WorldWideScience

Sample records for volumetrica ao longo

  1. O papel do leite ao longo do ciclo de vida

    OpenAIRE

    Lima, Joana Catarina Dinis

    2012-01-01

    Resumo da tese: A presença do leite nos guias alimentares denota a sua importância na alimentação humana. Contudo, não é consensual que este alimento deva fazer parte da nossa alimentação ao longo de todo o ciclo de vida. Sabe-se que cada espécie produz um tipo de leite diferente, com diversas moléculas bioativas e nutrientes que modulam o seu crescimento e desenvolvimento corporal. Recentemente, uma parte da fração proteica do leite tem sido apontada como tendo um possível efeito estimulante...

  2. Habilidades sociais e competência social: Analisando conceitos ao longo das obras de Del Prette e Del Prette

    Directory of Open Access Journals (Sweden)

    Camila Negreiros Comodo

    2017-08-01

    Full Text Available Considerando a diversidade conceitual do campo das Habilidades Sociais, tanto entre diferentes autores, como para um mesmo autor ao longo de suas obras, este estudo objetivou analisar as definições de habilidades sociais e competência social, a partir das obras de Del Prette e Del Prette. As definições dos conceitos foram selecionadas de livros e artigos teóricos desses autores, desde 1996 até 2012, e comparadas, em ordem cronológica. Com base nessas análises, observaram-se diferenças importantes em ambos os conceitos, ao longo das obras dos autores, produto de revisões, complementações e aprimoramentos de conhecimentos conceituais, empíricos e metodológicos que ocorreram ao longo do tempo.

  3. Prevalência e procura de ajuda na violência conjugal física ao longo da vida

    Directory of Open Access Journals (Sweden)

    Alessandra Bruschi

    2006-04-01

    Full Text Available OBJETIVO: Estimar a prevalência de violência conjugal física ao longo da vida em mulheres de comunidade urbana de baixa renda e identificar os tipos de ajuda procurados pelas vítimas. MÉTODOS: Trata-se de estudo-piloto brasileiro de corte transversal, vinculado a projeto multicêntrico internacional conduzido em 1999, com amostra probabilística de conglomerados no município de Embu, Estado de São Paulo. Foram considerados elegíveis os domicílios com mulheres de 15 a 49 anos, que residissem com filho/filha <18 anos e tivessem vivido com algum marido/companheiro ao longo da vida. Entrevistadoras treinadas aplicaram questionários padronizados (n=86. Três tipos de violência conjugal física sofrida ao longo da vida foram investigados: grave (chute, soco, espancamento e/ou uso/ameaça de uso de arma, não grave (tapa na ausência de violência grave e algum tipo (grave e/ou não grave, além de outras formas de agressão física espontaneamente referidas e os tipos de ajuda procurada (pessoas e instituições. Foram calculadas as freqüências dos tipos de violência e respectivos intervalos de confiança de 95%. RESULTADOS: As entrevistadas referiram tapa (32,6%, soco (17,5%, espancamento (15,2%, uso/ameaça de arma (13,9% e chute (10,6%. Foram altas as taxas de prevalência de violência conjugal: grave 22,1% (13,3-30,9, não grave 10,5% (4,0-17,0 e algum tipo 33,7% (32,7-34,7. Vítimas de violência grave procuraram ajuda mais freqüentemente da polícia/delegacia (36,8% ou de curandeiros/benzedeiras/pais de santo (21,1% que de centros de saúde (5,3%, apesar da disponibilidade desses serviços na região. CONCLUSÕES: A violência conjugal física ao longo da vida é freqüente e grave na comunidade estudada, sendo que a procura de ajuda foi direcionada mais freqüentemente à polícia/delegacia ou a curandeiros/benzedeiras/pais de santo do que a centros de saúde.

  4. Avaliação do potencial antioxidante da geleia real ao longo do tempo de armazenamento

    Directory of Open Access Journals (Sweden)

    Maria Luisa Teles Marques Florencio Alves

    2012-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2012v25n3p257   A geleia real é uma substância com aspecto de pasta gelatinosa, de cor branca, ligeiramente amarelada, secretada pelas glândulas hipofaringeanas e mandibulares das abelhas operárias. O objetivo desta pesquisa foi avaliar o potencial antioxidante da geleia real, ao longo do tempo de armazenamento. Os parâmetros físico-químicos utilizados foram: umidade, teor de ácido ascórbico e de fenólicos totais. As amostras foram submetidas ao processo de extração dando origem ao extrato alcoólico, que foi aplicado ao teste do 1,1-difenil-2-picrilhidrazil (DPPH para avaliação da atividade antioxidante in vitro. A geleia real apresentou baixos teores de ácido ascórbico (de 0,75 a 1,31mg/100g base úmida e de fenólicos totais (de 14,26 a 28,30mg EAG/100g base úmida. As porcentagens de descoloração do DPPH pelo extrato alcoólico das amostras ficaram acima de 50%, exceto aos 90 dias de armazenamento. A partir dos resultados obtidos, considerando-se os reduzidos teores de ácido ascórbico e de fenólicos totais e, ainda, o baixo desempenho do extrato alcoólico das amostras no teste de atividade antioxidante in vitro, conclui-se que a geleia real apresenta potencial antioxidante relativamente baixo. O tempo de armazenamento não foi determinante nas alterações encontradas.

  5. Educação: pensadores ao longo da história: Seymour Papert

    OpenAIRE

    Sousa, João Sérgio de Pina Carvalho (Ed.); Meirinhos, Manuel; Patrício, Maria Raquel; Gonçalves, Vitor

    2016-01-01

    Seymour Aubrey Papert (1928-2016) natural de Pretória, África do Sul, faleceu aos 88 anos nos Estados Unidos da América. Matemático de renome mundial, pioneiro da inteligência artificial e da computação educacional, foi docente do MIT Media Lab. Este poster evidencia os principais fundamentos teóricos e práticos da sua obra pedagógica, a atualidade da sua pedagogia e as suas implicações na educação. info:eu-repo/semantics/publishedVersion

  6. Um conceito reinterpretado ao longo do século: do intelectual individualista de Durkheim ao intelectual coletivo de Bourdieu

    Directory of Open Access Journals (Sweden)

    Ione Ribeiro Valle

    2017-10-01

    Full Text Available Para contribuir com o debate sobre os intelectuais recorremos a dois sociólogos, distanciados um do outro cerca de um século: Émile Durkheim (1858-1917 e Pierre Bourdieu (1930-2002. O primeiro preconiza a relação entre uma “moral individualista” e o papel do intelectual. Esta reflexão integra o conjunto de suas apostas na coesão social e na moral laica, indispensáveis à promoção do progresso e da ordem nas sociedades em processo crescente de diferenciação. A perspectiva de Bourdieu volta-se à necessidade de “reinventar uma espécie de intelectual coletivo segundo o modelo do que foram os enciclopedistas”. Segundo ele, um novo desafio se impõe ao intelectual coletivo: mobilizar a ciência, e a sociologia em particular, na luta contra os usos abusivos da própria ciência e da autoridade científica. As ideias destes pensadores oferecem chaves de leitura que inspiram o desenvolvimento de uma sociologia histórica voltada à educação no pensamento social brasileiro.

  7. Análise do desempenho do basquetebol brasileiro ao longo de três temporadas do Novo Basquete Brasil

    Directory of Open Access Journals (Sweden)

    Lucas Rodrigues Meneses

    2016-03-01

    Full Text Available Resumo O estudo verificou a evolução do basquetebol brasileiro a partir dos índices de desempenho (ID das equipes em três temporadas do Novo Basquete Brasil (2009 a 2012 e determinou valores de referência (percentis dos principais ID. Os dados foram coletados no site da Liga Nacional de Basquete. Foram analisados em 726 jogos os ID mais frequentes na análise do jogo de basquetebol pela ANOVA de um fator (post hoc de Tukey. A temporada 2011/12 apresentou menor número de arremessos de três pontos e maior de dois pontos, melhor aproveitamento nos lances livres e redução nos rebotes ofensivos. Os percentis indicam alto grau de exigência para a performance das equipes nos ID analisados. Nota-se uma tendência à modificação do estilo de jogo das equipes ao longo das três temporadas.

  8. O nitrato influencia o metabolismo de compostos nitrogenados em calopogônio (Calopogonium mucunoides ao longo do ciclo de vida

    Directory of Open Access Journals (Sweden)

    Regiane Aparecida Canatto

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2014v27n1p1   Em Calopogonium mucunoides, o metabolismo de nitrogênio foi significativamente alterado entre os diferentes estádios de desenvolvimento das plantas. Ao longo do ciclo de vida, mesmo na presença de nitrato, a planta manteve-se nodulada e altas concentrações de ureídeos foram identificadas nos tecidos e seiva de xilema, evidência de que a espécie é tolerante ao nitrato e que este não afeta a fixação de nitrogênio ao longo do desenvolvimento. A redução bioquímica de nitrato apresenta alterações ao longo do ciclo de vida, com mudança no sítio de redução junto com mudanças na concentração de aminoácidos solúveis totais. No entanto, a atividade de nitrato redutase constitutiva em nódulos desaparece com a exposição ao nitrato.

  9. Inteligência como constructo e como processo: sumário das pesquisas ao longo do tempo

    Directory of Open Access Journals (Sweden)

    Franco Lo Presti Seminerio

    2002-01-01

    Full Text Available Partindo da conceituação culturalmente corrente de inteligência, das implicações em termos da recente teoria da mente e das decorrências éticas e políticas, visa-se, neste artigo, tracejar o percurso das investigações científicas nesta área. Inicialmente destaca-se a tentativa de avaliar a idade mental e o constructo de QI, na Europa e nos Estados Unidos. Avalia-se, em seguida, o esforço dos fatorialistas para aprofundar o processo intelectual, a partir de seus determinismos. A busca de Spearman de um fator geral, através de um cálculo estatístico - equação tetrádica - e a ampliação desta teoria, bifatorial, para uma concepção hierárquica. A objeção metodológica de Thurstone e a criação do método centróide e da teoria multifatorial. A crítica epistemológica de Guilford ao modelo radicalmente empirista e a descrição antecipada de três dimensões básicas envolvendo cinco categorias de operações, seis de produtos e quatro de conteúdos (no modelo original. A posição anterior de Thorndike e a visão ambientalista multimodal, centrada na aprendizagem. A visão racionalista e universalista da Epistemologia Genética e as decorrências pedagógicas como autonomia radical no desenvolvimento ontogenético. Críticas. A visão social de Vigotzky e a contribuição da psicologia soviética. A aproximação da lingüística e da cognição. A contribuição de Bruner ao longo de quatro etapas. O grande debate inatismo ambientalismo e implicações político-sociais. O advento da metacognição, teoria da teoria e teoria da mente e as pesquisas de diagnóstico e de intervenção psicopedagógica. O papel do desenvolvimento intelectual para uma política igualitária de emancipação.

  10. Perspetiva imersa e distanciada ao longo da reestruturação cognitiva de crenças desadaptativas: estudo de caso em Terapia Cognitivo – Comportamental

    OpenAIRE

    Sousa Lopes, Patrícia Marlene

    2015-01-01

    O objetivo do presente estudo é analisar a relação entre estas diferentes perspetivas e a técnica de reestruturação cognitiva. Foi formulada uma hipótese com o intuito de verificar se pessoas deprimidas em Terapia Cognitivo – Comportamental aumentam a capacidade de distanciamento ao longo do processo terapêutico à medida que ocorre a Reestruturação Cognitiva.

  11. Serial discontinuity along the Descoberto River Basin, Central Brazil Descontinuidade serial ao longo da bacia do rio Descoberto, Brasil Central

    Directory of Open Access Journals (Sweden)

    Weliton José da Silva

    2010-09-01

    Full Text Available AIM: The Descoberto Basin was studied as a discontinuous ecological system through one seasonal cycle (about one year, at 13 sampling sites; METHODS: The connectivity was analyzed in relation to environmental and limnological characteristics along the length of the Descoberto River, and the variables that most influenced the different sampling sites were determined; RESULTS: Sites K and L, located upstream and downstream of the entrance of the Melchior River, respectively, differed most in physical and chemical parameters. A Principal Components Analysis demonstrated that the system was more influenced spatially than temporally, with 74.57% of accumulated variance accounted for by the first two axes. High values of chloride, chlorophyll-a, BOD5, total phosphorus, and total organic carbon, as well as low dissolved-oxygen concentrations separated sites L and M from the others. Winter and spring were the seasons in which most parameters showed significant differences among the sites; CONCLUSIONS: The construction of the dam and waste discharge act as discontinuity factors affecting the referred system, mainly at middle region and lower patch, between the sites K and L. Besides the construction of the reservoir, the Melchior River, an extremely impacted system, affects the Descoberto River downstream from its entry. Important changes in water quality occur in the lower basin, especially downstream of the Descoberto Reservoir, with significant increases in nutrient concentrations, suspended solids, turbidity, and chlorophyll a, and therefore a decrease in water clarity.OBJETIVO: A bacia do rio Descoberto foi estudada como um sistema descontínuo através de um ciclo sazonal (um ano em 13 estações amostrais; MÉTODOS: A conectividade foi analisada em relação a características ambientais e limnológicas ao longo eixo longitudinal do rio Descoberto e as variáveis que mais influenciaram as diferentes estações amostrais foram determinadas

  12. Vitimação múltipla feminina ao longo da vida: uma revisão sistemática da literatura

    Directory of Open Access Journals (Sweden)

    Marlene Matos

    2013-01-01

    Full Text Available No contexto internacional assistimos a um crescente reconhecimento científico de que as mulheres, vítimas preferenciais de diferentes formas de vitimação, tendem a coo-experienciar outras formas de vitimação ao longo da vida. Neste artigo realizamos uma revisão sistemática da literatura existente sobre a vitimação múltipla de mulheres ao longo da vida. Conclui-se que predominam os estudos quantitativos de natureza transversal, retrospectivos e com designs descritivos correlacionais, centrados na vitimação múltipla interpessoal, nomeadamente, íntima. Os inventários de autorrelato e as entrevistas semiestruturadas são os instrumentos mais frequentes para avaliar o fenómeno, recorrendo, maioritariamente, a amostras por conveniência, recrutadas em contexto normativo (universitário ou forense. A prevalência, embora elevada, oscila entre os estudos, reflexo das diferentes amostras e instrumentos utilizados. Quanto ao impacto, os estudos são consensuais na ideia de que quanto maior a vitimação cumulativa, maior o impacto (efeito dose. Finalmente, apresentamos os principais contributos e limitações que derivam desta revisão sistemática.

