production, and application of such production methods is likely to be beneficial within conventional agriculture, e.g., in integrated

Bottoming organic Rankine cycle for a small scale gas turbine: A comparison of different solutions

International Nuclear Information System (INIS)

Clemente, Stefano; Micheli, Diego; Reini, Mauro; Taccani, Rodolfo

2013-01-01

Highlights: ► The ORC bottoming section for a commercial micro gas turbine has been studied. ► Six different organic working fluids have been considered and compared. ► The preliminary designs of both axial and radial turbines have been developed. ► Also scroll and reciprocating expanders have been analyzed for comparison. ► The best suited machine has to be selected after a detailed analysis in each case. - Abstract: Recently, several efforts have been devoted to the improvement of the thermal efficiency of small gas turbines, in order to approach the typical values of the internal combustion engines in the same range of power. One possibility is represented by a combined cycle, obtained coupling the gas turbine to a bottoming organic Rankine cycle (ORC). This paper deals with the definition of the main features of an ORC system aimed to recover heat from a 100 kWe commercial gas turbine with internal recuperator. After the optimization of the thermodynamic cycles, involving a comparison between six working fluids, different expanders are analyzed, with the aim of detecting, if possible, the best suited machine. First, single stage turbines, in both radial and axial flow configuration, are designed specifically for each considered fluid, in particular investigating the opportunity of mounting the ORC expander directly on the high-speed shaft of the gas turbine. Then, the performances of these dynamic machines are compared with those of positive displacement expanders, such as scroll devices, obtainable from commercial HVAC compressor with minor revisions, and reciprocating ones, here newly designed

The effect of different tillage methods and organic fertilizers on soil physical state and crop yield

OpenAIRE

Ožeraitienė, Danutė; Čiuberkis, Steponas

2006-01-01

The present paper summarises the data of field and laboratory trials conducted in Lithuania (Vežaiciai Branch of the Lithuanian Institute of Agriculture) during the period 2003-2006. The effects of primary soil tillage: 1) deep (22-25 cm) ploughing; 2) shallow (10-12 cm) ploughing; 3) shallow (8-10 cm) tillage with a disc harrow as well as the effects of different organic fertilizers (farmyard manure, green manure and straw) on the main physical indicators of moraine loam soil (structure, bul...

Assessing the process and content of strategy in different organizations

NARCIS (Netherlands)

Romme, A.G.L.; Kunst, P.; Schreuder, H.; Spangenberg, J.

1990-01-01

This paper deals with a quantitative assessment of strategy content and strategy process characteristics. The framework used is based on the concept of strategic logics. The empirical study involves six organizations in The Netherlands. Both the content and the process dimension of strategy-making

Changes in plasma melatonin levels and pineal organ melatonin synthesis following acclimation of rainbow trout (Oncorhynchus mykiss) to different water salinities.

Science.gov (United States)

López-Patiño, Marcos A; Rodríguez-Illamola, Arnau; Gesto, Manuel; Soengas, José L; Míguez, Jesús M

2011-03-15

Melatonin has been suggested to play a role in fish osmoregulation, and in salmonids has been related to the timing of adaptive mechanisms during smolting. It has been described that acclimation to different environmental salinities alters levels of circulating melatonin in a number of fish species, including rainbow trout. However, nothing is known regarding salinity effects on melatonin synthesis in the pineal organ, which is the main source of rhythmically produced and secreted melatonin in blood. In the present study we have evaluated, in rainbow trout, the effects of acclimation to different salinities on day and night plasma melatonin values and pineal organ melatonin synthesis. Groups of freshwater (FW)-adapted rainbow trout were placed in tanks with four different levels of water salinity (FW, 6, 12, 18 p.p.t.; parts per thousand) and maintained for 6 h or 5 days. Melatonin content in plasma and pineal organs, as well as the pineal content of serotonin (5-HT) and its main oxidative metabolite (5-hydroxyindole-3-acetic acid; 5-HIAA) were measured by high performance liquid chromatography. In addition, day-night changes in pineal organ arylalkylamine N-acetyltransferase (AANAT2) activity and aanat2 gene expression were studied. Plasma osmolalities were found to be higher in rainbow trout exposed to all salinity levels compared with the control FW groups. A salinity-dependent increase in melatonin content was found in both plasma and pineal organs. This effect was observed during the night, and was related to an increase in aanat2 mRNA abundance and AANAT2 enzyme activity, both of which also occurred during the day. Also, the levels of indoles (5-HT, 5-HIAA) in the pineal organ were negatively affected by increasing water salinity, which seems to be related to the higher recruitment of 5-HT as a substrate for the increased melatonin synthesis. A stimulatory effect of salinity on pineal aanat2 mRNA expression was also identified. These results indicate that

Pulsed electric field processing of different fruit juices: impact of pH and temperature on inactivation of spoilage and pathogenic micro-organisms.

Science.gov (United States)

Timmermans, R A H; Nierop Groot, M N; Nederhoff, A L; van Boekel, M A J S; Matser, A M; Mastwijk, H C

2014-03-03

Pulsed electrical field (PEF) technology can be used for the inactivation of micro-organisms and therefore for preservation of food products. It is a mild technology compared to thermal pasteurization because a lower temperature is used during processing, leading to a better retention of the quality. In this study, pathogenic and spoilage micro-organisms relevant in refrigerated fruit juices were studied to determine the impact of process parameters and juice composition on the effectiveness of the PEF process to inactivate the micro-organisms. Experiments were performed using a continuous-flow PEF system at an electrical field strength of 20 kV/cm with variable frequencies to evaluate the inactivation of Salmonella Panama, Escherichia coli, Listeria monocytogenes and Saccharomyces cerevisiae in apple, orange and watermelon juices. Kinetic data showed that under the same conditions, S. cerevisiae was the most sensitive micro-organism, followed by S. Panama and E. coli, which displayed comparable inactivation kinetics. L. monocytogenes was the most resistant micro-organism towards the treatment conditions tested. A synergistic effect between temperature and electric pulses was observed at inlet temperatures above 35 °C, hence less energy for inactivation was required at higher temperatures. Different juice matrices resulted in a different degree of inactivation, predominantly determined by pH. The survival curves were nonlinear and could satisfactorily be modeled with the Weibull model. Copyright © 2013 Elsevier B.V. All rights reserved.

Structural organization of psychological defenses and coping strategies of preschool teachers with different levels of professional burnout

Directory of Open Access Journals (Sweden)

Тетяна Анатоліївна Колтунович

2015-10-01

Full Text Available The article deals with the actual problem of modern education system – preschool teachers’ professional burnout. Assumptions about the existence of the relationship between professional burnout, coping strategies and mechanisms of psychological defenses; about the determination of burnout at different stages of its formation according to the structural organization of coping and psychological defenses were empirically proven, and their leading and basic components were defined

[Overview of organic agriculture development.

Science.gov (United States)

Liu, Xiao Mei; Yu, Hong Jun; Li, Qiang; Jiang, Wei Jie

2016-04-22

This paper introduced the concepts of organic agriculture as defined by different international organizations, origin and theoretical development of organic agriculture, as well as its developing trajectory in China (i.e. a late start followed by rapid growth compared to developed countries). The differences between domestic and international organic agriculture were illustrated by scale, crop types, production standards, inputs and planting techniques. Constraints limiting improvements to organic agriculture in aspects of standards, technology, marketing, certification, environmental pollution, enterprise reputation, and national policies were discussed. Future directions and strategies for developing healthy organic agriculture in China were provided.

Organic photovoltaic films

OpenAIRE

Nelson, Jenny

2002-01-01

Organic electronic materials are of interest for future applications in solar cells. Although results for single layer organic materials have been disappointing, high photocurrent quantum efficiencies can be achieved in composite systems including both electron donating and electron accepting components. Efficiencies of over 2% have now been reported in four different types of organic solar cell. Performance is limited by the low red absorption of organic materials, poor charge transport, and...

[Accumulation of soil organic carbon and total nitrogen in Pinus yunnanensis forests at different age stages].

Science.gov (United States)

Miao, Juan; Zhou, Chuan-Yan; Li, Shi-Jie; Yan, Jun-Hua

2014-03-01

Taking three Pinus yunnanensis forests at different ages (19, 28 and 45 a) in Panxian County of Guizhou Province as test objects, we investigated vertical distributions and accumulation rates of soil organic carbon (SOC) and total nitrogen (TN), as well as their relationships with soil bulk density. For the three forests at different age stages, SOC and TN changed consistently along the soil profile, declining with the soil depth. Both SOC and TN storage increased with the forest age. The SOC and TN storage amounts were 96.24, 121.65 and 148.13 t x hm(-2), and 10.76, 12.96 and 13.08 t x hm(-2) for the forest stands with 19 a, 28 a and 45 a, respectively. SOC had a significant positive correlation with soil TN, while both of them had a significant negative relationship with the soil bulk density. The accumulation rates of both SOC and TN storage at different growth periods were different, and the rate in the period from age 19 to 28 was higher than in the period from age 28 to 45.

Organizations Utilize Lateral Relationships

OpenAIRE

Jacqueline C.

2017-01-01

The structures that subscribe to different organization play a major role and determine how information flows throughout an organization as well as the reporting structure within the organization. In some organization, decision making rely with the top management, and in other organizations, decision making responsibilities may be distributed within the organization. The latter part is what mainly constitutes a lateral structural arrangement where various departments work hand in hand in achi...

Organic and Conventional Dairy Farmers Prefer Different Improvements in Breeding Goal Traits

DEFF Research Database (Denmark)

Slagboom, Margot; Kargo, Morten; Edwards, David

software 1000Minds. These pairwise rankings were based on equal economic worth of trait improvements. The survey was filled in by 106 organic and 290 conventional farmers. The most preferred trait improvement for both production systems was in cow fertility, and the least preferred improvement......In dairy cattle breeding, breeding goals (BG) are developed and subsequently a selection index that farmers want to use. Therefore it is important to take their preferences for BG traits into account. Two production systems that are expected to influence farmer preferences for BG traits are organic...... and conventional systems. The aim of this study was to characterize preferences of organic and conventional Danish dairy farmers for improvements in BG traits for Holstein cattle. A survey was established to characterize preferences for improvements in ten traits, by means of pairwise rankings using the online...

Do nitrates differ?

Science.gov (United States)

Fung, H.-L.