  13. Volumetric humidity timely variation, at different depths, in soils of a toposequence of the Reconcavo Baiano - Brazil; Variacao da umidade volumetrica ao longo do tempo, em diferentes profundidades, em solos de uma topossequencia do Reconcavo Baiano

    Energy Technology Data Exchange (ETDEWEB)

    Ribeiro, Antonio Carlos; Costa, Liovando Marciano da [Vicosa Univ., MG (Brazil). Dept. de Solos; Paiva, Arlicelio de Queiroz [UESC, Ilheus, BA (Brazil). Dept. de Ciencias Agrarias e Ambientais. E-mail: aqpaiva@jacaranda.uescba.com.br; Souza, Luciano da Silva [Empresa Brasileira de Pesquisa Agropecuaria, Cruz das Almas, BA (Brazil). Centro Nacional de Pesquisa de Mandioca e Fruticultura. E-mail: lsouza@cnpmf.embrapa.br; Santana, Marlete Bastos [Bahia Univ., Cruz das Almas, BA (Brazil). Escola de Agronomia

    1997-07-01

    Aiming the time basis volumetric humidity evaluation, at different depths, the present work has been developed in a Reconcavo Baiano toposequence consisting of three different soils, in accordance with the distances from the toposequence begin. A neutron probe has been used for determination of the soil water contents. The relative counting of the neutron probe has been converted to gravimetric humidity by using regression equation for each type of soil.

  14. Etiologia das infecções intramamárias em vacas primíparas ao longo dos primeiros quatro meses de lactação

    Directory of Open Access Journals (Sweden)

    Laffranchi Alessandra

    2001-01-01

    Full Text Available De 88 vacas primíparas, oriundas de quatro rebanhos leiteiros, foram colhidas 1985 amostras de leite, ao longo dos 120 dias pós-parto, das quais 457 (23,02% apresentaram resultados microbiológicos positivos. Os estafilococos coagulase negativos (ECN foram isolados em 316 (69,14% amostras, Corynebacterium bovis em 56 (12,25%, estreptococos em 41 (8,97% e estafilococos coagulase positivos (ECP em 38 (8,31%. Mastite clínica foi detectada em nove (10,23% vacas. No primeiro dia pós-parto, 57 (64,77% animais e 114 (32,66% quartos apresentaram exames bacteriológicos positivos. Até o décimo quarto dia, ocorreu um decréscimo acentuado no número de vacas e quartos infectados, que posteriormente tendeu a estabilizar. Os ECN foram as bactérias mais isoladas ao longo de todo experimento, enquanto o número de estreptococos decresceu acentuadamente nas duas primeiras semanas pós-parto. As infecções por C. bovis aumentaram progressivamente a partir do parto. Entre os ECN, predominaram o S. hyicus e o S. intermedius e, nos estreptococos, os do grupo C e D. A contagem média de células somáticas (CCS, nos quartos infectados, foi de 508,914/m, enquanto que, nos quartos negativos, foi de 73,942/m.

  15. Avaliação hidrológica da zona ripária através da análise da água subterrânea ao longo das vertentes de uma microbacia experimental

    OpenAIRE

    Cláudia Moster

    2007-01-01

    Amostras da água subterrânea foram coletadas em poços piezométricos localizados em dois transectos ao longo das vertentes e dois transectos ao longo da cabeceira de drenagem de uma microbacia experimental, durante o período de maio de 2005 a abril de 2006. Em cada transecto os poços piezométricos estavam localizados respectivamente na parte alta da vertente, sob floresta plantada de Eucalyptus, na meia encosta, sob mata ciliar, e adjacente ao riacho. As análises destas amostras também foram c...

  16. Análise do comportamento da creatina quinase ao longo da pré-temporada de um time de futebol profissional

    Directory of Open Access Journals (Sweden)

    Daniel Barbosa Coelho

    2014-01-01

    Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2014v16n2p129 A realização de exercícios físicos pode resultar em danos teciduais sobre o sis-tema muscular, inclusive durante a pré-temporada, que é um período de preparação física visando competições subsequentes. O objetivo do estudo foi analisar o comportamento da CK plasmática como marcador de dano muscular ao longo da pré-temporada de uma equipe de futebol profissional; determinar em que momento da pré-temporada os níveis de CK atingem o valor pico; e verificar a concentração de CK no dia antecedente ao primeiro jogo oficial da temporada. Participaram deste estudo 31 jogadores de futebol profissional (24.3 ± 3.9 anos, 181.0 ± 7.0 cm de altura, 9.1 ± 1.3 %GC e 66.0 ± 4.5 mlO2/kg/min. A concentração plasmática de CK foi determinada ao início da pré-temporada (M1, 4 (M2, 10 (M3 e 15 (M4 dias após. Identificaram-se valores de CK de 178.2 ± 12.0, 540.0 ± 59.1, 389.8 ± 49.5, 408.7 ± 45.0 U/L para M1, M2, M3 e M4, respectivamente. A concentração pico de CK ocorreu no M2 (p<0,05. A análise do comportamento da CK plasmática revelou níveis aumentados ao longo de toda a pré-temporada de uma equipe de futebol profissional em comparação com o período de férias. O valor pico de CK foi atingido no 4º dia da pré-temporada. A concentração de CK no dia antecedente ao primeiro jogo oficial da temporada mostrou-se na faixa de valores recomendada para jogadores profissionais.

  17. Reprodutibilidade da classificação da AO/ASIF para fraturas dos ossos longos na criança Reproducibility of the AO / ASIF classification for fractures of long bones in children

    Directory of Open Access Journals (Sweden)

    Gilberto Francisco Brandão

    2010-12-01

    Full Text Available OBJETIVO: Avaliar a reprodutibilidade intraobservador e interobservador da classificação proposta pelo grupo AO/ASIF, para as fraturas dos ossos longos em crianças. MÉTODO: Foram analisadas e classificadas por cinco avaliadores, 100 radiografias convencionais digitalizadas de fraturas dos ossos longos em crianças, utilizando a classificação alfanumérica proposta pelo grupo AO/ASIF. A força de concordância intraobservador (realizada com intervalo de 90 dias e a interobservador foram avaliadas através do coeficiente Kappa. RESULTADOS: O índice Kappa para observação intraobservador foi de 0,69 (grande concordância e na análise interobservador o índice foi de 0,64 (grande concordância na primeira avaliação e 0,61 (grande concordância na segunda análise realizada 90 dias após a classificação inicial. CONCLUSÃO: A classificação proposta pelo grupo AO/ASIF mostrou grande concordância intra e interobservador, sendo útil para utilização nas fraturas dos ossos longos em crianças.OBJECTIVE: To evaluate the interobserver and intraobserver reproducibility of the classification proposed by the AO/ASIF group for long bone fractures in children. METHODS: One hundred roentgenograms of long bone fractures in children were evaluated and classified according to the alphanumeric AO/ASIF classification by six observers. The strength of theintraobserver(performed with a 90-day interval and interobserveragreementwere evaluated using the Kappa coefficient. RESULTS: The intraobserver Kappa index was 0.69 (good agreement. The interobserver index was 0.64 (good agreement in the first evaluation and 0.61 (goodagreement in the second analysisperformed 90 days after the initial classification. CONCLUSION: The classification proposed by the AO/ASIF group for long bone fractures demonstrated good inter- and intraobserver agreement. This classification is useful for describing fractures of long bones in children.

  18. Preparação para a aposentadoria como parte da educação ao longo da vida

    Directory of Open Access Journals (Sweden)

    Lucia Helena de Freitas Pinho França

    Full Text Available O processo de globalização trouxe para as grandes organizações uma série de consequências, entre as quais a prática das aposentadorias incentivadas, em que diversos trabalhadores experientes foram dispensados, muitos sem qualquer preparação para uma vida que pode durar mais do que o tempo dedicado ao trabalho. Hoje muitas organizações já reconhecem o valor dos trabalhadores mais velhos, que, se atualizados, podem continuar tão motivados quanto já demonstraram em capacidade e experiência. Entretanto, alguns precisam ou desejam se aposentar, aproveitando o tempo livre para realizar atividades de desenvolvimento pessoal, de lazer, de cuidado com a saúde, desenvolvimento de projetos pessoais, relacionamentos sociais e familiares e mesmo para o engajamento em uma atividade profissional mais prazerosa. Este artigo pretende oferecer uma perspectiva do envelhecimento dos trabalhadores nas organizações e do desafio de lidar com a aposentadoria, analisando-se aspectos e variáveis que podem facilitar ou dificultar o bem-estar das pessoas nessa transição. Mais do que focar nas teorias que estariam fundamentando os Programas de Preparação para a Aposentadoria (PPAs, o artigo apresenta algumas pesquisas empíricas, de forma a incentivar a reflexão dos psicólogos sociais, organizacionais e orientadores profissionais sobre as suas possibilidades de inserção nessa área de atuação.

  19. Alimentos utilizados ao longo da história para nutrir lactentes The history of infant nutrition

    Directory of Open Access Journals (Sweden)

    Silvia Diez Castilho

    2010-06-01

    Full Text Available OBJETIVO: Resgatar a história da alimentação infantil, com o intuito de compreender a prática da amamentação. FONTES DOS DADOS: O levantamento bibliográfico foi realizado nas bases MEDLINE, LILACS e SciELO, Internet, enciclopédias, livros científicos e leigos, literatura, arte e história. Foram consultados textos sobre os cuidados com lactentes em diferentes épocas, a história da Medicina, e artigos científicos recentes sobre nutrição infantil. SÍNTESE DOS DADOS: Durante o período pré-industrial, os costumes pouco variaram, e a chance de sobrevivência estava relacionada ao aleitamento materno ou à sua substituição pelo leite de uma ama. Caso isso não fosse possível, os lactentes recebiam leite animal, alimentos pré-mastigados ou papas pobres em nutrientes e contaminadas, que determinavam altos índices de mortalidade. Nada podia substituir a amamentação com sucesso, e dela dependia a sobrevivência da espécie. Com a Revolução Industrial, as mulheres, que costumavam amamentar, foram trabalhar nas fábricas, motivando a busca de alternativas para nutrir os lactentes. O consumo de leite animal e fórmulas (diluídas, farinhas, leite em pó, bem como a introdução precoce de alimentos comprometeram a saúde das crianças. O movimento feminista e a pílula anticoncepcional determinaram queda da natalidade. As fábricas, visando o lucro, desenvolveram fórmulas modificadas e investiram em propaganda. A sociedade reagiu com um movimento de incentivo ao aleitamento. CONCLUSÕES: Atualmente, reconhecem-se as vantagens do leite materno, e recomenda-se aleitamento exclusivo até os 6 meses, complementado com outros alimentos a partir dessa idade até pelo menos os 2 anos. A alimentação infantil, natural ou artificial, sempre foi determinada e condicionada pelo valor social atribuído à amamentação.OBJECTIVE: To retrace the history of infant nutrition with the objective of better understanding breastfeeding. SOURCES

  20. Potencial envolvimento da adiponectina e seus receptores na modulação da esteroidogênese em corpo lúteo de cadelas ao longo do diestro

    Directory of Open Access Journals (Sweden)

    Vanessa U. Fonseca

    2012-10-01

    Full Text Available No ciclo estral de cadelas a fase luteínica, denominada diestro, compreende um período que varia de 60 a 100 dias em animais não-prenhes, caracterizado pela elevação plasmática de progesterona nos primeiros 20 dias pós ovulação (p.o. A adiponectina é a mais abundante proteína secretada pelo tecido adiposo, porém sua concentração plasmática diminui significativamente em alterações metabólicas como resistência insulínica e Diabetes mellitus tipo2, alterações descritas como relacionadas em algumas cadelas com o período de diestro. O objetivo do estudo foi determinar a expressão e imunolocalização do sistema adiponectina (adiponectina e seus receptores, adipoR1 e adipoR2 no corpo lúteo de cadelas ao longo do diestro, correlacionando-o ao perfil hormonal de 17β-estradiol e progesterona, assim como à expressão de um dos genes alvo do sistema, o PPAR-γ. Para realização do estudo foram coletados corpos lúteos de 28 cadelas durante ovariosalpingohisterectomia de eleição nos dias 10, 20, 30, 40, 50, 60 e 70 pós ovulação (o dia zero da ovulação foi considerado aquele no qual a concentração plasmática de progesterona atingiu 5ng/mL. Os corpos lúteos foram avaliados por imunohistoquímica para adiponectina e seus receptores e a expressão do RNAm do PPAR-γ por PCR em tempo real. A análise estatística da avaliação gênica foi realizada com o teste ANOVA, seguido por comparação múltipla Newman-Keuls. O sinal da adiponectina apresentou-se mais intenso até os primeiros 20 dias p.o, momento de regência da progesterona; houve queda gradativa após este período, coincidindo com a ascensão do 17β-estradiol, cujo pico foi notado próximo do dia 40 p.o. A queda marcante da adiponectina ocorreu após 50 dias p.o. O sinal do adipoR1 mostrou-se bem evidente até os 40 dias p.o e o do adipoR2 até os 50 dias p. o, decaindo posteriormente. Foi observada maior expressão do gene PPAR-γ aos 10, 30 e 70 dias p

  1. Levantamento de Odonata (Insecta ao longo das margens do Rio Dois de Setembro, Município de Ecoporanga, noroeste do Estado do Espírito Santo

    Directory of Open Access Journals (Sweden)

    Ivani Vieira Damaceno

    2014-01-01

    Full Text Available É apresentado um levantamento das odonatas coletadas às margens do Rio Dois de Setembro, Município de Ecoporanga, noroeste do Estado do Espírito Santo. As coletas foram feitas de Junho de 2011 a Fevereiro de 2012, com auxílio de redes entomológicas aéreas, em cinco pontos ao longo das margens do rio, incluindo ambientes com distintos graus de antropização. Foram coletados 421 exemplares, representando 34 espécies. Dentre as espécies mais encontradiças estão Erythrodiplax basalis(Kirby, 1897; Erythrodiplax umbrata Linnaeus, 1758;Hetaerina auripennis (Burmeister, 1839; Perithemis lais(Perty, 1834. A ocorrência das seguintes espécies é registrada pela primeira vez para o Estado do Espírito Santo: Acanthagrion cuyabae Calvert, 1909; Enallagmanovaehispaniae Calvert, 1907; Lestes forficula Rambur, 1842.

  2. Arborização ao longo de ruas - túneis verdes - em Porto Alegre, RS, Brasil: avaliação quantitativa e qualitativa

    Directory of Open Access Journals (Sweden)

    Luciane Teresa Salvi

    2011-04-01

    Full Text Available Face à relevância da presença de árvores distribuídas em ruas e avenidas nos ambientes urbanos, o presente estudo buscou identificar as espécies arbóreas utilizadas ao longo de ruas com túneis verdes e avaliar as condições desta vegetação em Porto Alegre, RS. A relação entre porte da árvore versus condições do tronco foi investigada, buscando-se estimar uma possível relação de conflito entre exemplares de grande porte e redes de serviços aéreas. Para tanto, foram realizados levantamentos quali-quantitativos da vegetação em nove ruas da cidade (cinco túneis verdes e quatro vias controle. Foram efetuados 760 registros de 61 espécies vegetais, 25 nativas e 36 exóticas, agrupadas em 33 famílias botânicas perfazendo apenas cerca de 34 % das espécies arbóreas registradas em Porto Alegre. Estes dados alertam para a necessidade de implantação de arborização viária mais heterogênea e composta de plantas nativas. Os túneis verdes apresentaram menos espécies e indivíduos menos preservados que as vias controle, situação atribuída em parte à maior estatura da vegetação presente nos túneis. Como alternativa às situações que representam conflitos entre os exemplares de porte arbóreo e os serviços de infra-estrutura aéreos implantados nas vias, recomenda-se a adoção de rede compacta para distribuição de energia elétrica.

  3. "EU GANHEI MAIS O GOSTO DE ESTUDAR": O E-LEARNING COMO UM MEIO DE APRENDIZAGEM AO LONGO DA VIDA DE RECLUSAS DE UM ESTABELECIMENTO PRISIONAL PORTUGUÊS

    OpenAIRE

    Monteiro, Angélica; Leite, Carlinda; Barros, Rita

    2016-01-01

    RESUMO: O artigo estudou as percepções de reclusas sobre formação na modalidade e-learning, num estabelecimento prisional feminino de Portugal. A análise do curso e da formação, inscritos no paradigma de aprendizagem ao longo da vida, objetiva estudar a possibilidade do e-learning constituir um dispositivo de diferenciação pedagógica que promove a inclusão digital. Os dados relativos ao percurso de aprendizagem em regime de e-learning foram recolhidos por dois questionários e um grupo focal. ...

  4. Consumo de fertilizantes e produtividade da laranja em São Paulo ao longo das décadas de 1970, 1980 e 1990

    Directory of Open Access Journals (Sweden)

    Margarida Garcia de Figueiredo

    2009-09-01

    Full Text Available O Brasil, além de representar sozinho cerca de 80% do total de suco de laranja concentrado e congelado comercializado no mercado internacional, juntamente com os EUA responde por cerca de 50% da produção mundial de laranja. O estado de São Paulo, por sua vez, responde por cerca de 80% da produção nacional de laranja e 98% das exportações brasileiras de suco concentrado. A relevância econômica dessa atividade tem estimulado inúmeras pesquisas no sentido de analisar diversos aspectos relacionados ao sistema de produção da cultura. Dentre os diversos fatores de produção, o fertilizante é um insumo de grande importância para a cadeia citrícola, especialmente na composição dos custos. Dessa forma, o presente estudo procurou estimar o consumo de fertilizantes pela cultura da laranja em São Paulo ao longo das três últimas décadas. Os resultados encontrados foram satisfatórios, seguindo tendência condizente com a realidade do estado. Também foram desenvolvidos modelos teóricos para estimar o consumo dos nutrientes N, K2O e P2O5, em função da produtividade dos pomares. Finamente, foi desenvolvido um modelo teórico de produtividade (caixas/pé em função da idade do pomar, baseado em estimativas estocásticas de produtividade para cada idade do pomar. Os modelos ficaram bem ajustados, atendendo a todos os requisitos exigidos do ponto de vista econométrico.Brazil represents approximately 80% of the total frozen concentrate orange juice (FCOJ traded in the international market. In addition, Brazil and the United States represent 50% of the total fresh orange produced around the world. Sao Paulo state is responsible by 98% of Brazilian FCOJ exports and by 80% of the national fresh orange production. The economic importance of Sao Paulo's citrus industry has been stimulated researches in order to analyze all aspects related to citrus production system. Fertilizer is a very important input into citrus industry, especially in

  5. Estudo radiomorfológico do tendão fibular longo junto ao osso cuboide Radiomorphological study of the peroneus longus tendon adjacent to the cuboid bone

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Affonso Grinbaum

    2009-06-01

    Full Text Available OBJETIVO: Relatar os aspectos morfológicos e avaliar, radiograficamente, o segmento do tendão do músculo fibular longo em contato com o osso cuboide, em cadáveres, e relatar a incidência do ossículo fibular em seu interior, utilizando-se, em alguns casos, da análise histológica. MATERIAIS E MÉTODOS: Foram estudados 50 segmentos tendinosos, sendo radiografados para determinar a presença ou não de ossículo acessório no interior do tendão. As peças nas quais a presença era duvidosa foram seccionadas e submetidas a avaliação macroscópica. Nos casos em que ainda persistiam dúvidas, as peças foram histologicamente avaliadas em hematoxilina-eosina. Um segmento que demonstrou a presença de ossificação também foi analisado histologicamente, a título de ilustração. RESULTADOS: Todos os fragmentos apresentavam dilatação fusiforme na área de curvatura sob o cuboide. Após o estudo radiográfico, 29 desses fragmentos não tinham ossificação, 13 tinham ossificação e 8 eram duvidosos. Após a análise macroscópica, uma peça apresentou ossificação e cinco, não. As duas peças restantes continuaram indefinidas, sendo então analisadas histologicamente, e não se observou ossificação. CONCLUSÃO: Todas as peças demonstraram espessamento local na curvatura sob o cuboide. Entretanto, após análise quantitativa, nos dois casos submetidos ao estudo histológico foi verificado que o tendão era composto de fibrocartilagem e revestido por cartilagem hialina na superfície de contato com o osso. Assim, os segmentos apresentaram o ossículo fibular do ponto de vista morfológico em 28%, e do ponto de vista radiográfico, em 26% dos casos.OBJECTIVE: To describe morphological aspects, and radiographically evaluate the segment of the peroneus longus tendon adjacent to the cuboid bone, in cadavers, and reporting the incidence of a fibular ossicle, in some cases with the help of histological analysis. MATERIALS AND METHODS: Fifty

  6. Modelo matemático para o Problema de Alocação de Berços em portos com limitações de operação de carga ao longo do cais

    Directory of Open Access Journals (Sweden)

    Ivan Bridi Gimenes Rodrigues

    Full Text Available Resumo: A exploração de petróleo no Brasil é realizada por plataformas em alto-mar que demandam diversas cargas levadas por navios. Os portos para atender esses navios têm de manusear vários tipos de carga e, por conta dessa variedade, trechos para movimentar cada tipo de carga são determinados ao longo do cais, aumentando a complexidade do planejamento da atracação dos navios. Visando aumentar a eficiência na operação desses portos, este artigo propõe um modelo matemático para o problema de alocação de berços contínuos que difere das demais por apresentar restrições nas operações de cargas ao longo do cais. Utilizaram-se dados reais da Companhia Portuária de Vila Velha (CPVV para avaliar o modelo. Utilizou-se o CPLEX 12.6 para executar o modelo e instâncias de até 147 navios com 440 metros de cais foram resolvidas de forma ótima. Os resultados são apresentados e comparados com os alcançados pelo método manual atual, evidenciando ganhos importantes.

  7. A Síndrome do QT Longo Associada ao uso de Citalopram e Escitalopram / The Long QT Syndrome Associated to Citalopram and Escitalopram

    Directory of Open Access Journals (Sweden)

    Filipe Santos Falani

    2016-06-01

    Full Text Available Objetivo: Revisar a literatura em relação à associação do prolongamento do intervalo QT no eletrocardiograma e o uso de citalopram e escitalopram, antidepressivos de segunda geração de largo consumo em escala mundial. Materiais e Métodos: Revisão da literatura em bases de dados Scielo e Medline. Desenvolvimento: citalopram e escitalopram são antidepressivos conhecidos como indutores de QT Longo dose-induzida, e os riscos-benefícios devem ser avaliados antes de seu uso. O citalopram é o inibidor seletivo da recaptação da serotonina mais prescrito no mundo, enquanto o escitalopram é amplamente usado nas doenças depressivas maiores. O escitalopram é também amplamente prescrito devido seus efeitos colaterais leves e transitórios. A Síndrome do QT Longo ocorre devido uma alteração no sistema elétrico cardíaco. Uma duração do intervalo QT maior que 450ms em homens e 460ms em mulheres deve ser considerada anômala, com etiologia específica. Entretanto, arritmias cardíacas ocorrem mais frequentemente quando o QT é maior que 500ms. O principal mecanismo do QT Longo induzido por drogas é a inibição do canal de potássio hERG, particularmente naqueles pacientes com a variante polimórfica. Conclusão: Apesar da pequena prevalência de prolongamento do intervalo QT induzido em usuários de antidepressivos de segunda geração, dado seu amplo uso pela população, é necessária uma maior preocupação em relação à monitorização eletrocardiográfica, principalmente quando estiverem presentes fatores de risco ou sinais de overdose. Objective: To review the literature regarding the association of QT prolongation on electrocardiogram and the use of citalopram and escitalopram, the second generation of wide consumption worldwide antidepressants. Materials and Methods: Literature review in Scielo and Medline databases. Development: Citalopram and escitalopram are antidepressants known as Long QT-inducing dose-induced, and the

  8. Estudo dos mecanismos induzidos pelo treinamento físico aeróbico ao longo do tempo na inflamação pulmonar e no remodelamento brônquico em um modelo murino de asma

    OpenAIRE

    Ronaldo Aparecido da Silva

    2013-01-01

    O treinamento aeróbico (TA) traz benefícios para os asmáticos, porém os mecanismos antiinflamatórios não são conhecidos. Estudos experimentais de asma têm mostrado que o TA reduz a inflamação pulmonar alérgica crônica (IPAC) e a reposta Th2, no entanto, nenhum estudo explicou quando os efeitos protetores são iniciados e qual é a principal via anti-inflamatória desencadeada. Objetivo: Avaliar o efeito do TA ao longo do tempo em um modelo murino de asma visando identificar quando são iniciados ...

  9. Concentração plasmática de melatonina em novilhas bubalinas (Bubalus bubalis ao longo do ano Plasma melatonin in bufallo heifers (Bubalus bubalis during a year

    Directory of Open Access Journals (Sweden)

    P.S.R. Mattos

    2000-10-01

    Full Text Available Coletaram-se nove amostras de sangue ao longo do dia, mês-a-mês durante um ano, de seis novilhas bubalinas da raça Mediterrâneo, para determinação da melatonina plasmática dos animais mantidos na latitude 22° Sul. A concentração plasmática de melatonina se elevou lentamente até atingir o pico entre 21 e 23 horas, permanecendo elevada até as 3-5 horas. A seguir, a concentração diminuiu para valores baixos antes do nascer do sol. A duração da elevação noturna de melatonina plasmática não acompanhou a duração do período noturno ao longo do ano e a diminuição da concentração diurna de melatonina plasmática ocorreu na época de maior atividade reprodutiva estimada do rebanho.Nine blood samples were taken to determine plasma melatonin in a 24h-period/month for a year. The six buffalo heifers used were kept at latitude 22° South. Plasma melatonin rose slowly, peaking at night (between 9 and 11pm and maintained until 3 to 5am. Melatonin concentration decreased day-time to lower levels until sunrise. Nocturnal higher plasmatic melatonin did not vary with night length over the year. Diurnal melatonin concentrations were lower when estimated reproductive rate was the highest for the herd.