1992-01-01

1 The organic nitrates all share a common biochemical and physiological mechanism of action. 2 The organic nitrates differ substantially in their pharmacologic potency and pharmacokinetics. In vitro potency differences appear larger than the corresponding in vivo activities. 3 The duration of action of organic nitrates, after a single immediate-release dose, is governed by the pharmacokinetics of the drug. However, the duration of action of available sustained-release preparations, whatever the nitrate or formulation, is limited to about 12 h, due to the development of pharmacologic tolerance. 4 Nitrates do not appear to differ in their production of undesirable effects. PMID:1633079

Organic spintronics

International Nuclear Information System (INIS)

Naber, W J M; Faez, S; Wiel, W G van der

2007-01-01

We review the emerging field of organic spintronics, where organic materials are applied as a medium to transport and control spin-polarized signals. The contacts for injecting and detecting spins are formed by ferromagnetic metals, oxides, or inorganic semiconductors. First, the basic concepts of spintronics and organic electronics are addressed, and phenomena which are in particular relevant for organic spintronics are highlighted. Experiments using different organic materials, including carbon nanotubes, organic thin films, self-assembled monolayers and single molecules are then reviewed. Observed magnetoresistance points toward successful spin injection and detection, but spurious magnetoresistance effects can easily be confused with spin accumulation. A few studies report long spin relaxation times and lengths, which forms a promising basis for further research. We conclude with discussing outstanding questions and problems. (topical review)

Advances in organic-inorganic hybrid sorbents for the extraction of organic and inorganic pollutants in different types of food and environmental samples.

Science.gov (United States)

Ng, Nyuk-Ting; Kamaruddin, Amirah Farhan; Wan Ibrahim, Wan Aini; Sanagi, Mohd Marsin; Abdul Keyon, Aemi S

2018-01-01

The efficiency of the extraction and removal of pollutants from food and the environment has been an important issue in analytical science. By incorporating inorganic species into an organic matrix, a new material known as an organic-inorganic hybrid material is formed. As it possesses high selectivity, permeability, and mechanical and chemical stabilities, organic-inorganic hybrid materials constitute an emerging research field and have become popular to serve as sorbents in various separaton science methods. Here, we review recent significant advances in analytical solid-phase extraction employing organic-inorganic composite/nanocomposite sorbents for the extraction of organic and inorganic pollutants from various types of food and environmental matrices. The physicochemical characteristics, extraction properties, and analytical performances of sorbents are discussed; including morphology and surface characteristics, types of functional groups, interaction mechanism, selectivity and sensitivity, accuracy, and regeneration abilities. Organic-inorganic hybrid sorbents combined with extraction techniques are highly promising for sample preparation of various food and environmental matrixes with analytes at trace levels. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Transport of organic contaminants in subsoil horizons and effects of dissolved organic matter related to organic waste recycling practices.

Science.gov (United States)

Chabauty, Florian; Pot, Valérie; Bourdat-Deschamps, Marjolaine; Bernet, Nathalie; Labat, Christophe; Benoit, Pierre

2016-04-01

Compost amendment on agricultural soil is a current practice to compensate the loss of organic matter. As a consequence, dissolved organic carbon concentration in soil leachates can be increased and potentially modify the transport of other solutes. This study aims to characterize the processes controlling the mobility of dissolved organic matter (DOM) in deep soil layers and their potential impacts on the leaching of organic contaminants (pesticides and pharmaceutical compounds) potentially present in cultivated soils receiving organic waste composts. We sampled undisturbed soil cores in the illuviated horizon (60-90 cm depth) of an Albeluvisol. Percolation experiments were made in presence and absence of DOM with two different pesticides, isoproturon and epoxiconazole, and two pharmaceutical compounds, ibuprofen and sulfamethoxazole. Two types of DOM were extracted from two different soil surface horizons: one sampled in a plot receiving a co-compost of green wastes and sewage sludge applied once every 2 years since 1998 and one sampled in an unamended plot. Results show that DOM behaved as a highly reactive solute, which was continuously generated within the soil columns during flow and increased after flow interruption. DOM significantly increased the mobility of bromide and all pollutants, but the effects differed according the hydrophobic and the ionic character of the molecules. However, no clear effects of the origin of DOM on the mobility of the different contaminants were observed.

The Influence of Different Cover Types on American Robin Nest Success in Organic Agroecosystems

Directory of Open Access Journals (Sweden)

James R. Brandle

2013-08-01

Full Text Available There are many opportunities for biodiversity conservation in organic farm systems. Successful and sustainable conservation efforts in organic systems, however, need to measure appropriate outcomes. In particular, data are needed on the breeding success of associated wildlife species. We measured nesting success of the American Robin (Turdus migratorius in woodlands embedded within eight organic farms in eastern Nebraska. We modeled daily nest survival rate to identify land use and land cover patterns that optimize conservation of birds in organic farm systems. The percentage of a crop in the fields adjacent to linear woodlands best predicted daily survival rate. Daily survival rate was lower in fields adjacent to wheat and greater in woodlands adjacent to soybean fields, though the latter may be a weak effect. There was no evidence that reducing the area allocated to organic crop production would improve daily survival rate but rather an evidence of a patch-matrix interaction. These results suggest that, if suitable nesting sites exist, organic farmers can complement local conservation efforts without losing working farmland.

Investigation of dissolved organic substances in the Northern Dvina under different hydrological seasons

Science.gov (United States)

Shorina, Natalia; Spencer, Robert; Klimov, Sergey; Bulygina, Ekaterina; Ladesov, Anton; Shestakov, Semen; Vorobieva, Taisia

2017-04-01

The rivers of the Russian Arctic, which include the Northern Dvina, are important sources of organic matter of terrestrial origin to the seas of the Arctic Ocean. The Northern Dvina River accounts for 50% of the entire flow of the river system to the White Sea. The spring freshet period accounts for 60% of the annual hydrological flow, and 80% of the annual flow of riverine suspended sediment. Despite the importance of the study of organic matter in dissolved form for global carbon cycling, this topic has received little attention in this region of Russia. This paper presents results from a study examining dissolved organic matter (DOM) in the Northern Dvina River encompassing different hydrological seasons, utilizing a range of methods for isolation and concentration. The goal of this study was to characterize the molecular features of DOM in the Northern Dvina River across the seasonal hydrograph. IR spectra of the samples were recorded on a FTIR spectrometer Vertex 70 (Bruker, Germany), with a resolution of 4 cm-1, measuring the range 4000-400 cm-1 and 128 recorded parallel determinations. The absorption band at 3200cm-1 and 1600 cm-1 are due to OH group. In the range of 2800-3000 cm-1 we observed bands due to methyl, methylene groups, and possibly the presence of nitrogen-containing C = NH groups. In the area of 1710 cm-1 there is a strong band of carbonyl groups characteristic of aldehydes, ketones and carboxylic acids. The mild band at 1450 cm-1 is noted and can be attributed to the C-C vibrations of the aromatic ring. In the range of 1100-1000 cm-1 is observed a band related to C-O groups. The absorption bands at 1030 cm-1 correspond to C-O-C symmetric stretching vibrations, and at the 1150 cm-1 belongs to the aromatic C-H-planar deformation fluctuations. Based on data from the infrared spectrometry, it should be noted that along with the strongly expressed aliphatic component, studied samples are characterized by the presence of aromatic ring groups. An

Lectin histochemical study on the olfactory organ of the newt, Cynops pyrrhogaster, revealed heterogeneous mucous environments in a single nasal cavity.

Science.gov (United States)

Saito, Shouichiro; Matsui, Toshiyasu; Kobayashi, Naoto; Wakisaka, Hiroyuki; Mominoki, Katsumi; Matsuda, Seiji; Taniguchi, Kazuyuki

2003-04-01

Expression patterns of glycoconjugates were examined by lectin histochemistry in the nasal cavity of the Japanese red-bellied newt, Cynops pyrrhogaster. Its nasal cavity consisted of two components, a flattened chamber, which was the main nasal chamber (MNC), and a lateral diverticulum called the lateral nasal sinus (LNS), which communicated medially with the MNC. The MNC was lined with the olfactory epithelium (OE), while the diverticulum constituting the LNS was lined with the vomeronasal epithelium (VNE). Nasal glands were observed beneath the OE but not beneath the VNE. In addition, a secretory epithelium was revealed on the dorsal boundary between the MNC and the LNS, which we refer to as the boundary secretory epithelium (BSE) in this study. The BSE seemed to play an important role in the construction of the mucous composition of the VNE. Among 21 lectins used in this study, DBA, SBA and Jacalin showed different staining patterns between the OE and the VNE. DBA staining showed remarkable differences between the OE and the VNE; there was intense staining in the free border and the supporting cells of the VNE, whereas there was no staining or weak staining in the cells of the OE. SBA and Jacalin showed different stainings in the receptor neurons for the OE and the VNE. Furthermore, UEA-I and Con A showed different stainings for the nasal glands. UEA-I showed intense staining in the BSE and in the nasal glands located in the ventral wall of the MNC (VNG), whereas Con A showed intense staining in the BSE and in the nasal glands located in the dorsal and medial wall of the MNC (DMNG). The DMNG were observed to send their excretory ducts into the OE, whereas no excretory ducts were observed from the VNG to the OE or the VNE. These results suggested that the secretion by the supporting cells as well as the BSE and the DMNG establishes that there are heterogeneous mucous environments in the OE and the VNE, although both epithelia are situated in the same nasal cavity.

Can Management Practices Make a Difference? Nonprofit Organization Financial Performance during Times of Economic Stress

Directory of Open Access Journals (Sweden)

QIAN HU

2017-12-01

Full Text Available The economic crisis presented unprecedented challenges to nonprofit organizations to sustain their services. In this study, we examined both financial and management factors that influence the financial performance of nonprofit organizations during times of economic stress. In particular, we investigated whether strategic planning and plan implementation, revenue diversification, and board involvement help nonprofit organizations deal with financial uncertainty and strengthen financial performance. Despite the negative impacts that the economic downturn had on nonprofit organizations, we found that the implementation of strategic plans can help nonprofit organizations reduce financial vulnerability. Our findings call attention to key management factors that influence the financial performance of nonprofit organizations.

Amygdaloid projections to the ventral striatum in mice: direct and indirect chemosensory inputs to the brain reward system.

Science.gov (United States)

Novejarque, Amparo; Gutiérrez-Castellanos, Nicolás; Lanuza, Enrique; Martínez-García, Fernando

2011-01-01

Rodents constitute good models for studying the neural basis of sociosexual behavior. Recent findings in mice have revealed the molecular identity of the some pheromonal molecules triggering intersexual attraction. However, the neural pathways mediating this basic sociosexual behavior remain elusive. Since previous work indicates that the dopaminergic tegmento-striatal pathway is not involved in pheromone reward, the present report explores alternative pathways linking the vomeronasal system with the tegmento-striatal system (the limbic basal ganglia) by means of tract-tracing experiments studying direct and indirect projections from the chemosensory amygdala to the ventral striato-pallidum. Amygdaloid projections to the nucleus accumbens, olfactory tubercle, and adjoining structures are studied by analyzing the retrograde transport in the amygdala from dextran amine and fluorogold injections in the ventral striatum, as well as the anterograde labeling found in the ventral striato-pallidum after dextran amine injections in the amygdala. This combination of anterograde and retrograde tracing experiments reveals direct projections from the vomeronasal cortex to the ventral striato-pallidum, as well as indirect projections through different nuclei of the basolateral amygdala. Direct projections innervate mainly the olfactory tubercle and the islands of Calleja, whereas indirect projections are more widespread and reach the same structures and the shell and core of nucleus accumbens. These pathways are likely to mediate innate responses to pheromones (direct projections) and conditioned responses to associated chemosensory and non-chemosensory stimuli (indirect projections). Comparative studies indicate that similar connections are present in all the studied amniote vertebrates and might constitute the basic circuitry for emotional responses to conspecifics in most vertebrates, including humans.