  10. Padrões de transferência e mecanismos de defesa ao longo do processo psicoterapêutico : Dois estudos de caso sistemáticos

    OpenAIRE

    Loureiro, Susana Maria Durão

    2015-01-01

    Dissertação de Mestrado apresentada ao ISPA - Instituto Universitário O conceito de transferência tem-se mostrado complexo e controverso, tendo este constructo no decorrer dos últimos cem anos sofrido inúmeras alterações. A presente revisão de literatura pretende estabelecer uma melhor compreensão do conceito de transferência e dos tipos de transferência que se revelam e instalam durante o processo terapêutico. A abordagem a este constructo será efetuada numa perspectiva teórica, partindo ...

  11. O Significado de Saúde e Doença para o Aluno de Medicina ao longo da Graduação: Estudo Exploratório entre Alunos da Unifesp-EPM

    Directory of Open Access Journals (Sweden)

    Tatiana Gottlieb Lerman

    Full Text Available RESUMO No início da graduação, a compreensão sobre saúde e doença do aluno depende de seus conhecimentos e experiências prévias, bem como do grau de contato com a prática médica e a realidade que envolve esse tema. Neste estudo, pretende-se compreender qual é a visão de saúde e doença que permeia a mente dos futuros médicos e traçar que relações são estabelecidas entre a noção de saúde e doença com as experiências pessoais e profissionais do aluno ao longo da graduação. Foi realizado um estudo qualitativo, utilizando-se um questionário psicossocial e entrevista semiestruturada com alunos do primeiro, terceiro e sexto ano de um mesmo ano letivo da Universidade Federal de São Paulo (Unifesp-EPM. O material foi submetido à análise de conteúdo. As experiências e características pessoais de cada participante, assim como as experiências curriculares e extracurriculares e o currículo oculto influenciam tanto a visão que possuem de saúde e doença quanto a escolha profissional. Nota-se certo esfriamento na relação médico-paciente e uma postura de maior desconfiança em relação aos pacientes ao longo da graduação. Os alunos têm o conhecimento de uma visão mais global e humana dos pacientes, mas não conseguem colocá-la em prática. Observa-se que essa problemática está vinculada ao fato de terem dificuldade de entrar em contato com os aspectos emocionais despertados na relação médico-paciente.

  12. Animação sociocultural: uma forma de educação permanente e ao longo da vida para um envelhecimento activo

    OpenAIRE

    Correia, Ana Catarina

    2010-01-01

    Relatório de estágio de mestrado em Educação (área de especialização em Educação de Adultos e Intervenção Comunitária) O envelhecimento faz parte do ciclo de vida de um indivíduo e é um tema que preocupa a actualidade de Portugal. A população está cada vez mais envelhecida devido ao aumento da esperança média de vida e da diminuição da taxa de natalidade. Esta realidade provoca a reflexão sobre as infra-estruturas; apoios; políticas; que rodeiam a população idosa. Pelas suas ca...

  13. "EU GANHEI MAIS O GOSTO DE ESTUDAR": O E-LEARNING COMO UM MEIO DE APRENDIZAGEM AO LONGO DA VIDA DE RECLUSAS DE UM ESTABELECIMENTO PRISIONAL PORTUGUÊS

    Directory of Open Access Journals (Sweden)

    Angélica Monteiro

    Full Text Available RESUMO: O artigo estudou as percepções de reclusas sobre formação na modalidade e-learning, num estabelecimento prisional feminino de Portugal. A análise do curso e da formação, inscritos no paradigma de aprendizagem ao longo da vida, objetiva estudar a possibilidade do e-learning constituir um dispositivo de diferenciação pedagógica que promove a inclusão digital. Os dados relativos ao percurso de aprendizagem em regime de e-learning foram recolhidos por dois questionários e um grupo focal. A análise dos dados evidencia que essas formandas, reclusas, consideram que a experiência de formação em e-learning lhes devolveu a confiança de que ainda têm capacidade de realizar novas aprendizagens, com impacto em perspectivas relacionadas a uma futura inserção no mercado de trabalho.

  14. A PARTICIPAÇÃO DA ASSEMBLÉIA DOS FIÉIS NA CELEBRAÇÃO EUCARÍSTICA AO LONGO DA HISTÓRIA: E-VOLUÇÃO OU IN-VOLUÇÃO?

    Directory of Open Access Journals (Sweden)

    José Raimundo de Melo

    2010-07-01

    Full Text Available A função e o significado da assembléia cristã reunida para a celebração nos é atestado tanto na tradição do Novo Testamento, como em documentos que descrevem a ação e a vida da Igreja na era patrística. Nessas assembléias iniciais, o povo não se comportava como frio ouvinte ou mudo espectador. Ao contrário, a sua participação viva, consciente e atuante constituía um elemento sem o qual a celebração não tinha sentido. O povo era sempre convocado por Deus para participar plenamente, em especial, da ceia eucarística. E, na participação-resposta do povo, estava a razão de ser da assembléia reunida. Quando assistimos hoje a tantas tentativas de redescoberta, a nível teológico e litúrgico, do sentido profundo da assembléia do povo cristão no seio da Igreja, uma retomada de suas raízes históricas se faz útil e necessária, seja para iluminar o presente, seja para conduzir com segurança e abertura ao futuro. O presente estudo, pela extensão temporal que almeja abraçar, analisa a participação na eucaristia ao longo da história cristã de forma assaz resumida.

  15. Diurnal and seasonal variability in bird counts in a forest fragment in southeastern Brazil Variação no registro de aves ao longo do dia num fragmento florestal do sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Alexsander Z. Antunes

    2008-06-01

    Full Text Available Diurnal variation in detection can influence bird census results. I measured variation in daily and seasonal detections of birds in a forest fragment at Barreiro Rico ranch, Anhembi, state of São Paulo. Birds were recorded on transects of unlimited distance, sampled one day per month, dawn to dusk, between December 2000 and March 2001 (rainy season and between May and August 2001 (dry season. Significant daily variation in detection occurred during the rainy season, with most detections between dawn and 9 h. In the dry season detections declined for total numbers of individuals and species and most detections occurred during late morning and mid afternoon. Detection patterns might reflect seasonal variation in bird behavior rather than seasonal variation in species composition.A variação nos padrões de detecção é um dos fatores que interfere nos resultados de levantamentos de aves. Essa variação foi avaliada ao longo do dia e sazonalmente para a comunidade de aves de um fragmento florestal localizado na fazenda Barreiro Rico, Anhembi, São Paulo. O método utilizado foi o de trajetos de distância ilimitada, efetuados em um período diurno inteiro por mês, entre dezembro de 2000 e março de 2001 (estação chuvosa e entre maio e agosto de 2001 (estação seca. Houve variação significativa na detecção ao longo do dia para a estação chuvosa, com o maior número de contatos obtidos do amanhecer às 9 h. Durante a estação seca foram contatados menos indivíduos, com maiores proporções de registros no final da manhã e no meio da tarde. Estas diferenças devem estar mais relacionadas às variações sazonais no comportamento das aves, do que às alterações na composição da comunidade entre estações.

  16. Mood changes in the course of preparation for the Brazilian university admission exam - a longitudinal study Alterações de humor ao longo da preparação para o vestibular - um estudo longitudinal

    Directory of Open Access Journals (Sweden)

    Marco Aurélio Monteiro Peluso

    2010-03-01

    Full Text Available OBJECTIVE: Academic examinations are an important source of stress for students. This study is intended to assess senior high school students' mood changes during the preparation for a very important academic examination, the Brazilian university admission examination. METHOD: Positive and Negative Affect Schedule - Expanded Form was used to assess the students three times in the course of the months preceding the examination. RESULTS: ANOVA for repeated measures showed that Negative Affect increased as the examination approached, and that this increment was already present months before the examinationtookplace. Asingle conditionallyindependent random effect model showed that time spent studying was associated with fluctuations in mood. CONCLUSION: Teenagers, in preparation for a very important examination, may present mood disturbances associated with both the proximity of the examination and their study load months before the examination actually takes place. Other stressing factors may play a role in these findings and should be further investigated.OBJETIVO: Exames acadêmicos são uma fonte importante de estresse para estudantes. Este estudo teve como objetivo avaliar alterações de humor em estudantes de terceiro ano do Ensino Médio ao longo da preparação para um exame acadêmico de grande importância, o vestibular. MÉTODO: Positive and Negative Affect Schedule - Expanded Form foi utilizado para avaliar os estudantes três vezes ao longo dos meses antecedendo o exame. RESULTADOS: ANOVA para medidas repetidas mostrou que o afeto negativo aumentou com a aproximação do exame e que esse aumento já estava presente meses antes dele acontecer. Um modelo de efeitos aleatórios com independência condicional mostrou que o tempo de estudo estava associado às flutuações de humor. CONCLUSÃO: Adolescentes em preparação para exames muito importantes podem apresentar um distúrbio de humor associado à proximidade do exame e à quantidade

  17. Can endometrial arylsulfatase A activity predict the onset of endometrial polyps over the years? A atividade da arilsulfatase endometrial A pode prever a aparição de pólipos endometriais ao longo dos anos?

    Directory of Open Access Journals (Sweden)

    Ugo Indraccolo

    2013-01-01

    Full Text Available PURPOSE: To assess if arylsulfatase A activity (ASA and sulfatide (SL concentration in the human endometrium can be predictive of the development of endometrial polyps over the years, since ASA activity reflects the endometrial sensitivity to hormones. METHODS: ASA activity and SL concentration were determined by biochemical procedures on endometrial samples collected between 1990 and 1994 in non-menopausal women. These women underwent a new endometrial sampling following the clinical indication some years after the first endometrial sampling. The histological assessment of the second endometrial specimens found four patients with normal endometrial pattern and 10 patients with one or more endometrial polyps. ASA activity/years elapsed and SL concentration/years elapsed were compared using two tailed Mann-Whitney test for unpaired data between patients with normal pattern and patients with endometrial polyps. RESULTS: Median ASA activities were 2.62 (normal pattern versus 1.85 (endometrial polyps nmol hydrolized substrate/min. Median activity/years elapsed is higher in patients with second endometrial sample presenting normal pattern (p=0.006 and median SL concentration/years elapsed does not differ significantly among groups, even if median SL concentration seems to be higher in patients who subsequently developed polyps (1031 µg/g of fresh tissue versus 341,5 µg/g of fresh tissue. CONCLUSIONS: ASA activity can predict the onset of endometrial polyps over the years.OBJETIVO: Avaliar se a atividade da arilsulfatase A (ASA e a concentração de sulfatida (SL no endométrio humano pode ser preditivo em relação ao desenvolvimento de pólipos endometriais ao longo dos anos, posto que atividade da ASA reflete a sensibilidade do endométrio aos hormônios. MÉTODOS: A atividade da ASA, assim como a concentração de SL, foi determinada por meio de procedimentos bioquímicos em amostras de endométrio coletadas entre 1990 e 1994, em mulheres que n

  18. Ecologia de mosquitos (Diptera: Culicidae em criadouros naturais e artificiais de área rural do Norte do Estado do Paraná, Brasil: l - Coletas ao longo do leito de ribeirão

    Directory of Open Access Journals (Sweden)

    José Lopes

    1995-06-01

    Full Text Available Objetivando-se conhecer as espécies de Culicidae aptas a colonizarem ambiente de um ribeirão com mata ciliar reduzida e localizado na região Sul do Brasil, foram realizadas capturas com auxílio de rede para coleta de insetos aquáticos. Foram apanhadas as seguintes espécies: Aedes crinifer, Aedomya squamipennis, Anopheles fluminensis, An. intermedius, An. albitarsis, An. argyritarsis, An. evansae, An. galvaoi, An. oswaldoi, An. strodei, An. triannulatus, Chagasia fajardi, Culex bidens, Cx. grupo coronator, Cx. eduardoi, Cx. mollis, Cx. quinquefasciatus, Cx. coppenamensis, Cx. vaxus, Cx. grupo inhibitator, Cx. intrincatus, Cx. (Melanoconion sp., Psorophora saeva (? e Uranotaenia pulcherrima. Para as espécies em que foi capturada uma amostra tida como representativa, foram estudadas a distribuição ao longo da área pesquisada, a flutuação populacional e a correlação com fatores físicos do ambiente. Conclui-se da análise que massas de água orladas por mata ciliar reduzida podem funcionar como refúgio para alguns Culicidae e esta condição pode contribuir decisivamente para o processo de domiciliação de espécies deste grupo.

  19. Concreto usinado: análise da variação da resistência à compressão e de propriedades físicas ao longo da descarga do caminhão betoneira

    Directory of Open Access Journals (Sweden)

    R. Mascolo

    Full Text Available Visto a prática comum nos canteiros de obra da região de Porto Alegre, de coleta de amostras, para fins de ensaio e moldagem dos corpos-de-prova, logo da primeira porção do concreto descarregado do caminhão betoneira, somada à inexistência de normatização para aferição da qualidade do misturador e uniformidade da mistura e a importância dos ensaios de controle de qualidade dos concretos. O presente trabalho tem como meta analisar a uniformidade de misturas de concreto em caminhão betoneira. A fim de atingir os objetivos realizaram-se coletas de amostras em cinco pontos distintos, ao longo da descarga do concreto do caminhão betoneira, para 13 lotes (amassadas de concreto convencional. Não houve a formação de um perfil representativo das variações de resistência conforme o ponto de coleta e não foi constatada variação significativa entre pontos de coleta.

  20. Características Microestruturais e Mecânicas ao Longo da Seção Transversal de Juntas Soldadas em Multipasses pelo Processo GMAW de um Aço API 5L X65Q

    Directory of Open Access Journals (Sweden)

    Vicente Braz Trindade

    Full Text Available Resumo Características microestruturais e mecânicas foram avaliadas ao longo da seção transversal de juntas obtidas por soldagem (GMAW, de tubos sem costura de aço API 5L X65Q. Dois tipos de juntas foram obtidas a partir da confecção de chanfro V e ½ V. Dividindo-se as chapas soldadas em 8 camadas espaçadas de 3mm, no sentido transversal, corpos de prova foram confeccionados para ensaios de tração, microdureza Vickers e análise química. Foi realizada ainda caracterização metalográfica no metal base e nas juntas soldadas. Observou-se pequena alteração na composição química do metal de solda entre as camadas da junta V e junta ½ V. A maior taxa de resfriamento promoveu maior fração de ferrita acicular no chanfro ½ V. Alguns corpos de prova de tamanho reduzido não atenderam aos limites mínimos de escoamento e de resistência especificados na Norma API 5L, resultado atribuído à presença de descontinuidades em algumas regiões da solda. A maior microdureza Vickers da junta ½ V foi atribuída à maior presença de ferrita acicular. A adoção de chanfro estreito para aumento de produtividade na soldagem do aço em estudo não impactou negativamente as propriedades da junta, entretanto, aumentou a ocorrência de falta de fusão na face do bisel.

  1. Posicionamento palpebral superior e inferior em diferentes graus de rotação ocular ao longo do meridiano vertical Upper and lower eyelid position in different degrees of downgaze and upgaze

    Directory of Open Access Journals (Sweden)

    Dante Augusto Mastropietro

    2009-12-01

    Full Text Available OBJETIVO: Quantificar a relação entre o posicionamento do olho e das pálpebras, em diferentes posições do olhar, ao longo do meridiano vertical, em indivíduos normais. MÉTODOS: Foi quantificada a posição das pálpebras superior e inferior e do olho, de dez indivíduos normais, por meio do processamento da imagem da fenda palpebral usando o programa NIH Image. Foram medidas as distâncias margem-centro pupilar superior e inferior em sete posições do olhar ao longo do meridiano vertical, ou seja -30, -20, -10, 0, +10, +20 e +30 graus (sinais: negativos infraducção e positivos supraducção. RESULTADOS: Em relação à distância margem superior-centro da pupila, nota-se que o maior valor é obtido na posição primária do olhar, ou seja, tanto quando se olha para cima, como para baixo, essa distância diminui. A redução na distância margem superior-centro da pupila é um pouco maior no olhar para cima. Em relação à distância margem inferior-centro da pupila, nota-se que o valor é maior no olhar para cima e menor no olhar para baixo, em relação à posição primária do olhar. No que tange à fenda palpebral, pode-se notar que no olhar para cima a fenda aumenta até 20 graus de rotação ocular. No olhar para baixo, ela diminui. CONCLUSÃO: Os dados do presente trabalho mostram que a altura da fenda palpebral varia de acordo com a amplitude da mirada vertical e que considerações sobre o valor da magnitude da distância entre a margem palpebral e o centro da pupila devem levar em conta o grau de rotação ocular vertical.PURPOSE: To quantify the relation between eye and eyelids placement in different positions during downgaze and upgaze in healthy subjects. METHODS: The position of the eye and eyelids of 10 healthy individuals was quantified by palpebral fissure image processing with NIH Image software. Upper and lower mid-pupil margin distance was measured in 7 positions: -30, -20, -10, 0, +10, +20 and +30 degrees

  2. Gênero, feminismo e Serviço Social: encontros e desencontros ao longo da história da profissão Gender, feminism and social work: approximations and conflicts in the history of the profession

    Directory of Open Access Journals (Sweden)

    Teresa Kleba Lisboa

    2010-06-01

    Full Text Available Este artigo aponta a crescente demanda de situações que perpassam a questão de gênero no cotidiano de intervenção dos assistentes sociais; discute o descompasso entre o Serviço Social e os estudos feministas traçando um paralelo entre as trajetórias dos dois enfoques ao longo da história. Faz uma crítica ao submetimento da profissão às teorias androcêntricas que exerceram poder e dominação na produção de conhecimento. Sugere que as teorias feministas e os estudos de gênero constituem-se um aporte teórico-metodológico significativo para o Serviço Social. Polemiza "como garantir igualdade com respeito às diferenças", aponta as principais áreas críticas que impedem o desenvolvimento das mulheres e demarcam a desigualdade de gênero, e conclui que a adoção da perspectiva de gênero nas mediações teóricas lança um novo olhar sobre a realidade, a partir das mulheres e com as mulheres, revolucionando a ordem dos poderes e dos submetimentos.This article looks at the growing needs found in situations that involve the issue of gender in the common intervention of social workers. It discusses the gap between social work and feminist studies, by sketching a historic parallel between the trajectories of the two fields. It criticizes the submission of the profession to andro-centric theories that exercise power and control in the production of knowledge. It suggests that feminist theories and gender studies provide significant theoretical and methodological support for social work. The paper questions "how to guarantee equality while respecting differences," and points to the principal critical areas that impede the development of women and mark gender inequality. It concludes that the adoption of a gender perspective in theoretical mediations allows a new look at reality, based on women and with women, revolutionizing the order of power and submission.

  3. Os 600 transplantes renais do Hospital das Clínicas da Faculdade de Medicina de Botucatu (HC da FMB - UNESP: Mudanças ao longo do tempo

    Directory of Open Access Journals (Sweden)

    Luis Gustavo Modelli de Andrade

    2014-04-01

    Full Text Available Introdução: Os resultados alcançados pelos transplantes renais nas últimas décadas têm melhorado progressivamente. Objetivo: A fim de determinar a extensão desse progresso, conduzimos uma análise dos resultados obtidos em nosso programa de transplantes através de três períodos diferentes. Métodos: Avaliamos os 600 transplantes renais realizados no HC FMB-UNESP até dezembro de 2011, subdividindo-os em três eras, de acordo com a imunossupressão vigente. Era 1: de 1987 a 2000 (n = 180; associação de ciclosporina e azatioprina. Era 2: de 2001 a 2006 (n = 120; associação de ciclosporina e micofenolato e Era 3: de 2007 a 2011 (n = 300; associação de tacrolimus e micofenolato. Resultados: Os resultados mostram aumento da idade média do receptor, da prevalência de diabetes e do número de transplantes com doador falecido (60% na terceira era. O uso de terapia de indução foi de 75% era atual contra 46,6% (Era 2 e 3,9% (Era 1, p < 0,0001. Os dados de sobrevida geral por tipo de doador mostram dados semelhantes à literatura. Houve progressivo aumento da sobrevida do enxerto com doadores falecidos em 5 anos, saindo de 13,7% (Era 1 para 81,9% (Era 3. Conclusão: Houve significativas diferenças ao longo do tempo, culminando com aumento do volume de transplantes na atual era (média de 14 transplantes/ano na Era 1 para 75 transplantes/ano na Era 3. Inverteu-se o perfil de transplantes na era atual com predomínio de doador falecido. A melhor sobrevida com doador falecido da atual era foi atribuída a maior experiência do centro e aos esquemas de imunossupressão baseados na combinação de tacrolimus com micofenolato associados a esquema de indução.

  4. Avaliação a longo termo da terapêutica com tiotropium inalado uma vez ao dia na doença pulmonar obstrutiva crónica

    Directory of Open Access Journals (Sweden)

    R. Casaburi

    2002-09-01

    Full Text Available RESUMO: O objectivo do estudo foi avaliar a eficácia e segurança do tiotropium – um anticolinérgico inalado de toma única diária – no tratamento da DPOC.O estudo – randomizado, duplamente cego e controlado com placebo – envolveu doentes com DPOC estável e teve a duração de um ano.Os doentes seleccionados eram de ambos os sexos, com idade igual ou superior a 40 anos, FEV1Ao longo do estudo avaliou-se o FEV1 (imediatamente antes da inalação da terapêutica e até 3 horas depois, a dispneia e a qualidade de vida relacionada com a saúde (SGRQ. Foram também registados o uso de medicação adicional e as reacções adversas. O estudo envolveu 921 doentes, 550 dos quais medicados com tiotropium (randomização 3/2, permitindo concluir que: · O tiotropium produziu maior broncodilatação, com significado estatístico em relação ao placebo – aumento médio do FEV1 em relação ao valor basal de 12% na medição prévia à inalação e de 22% na medição 3 horas após inalação. · Este efeito broncodilatador manteve-se ao longo dos 12 meses de estudo. · O tiotropium também melhorou de forma significativa o grau de dispneia e o score de qualidade de vida. · O número de exacerbações e de hospitalizações foi também menor no grupo tratado com tiotropium. · As reacções adversas foram comparáveis nos dois grupos, excepto a incidência de secura da boca, que foi mais frequente nos doentes tratados com tiotropium (16% versus 2,7%. Os autores concluiram que o tiotropium

  5. Prevalência e procura de ajuda na violência conjugal física ao longo da vida Lifetime prevalence and help seeking behavior in physical marital violence

    Directory of Open Access Journals (Sweden)

    Alessandra Bruschi

    2006-04-01

    Full Text Available OBJETIVO: Estimar a prevalência de violência conjugal física ao longo da vida em mulheres de comunidade urbana de baixa renda e identificar os tipos de ajuda procurados pelas vítimas. MÉTODOS: Trata-se de estudo-piloto brasileiro de corte transversal, vinculado a projeto multicêntrico internacional conduzido em 1999, com amostra probabilística de conglomerados no município de Embu, Estado de São Paulo. Foram considerados elegíveis os domicílios com mulheres de 15 a 49 anos, que residissem com filho/filha OBJECTIVE: To estimate the lifetime prevalence of physical marital violence among women from a low-income urban community and to investigate help-seeking behavior among victims. METHODS: This is the Brazilian pilot cross-sectional study for an international multicenter study conducted in 1999, and is based on a probabilistic cluster sample from the municipality of Embu, São Paulo State. We considered as eligible women aged 15 to 49 years, living with children under age 18 years, who had lived with a husband or partner in lifetime. Information was collected using standardized questionnaires (n=86, administered by trained interviewers. We investigated three types of physical violence: severe (kicking, hitting with fist, beating, and/or use/threat to use weapon, non-severe (slapping in the absence of severe violence, and any type (severe and/or non-severe and/or other physical aggressions spontaneously referred, as well as the type of help sought by the victim (from people or institutions. We calculated frequency and 95% confidence intervals for each type of violence. RESULTS: Subjects reported slapping (32.6%, hitting with fist (17.5%, beating (15,2%, use/threat to use weapon (13.9%, and kicking (10.6%. Prevalence of marital violence was high: 22.1% (13.3-30.9 for severe violence, 10.5% (4.0-17.0 for non-severe violence, and 33.7% (32.7-34.7 for any type of violence. Victims of severe violence were more likely to seek help from the

  6. Compaction caused by mechanized operations in a Red- Yellow Latosol cultivated with coffee over time Compactação causada pelas operações mecanizadas em um Latossolo Vermelho-Amarelo cultivado com cafeeiros ao longo do tempo

    Directory of Open Access Journals (Sweden)

    Paula Cristina Caruana Martins

    2012-08-01

    implantação da lavoura cafeeira e os impactos causados pelo tráfego das operações mecanizadas nas linhas de tráfego localizadas na parte de cima e de baixo do terreno. Este estudo foi realizado na Fazenda Experimental da EPAMIG, situada em Três Pontas, MG, em lavouras cafeeiras (Coffee arabica L. com 2, 7, 18 e 33 anos de implantação. Para a obtenção dos modelos de capacidade de suporte de carga, 12 amostras indeformadas de solo foram coletadas aleatoriamente nas camadas 0-3 e 15-18 cm no centro das entrelinhas, para cada tempo de implantação da lavoura cafeeira. Foram também coletadas aleatoriamente 10 amostras indeformadas para cada tempo de implantação da lavoura cafeeira ao longo das linhas de tráfego do trator situadas nas partes de cima e de baixo do terreno. Essas amostras foram usadas no ensaio de compressão uniaxial. O uso dos modelos de capacidade de suporte de carga permitiu identificar a suscetibilidade do solo à compactação, em razão do tempo de implantação da lavoura cafeeira e a compactação causada pelo tráfego do maquinário nas linhas de tráfego situadas na parte de cima e de baixo do terreno. A porcentagem de amostras compactadas aumentou com a idade da lavoura na camada de 15-18 cm.

  7. Biological stability of a strain of Cowpea severe mosaic virus over 20 years Estabilidade biológica de uma estirpe do Cowpea severe mosaic virus ao longo de 20 anos

    Directory of Open Access Journals (Sweden)

    José Albersio Araujo Lima

    2012-03-01

    : CPSMV-CE - o primeiro isolado do vírus obtido no Ceará; isolados obtidos de feijão-caupi: CPSMV-AL (Alagoas and CPSMV-PE (Pernambuco; CPSMV-PR - isolado de soja (Glycine max no Paraná e CPSMV-CROT - isolado de Crotalaria paulinea no Maranhão. Um isolado de CPSMV capaz de infetar o cv. Macaibo, cultivar de ffeijão-caupi imune a todos os demais isolados de CPSMV foi biológica e sorologicamente caracterizado e designado de CPSMV-MC. O CPSMV-MC obtido em janeiro de 1990 vem sendo avaliado através de estudos de gama de hospedeiro e mantido in vivo através de inoculações periódicas em feijão-caupi. Os resultados dessas avaliações revelaram que a integridade biológica e as propriedades sorológicas do CPSMV-MC foram preservadas ao longo dos anos, indicando que a preservação das propriedades genéticas de uma estirpe viral pode acontecer através dos anos. Estudos moleculares adicionais revelaram que a seqüência de nucleotídeos correspondente a parte do gene da capa protéica de cinco isolados de CPSMV, incluindo o CPSMV-MC, possui elevado grau de conservação, com 92-100% da seqüência de nucleotídeos idêntica entre os isolados.