Molecular Evolutionary Characterization of a V1R Subfamily Unique to Strepsirrhine Primates

Science.gov (United States)

Yoder, Anne D.; Chan, Lauren M.; dos Reis, Mario; Larsen, Peter A.; Campbell, C. Ryan; Rasoloarison, Rodin; Barrett, Meredith; Roos, Christian; Kappeler, Peter; Bielawski, Joseph; Yang, Ziheng

2014-01-01

Vomeronasal receptor genes have frequently been invoked as integral to the establishment and maintenance of species boundaries among mammals due to the elaborate one-to-one correspondence between semiochemical signals and neuronal sensory inputs. Here, we report the most extensive sample of vomeronasal receptor class 1 (V1R) sequences ever generated for a diverse yet phylogenetically coherent group of mammals, the tooth-combed primates (suborder Strepsirrhini). Phylogenetic analysis confirms our intensive sampling from a single V1R subfamily, apparently unique to the strepsirrhine primates. We designate this subfamily as V1Rstrep. The subfamily retains extensive repertoires of gene copies that descend from an ancestral gene duplication that appears to have occurred prior to the diversification of all lemuriform primates excluding the basal genus Daubentonia (the aye-aye). We refer to the descendent clades as V1Rstrep-α and V1Rstrep-β. Comparison of the two clades reveals different amino acid compositions corresponding to the predicted ligand-binding site and thus potentially to altered functional profiles between the two. In agreement with previous studies of the mouse lemur (genus, Microcebus), the majority of V1Rstrep gene copies appear to be intact and under strong positive selection, particularly within transmembrane regions. Finally, despite the surprisingly high number of gene copies identified in this study, it is nonetheless probable that V1R diversity remains underestimated in these nonmodel primates and that complete characterization will be limited until high-coverage assembled genomes are available. PMID:24398377

Three-dimensional structure of human lamellar bone: the presence of two different materials and new insights into the hierarchical organization.

Science.gov (United States)

Reznikov, Natalie; Shahar, Ron; Weiner, Steve

2014-02-01

Lamellar bone is the most common bone type in humans. The predominant components of individual lamellae are plywood-like arrays of mineralized collagen fibrils aligned in different directions. Using a dual-beam electron microscope and the Serial Surface View (SSV) method we previously identified a small, but significantly different layer in rat lamellar bone, namely a disordered layer with collagen fibrils showing little or no preferred orientation. Here we present a 3D structural analysis of 12 SSV volumes (25 complete lamellae) from femora of 3 differently aged human individuals. We identify the ordered and disordered motifs in human bone as in the rat, with several significant differences. The ordered motif shows two major preferred orientations, perpendicular to the long axis of the bone, and aligned within 10-20° of the long axis, as well as fanning arrays. At a higher organizational level, arrays of ordered collagen fibrils are organized into 'rods' around 2 to 3μm in diameter, and the long axes of these 'rods' are parallel to the lamellar boundaries. Human bone also contains a disordered component that envelopes the rods and fills in the spaces between them. The disordered motif is especially well-defined between adjacent layers of rods. The disordered motif and its interfibrillar substance stain heavily with osmium tetroxide and Alcian blue indicating the presence of another organic component in addition to collagen. The canalicular network is confined to the disordered material, along with voids and individual collagen fibrils, some of which are also aligned more or less perpendicular to the lamellar boundaries. The organization of the ordered fibril arrays into rods enveloped in the continuous disordered structure was not observed in rat lamellar bone. We thus conclude that human lamellar bone is comprised of two distinct materials, an ordered material and a disordered material, and contains an additional hierarchical level of organization composed of

Soil carbon varies between different organic and conventional management schemes in arable agriculture

DEFF Research Database (Denmark)

Hu, Teng; Sørensen, Peter; Olesen, Jørgen Eivind

2018-01-01

The effects of organic versus conventional farming systems on changes in soil organic carbon (SOC) has long been debated. The effects of such comparisons may depend considerably on the design of the respective systems and climate and soil conditions under which they are performed. Here, we compar...

Laboratory measurements of nitric oxide release from forest soil with a thick organic layer under different understory types

Directory of Open Access Journals (Sweden)

A. Bargsten

2010-05-01

Full Text Available Nitric oxide (NO plays an important role in the photochemistry of the troposphere. NO from soil contributes up to 40% to the global budget of atmospheric NO. Soil NO emissions are primarily caused by biological activity (nitrification and denitrification, that occurs in the uppermost centimeter of the soil, a soil region often characterized by high contents of organic material. Most studies of NO emission potentials to date have investigated mineral soil layers. In our study we sampled soil organic matter under different understories (moss, grass, spruce and blueberries in a humid mountainous Norway spruce forest plantation in the Fichtelgebirge (Germany. We performed laboratory incubation and flushing experiments using a customized chamber technique to determine the response of net potential NO flux to physical and chemical soil conditions (water content and temperature, bulk density, particle density, pH, C/N ratio, organic C, soil ammonium, soil nitrate. Net potential NO fluxes (in terms of mass of N from soil samples taken under different understories ranged from 1.7–9.8 ng m⁻² s⁻¹ (soil sampled under grass and moss cover, 55.4–59.3 ng m⁻² s⁻¹ (soil sampled under spruce cover, and 43.7–114.6 ng m⁻² s⁻¹ (soil sampled under blueberry cover at optimum water content and a soil temperature of 10 °C. The water content for optimum net potential NO flux ranged between 0.76 and 0.8 gravimetric soil moisture for moss covered soils, between 1.0 and 1.1 for grass covered soils, 1.1 and 1.2 for spruce covered soils, and 1.3 and 1.9 for blueberry covered soils. Effects of soil physical and chemical characteristics on net potential NO flux were statistically significant (0.01 probability level only for NH₄⁺. Therefore, as an alternative explanation for the differences in soil biogenic NO emission we consider more biological factors like understory

Prevalent fatty acids in cashew nuts obtained from conventional and organic cultivation in different stages of processing

Directory of Open Access Journals (Sweden)

Denise Josino Soares

2013-06-01

Full Text Available Brazil is one of the three largest producers of fruits in the world, and among those fruit trees, the cashew tree stands out due to the high nutritional and commercial value of its products. During its fruit processing, there are losses in some compounds and few studies address this issue. Over the last decade the conventional system of food production has been substituted for the organic cultivation system, which is a promising alternative source of income given the global demand for healthy food. Therefore, this research aimed to characterize and quantify the prevalent fatty acids found in cashew nuts obtained from conventional and organic cultivation during various stages of processing. The prevalent fatty acids found were palmitic, linoleic, oleic, and stearic acid. The average of these fatty acids were 6.93 ± 0.55; 16.99 ± 0.61; 67.62 ± 1.00 and 8.42 ± 0.55 g/100 g, respectively. There was no reduction in the palmitic, oleic and stearic fatty acid contents during processing. Very little difference was observed between the nuts obtained from conventional and organic cultivation, indicating that the method of cultivation used has little or no influence on the content of cashew nut fatty acids.

The Effect of Tillage on Organic Carbon Stabilization in Microaggregates in Different Climatic Zones of European Russia

Directory of Open Access Journals (Sweden)

Zinaida S. Artemyeva

2016-12-01

Full Text Available Tillage may affect the microstructural organization of soil, including the distribution of microaggregates with different mechanical strengths. We quantified the impact of tillage treatment on the amount and distribution of free organic matter, microaggregates (unstable and stable under low intensity sonification and their components, in the upper horizons of zonal soils of the Center of the Russian Plain. Under plowing, the carbon content decreases, both in unstable and stable microaggregates. The loss of carbon in unstable microaggregates was ~24%, whereas in stable microaggregates, it was ~37%, relative to native soils. The carbon content of organic (LFoc and organo-clay (Clayrd fractions in unstable microaggregates (CLFoc/CClayrd was almost identical in the upper horizons of native soils: the ratio of these components is for Albeluvisols (1.1, Phaeozem (0.8 and Chernozems (1.0. Under plowing, these decrease to: Albeluvisols and Chernozems (0.6 and Phaeozem (0.5. The shares of carbon accumulated within the unstable and stable microaggregates (Cunstable/Cstable are constant under equilibrium conditions and show a tendency to decrease from north to south on the order of: Albeluvisols and Phaeozem (2.2 > Chernozems (1.0. Under plowing, they increase to: Albeluvisols (3.0 and Phaeozem (3.2 > Chernozems (1.5.

Content of sugar, organic acids and ethanol in fermented milk beverages obtained with different types of kombucha inoculum

Directory of Open Access Journals (Sweden)

Iličić Mirela D.

2017-01-01

Full Text Available The aim of this study was to examine the influence of different types and concentration of kombucha inoculum on content of sugar, organic acids and ethanol in the fermented beverages produced from milk of 0.9% fat content. Three different kombucha inoculums, cultivated on black tea with addition of sucrose: standard inoculum - 10% (w/w and 15% (w/w, concentrated by microfiltration- 10% (w/w and 15% (w/w, and concentrated by evaporation - 1.5% (w/w and 3.0% (w/w, were applied in the manufacture of fermented milk. Contents of lactose, galactose, glucose, fructose, organic acids, and ethanol in the kombuha fermented milk beverages were determined by the enzyme tests. It was found that the lactose content varied from 3.30 to 4.0 g/100g. All samples showed higher content glucose than fructose. The content of L-lactic acid in the samples ranged from 0.4 to 0.7 g/100g, while significantly lower level of D-lactic and acetic acid were determined in all samples of kombucha fermented milk (<0.06g/100g.[Project of the Serbian Ministry of Education, Science and Technological Development, Grant no. 46009

Solubility of daidzin in different organic solvents and (ethyl alcohol + water) mixed solvents

International Nuclear Information System (INIS)

Fan, Jie-Ping; Yang, Dan; Xu, Xiao-Kang; Guo, Xiao-Jie; Zhang, Xue-Hong

2015-01-01

Highlights: • The solubilities of daidzin were measured in various solvents. • The solubility data were correlated by three models. • The thermodynamic properties of the dissolution process were also determined. - Abstract: The solubility of daidzin in different organic solvents and (ethyl alcohol + water) mixed solvents was measured by high performance liquid chromatography (HPLC) analysis method from T = (283.2 to 323.2) K at atmosphere pressure. The results show that at higher temperature more daidzin dissolves, and moreover, the solubility increases with the ethyl alcohol mole fraction increase in the (ethyl alcohol + water) mixed solvents. The experimental solubility values were correlated by a simplified thermodynamic equation, λh equation and modified Apelblat equation. Based on the solubility of daidzin, the enthalpy and entropy of solution were also evaluated by van’t Hoff equation. The results illustrated that the dissolution process of daidzin is endothermic and entropy driven

[Mentalization and theory of mind in borderline personality organization: exploring the differences between affective and cognitive aspects of social cognition in emotional pathology].

Science.gov (United States)

Górska, Dominika; Marszał, Monika

2014-01-01

This article addresses the problem of explaining emotional pathology (levels of personality organization) using the concepts of theory of mind (ToM) and mentalization. Although these terms are used interchangeably to describe the "ability to interpret the behavior of others in terms of mental states," they do not have identical status in emotional disorders. ToM refers to a "cold" knowledge, whereas mentalization requires the activation of relational and emotional representations, as well as processing of emotional experience (whether reflection or defense). The aim of the study was to compare the cognitive (ToM) and affective (mentalization) aspects of "understanding the behavior of others in terms of mental states" in the clinical group--consisting of patients with borderline personality organization (N = 30); and the control group (N = 30). The Borderline Personality Inventory was used as a diagnostic questionnaire for the organization of personality, the Strange Stories Test was employed to measure ToM, and the Mental States Task instrument measured mentalization. With respect to mentalization, different patterns of results were obtained: the activation of overwhelming mental states and primitive defenses in the clinical group; as well as the inhibition of the recognition of mental content by defenses, such as denial and suppression of emotions, in the control group. No differences were observed in ToM between groups. In explaining the personality organization levels, only the affective, and not the cognitive, aspects of "understanding the behavior of others in terms of mental states" are significant. People with borderline personality organization, as well as healthy individuals, use "cold" knowledge about internal states. However, the activation of relational and emotional representations triggers different mental states in both groups.

One year monitoring of fire-induced effects on dissolved organic matter and nutrient dynamics under different land-use

Science.gov (United States)

Potthast, Karin; Meyer, Stefanie; Crecelius, Anna; Schubert, Ulrich; Michalzik, Beate

2016-04-01

It is supposed that the changing climate will promote extreme weather events that in turn will increase drought periods and the abundance of fire events in temperate climate regions such as Central Europe. The impact of fires on the nutrient budgets of ecosystems is highly diverse and seems to depend on the ecosystem type. For example, little is known about fire effects on water-bound organic matter (OM) and nutrient fluxes in temperate managed forest ecosystems. Fires can strongly alter the distribution (forest floor vs. mineral soil), binding forms (organic vs. inorganic) and availability (solubility by water) of OM and associated nutrients. To elucidate the effects and seasonality of low intensity fires on the mobilization of dissolved organic carbon and nutrients, an experimental ground fire was conducted in November 2014 in the Hainich region, Central Germany. In addition, differences in response patterns between two land-use types (pasture and beech forest) were investigated. Lysimeters (n=5 controls/ 5 fire-manipulated) with topsoil monoliths (0-4 cm), rainfall/throughfall samplers, littertraps as well as temperature and moisture sensors were installed on three sites of each land-use type. During the one year of monitoring (Sep14-Dec15) soil solution, rainfall, and throughfall samples were taken biweekly and analyzed for pH, dissolved and particulate organic carbon (DOC, POC) and nitrogen (DN, PN) as well as for nutrients (e.g. K, Ca, Mg, P, S). Compared to the control sites, the ground fire immediately induced a short-run release peak of DOC in both land-use types. Within two weeks these differences were muted in the post-fire period. The effect of fire was land-use specific with annual DOC fluxes of 82 and 45 kg/(ha*a) for forest and pasture sites, respectively. In contrast, nitrogen fluxes responded differently to the fire event. In the forest, a significant increase in DN concentrations was notable five months after the fire, at the beginning of the

Perubahan Nilai Hematologi, Biokimia Darah, Bobot Organ dan Bobot Badan Tikus Putih pada Umur Berbeda (THE CHANGES ON HEMATOLOGICAL, BLOOD BIOCHEMICAL VALUES, ORGAN AND BODY WEIGHT OF RAT AT DIFFERENT AGES

Directory of Open Access Journals (Sweden)

Marice Sihombing

2012-03-01

Full Text Available Research and development of health science require an animal model which has been known for itsorigin and characteristics. One of experimental animal model which is commonly used is albino rat. Thepurpose of this study was to investigate weight of organs (kidney, liver, spleen, and lung, hematologicalvalues (hemoglobin, hematocrit, erythrocyte and leucocyte, and the values of the biochemical blood (SGPT,SGOT, glucose and total protein of the albino rat at different ages. This study used 60 rats, which weredivided into 3 groups based on age namely 1, 2, and 3 months and groups based on sex that each groupconsisted of 10 males and 10 females. Samples of age and sex groups of rat were taken randomly. Eachcage consisted of 5 rats with the same ages and sex. Those rats fed and tap water ad libitum. The rats weresacrificed anaesthetically by with ether to take their blood and measure their organ‘s weight. Data wasanalyzed using one way ANOVA test, except data from heart organ which was analyzed using nonparametrictest (Friedman Test. To find out the increase of rats body weight age 1 -3 months, it was usedregression linier test. Results of statistic showed that there were significantly difference (p < 0,05 in bodyweight change, average of hematological values, blood biochemical values and organs weight in accordancewith increasing of rats age in all age groups. In contrast, average of hematocrit values had no significantlydifference (p > 0,05. Generally, male rats were bigger than female rats but there was no difference in all

Gas chromatography-mass spectrometry analysis of different organic crude extracts from the local medicinal plant of Thymus vulgaris L

Institute of Scientific and Technical Information of China (English)

Laila Salim Al Hashmi; Mohammad Amzad Hossain; Afaf Mohammed Weli; Qasim Al-Riyami; Jamal Nasser Al-Sabahi

2013-01-01

Objective: To isolate and analyze the chemical composition in different crude extracts of from the leaves of locally grown of Thymus vulgaris L (T. vulgaris) by gas chromatography-mass spectrometry (GC-MS). Methods: The shade dried leaves powder was extracted with methanol by using Soxhlet extractor. Methanol crude extracts of T. vulgaris and the derived fractions of hexane, chloroform, ethyl acetate and butanol were obtained. Results: Qualitative analyses of various organic crude extracts of T. vulgaris by using GC-MS showed that there were different types of high and low molecular weight compounds. Most of the isolated and identified compounds by GC-MS in the crude extracts are basically biologically important. Further, the T. vulgaris leaf possessed certain characteristics that can be ascribed to cultivation on a domestic plantation. The crude extracts were prepared from the powder leaves of T. vulgaris for respective compounds can be chosen on the basis of above GC-MS analysis. Conclusions: All the major compounds were identified and characterized by spectroscopic method in different organic crude extracts of T. vulgaris are biologically active molecules. Thus the identification of a good number of compounds in various crude extracts of T. vulgaris might have some ecological role.

Gas chromatography-mass spectrometry analysis of different organic crude extracts from the local medicinal plant of Thymus vulgaris L

Institute of Scientific and Technical Information of China (English)

Laila; Salim; Al; Hashmi; Mohammad; Amzad; Hossain; Afaf; Mohammed; Weli; Qasim; Al-Riyami; Jamal; Nasser; Al-Sabahi

2013-01-01

Objective:To isolate and analyze the chemical composition in different crude extracts of from the leaves of locally grown of Thymus vulgaris L(T.vulgaris)by gas chromatography-mass spectrometry(GC-MS).Methods:The shade dried leaves powder was extracted with methanol by using Soxhlet extractor.Methanol crude extracts of T.vulgaris and the derived fractions of hexane,chloroform,ethyl acetate and butanol were obtained.Results:Qualitative analyses of various organic crude extracts of T.vulgaris by using GC-MS showed that there were different types of high and low molecular weight compounds.Most of the isolated and identified compounds by GC-MS in the crude extracts are basically biologically important.Further,the T.vulgaris leaf possessed certain characteristics that can be ascribed to cultivation on a domestic plantation.The crude extracts were prepared from the powder leaves of T.vulgaris for respective compounds can be chosen on the basis of above GC-MS analysis.Conclusions:All the major compounds were identified and characterized by spectroscopic method in different organic crude extracts of T.vulgaris are biologically active molecules.Thus the identification of a good number of compounds in various crude extracts of T.vulgaris might have some ecological role.

Coagulation and flocculation of dissolved organic substances with organic polymers

OpenAIRE

Kvinnesland, Thomas

2002-01-01

Coagulation of natural organic matter (NOM) in water is a well-established process, enabling or enhancing the removal of these substances by different particle separation processes. The dominating coagulating agents used are, however, inorganic salts of iron (Fe3+) and aluminium (Al3+). The primary use of organic polymers is as flocculating agents for already coagulated aggregates. However, in recent years the use of cationic organic polymers have received increasing attent...

Dynamics of Intracellular Polymers in Enhanced Biological Phosphorus Removal Processes under Different Organic Carbon Concentrations

Directory of Open Access Journals (Sweden)

Lizhen Xing

2013-01-01

Full Text Available Enhanced biological phosphorus removal (EBPR may deteriorate or fail during low organic carbon loading periods. Polyphosphate accumulating organisms (PAOs in EBPR were acclimated under both high and low organic carbon conditions, and then dynamics of polymers in typical cycles, anaerobic conditions with excess organic carbons, and endogenous respiration conditions were examined. After long-term acclimation, it was found that organic loading rates did not affect the yield of PAOs and the applied low organic carbon concentrations were advantageous for the enrichment of PAOs. A low influent organic carbon concentration induced a high production of extracellular carbohydrate. During both anaerobic and aerobic endogenous respirations, when glycogen decreased to around 80 ± 10 mg C per gram of volatile suspended solids, PAOs began to utilize polyphosphate significantly. Regressed by the first-order reaction model, glycogen possessed the highest degradation rate and then was followed by polyphosphate, while biomass decay had the lowest degradation rate.

Real-Time Measurements of Gas/Particle Partitioning of Semivolatile Organic Compounds into Different Probe Particles in a Teflon Chamber

Science.gov (United States)

Liu, X.; Day, D. A.; Ziemann, P. J.; Krechmer, J. E.; Jimenez, J. L.