  8. Diel density variation of amphipods associated with Sargassum beds from two shores of Ubatuba, Southeastern, Brazil Variação ao longo do dia na densidade de anfípodos associados a bancos de Sargassum em duas praias de Ubatuba, SP, Brasil

    Directory of Open Access Journals (Sweden)

    Fosca P. P. Leite

    2007-12-01

    Full Text Available Densities of mobile epifaunal assemblages associated with macrophytes are very variable during the day and the activity of visually-oriented predators is thought to have an important influence on this pattern. Here we compared densities of amphipods associated with a common brown alga, Sargassum stenophyllum (Phaeophyceae, at sites contrasting in water turbidity. We expected that diel variation of amphipods would occur in a shore with clear waters (Perequê, whereas no variation was expected in a shore with turbid waters (Lamberto. Amphipod density varied during the day at both shores, with no indication of a larger variation at Perequê. Most species showed two density peaks, one at night and the other in the afternoon. These peaks occurred close the times of high tide, suggesting that tidal rhythms could influence more amphipod densities than the activity of predators. Thus, more studies are necessary to understand factors that influence short-term variation of epifaunal assemblages.As densidades da epifauna móvel associada a macrófitas variam muito ao longo do dia, sendo a atividade de predadores visualmente orientados um dos principais fatores apontados para explicar este padrão. Neste estudo, comparamos as densidades de anfípodos associados a uma alga parda comum, Sargassum stenophyllum (Phaeophyceae, em praias contrastando em turbidez da água. Era esperada a ocorrência de variação ao longo do dia numa praia com águas claras (Perequê e nenhuma variação na praia com águas turvas (Lamberto. A densidade de anfípodos variou ao longo do dia em ambas as praias, sem indicação de maior variação em Perequê. A maioria das espécies apresentou dois picos de densidade: um à noite e outro à tarde. Estes ocorreram próximos aos períodos de maré alta, sugerindo que o ritmo de maré poderia influenciar mais as densidades de anfípodos que a atividade de predadores. Assim, mais estudos são necessários para se compreender os fatores

  9. Avaliação do impacto de efluente doméstico tratado lançado no estuário do Rio Sauípe, Bahia, Brasil: um estudo de curta duração ao longo de um ciclo de maré.

    OpenAIRE

    Braga, Yonara Souza

    2005-01-01

    p. 1-94 O presente estudo teve como principais objetivos: avaliar o comportamento do efluente, lançado no rio, durante um ciclo de maré; estimar a carga de fósforo (P) que a ETE lança no rio e, através de bioensaio, determinar o possível efeito deste efluente no crescimento de microalgas. Foram coletadas amostras na ETE e no estuário para análises de parâmetros físico-químicos, nutricionais, clorofila a e produção primária. Na ETE foram realizadas coletas de superfície ao longo do dia. No ...

  10. A UTILIDADE DA EDUCAÇÃO DE ADULTOS: A APRENDIZAGEM AO LONGO DA VIDA NA UNIÃO EUROPEIA E A POLÍTICA PÚBLICA DE EDUCAÇÃO E FORMAÇÃO DE ADULTOS EM PORTUGAL

    Directory of Open Access Journals (Sweden)

    Paula Guimarães

    2016-02-01

    Full Text Available Neste artigo, procura-se discutir sentidos dominantes nos últimos anos nas políticas públicas de educação de adultos em Portugal. Para tal, num primeiro momento, esclarece-se as finalidades contidas nas orientações da União Europeia para a aprendizagem ao longo da vida. Num segundo, abordam-se as reinterpretações efetuadas nas políticas públicas nacionais de educação de adultos nas últimas duas décadas. Conclui-se destacando a influência da União Europeia nos discursos políticos portugueses, bem como a progressiva importância atribuída ao carácter utilitário da educação de adultos relativamente ao desenvolvimento económico e à gestão de recursos humanos, enquanto se registam cada vez menos sentidos humanistas e de educação crítica. 

  11. Curvas de referência da Escala Motora Infantil de Alberta: percentis para descrição clínica e acompanhamento do desempenho motor ao longo do tempo

    Directory of Open Access Journals (Sweden)

    Raquel Saccani

    2012-02-01

    Full Text Available OBJETIVOS: Comparar os dados de infantes brasileiros com a normativa canadense e estabelecer as curvas de referência e percentis do desenvolvimento motor da Escala Motora Infantil de Alberta segundo sexo. MÉTODOS: Participaram da pesquisa, 795 crianças com idade entre 0 e 18 meses provenientes de diferentes cidades de uma região do Brasil. Os participantes foram avaliados com a Escala Motora Infantil de Alberta, em uma sala silenciosa, por um experiente pesquisador. Foi realizada análise dos percentis (P5, P10, P25, P50, P75, P90 por faixa etária da escala e sexo. RESULTADOS: Não foram encontradas diferenças significativas (p > 0,05 entre meninos e meninas na maioria das diferentes faixas etárias. Apenas aos 14 meses, foi encontrada superioridade das meninas no escore total de desempenho motor (p = 0,015 e no percentil de desenvolvimento (0,021. Verificou-se, para ambos os sexos e para crianças típicas e atípicas, uma tendência de desenvolvimento motor alinear nas curvas desenvolvimentistas. Observou-se variação reduzida das aquisições motoras nos limites etários, nos dois primeiros meses de vida e a partir dos 15 meses. CONCLUSÕES: A Escala Motora Infantil de Alberta, embora seja um instrumento amplamente utilizado em clínica e pesquisa, possui restrições considerando a diferenciação comportamental até os 2 meses e depois dos 15 meses. Essa reduzida sensibilidade da escala nas extremidades etárias pode estar relacionada com o número e dificuldade dos itens motores avaliados nessas idades. Sugere-se a utilização de outros instrumentos de triagem para crianças acima dos 15 meses de idade.

  12. Toxina botulínica no tratamento de distonias faciais: avaliação da eficácia e da satisfação dos pacientes ao longo do tratamento Botulinum toxin in the treatment of facial dystonia: evaluation of its efficacy and patients' satisfaction along the treatment

    Directory of Open Access Journals (Sweden)

    Patrícia Gravito Costa

    2005-08-01

    Full Text Available OBJETIVO: Estudar a eficácia do tratamento com toxina botulínica nos pacientes com distonia facial e a satisfação com o tratamento ao longo do tempo. MÉTODOS: Estudo retrospectivo de 42 pacientes portadores de distonia facial acompanhados no setor de Plástica Ocular da Clínica Oftalmológica do Hospital das Clínicas da Universidade de São Paulo. RESULTADOS: Após as primeiras aplicações, 45,2% dos pacientes deram notas entre 9-10 para melhora do espasmo, 35,7% deram notas entre 7-8, 16,7% deram notas entre 5-6 e apenas um paciente deu nota 4. Em relação ao intervalo de reaparecimento do espasmo, 4,8% dos pacientes referiram entre 5-6 meses, 64,2% entre 3-4 meses e 31% entre 1-2 meses. Ao longo do tratamento, 76,1% dos pacientes referiram manter a mesma nota sobre a melhora do espasmo, 19,1% referiram melhora do resultado nas aplicações e apenas 4,8% referiram piora da eficácia nas aplicações atuais. Quanto ao tempo de retorno do espasmo após aplicação, 64,2% relataram não haver mudança ao longo do seguimento no serviço, 16,7% relataram aumento e 19,1% relataram diminuição do intervalo de remissão dos sintomas. Após aplicação, 19% dos pacientes apresentaram efeitos colaterais e 73,8% dos pacientes referiram desconforto apenas leve ou moderado em relação à aplicação. CONCLUSÕES: O uso da toxina botulínica foi eficaz e não houve alteração da eficácia ao longo do tempo. São poucos os efeitos colaterais e boa tolerância à administração. É boa alternativa para melhorar a qualidade de vida desses pacientes evitando a cegueira funcional causada por essas doenças.PURPOSE: To study the efficiency of botulinum toxin treatment in facial dystonia patients and their satisfaction along treatment. METHODS: Retrospective study of 42 facial dystonia cases followed at the Oculoplastic Surgery Department of the "Hospital das Clínicas" of the University of São Paulo. RESULTS: Following the first injections, 45.2% of

  13. Acompanhamento da evolução dos distúrbios de imagem corporal em pacientes com bulimia nervosa, ao longo do tratamento multiprofissional Longitudinal assessment of body image disturbances in patients with bulimia nervosa submitted to multidisciplinary treatment

    Directory of Open Access Journals (Sweden)

    Fernanda Timerman

    2010-01-01

    Full Text Available OBJETIVO: Aumentar a compreensão sobre os distúrbios da imagem corporal em pacientes com bulimia nervosa e sua evolução após o tratamento multidisciplinar. MÉTODOS: Onze mulheres responderam dois questionários de imagem corporal (Body Attitudes Questionnaire e Escala de Figuras de Stunkard antes e após o tratamento e preencheram o diário alimentar, utilizado para a análise de sintomas de bulimia nervosa. RESULTADOS: Tanto no pré quanto no pós-tratamento o índice de massa corporal médio se encontrava na faixa de eutrofia. Cerca de 57,0% da amostra teve remissão total dos sintomas de bulimia nervosa. Em relação à imagem corporal, na escala de Stunkard, o tamanho da figura escolhida como ideal aumentou e houve redução da insatisfação corporal após o tratamento. Não houve redução significativa da superestimativa do tamanho corporal, porém no início do tratamento 57,1% das pacientes já não superestimavam seu tamanho. Em relação ao questionário de atitudes, notou-se diminuição das seguintes variáveis: depreciação corporal; sentir-se gorda; sensação de ter gordura nos membros inferiores e importância pessoal do corpo. CONCLUSÕES: O tratamento foi eficaz em alguns aspectos atitudinais, porém deve ser aprimorado em outros, como a distorção perceptual.OBJECTIVE: Increase the comprehension of body image disturbances in patients with bulimia nervosa and its evolution after treatment, multidisciplinary. METHODS: Eleven women answered two body image questionnaires (Body Attitudes Questionnaire and Stunkard's Figure Scale before and after treatment and filled a food diary used to analyze the frequency of bulimia nervosa symptoms. RESULTS: The mean body mass index was found at normal weight category before and after treatment. Approximately 57.0% of the sample had total remission of bulimia nervosa symptoms. In relation to body image based on Stunkard's scale, the size of the figure chosen as ideal increased and body

  14. Política e comércio: a atuação de Antônio Vicente da Fontoura ao longo da Revolução Farroupilha (1835 -1845 = Politics and commerce: the role of Antônio Vicente da Fontoura along the Farroupilha Revolution” (1835-1845

    Directory of Open Access Journals (Sweden)

    Campos, Cristiano Soares

    2014-01-01

    Full Text Available Este trabalho se propôs averiguar a atuação de Antonio Vicente da Fontoura, durante a Revolução Farroupilha (1835 – 1845, os postos assumidos por este comerciante ao longo do conflito, e seu retorno a politica local de Cachoeira após a Revolta. A pesquisa vem sendo desenvolvida com base em bibliografias envolvendo a temática, jornais de época e documentos (correspondências que nos ajudem a “rastrear” as ações do personagem. Veremos neste artigo como Vicente da Fontoura, comerciante da região de Cachoeira, inseriu-se à Revolução Farroupilha seja ela por sua posição econômico-social, pelo interesse dos Farroupilhas, ou por possuir interesses pessoais na participação do conflito. Atualmente como Mestrando do Programa de Pós-Graduação em História da Universidade Federal de Santa Maria (PPGH-UFSM, Bolsista FAPERGS/CAPES, continuo pesquisando Antonio Vicente da Fontoura juntamente com Domingos José de Almeida, averiguando a atuação comercial destes na Fronteira Platina entre 1830 a 1850. Meu orientador é o Professor Doutor José Iran Ribeiro

  15. sua relação ao longo da escolaridade

    Directory of Open Access Journals (Sweden)

    Gina Lemos

    2008-01-01

    Full Text Available Este estudio analiza la relación entre los resultados en pruebas cognitivas y el rendimiento académico. Se consideró una muestra representativa de alumnos portugueses entre 5º de Primaria y 2º de Bachillerato (n=4899. La evaluación cognitiva contempló los resultados en la Batería de Pruebas de Raciocinio: versión BPR5/6, versión BPR7/9, y versión BPR10/12. Todas las pruebas evalúan la capacidad de inferir y aplicar relaciones, recurriendo a tareas de contenido diferenciado (figurativo-abstracto, numérico, verbal, mecánico y espacial. Los coeficientes de correlación sugieren una mayor asociación entre las habilidades cognitivas y el rendimiento escolar en las disciplinas cuyo contenido curricular más se aproxima a los ítems de las pruebas. Por otro lado, se observa una disminución progresiva en los coeficientes de correlación a medida que se avanza en la escolaridad, apuntando para una menor importancia de las variables cognitivas en la predicción del rendimiento académico en los años escolares más avanzados. Estos resultados sugieren una mayor atención, a medida que avanzamos en la escolaridad, a variables no estrictamente cognitivas y a variables propias de los contextos de enseñanza-aprendizaje en la explicación del rendimiento escolar.