2017-12-01

The partitioning of semivolatile organic compounds (SVOCs) into and out of particles plays an essential role in secondary organic aerosol (SOA) formation and evolution. Most atmospheric models treat the gas/particle partitioning as an equilibrium between bulk gas and particle phases, despite potential kinetic limitations and differences in thermodynamics as a function of SOA and pre-existing OA composition. This study directly measures the partitioning of oxidized compounds in a Teflon chamber in the presence of single component seeds of different phases and polarities, including oleic acid, squalane, dioctyl sebacate, pentaethylene glycol, dry/wet ammonium sulfate, and dry/wet sucrose. The oxidized compounds are generated by a fast OH oxidation of a series of alkanols under high nitric oxide conditions. The observed SOA mass enhancements are highest with oleic acid, and lowest with wet ammonium sulfate and sucrose. A chemical ionization mass spectrometer (CIMS) was used to measure the decay of gas-phase organic nitrates, which reflects uptake by particles and chamber walls. We observed clear changes in equilibrium timescales with varying seed concentrations and in equilibrium gas-phase concentrations across different seeds. In general, the gas evolution can be reproduced by a kinetic box model that considers partitioning and evaporation with particles and chamber walls, except for the wet sucrose system. The accommodation coefficient and saturation mass concentration of each species in the presence of each seed are derived using the model. The changes in particle size distributions and composition monitored by a scanning mobility particle sizer (SMPS) and a high-resolution time-of-flight aerosol mass spectrometer (HR-ToF-AMS) are investigated to probe the SOA formation mechanism. Based on these results, the applicability of partitioning theory to these systems and the relevant quantitative parameters, including the dependencies on seed particle composition, will

Features of physiological responses on organism of football players aged 10-12 years in exercise using different training methods

Directory of Open Access Journals (Sweden)

A. B. Abdula

2014-02-01

Full Text Available Purpose : To evaluate the effect of various special exercises football players’ organism in different modes. Material : The study involved 24 young players aged 10-12 years. Results : There is a large range of load parameters for elite athletes, which necessitates evaluation exercise intensity football for young players. Found that depending on the method chosen football special exercises have different effects on the body force young players. Conclusions : It was found that by using the method of competitive gaming and heart rate and energy increases with increasing number of players. The analysis shows the existence of significant differences in terms of heart rate for game and interval method.

Cognitive organization of emotion: differences between labels and descriptors of emotion in jealousy situations.

Science.gov (United States)

Hupka, R B; Eshett, C

1988-06-01

The purpose of this study was to ascertain whether the cognitive organization of labels of emotion differs from descriptions of affective states. This was done in the context of determining whether the attributions of labels of emotion and descriptions of affective responses in jealousy situations differed according to the status of the interloper, presence of an audience to the untoward behavior, and sex of the respondent. The subjects, 300 male and female junior college students, read vignettes which placed them at a party where their mates passionately kissed interlopers of varying status, and whose transgressions were, or were not, observed by others. The subjects were required to indicate the likelihood that they would experience anger, disgust, fear, jealousy, sadness, and surprise, and 49 cognitive and physiological descriptions of the affective states referred to by the aforementioned labels of emotion. Different findings were obtained with the labels and descriptors of affective states. This was interpreted as support for the systems theory of G.E. Schwartz. The descriptions, but not the labels, indicated that men were most upset when the interloper was a best friend and least concerned when he was a stranger. In contrast, women were most upset when the interloper was someone of equal or lower status than themselves and least upset when the interloper was their best friend.

Effects of different doses of organic fertilizer type bocashi in morphological and productive indicators of pepper crop (Capsicum annuum L. var. California wonder

Directory of Open Access Journals (Sweden)

Ana Boudet Antomarchi

2015-04-01

Full Text Available Between June and September 2012 in field condition in agroecological farm was carried out an investigation using a randomised block experimental design with four treatments and four repetitions with the objective to evaluate the effect of different doses of organic fertilizer bocashi in pepper crop (Capsicum annuum L..The treatment consisted in the application of different doses of organic fertilizer bocashi (1.66, 2.22, 2.78 tha-1 and a control treatment without application. The results were evaluated by means of the pro-gram Statistica version 8.0, for windows, where the indicators used showed significant differences multiple comparison of Tukey was applied to p ≤ 0.05. The variable evaluated were: height of the plants (cm, steam diameter (cm,yield and their components (number fruit.plant -1, average weigh of fruit (g, average diameter of fruit (cm and average large of fruit (cm. The treatment where was applied doses of 2.22 and 2.78 tha-1 of organic fertilizer bocashi was obtained the best results in productive indicator evaluated with securities in the agricultural yield of 33.4 and 32.9 tha-1

New views for sustainable production in family agriculture: Assessment of American lettuce cultivated with different types of organic fertilizers

Directory of Open Access Journals (Sweden)

Renan Borro Celestrino

2017-07-01

Full Text Available The general objective of this work was to evaluate the response of the American Lettuce to its development, using different types of organic fertilizers. Specifically, the objective was to outline the potential market for this type of food with agroecological production, with emphasis on small producers of family agriculture and to seek alternatives for legal marketing of organic products through family farming, based on Law 10.831/2003. Data collection on lettuce response to fertilization was completely randomized, with five treatments and four repetitions. It is a descriptive, exploratory research. Through a bibliographical survey, it was concluded that the insertion in the system of agroecological-organic production is opportune to establish competitiveness in family farming, in the primary productive sector of the production chain of olericulture, where the American Lettuce is among the main cultivated varieties. It was observed that the fertilization with manure of hardened chicken showed a higher development of lettuce in relation to other treatments. The consumer market confirms a demand for healthy food with the focus on vegetables. For legal marketing, organic food needs to get a special seal. Brazilian legislation establishes three guarantee instruments: third-party certification, participatory guarantee systems and social control for direct sale without certification. This last recommended for family farmers.

Person-Organization Commitment: Bonds of Internal Consumer in the Context of Non-profit Organizations.

Science.gov (United States)

Juaneda-Ayensa, Emma; Clavel San Emeterio, Mónica; González-Menorca, Carlos

2017-01-01

From an Organizational Behavior perspective, it is important to recognize the links generated between individuals and the organization that encourage a desire for permanence. After more than a half century of research, Organizational Commitment remains one of the open questions in the Psychology of Organizations. It is considered an essential factor for explaining individual behavior in the organization such as satisfaction, turnover intention, or loyalty. In this paper, we analyze different contributions regarding the nature of the bond between the individual and the organization. Taking into account the peculiarities of Non-profit Organizations, we present different interpretation for later validation, comparing results from the Confirmatory Factor Analysis of the four models obtained using exploratory factor analysis, both conducted on a sample of 235 members of Non-profit Organizations.

Influence of different breathing maneuvers on internal and external organ motion: Use of fiducial markers in dynamic MRI

International Nuclear Information System (INIS)

Plathow, Christian; Zimmermann, Hendrik; Fink, Christian; Umathum, Reiner; Schoebinger, Max; Huber, Peter; Zuna, Ivan; Debus, Juergen; Schlegel, Wolfgang; Meinzer, Hans-Peter; Semmler, Wolfhard; Kauczor, Hans-Ulrich; Bock, Michael

2005-01-01

Purpose: To investigate, with dynamic magnetic resonance imaging (dMRI) and a fiducial marker, the influence of different breathing maneuvers on internal organ and external chest wall motion. Methods and materials: Lung and chest wall motion of 16 healthy subjects (13 male, 3 female) were examined with real-time trueFISP (true fast imaging with steady-state precession) dMRI and a small inductively coupled marker coil on either the abdomen or thorax. Three different breathing maneuvers were performed (predominantly 'abdominal breathing,' 'thoracic breathing,' and unspecific 'normal breathing'). The craniocaudal (CC), anteroposterior (AP), and mediolateral (ML) lung distances were correlated (linear regression coefficient) with marker coil position during forced and quiet breathing. Results: Differences of the CC distance between maximum forced inspiration and expiration were significant between abdominal and thoracic breathing (p < 0.05). The correlation between CC distance and coil position was best for forced abdominal breathing and a marker coil in the abdominal position (r 0.89 ± 0.04); for AP and ML distance, forced thoracic breathing and a coil in the thoracic position was best (r = 0.84 ± 0.03 and 0.82 ± 0.03, respectively). In quiet breathing, a lower correlation was found. Conclusion: A fiducial marker coil external to the thorax in combination with dMRI is a new technique to yield quantitative information on the correlation of internal organ and external chest wall motion. Correlations are highly dependent on the breathing maneuver

Distribution coefficients of 134Cs, 60Co, 65Zn and 51Cr in different contaminated soils affected by organic waste disposal

International Nuclear Information System (INIS)

Metwally, E.

2003-01-01

Batch adsorption experiments were conducted with mixtures of solutes of different concentrations of some radionuclides as 1 34Sc, 6 0Co, 6 5Zn and 5 1Cr, in five different soils. The soils varied in their organic matter source and content due to prolonged irrigation with primary treated sewage effluent or untreated industrial wastewater. the distribution coefficients (K d ) were measured at different equilibrium times namely, 2, 24, 48, 72, 144 and 336 h. statistical correlation and curve fittings indicated that metal sorption into soils was influenced by the presence of clays, organic matter content and hydrous oxides of Fe and Mn. The highest log K d values were obtained in case of Cs in all investigated soils with a general mean of 1.878 0.28. Log K d for Cr exhibited a higher values than those did for at any tested soil (general mean 1.675 .33 and 1.658 0.24 for Cr and Co respectively). Zinc had the lowest log K d values, indicating that Cs is highly retained in soil than other tested elements and Zn is relatively mobile in soil than other tested elements. The investigated elements retention in soil could be arranged in the following order: Cs > Cr > Co > Zn. Soils enriched in organic matter exhibited the highest sorption caption capacity for all tested metals. Variability in the distribution coefficient due to soils and metals interactions were discussed

Correlation between Soil Organic Matter, Total Organic Matter and ...

African Journals Online (AJOL)

A total of four sites distributed in different soils of Kelantan State, Malaysia was identified for the study. Soils were collected by depth interval of 0-10cm, 10-20cm and 20-30cm. The correlation of soil organic matter (SOM) content, total organic carbon (TOC) content, water content and soils texture for industrial area at ...

Evaluation of different approaches to quantify strong organic acidity and acid-base buffering of organic-rich surface waters in Sweden.

Science.gov (United States)

Köhler, Stephan; Hruska, Jakub; Jönsson, Jörgen; Lövgren, Lars; Lofts, Stephen

2002-11-01

The role of organic acids in buffering pH in surface waters has been studied using a small brownwater stream (26mg L(-1) TOC) draining a forested catchment in Northern Sweden. Under the conditions of elevated pressure of CO2 stream field pH was changed between 3.5 and 6.1 during the acidification and alkalinization experiment. Acid-base characteristics of the natural organic matter were also determined using a high precision potentiometric method for a concentrated sample from the same stream. We compared the predictions from the Windermere Humic Aqueous Model (WHAM Model V), a model derived from the potentiometric titration (diprotic/monoprotic acid model) and a previously derived triprotic acid model which only uses alkalinity and TOC as input variables. The predicted buffering characteristics of all three models are very similar in the pH range 4.5-7 which suggests that during routine analysis alkalinity and TOC are sufficient to give a good estimate of organic acid anion charge contribution in a large range of surface waters. A slightly adjusted version of WHAM V successfully describes the organic charge contribution in a large number of sampled surface water lakes, which were previously used to calibrate the triprotic model.

The Relationship between Persistent Organic Pollutants Exposure and Type 2 Diabetes among First Nations in Ontario and Manitoba, Canada: A Difference in Difference Analysis

Directory of Open Access Journals (Sweden)

Lesya Marushka

2018-03-01

Full Text Available We previously studied the association between fish consumption and prevalence of type 2 diabetes (T2D in Manitoba and Ontario First Nations (FNs, Canada and found different results. In this study, we used a difference in difference model to analyze the data. Dietary and health data from the First Nations Food Nutrition and Environment Study, a cross-sectional study of 706 Manitoba and 1429 Ontario FNs were analyzed. The consumption of fish was estimated using a food frequency questionnaire. Fish samples were analyzed for dichloro diphenyldichloro ethylene (DDE and polychlorinated biphenyls (PCBs content. Difference in difference model results showed that persistent organic pollutant (POP exposure was positively associated with T2D in a dose-response manner. Stronger positive associations were found among females (OR = 14.96 (3.72–60.11 than in males (OR = 2.85 (1.14–8.04. The breakpoints for DDE and PCB intake were 2.11 ng/kg/day and 1.47 ng/kg/day, respectively. Each further 1 ng/kg/day increase in DDE and PCB intake increased the risk of T2D with ORs 2.29 (1.26–4.17 and 1.44 (1.09–1.89, respectively. Our findings suggest that the balance of risk and benefits associated with fish consumption is highly dependent on the regional POP concentrations in fish.

Quantitative Analysis of Phenylpropanoid Glycerol Glucosides in Different Organs of Easter Lily (Lilium longiflorum Thunb.).

Science.gov (United States)

Munafo, John P; Gianfagna, Thomas J

2015-05-20

The Easter lily (Lilium longiflorum Thunb.) is esteemed worldwide as an attractive ornamental plant, and the flower buds and bulbs are used for both culinary and medicinal purposes in many parts of the world. L. longiflorum contains significant amounts of phenylpropanoid glycerol glucosides, a group of compounds that may contribute to plant pathogen defense, ultraviolet/high-intensity visible light (UV/high light) protection, and the purported medicinal uses of lilies. To define the natural distribution of these compounds within the plant, a liquid chromatography-mass spectrometry (LC-MS) method performed in selected ion monitoring (SIM) mode was employed for the quantitative analysis of five phenylpropanoid glycerol glucosides, namely, (2S)-1-O-caffeoyl-2-O-β-D-glucopyranosylglycerol, 1; (2R)-1-O-β-D-glucopyranosyl-2-O-p-coumaroylglycerol, 2; (2S)-1-O-p-coumaroyl-2-O-β-D-glucopyranosylglycerol, 3; (2S)-1-O-caffeoyl-2-O-β-D-glucopyranosyl-3-O-acetylglycerol, 4; and (2S)-1-O-p-coumaroyl-2-O-β-D-glucopyranosyl-3-O-acetylglycerol, 5, in the different organs of L. longiflorum. The p-coumaroyl-based 3 and its acetylated derivative 5 were determined to be the most abundant of the phenylpropanoid glycerol glucosides found in Easter lily bulbs, at 776.3 ± 8.4 and 650.7 ± 32.6 μg/g dry weight, respectively. The acetylated p-coumaroyl- and caffeoyl-based derivatives, 5 and 4, accumulated to the highest concentration in the closed flower buds, at 4925.2 ± 512.8 and 3216.8 ± 406.4 μg/g dry weight, respectively. Compound 4, followed by 5 and 1, proved to be the most abundant in the mature flowers, occurring at 6006.2 ± 625.8, 2160.3 ± 556.5, and 1535.8 ± 174.1 μg/g dry weight, respectively. Total concentrations of the phenylpropanoid glycerol glucosides were 10-100-fold higher in the above-ground plant organs as compared to the bulbs and fleshy roots. Two of the five compounds, 1 and 2, were identified in L. longiflorum for the first time. The quantitative

Nutritional composition of black soldier fly (Hermetia illucens) prepupae reared on different organic waste substrates.

Science.gov (United States)

Spranghers, Thomas; Ottoboni, Matteo; Klootwijk, Cindy; Ovyn, Anneke; Deboosere, Stefaan; De Meulenaer, Bruno; Michiels, Joris; Eeckhout, Mia; De Clercq, Patrick; De Smet, Stefaan

2017-06-01

Black soldier fly larvae are converters of organic waste into edible biomass, of which the composition may depend on the substrate. In this study, larvae were grown on four substrates: chicken feed, vegetable waste, biogas digestate, and restaurant waste. Samples of prepupae and substrates were freeze-dried and proximate, amino acid, fatty acid and mineral analyses were performed. Protein content of prepupae varied between 399 and 431 g kg -1 dry matter (DM) among treatments. Differences in amino acid profile of prepupae were small. On the other hand, the ether extract (EE) and ash contents differed substantially. Prepupae reared on digestate were low in EE and high in ash (218 and 197 g kg -1 DM, respectively) compared to those reared on vegetable waste (371 and 96 g kg -1 DM, respectively), chicken feed (336 and 100 g kg -1 DM, respectively) and restaurant waste (386 and 27 g kg -1 DM, respectively). Prepupal fatty acid profiles were characterised by high levels of C12:0 in all treatments. Since protein content and quality were high and comparable for prepupae reared on different substrates, black soldier fly could be an interesting protein source for animal feeds. However, differences in EE and ash content as a function of substrate should be considered. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Determination of lead, mercury and cadmium concentrations in different organs of Barbus grypus and Liza abu of Karoon River in 2011

Directory of Open Access Journals (Sweden)

A ghorbani ranjbary

2013-02-01

Full Text Available Accumulation of heavy metals in fish body causes the destruction of soft tissues and suppression of immune system. Moreover, consumption of contaminated fish causes several consequences in humans. This survey was conducted to determine the concentration of lead, mercury and cadmium in muscle tissue, gill as well as liver of Barbus grypus and Liza abu. These two species are native fishes of Karoon River in Ahvaz area. A total number of 80 sample was obtained during the winter of 2010. After preparation and chemical digestion of fish samples, the amounts of heavy metals were determined by spectrophotometer method. According to the results, the overall lead concentration in different organs of the two species was more than mercury and cadmium concentrations. Furthermore, the accumulation of heavy elements in gills was estimated higher than the other organs. Although a significant difference (P

Organic fertigation for greenhouse crops

DEFF Research Database (Denmark)

Pokhrel, Bhaniswor

2017-01-01

productivity is suboptimal nutrient management resulting from poor synchronization between crop nutrient demand and nutrient release from organic fertilizers, affecting the physical, chemical and biological characteristics of the root zone environment, and thus plant growth and productivity. Compared to solid...... organic fertilizers, the application of liquid organic fertilizers potentially more accurately addresses the nutrient demand, because nutrients are readily available and different fertilizers are easily mixed. This PhD work explores the possibilities and challenges related to the application of liquid...... organic fertilizers in organic greenhouse crop production. Four greenhouse experiments were designed where different liquid organic fertilizers were prepared: acidic extraction or anaerobic digestion of red clover and white mustard silage, water extraction of composted chicken manure and flushing...

Topological organization of functional brain networks in healthy children: differences in relation to age, sex, and intelligence.

Science.gov (United States)

Wu, Kai; Taki, Yasuyuki; Sato, Kazunori; Hashizume, Hiroshi; Sassa, Yuko; Takeuchi, Hikaru; Thyreau, Benjamin; He, Yong; Evans, Alan C; Li, Xiaobo; Kawashima, Ryuta; Fukuda, Hiroshi

2013-01-01

Recent studies have demonstrated developmental changes of functional brain networks derived from functional connectivity using graph theoretical analysis, which has been rapidly translated to studies of brain network organization. However, little is known about sex- and IQ-related differences in the topological organization of functional brain networks during development. In this study, resting-state fMRI (rs-fMRI) was used to map the functional brain networks in 51 healthy children. We then investigated the effects of age, sex, and IQ on economic small-world properties and regional nodal properties of the functional brain networks. At a global level of whole networks, we found significant age-related increases in the small-worldness and local efficiency, significant higher values of the global efficiency in boys compared with girls, and no significant IQ-related difference. Age-related increases in the regional nodal properties were found predominately in the frontal brain regions, whereas the parietal, temporal, and occipital brain regions showed age-related decreases. Significant sex-related differences in the regional nodal properties were found in various brain regions, primarily related to the default mode, language, and vision systems. Positive correlations between IQ and the regional nodal properties were found in several brain regions related to the attention system, whereas negative correlations were found in various brain regions primarily involved in the default mode, emotion, and language systems. Together, our findings of the network topology of the functional brain networks in healthy children and its relationship with age, sex, and IQ bring new insights into the understanding of brain maturation and cognitive development during childhood and adolescence.

Topological organization of functional brain networks in healthy children: differences in relation to age, sex, and intelligence.

Directory of Open Access Journals (Sweden)

Kai Wu

Full Text Available Recent studies have demonstrated developmental changes of functional brain networks derived from functional connectivity using graph theoretical analysis, which has been rapidly translated to studies of brain network organization. However, little is known about sex- and IQ-related differences in the topological organization of functional brain networks during development. In this study, resting-state fMRI (rs-fMRI was used to map the functional brain networks in 51 healthy children. We then investigated the effects of age, sex, and IQ on economic small-world properties and regional nodal properties of the functional brain networks. At a global level of whole networks, we found significant age-related increases in the small-worldness and local efficiency, significant higher values of the global efficiency in boys compared with girls, and no significant IQ-related difference. Age-related increases in the regional nodal properties were found predominately in the frontal brain regions, whereas the parietal, temporal, and occipital brain regions showed age-related decreases. Significant sex-related differences in the regional nodal properties were found in various brain regions, primarily related to the default mode, language, and vision systems. Positive correlations between IQ and the regional nodal properties were found in several brain regions related to the attention system, whereas negative correlations were found in various brain regions primarily involved in the default mode, emotion, and language systems. Together, our findings of the network topology of the functional brain networks in healthy children and its relationship with age, sex, and IQ bring new insights into the understanding of brain maturation and cognitive development during childhood and adolescence.