  16. Características das mulheres violentadas sexualmente e da adesão ao seguimento ambulatorial: tendências observadas ao longo dos anos em um serviço de referência em Campinas, São Paulo, Brasil Characteristics of women victims of sexual violence and their compliance with outpatient follow-up: time trends at a referral center in Campinas, São Paulo State, Brazil

    Directory of Open Access Journals (Sweden)

    Carlos Tadayuki Oshikata

    2011-04-01

    Full Text Available A violência sexual é um crime praticado contra a integridade e a liberdade sexual de uma pessoa. Atinge mulheres de todos os níveis socioeconômicos, e o agressor não escolhe a cor e nem a idade da vítima para agredi-las. É causa de elevado custo financeiro ao país e grave problema de saúde pública. Este estudo teve como objetivo avaliar a evolução da adesão de mulheres vítimas de violência sexual ao seguimento ambulatorial, as quais foram atendidas no Centro de Atenção Integral à Saúde da Mulher da Universidade Estadual de Campinas, entre janeiro de 2000 a dezembro de 2006. Observamos um aumento significativo no retorno às consultas agendadas. Em 2000, 41% das mulheres completavam o seguimento de seis meses, e, em 2006, o índice aumentou para 70%. Cerca de 70% das mulheres compareceram nas primeiras 24 horas após serem agredidas; a agressão por conhecidos triplicou ao longo dos anos. Houve mudanças na forma de intimidação e diminuição significativa na prescrição da anticoncepção de emergência.Sexual violence is a crime against individual integrity and sexual freedom. It affects women of all socioeconomic levels, and the perpetrator does not choose the victim's color or age. It is a source of high financial cost and a serious public health problem in Brazil. The current study aimed to assess compliance with outpatient follow-up by women victims of sexual violence treated at the Center for Women's Comprehensive Healthcare at the State University in Campinas, São Paulo State, from January 2000 to December 2006. We observed a significant increase in the return for scheduled appointments. In 2000, 41% of the women completed the six-month follow-up, and by 2006 the proportion had increased to 70%. Some 70% of the women appeared for treatment within 24 hours after being raped. Sexual assault by perpetrators known to the victims tripled during this same period. There were changes in the forms of intimidation and a

  17. Tipos e intensidade de danos mecânicos em bananas 'prata-anã' ao longo da cadeia de comercialização Types and intensity of mechanical damages on 'prata anã' bananas along the commercialization chain

    Directory of Open Access Journals (Sweden)

    Victor Martins Maia

    2008-06-01

    Full Text Available Atualmente, a maior parte da produção brasileira de banana é destinada ao mercado interno e, geralmente, é colhida, manuseada e transportada de forma deficiente e inadequada, contribuindo para perdas substanciais na fase pós-colheita. Objetivou-se identificar os tipos e a intensidade de danos mecânicos após a colheita da banana 'Prata-Anã', produzida no Município de Verdelândia (MG e embalada em caixas de papelão, madeira e plástico. Foram amostradas quatro caixas de banana 'Prata-Anã' em cada etapa da cadeia de comercialização, a saber: antes da colheita, após a primeira lavagem e pré-seleção (1ª piscina da casa de embalagem, após embalagem, após transporte e após distribuição ao mercado varejista em Montes Claros (MG, onde os frutos permaneceram em exposição para vendas por 8 horas. A porcentagem de frutos, área da casca e porcentagem da área da casca danificados aumentou ao longo da cadeia de comercialização. O uso da caixa de papelão proporcionou redução na incidência e intensidade de dano mecânico em relação aos demais tipos de embalagem. Houve alta incidência do dano por abrasão em todas as etapas da cadeia de comercialização. O dano por compressão apresentou grande importância relativa no varejo.Currently, most of the Brazilian production of banana is destined for domestic market and, generally, it is harvested, handled and carried in a deficient and inadequate form, contributing to substantial post harvest losses. This work had the objective of identifying the types and the intensity of mechanical damages after the harvest of 'Prata Anã' banana grown in Verdelândia, MG and put in cardboard, wood and plastic boxes. So, four boxes of banana were evaluated in each stage of the commercialization chain: before harvest, after the first washing and pre-selection (1st swimming pool of the packing house, after packing, after transport and distribution to the retail market in Montes Claros, MG, where

  18. Adubação orgânica da batata com esterco e, ou, Crotalaria juncea: II - disponibilidade de N, P e K no solo ao longo do ciclo de cultivo Organic fertilization of potato with manure and, or, Crotalaria juncea: II - soil N, P, and K availability throughout the growing season

    Directory of Open Access Journals (Sweden)

    Tácio Oliveira da Silva

    2007-02-01

    Full Text Available Os solos do Agreste paraibano têm baixa fertilidade e a prática usual de adubação é a incorporação de esterco na época do plantio. Entretanto, dependendo da qualidade do esterco, essa prática pode causar a imobilização de nutrientes do solo durante os primeiros meses de cultivo. É possível que o cultivo e incorporação de Crotalaria juncea, combinado com o esterco, possa promover mineralização mais sincronizada com a demanda de nutrientes pelas plantas. No presente estudo, realizado em 2003, foram conduzidos experimentos de campo e em casa de vegetação para testar essa hipótese. As parcelas de campo foram previamente cultivadas com batata no período de 1996 a 2002 e submetidas anualmente aos seguintes tratamentos: plantio e incorporação da crotalária na época da floração (C; adição de 15 t ha-1 de esterco (E; plantio e incorporação de crotalária + 7,5 t ha-1 de esterco (CE; e testemunha, sem esterco ou crotalária (T. Em 2003, foram aplicados os mesmos tratamentos de adubação orgânica e foi avaliada a dinâmica da decomposição e liberação de nutrientes pelo material vegetal e esterco contidos em sacolas de náilon incorporadas ao solo das parcelas de campo. Também se avaliou a dinâmica da disponibilidade de N, P e K no solo das parcelas de campo, por meio de coletas periódicas de solo. No ensaio em casa de vegetação, foram realizados cultivos sucessivos de capim-buffel (Cenchrus ciliaris L. por um período de 300 dias, utilizando-se amostras do solo das parcelas de campo. As perdas de massa e nutrientes do material incorporado ao solo foram maiores nos primeiros 30 dias da incubação, em todos os tratamentos. No final do ensaio, as proporções de matéria seca e nutrientes remanescentes foram maiores nos tratamentos E e CE que nos tratamentos C e T. No solo das parcelas de campo, o tratamento E aumentou os teores de P e K extraíveis (Mehlich-1 do solo ao longo do período do estudo, porém provocou a

  19. Aumento da inteligência ao longo do tempo: efeito Flynn e suas possíveis causas Aumento de la inteligencia a lo largo del tiempo: efecto flynn y sus causas posibles Increase of intelligence over time: Flynn effect and its possible causes

    Directory of Open Access Journals (Sweden)

    Patrícia Waltz Schelini

    2013-04-01

    Full Text Available O presente trabalho descreve o efeito Flynn, entendido como os ganhos verificados nas medidas de inteligência ao longo do tempo. Para viabilizar a compreensão do efeito, são apresentadas algumas concepções psicométricas sobre a inteligência, sobretudo as que sugerem uma organização hierárquica das capacidades cognitivas, diferenciando fatores mais gerais de fatores mais específicos. O efeito Flynn tende a ser mais consistentemente observado em testes que avaliam a inteligência geral e a inteligência fluida. As possíveis causas explicativas do efeito Flynn são igualmente apresentadas e discutidas, dentre elas: os anos de escolaridade, a nutrição, a complexidade dos ambientes mais atuais, a atitude assertiva para resolver testes e a heterose.En este trabajo se describe el efecto Flynn, entendido como las ganancias observadas en las medidas de inteligencia a lo largo del tiempo. Para facilitar la comprensión del efecto, se describen algunas concepciones psicométricas sobre la inteligencia, especialmente aquellas que sugieren una organización jerárquica de las capacidades cognitivas, diferenciando factores más generales de factores más específicos asociados con el aprendizaje. El Efecto Flynn tiende a ser más consistentemente observado en las pruebas de inteligencia general y de inteligencia fluida. Las posibles causas explicativas del efecto Flynn son igualmente presentadas y discutidas.The present paper describes the Flynn effect, understood as the gains observed in measures of intelligence over time. To facilitate the understanding of the effect some ideas about psychometric intelligence are presented, especially those that suggest a hierarchical organization of cognitive abilities, differing more general factors over specific factors associated with learning. The Flynn effect tends to be more consistently observed in tests of general intelligence and fluid intelligence. Possible causes of the Flynn effect and the

  20. Síndromes de dispersão de sementes em três trechos de vegetação ciliar (nascente, meio e foz ao longo do rio Pindaíba, MT Seed dispersal syndromes in three riparian vegetation sites (source, middle and estuary along the Pindaíba river, Mato Grosso state, Brazil

    Directory of Open Access Journals (Sweden)

    Daniel Stefanello

    2009-12-01

    Full Text Available Este estudo foi desenvolvido visando identificar as proporções entre as síndromes de dispersão e os tipos de frutos encontrados em três áreas: nascente (Cerrado Rupestre, meio e foz (mata ciliar Floresta Estacional Semidecidual ao longo do Rio Pindaíba, MT. No trecho de nascente, 55,6% das espécies amostradas eram zoocóricas, 43% anemocóricas e apenas 1,4% autocóricas, respectivamente. No trecho do meio, 85,7% das espécies eram zoocóricas, 11,7% anemocóricas e apenas 1,3% autocóricas. Na foz do Rio Pindaíba foram encontradas 77,5% de espécies zoocóricas, 20% de anemocóricas e apenas 2,5% de autocóricas. A hipótese levantada neste estudo foi de que em áreas abertas (nascente a proporção de espécies anemocóricas seria maior do que em ambientes fechados (meio e foz, onde predominaria a zoocoria. Entretanto, não houve diferença significativa nas proporções de espécies anemocóricas e zoocóricas na nascente (Cerrado Rupestre, enquanto no meio e na foz (mata ciliar as proporções de zoocoria foram maiores. Ambientes florestais, estruturalmente mais complexos com menor circulação do vento e menor incidência luminosa, requerem estratégias de dispersão mais direcionadas e previsíveis como a zoocoria.This study was carried out to identify the proportions between the dispersal syndromes and fruit types found in three regions: source (rupestrian cerrado, middle zone and estuary (riparian semideciduous forest along the River Pindaíba-MT. At the source, 55.6% of shrub-tree species are zoochoric, 43% are anemochoric and only 1.4% are autochoric. In the middle zone, 85.7% of species are zoochoric, 11.7% anemochoric and only 1.3% are autochoric. At the estuary of River Pindaíba, we found 77.5% of zoochoric species, 20% of anemochory and only 2.5% of autochory. Our hypothesis for the study was that, in open areas (source, the proportion of anemochoric species would be higher than in closed environments (middle zone and

  1. Percepção da morte pelo paciente oncológico ao longo do desenvolvimento Percepción de la muerte por el paciente oncológico a lo largo del desarrollo Perception of death by oncologycal patient along its development

    Directory of Open Access Journals (Sweden)

    Alini Daniéli Viana Sabino Borges

    2006-08-01

    Full Text Available O propósito deste estudo é empreender uma revisão não-sistemática da literatura dedicada à percepção da morte e do morrer na perspectiva do paciente oncológico, de acordo com as diferentes fases do ciclo vital. Os resultados mostram que, na criança, a percepção da morte modifica-se conforme se desenvolvem o pensamento e a linguagem. No adulto, a concepção da morte depende muito da experiência física e psicológica por que se está passando. Por fim, no idoso a morte é mais bem aceita e sua percepção depende sobretudo da satisfação previamente auferida com a vida. Diante disso, a literatura ressalta que a percepção da morte é ainda uma experiência eminentemente individual e que, por isso, deve ser considerada a percepção subjetiva de cada paciente oncológico. Concluindo, as reflexões deste estudo enfatizam as transformações da percepção da morte ao longo do desenvolvimento, sustentando a noção da presença da morte como parte integrante da vida.El propósito de este estudio es emprender una revisión no-sistemática de la literatura dedicada a la percepción de la muerte y del morir en la perspectiva del paciente oncológico, según las diferentes fases del ciclo vital. Los resultados muestran que, en el niño, la percepción de la muerte se modifica conforme se desarrollan el pensamiento y el lenguaje. En el adulto, la concepción de la muerte depende mucho de la experiencia física y psicológica por la que está pasando. Por fin, en el anciano la muerte es mejor aceptada y su percepción depende sobretodo de la satisfacción previamente obtenida con la vida. Delante de eso, la literatura resalta que la percepción de la muerte es aún una experiencia eminentemente individual, y que, a causa de eso, debe ser considerada la percepción subjetiva de cada paciente oncológico. Concluyendo, las reflexiones de este estudio enfatizan las transformaciones de la percepción de la muerte a lo largo del desarrollo

  2. Efeito da sombra natural e da tosquia no comportamento de ovelhas das raças Texel e Hampshire Down, ao longo do período diurno, no Noroeste do Estado do Paraná Effect of natural shade and shearing on the behavior of Texel and Hampshire Down sheep during the day period in the northwestern region of Paraná

    Directory of Open Access Journals (Sweden)

    Walber Mendonça Onorato

    2001-05-01

    Full Text Available Durante 12 meses, divididos em estações quente e fria, durante três dias mensais, das 6 às 18 h, registraram-se os comportamentos ligados ao pastejo, ruminação e ócio ao sol e à sombra, respectivamente, e frequência ao bebedouro em 16 ovelhas, com idade entre três e quatro anos, sendo oito da raça Texel e oito Hampshire Down, tosquiando-se quatro animais por raça. Avaliou-se a quantidade de folhas verdes, proteína bruta e FDA da pastagem. Os dados climáticos foram registrados a cada hora e a precipitação, mensalmente. A busca de sombra elevou-se devido ao aumento da radiação solar. O bosque de grevíleas foi utilizado na busca de sombra, bem como no consumo da folhagem. No piquete, com bosque de eucalipto, apenas a sombra da instalação foi utilizada. As condições da pastagem e as variáveis climáticas podem ter alterado o comportamento. Os animais tosquiados foram mais tolerantes ao sol. As raças apresentaram-se adaptadas à região, destacando a importância de bosques.The behavior of 16 sheep was reported during a twelve-month period, comprising hot and cold seasons, for three days each month, from 6 to18h. The eight Texel and eight Hampshire Down sheep, aged three and four years, were analyzed with regard to grazing, rumination, resting in the sun and in the shade, respectively, and watering. Four animals of each breed were sheared. Quantity of green leaves, crude protein and pasture FDA were analyzed. Climate data were reported hourly and rainfall monthly. Rise in shade seeking was recorded in proportion to increase in solar radiation. Silk oak grove was used for shade and leaf consumption. Only the shade of the pen in the eucalyptus grove was used. Grazing conditions and climatic variables may have changed sheep’s behavior. Sheared animals were more tolerant to the sunrays. Although breeds have adapted themselves extremely well to the region, the importance of groves must be enhanced.