Can Carbon Fluxes Explain Differences in Soil Organic Carbon Storage under Aspen and Conifer Forest Overstories?

Directory of Open Access Journals (Sweden)

Antra Boča

2017-04-01

Full Text Available Climate- and management-induced changes in tree species distributions are raising questions regarding tree species-specific effects on soil organic carbon (SOC storage and stability. Quaking aspen (Populus tremuloides Michx. is the most widespread tree species in North America, but fire exclusion often promotes the succession to conifer dominated forests. Aspen in the Western US have been found to store more SOC in the mineral soil than nearby conifers, but we do not yet fully understand the source of this differential SOC accumulation. We measured total SOC storage (0–50 cm, characterized stable and labile SOC pools, and quantified above- and belowground litter inputs and dissolved organic carbon (DOC fluxes during snowmelt in plots located in N and S Utah, to elucidate the role of foliage vs. root detritus in SOC storage and stabilization in both ecosystems. While leaf litterfall was twice as high under aspen as under conifers, input of litter-derived DOC with snowmelt water was consistently higher under conifers. Fine root (<2 mm biomass, estimated root detritus input, and root-derived DOC fluxes were also higher under conifers. A strong positive relationship between root and light fraction C content suggests that root detritus mostly fueled the labile fraction of SOC. Overall, neither differences in above- and belowground detritus C inputs nor in detritus-derived DOC fluxes could explain the higher and more stable SOC pools under aspen. We hypothesize that root–microbe–soil interactions in the rhizosphere are more likely to drive these SOC pool differences.

Similarity or difference?

DEFF Research Database (Denmark)

Villadsen, Anders Ryom

2013-01-01

While the organizational structures and strategies of public organizations have attracted substantial research attention among public management scholars, little research has explored how these organizational core dimensions are interconnected and influenced by pressures for similarity....... In this paper I address this topic by exploring the relation between expenditure strategy isomorphism and structure isomorphism in Danish municipalities. Different literatures suggest that organizations exist in concurrent pressures for being similar to and different from other organizations in their field......-shaped relation exists between expenditure strategy isomorphism and structure isomorphism in a longitudinal quantitative study of Danish municipalities....

The Secondary Organic Aerosol Processor (SOAP v1.0) model: a unified model with different ranges of complexity based on the molecular surrogate approach

Science.gov (United States)

Couvidat, F.; Sartelet, K.

2015-04-01

In this paper the Secondary Organic Aerosol Processor (SOAP v1.0) model is presented. This model determines the partitioning of organic compounds between the gas and particle phases. It is designed to be modular with different user options depending on the computation time and the complexity required by the user. This model is based on the molecular surrogate approach, in which each surrogate compound is associated with a molecular structure to estimate some properties and parameters (hygroscopicity, absorption into the aqueous phase of particles, activity coefficients and phase separation). Each surrogate can be hydrophilic (condenses only into the aqueous phase of particles), hydrophobic (condenses only into the organic phases of particles) or both (condenses into both the aqueous and the organic phases of particles). Activity coefficients are computed with the UNIFAC (UNIversal Functional group Activity Coefficient; Fredenslund et al., 1975) thermodynamic model for short-range interactions and with the Aerosol Inorganic-Organic Mixtures Functional groups Activity Coefficients (AIOMFAC) parameterization for medium- and long-range interactions between electrolytes and organic compounds. Phase separation is determined by Gibbs energy minimization. The user can choose between an equilibrium representation and a dynamic representation of organic aerosols (OAs). In the equilibrium representation, compounds in the particle phase are assumed to be at equilibrium with the gas phase. However, recent studies show that the organic aerosol is not at equilibrium with the gas phase because the organic phases could be semi-solid (very viscous liquid phase). The condensation-evaporation of organic compounds could then be limited by the diffusion in the organic phases due to the high viscosity. An implicit dynamic representation of secondary organic aerosols (SOAs) is available in SOAP with OAs divided into layers, the first layer being at the center of the particle (slowly

Characteristics and source apportionment of organic matter in PM(2.5) from cities in different climatic zones of China

Science.gov (United States)

Feng, Jialiang

environment. WSOC/TC ratios were comparable in all three cities at 0.2-0.3 and this value can be considered typical for urban aerosols from Chinese cities. Similar PAH/ALK ratios were found in the three cities, and PAHs were from a mixed contribution of coal burning and engine exhaust. More than half of the resolved SEOC was found to be n-fatty acids and they were mainly from kitchen emissions based on source profile comparisons and CMB analysis. The increase of contribution from coal burning in Beijing due to space heating was identified by the different distribution of triterpanes in summer and winter. The relative concentrations of semivolatile fossil fuel residue n-alkanes (Guangzhou was a reflection of the variations of the vegetation in the different climatic zones. The seasonal variations in the concentrations and compositions of organic matter at Changdao were similar to the three cities, especially to Beijing. The remote island was also impacted by anthropogenic pollutants, and transported particles played a significant role in the contribution of the organic matter exemplified by the high WSOC/TC, low C18:1/C18 fatty acid, and high BeP/(BeP+BaP) ratios.

Risk assessment of metals and PAHs for receptor organisms in differently polluted areas in Slovenia.

Science.gov (United States)

Al Sayegh Petkovšek, Samar; Kopušar, Nataša; Tome, Davorin; Kryštufek, Boris

2015-11-01

Samples from receptor organisms (small mammals, passerine birds) and their food sources (herbaceous plants, leaves and fruits of wood plants, earthworms) were collected during 2011-2014 from the vicinity of a former lead smelter, from the vicinity of the largest Slovenian thermal power plant, from along a state road and also from a reference area. The samples were then analysed to determine the degree of contamination with the metals (Pb, Cd, Zn, Hg, Cu, Mo) and with polycyclic aromatic hydrocarbons (PAHs). This study provides the first data on metal and PAH exposure to small mammals and passerine birds in southeast Europe, focussing on the transfer of metals and PAHs through the food chain and on risk assessment for differently polluted areas in Slovenia. The results indicate that: (i) earthworms and herbaceous plants (especially roots) can be a source of metal exposure for organisms higher in the food chain; (ii) a risk from Pb and Cd (HQ > 1) in the vicinity of the former lead smelter exists for Myodes glareolus feeding in part on roots and for Apodemus flavicollis and Parus major feeding in part on earthworms; and (iii) mean Pb and Cd concentrations in the liver of small mammal species inhabiting the vicinity of the lead smelter reach effect concentrations in a significant proportion of the specimens (Pb: 40%, Cd: 67%); (iv) the results for P. major confirm that the study area is exposed to Pb, Cd, Hg; (v) metals contribute the major part of the total risk for receptor organisms from vicinity of lead smelter. On the contrary, the risk of PAHs for small mammals trapped close to the state road is insignificant. We can summarize, that the hazards experienced by the local ecosystem due to metal exposure may persist for decades in the vicinity of large emission sources (especially smelters). Copyright © 2015 Elsevier B.V. All rights reserved.

Rapid changes in the size of different functional organ and muscle groups during refueling in a long-distance migrating shorebird

NARCIS (Netherlands)

Piersma, T; Gudmundsson, GA; Lilliendahl, K; Gudmundsson, Gudmundur A.

1999-01-01

The adaptive value of size changes in different organ and muscle groups was studied in red knots (Calidris canutus islandica) in relation to their migration. Birds were sampled on five occasions: at arrival in Iceland in May 1994, two times during subsequent refueling, at departure toward, and on

Characterization of Screen-Printed Organic Electrochemical Transistors to Detect Cations of Different Sizes

Directory of Open Access Journals (Sweden)

Laura Contat-Rodrigo

2016-09-01

Full Text Available A novel screen-printing fabrication method was used to prepare organic electrochemical transistors (OECTs based on poly(3,4-ethylenedioxythiophene doped with polysterene sulfonate (PEDOT:PSS. Initially, three types of these screen-printed OECTs with a different channel and gate areas ratio were compared in terms of output characteristics, transfer characteristics, and current modulation in a phosphate buffered saline (PBS solution. Results confirm that transistors with a gate electrode larger than the channel exhibit higher modulation. OECTs with this geometry were therefore chosen to investigate their ion-sensitive properties in aqueous solutions of cations of different sizes (sodium and rhodamine B. The effect of the gate electrode was additionally studied by comparing these all-PEDOT:PSS transistors with OECTs with the same geometry but with a non-polarizable metal gate (Ag. The operation of the all-PEDOT:PSS OECTs yields a response that is not dependent on a Na+ or rhodamine concentration. The weak modulation of these transistors can be explained assuming that PEDOT:PSS behaves like a supercapacitor. In contrast, the operation of Ag-Gate OECTs yields a response that is dependent on ion concentration due to the redox reaction taking place at the gate electrode with Cl− counter-ions. This indicates that, for cation detection, the response is maximized in OECTs with non-polarizable gate electrodes.

Experimentation of grapevine cultivation in organic system, on five different Romanian vineyards

Directory of Open Access Journals (Sweden)

Aurora Maria Ranca

2016-11-01

Full Text Available In five Romanian vineyards, in 2013-2014 period was experimented organic system growing on  grape varieties for wine representative for each area, here are applied organic growing technology in parallel with the conventional (control. White varieties studied are: Chardonnay (Murfatlar and Valea Calugareasca, Sauvignon blanc and Muscat Ottonel(Tarnave, Feteasca regala (Tarnave, Bujoru and Copou-Iasi. Red varieties are Cabernet Sauvignon (Murfatlar and Valea Calugareasca and Merlot (Bujoru. Concerning evolution of main climatic factors for the years 2013-2014 it is show that the annual average air temperature increase compared with the average of the years 1991-2010; is observed an increasing in mean annual temperature, mean temperature during the growing season and the value of sum of sunshine hours. The water regime was kept constant, registering values close to the annual average, both during the growing season and at entire year. The weeds spectrum is represented both by dicotyledonous as knotweed (Polygonum aviculare, Veronica (Stellaria media, news (Amaranthus retroflexus, bindweed (Convolvurus arvensis and monocotyledonous as grass thick (Cynodon dactylon. Concerning the phytosanitary status, at Murfatlar were registered problems with oidium attack, with all main disease at Dealu Mare and with downy mildew at Bujoru. In all areas the pest has been found are: grape mouth (Lobesia botrana and spiders (Tetranichus sp.. Schemes of treatments focused generally on substances bassed on copper and sulfur to combat diseases and for pests have been used pheromonal traps or other certified organic products. The grapes harvest was lower in organic plots with till 25%; their quality being close at both growing variants.

ORGANIC ACIDS PRODUCTION OF RICE STRAW FERMENTED WITH SEVERAL TYPES OF MICROORGANISM AT DIFFERENT TEMPERATURES

Directory of Open Access Journals (Sweden)

Y. Yanti

2014-10-01

Full Text Available The experiment was carried out to examine the organic acids production of rice straw fermentedwith some types of microorganisms at different temperatures. The experiment was designed as SplitPlot-Completely Randomized Design. The main plot was temperatures treatments (25, 35, 45°C and thesub plot were microorganisms (Control, Control+Mollases, Lactobacillus fermentum, Bacillus subtilis,Bacillus coagulant, Saccharomyces cerevisiae, Aspergillus niger. The highest lactic acid productionswas in B. coagulans treatment at 35°C (53.79 g/kg DM. The highest acetic acid productions was in L.fermentum at 35°C (13.20 g/kg DM, while the highest propionic acid productions were in Controltreatment at 35°C (0.37 g/kg DM.

Characterisation of different hole transport materials as used in organic p-i-n solar cells

Energy Technology Data Exchange (ETDEWEB)

Pfuetzner, Steffen; Petrich, Annette; Koch, Maik; Riede, Moritz; Leo, Karl [Institut fuer Angewandte Photophysik, Technische Universitaet Dresden (Germany); Malbrich, Christine [Leibniz-Institut fuer Festkoerper- und Werkstoffforschung, Dresden (Germany); Hildebrandt, Dirk; Pfeiffer, Martin [Heliatek GmbH, Dresden (Germany)

2008-07-01

This work focuses on the replacement of hole transport material MeO-TPD, which has been used so far in organic p-i-n- solar cells despite its has unfavourable behaviour at elevated temperatures. For this reason, different characterisation and investigations of the hole transport materials PV-TPD, PV-TPDoM, Di-NPB and MeO-Spiro-TPD were done, i.e. dopability, hole mobility, absorption, reflection, cyclic voltametry and glass transition temperature were measured. With simplified structures, e.g. m-i-p diodes, and simplified solar cells, consisting of the blue absorbing fullerene C{sub 60} as acceptor and the transparent donor material 4P-TPD, further specific material properties were determined.

Maximum organic carbon limits at different melter feed rates (U)

International Nuclear Information System (INIS)

Choi, A.S.

1995-01-01

This report documents the results of a study to assess the impact of varying melter feed rates on the maximum total organic carbon (TOC) limits allowable in the DWPF melter feed. Topics discussed include: carbon content; feed rate; feed composition; melter vapor space temperature; combustion and dilution air; off-gas surges; earlier work on maximum TOC; overview of models; and the results of the work completed

Organic food processing

DEFF Research Database (Denmark)

Kahl, Johannes; Alborzi, Farnaz; Beck, Alexander

2014-01-01

In 2007 EU Regulation (EC) 834/2007 introduced principles and criteria for organic food processing. These regulations have been analysed and discussed in several scientific publications and research project reports. Recently, organic food quality was described by principles, aspects and criteria....... These principles from organic agriculture were verified and adapted for organic food processing. Different levels for evaluation were suggested. In another document, underlying paradigms and consumer perception of organic food were reviewed against functional food, resulting in identifying integral product...... identity as the underlying paradigm and a holistic quality view connected to naturalness as consumers' perception of organic food quality. In a European study, the quality concept was applied to the organic food chain, resulting in a problem, namely that clear principles and related criteria were missing...

Bacteriological quality of vegetables from organic and conventional production in different areas of Korea.

Science.gov (United States)

Tango, Charles Nkufi; Choi, Na-Jung; Chung, Myung-Sub; Oh, Deog Hwan

2014-08-01

Foods grown in organic production systems have been described as representing an increased risk to public health compared with foods from conventional production. Leafy vegetables (spinach, romaine lettuce, and green sesame leaves) grown in organic and conventional systems were collected from various areas in Korea and examined using standard culture methods to compare the microbiological quality of the produce grown in the two agricultural systems. The 354 samples of these leafy vegetables were analyzed for levels of indicator bacteria (aerobic bacteria, coliforms, and Escherichia coli) and the prevalence of the pathogens Staphylococcus aureus, E. coli O157:H7, Listeria monocytogenes, Bacillus cereus, and Salmonella. Aerobic bacteria and coliforms were detected in all vegetable types, but nonpathogenic E. coli was below the limit of detection in all samples. B. cereus was the most prevalent pathogen, found on 7 (11.1%) of the 63 organic spinach samples. The prevalence of S. aureus was highest in organic sesame leaves; it was found on 5 (8.0%) of the 63 samples. The prevalence of L. monocytogenes was highest on organic romaine lettuce and spinach; it was found in 4 (6.4%) of 63 samples of each type of vegetable. E. coli O157:H7 found on only 1 (1.58%) of 55 conventional spinach samples. These results suggest that farming type at most only slightly affects the hygienic quality of leafy vegetables, and no effect was found for sample collection area. Salmonella was not isolated from any of the conventional or organic leafy vegetables. These results do not support the hypothesis that organic produce poses a substantially greater risk of pathogen contamination than does conventional produce.

Behaviour in an Organization

OpenAIRE

Klímová, Kateřina

2009-01-01

Diploma thesis "The behavior in the organization" at a practical level, integrates the knowledge of psychology, sociology and management. It explains bahavior of people in the organization, which seeks to use this knowledge for the benefit of the organizaton and its management. It focuses on individual differences among people in the organization, organizational culture, relationships between people in workplace, organizational structure, communication within the organization, motivation, dev...

Qualitative attributes and postharvest conservation of green ears of maize grown on different cover crops in organic no-till system

Directory of Open Access Journals (Sweden)

Luiz Fernando Favarato

Full Text Available ABSTRACT Postharvest quality of sweet maize varies depending on the type of seed, soil, quality of fertilizer, climatic conditions, and stage of maturation. This study aimed to evaluate the post-harvest quality and shelf life of green ears of maize grown on three soil covers in organic no-till sytem. The study was conducted in the municipality of Domingos Martins, ES (20° 22'16.91" S and 41° 03' 41.83" W. The experiment was arranged in a randomized block design with six replications and five treatments, consisting of three cover crops in organic no-till system: black-oat straw, white lupin, oat/lupin intercrop and two systems, organic and conventional, without straw. Maize double hybrid AG-1051 was sown in a spacing of 1.00 x 0.20 m. The variables evaluated included relative percentage of grain, straw and cob, pH, titratable acidity, soluble solids, grain moisture and shelf life. The use of different straws in the organic no-till system does not influence the postharvest quality of green ears. Ears packed in polystyrene trays with plastic film are suitable for marketing until the fifth day of storage at room temperature.

The soil organic carbon content of anthropogenically altered organic soils effects the dissolved organic matter quality, but not the dissolved organic carbon concentrations

Science.gov (United States)

Frank, Stefan; Tiemeyer, Bärbel; Bechtold, Michel; Lücke, Andreas; Bol, Roland

2016-04-01

Dissolved organic carbon (DOC) is an important link between terrestrial and aquatic ecosystems. This is especially true for peatlands which usually show high concentrations of DOC due to the high stocks of soil organic carbon (SOC). Most previous studies found that DOC concentrations in the soil solution depend on the SOC content. Thus, one would expect low DOC concentrations in peatlands which have anthropogenically been altered by mixing with sand. Here, we want to show the effect of SOC and groundwater level on the quantity and quality of the dissolved organic matter (DOM). Three sampling sites were installed in a strongly disturbed bog. Two sites differ in SOC (Site A: 48%, Site B: 9%) but show the same mean annual groundwater level of 15 and 18 cm below ground, respectively. The SOC content of site C (11%) is similar to Site B, but the groundwater level is much lower (-31 cm) than at the other two sites. All sites have a similar depth of the organic horizon (30 cm) and the same land-use (low-intensity sheep grazing). Over two years, the soil solution was sampled bi-weekly in three depths (15, 30 and 60 cm) and three replicates. All samples were analyzed for DOC and selected samples for dissolved organic nitrogen (DON) and delta-13C and delta-15N. Despite differences in SOC and groundwater level, DOC concentrations did not differ significantly (A: 192 ± 62 mg/L, B: 163 ± 55 mg/L and C: 191 ± 97 mg/L). At all sites, DOC concentrations exceed typical values for peatlands by far and emphasize the relevance even of strongly disturbed organic soils for DOC losses. Individual DOC concentrations were controlled by the temperature and the groundwater level over the preceding weeks. Differences in DOM quality were clearer. At site B with a low SOC content, the DOC:DON ratio of the soil solution equals the soil's C:N ratio, but the DOC:DON ratio is much higher than the C:N ratio at site A. In all cases, the DOC:DON ratio strongly correlates with delta-13C. There is no

The Effects of Simultaneous Application of Different Organic and Biological Fertilizers on Quantitative and Qualitative Characteristics of Cucurbita pepo L.

Directory of Open Access Journals (Sweden)

M Jahan

2013-08-01

Full Text Available Understanding of relations and interactions between ecosystem’s components and plants is one of the main conditions for sustainable production of medicinal plants. To study the effect of simultaneous application of organic and biological fertilizers on yield and yield components of zucchini squash, a split plot arrangement of factors based on randomized complete block design with tree replications was used during 2009-10 growing season. The mainplot factor was the type of organic fertilizers, including 1-cow manure, 2-sheep manure, 3-chicken manure, 4-vermicompost and 5-control. The subplot factor was the biofertilizer (namely Nitragin, containing Azotobacter sp. , Azospirillum sp. and Pseudomonas sp., utilization. The results showed the positive but non significant effect of organic and biological fertilizers on yield and yield components of zucchini squash. Amongst the organic fertilizers, cow and chicken manure, have superiority compared the others. The highest seed oil and protein percent resulted in chicken manure, although there was not significant different between treatments due to seed oil percent. The positive effect of organic and biological fertilizers on seed yield was higher than fruit yield. Positive correlations found between fruit and seed yield, and between one fruit weight and one fruit seed weight (R2=0.72** and 0.56**, respectively. At a glance, cow manure solely application was better than its application with nitragin. Nitragin application has no significant effect on some traits, when utilized with sheep manure and vermicompost. The possibilities of antagonistic effect among organic and biological fertilizers needs to be more studied.

A Comparison of How Undergraduates, Graduate Students, and Professors Organize Organic Chemistry Reactions

Science.gov (United States)

Galloway, Kelli R.; Leung, Min Wah; Flynn, Alison B.

2018-01-01

To explore the differences between how organic chemistry students and organic chemistry professors think about organic chemistry reactions, we administered a card sort task to participants with a range of knowledge and experience levels. Beginning students created a variety of categories ranging from structural similarities to process oriented…

What Differences Make a Difference? The Promise and Reality of Diverse Teams in Organizations.

Science.gov (United States)