  3. A FORMAÇÃO PARA ENSINAR MATEMÁTICA OFERECIDA NO CURSO NORMAL DE SÃO PAULO E AS INFLUÊNCIAS QUE ORIENTAVAM A DIREÇÃO DESSE CURSO AO LONGO DOS PRIMEIROS ANOS DE SUA EXISTÊNCIA

    Directory of Open Access Journals (Sweden)

    Edda Curi

    2011-05-01

    Full Text Available Este artigo, resultado de pesquisa realizada, tem como finalidade identificar como o Curso Normal de São Paulo, desde sua criação até a década de 1930 formou professores para atuar no período de escolarização que hoje se denomina anos iniciais do Ensino Fundamental. Por meio de uma análise documental discute como se dava a preparação para ensinar Matemática, buscando indícios das influências que orientavam a direção desse curso durante os primeiros anos de sua existência. Foram analisados documentos elaborados por órgãos normativos e instituições formadoras, manuais didáticos e revistas destinadas ao ensino e à formação do professor. A pesquisa evidenciou, no Período do Império, o predomínio de uma formação genérica, assentada nos fundamentos da moral e bons costumes, o aumento da quantidade de disciplinas sob a influência do positivismo na época da Proclamação da República, e o foco nos Fundamentos da Educação e a influência da Psicologia a partir de 1920.  Palavras chave: Formação de professores. Conhecimentos matemáticos. Curso normal

  4. Distribuição da altura uterina ao longo da gestação em uma coorte brasileira: comparação com a curva de referência do Centro Latino-Americano de Perinatologia Distribution of uterine height during pregnancy in a Brazilian cohort: comparison with the reference curve of the Centro Latino-Americano de Perinatologia

    Directory of Open Access Journals (Sweden)

    Maria Lúcia Rocha Oppermann

    2006-09-01

    Full Text Available OBJETIVOS: descrever, em gestantes do Estudo Brasileiro do Diabetes Gestacional (EBDG, a distribuição da altura uterina de acordo com a idade gestacional e validar a curva do Centro Latino-Americano de Perinatologia (CLAP, curva de referência para a predição de anormalidades do crescimento fetal. MÉTODOS: o EBDG é uma coorte de 5564 gestantes, com mais de 19 anos, seguidas até e após o parto. Entrevistas e medidas antropométricas padronizadas foram feitas no arrolamento entre a 20ª e a 28ª semana. Os prontuários foram revisados segundo protocolo padronizado, abrangendo os períodos de pré-natal e parto. As análises referem-se a 3539 gestantes com datação da gravidez confirmada por ultra-sonografia. Determinamos as propriedades diagnósticas dos percentis 10 e 90 de altura uterina de ambas as curvas (EBDG e CLAP como indicadores de anormalidade no peso neonatal. RESULTADOS: as medidas de altura uterina no EBDG foram maiores que as do CLAP em todas as semanas de gestação (1 a 4 cm e 2 a 6 cm, respectivamente, nos percentis 10 e 90. O percentil 10 do CLAP identificou como pequenas as medidas uterinas de 0,3 a 1,7% das gestantes brasileiras, ao passo que o percentil 90 classificou como grandes as medidas uterinas de 42 a 57% das brasileiras. A sensibilidade do percentil 10 do CLAP para predizer recém-nascidos pequenos para a idade gestacional variou de 0,8 a 6% e a especificidade do percentil 90 para predizer grandes para a idade gestacional, de 46 a 61%. CONCLUSÕES: a curva de referência do CLAP não reflete o padrão de crescimento uterino das gestantes brasileiras, limitando sua capacidade de identificar anormalidades de crescimento fetal, especialmente a restrição de crescimento.PURPOSE: to describe, in participants of the Brazilian Study of Gestational Diabetes (EBDG, the percentile distribution of uterine height by gestational age and to validate the use of percentiles of the chart derived by the "Centro Latino

  5. Estrutura trófica da ictiofauna, ao longo do gradiente longitudinal do reservatório de Salto Caxias (rio Iguaçu, Paraná, Brasil, no terceiro ano após o represamento - DOI: 10.4025/actascibiolsci.v27i1.1362 Fishfauna trophic structure across longitudinal gradient of Salto Caxias Reservoir (Iguaçu River – state of Paraná – Brazil in the third year after dam - DOI: 10.4025/actascibiolsci.v27i1.1362

    Directory of Open Access Journals (Sweden)

    Rosilene Luciana Delariva

    2005-03-01

    Full Text Available Objetivou-se, neste estudo, avaliar a estrutura trófica da ictiofauna, ao longo do gradiente longitudinal do reservatório de Salto Caxias, no terceiro ano após seu represamento (pós 3. Compararam-se os dados obtidos neste trabalho com dados anteriores (pré e pós 1, a fim de verificar se as espécies que alteraram suas dietas no início do represamento voltaram a utilizar os mesmos recursos alimentares oferecidos no ambiente natural. Foram analisados conteúdos estomacais de 1527 exemplares pelo método volumétrico. A maioria das espécies apresentou dietas compostas por grande diversidade de itens alimentares, predominando, geralmente, um tipo de recurso. A ictiofauna foi organizada em oito guildas tróficas. As espécies detritívoras e piscívoras não alteraram consideravelmente seu hábito alimentar ao longo do gradiente espacial. A montante, todas as guildas estiveram distribuídas em proporção mais semelhante do que nos demais locais. Comparando-se os períodos de pré e pós 1 com o pós 3, verifica-se que poucas espécies retomaram seu hábito alimentar originalThis study aims at evaluating the fishfauna trophic structure across the longitudinal gradient of Salto Caxias reservoir, in the third year after its dam (post 3. The data obtained were compared with the previous ones (pre and post 1 to verify if the species that altered their diets in the initial phase of the dam, returned to the same food resources offered by natural environment. S(tomachal contents of 1527 fishes were analyzed, using the volumetric method. In general, fishes presented a great diversity of food items in their diets, usually with a predominant resource kind. Thus, the fishfauna was synthetized in eight trophic guilds. The detrivore and piscivore species did not alter their feeding habit across spatial gradient considerably. (A montanteUpstream, all the trophic guilds were equally distributed compared to the other sites. Comparing pre and post 1 periods

  6. Comportamento da freqüência cardíaca e da pressão arterial, ao longo da gestação, com treinamento no meio líquido Comportamiento de la frecuencia cardiaca y la presión arterial, a lo largo de la gestación, con entrenamiento en medio líquido Heart rate and blood pressure behavior throughout pregnancy, with training in water medium

    Directory of Open Access Journals (Sweden)

    Ilana Finkelstein

    2006-12-01

    Full Text Available OBJETIVO: O objetivo deste estudo foi avaliar o comportamento da freqüência cardíaca (FC ao longo da gestação, antes, durante e após as aulas de hidroginástica, e o da pressão arterial (PA antes e após o mesmo exercício. MÉTODOS: A amostra foi composta por sete gestantes. A leitura da FC foi realizada em três momentos: 1 na artéria radial, em 15 segundos, antes do exercício, na posição sentada; 2 após 20 a 30 minutos do início do exercício, que foi realizada entre 13 e 14 na escala de percepção subjetiva de esforço (escala de Borg 6-20 na posição em pé, com água na altura do apêndice xifóide; 3 após, aproximadamente, 20 minutos do término da aula, na posição sentada. A medida de PA foi verificada antes e após o exercício nas condições descritas anteriormente. As medidas foram realizadas uma vez por semana no decorrer da gestação. Utilizou-se estatística descritiva, ANOVA para medidas repetidas e teste post-hoc de Bonferroni com p OBJETIVO: El objetivo de este estudio ha sido el de evaluar el comportamiento de la Frecuencia Cardiaca (FC a lo largo de la gestación, antes, durante y después de las clases de hidrogimnasia, y el de la Presión Arterial (PA antes y después del mismo ejercicio. MÉTODOS: La muestra fue compuesta por siete gestantes. La lectura de FC fue realizada en tres momentos: 1 en la arteria radial, 15 segundos antes del ejercicio, en posición sentada; 2 después de 20 a 30 minutos de iniciado el ejercicio, realizada entre 13-14 en la escala de percepción subjetiva de esfuerzo (Escala de Borg 6-20 de pie, con agua hasta la altura del apéndice xifoide; 3 después, aproximadamente, de 20 minutos de acabada la clase, en posición sentada. La medición de PA fue verificada antes y después del ejercicio en las condiciones descritas anteriormente. Las medidas fueron realizadas una vez por semana durante el transcurso de la gestación. Se utilizó la estadística descriptiva, ANOVA para

  7. LongoVital in the prevention of recurrent aphthous ulceration

    DEFF Research Database (Denmark)

    Pedersen, A; Hougen, H P; Klausen, B

    1990-01-01

    LongoVital (LV) (DK. Reg. No. 5178/75) is a herbal based tablet enriched with recommended doses of vitamins. The present study was undertaken to investigate prevention of recurrent aphthous ulceration (RAU) during 6 months' daily intake of LV as compared with placebo in a double-blind, randomized...

  8. Effects of the use of MIG3 bioceramics fabrics use - long infrared emitter - in pain, intolerance to cold and periodic limb movements in post-polio syndrome Efeitos do uso de tecidos com biocerâmica MIG3 - emissora de infravermelho longo - na dor, intolerância ao frio e movimentos periódicos dos membros na síndrome pós-poliomielite

    Directory of Open Access Journals (Sweden)

    Tatiana Mesquita e Silva

    2009-12-01

    Full Text Available The main post-polio syndrome (PPS symptoms are new-onset weakness, new-onset atrophy, fatigue, cold intolerance, and pain associated with sleep disturbances. The polysomnographic study is the gold pattern to analyze sleep disorders. OBJECTIVE: To assess pain, intolerance to cold and periodic limb movements (PLM index before and after the use of MIG3 bioceramic fabrics over 4 weeks. METHOD: 12 patients with PPS from UNIFESP/EPM. All patients were submitted to polysomnography and infra-red examinations with answered scales of pain and intolerance to cold before and after the use of MIG3 bioceramics fabrics. RESULTS: There were significant decreases in pain and PLM index. CONCLUSION: MIG3 bioceramic fabrics can help in the treatment of pain and PLM in PPS patients.Dentre as manifestações clínicas da SPP destacam-se nova fraqueza, fadiga, dor, intolerância ao frio, nova atrofia e transtornos do sono. A polissonografia de noite inteira permanece sendo padrão ouro para análise do sono e diagnóstico de transtornos do sono. OBJETIVO: Avaliar o comportamento da dor, intolerância ao frio (IF e índice de movimentos periódicos de membros (PLMs após uso de colchonete e roupas com biocerâmica MIG3 por 4 semanas. MÉTODO: 12 pacientes com SPP, da UNIFESP/EPM. Todos realizaram exames de polissonografia e infravermelho e responderam a questionários de dor e IF antes e após o uso dos materiais. RESULTADOS: Houve diminuição significativa da dor e dos PLMs. CONCLUSÃO: Os tecidos com biocerâmica MIG3 podem ser um coadjuvante ao tratamento da dor e dos PLMs nos pacientes com SPP.

  9. Estratégia de corrida em média e longa distância: como ocorrem os ajustes de velocidade ao longo da prova? La estratégia de la carrera del media y larga distancia: como se producen los ajustes de velocidad a lo largo de la carrera? Pacing strategy in middle and long distance running: how are velocities adjusted during the race?

    Directory of Open Access Journals (Sweden)

    Everton Crivoi do Carmo

    2012-06-01

    Full Text Available A estratégia de corrida tem sido apontada como um fator decisivo para o sucesso do atleta. Durante corridas de média e longa duração, a melhor estratégia será aquela capaz de poupar as "reservas fisiológicas", permitindo ao atleta terminar a prova no menor tempo possível. O controle da estratégia de corrida parece ser influenciado por fatores fisiológicos e psicológicos, que são ajustados constantemente durante a corrida, permitindo ao atleta determinar a intensidade do esforço. Diversas variáveis fisiológicas têm sido relacionadas aos ajustes da estratégia de corrida, no entanto, os resultados observados são controversos e foco de grandes discussões. Assim, a presente revisão tem como objetivo propiciar aos profissionais do esporte um melhor entendimento de questões como: 1 quais as melhores estratégias adotadas para determinado tipo de prova?; 2 como os ajustes da estratégia de corrida são realizados?; e 3 quais variáveis fisiológicas influenciam no controle da estratégia de corrida?La estrategia de la carrera ha sido identificada como un factor decisivo para el éxito del atleta. Durante las carreras de médio y largo plazo, la mejor estrategia es aquella que puede salvar a la "reserva fisiológica" que permite al atleta terminar la carrera en el menor tiempo posible. El control de la estrategia de carrera parece estar influenciada por algunos factores fisiológicos y psicológicos, que se ajustan com frecuencia durante la carrera, lo que permite al atleta determinar la intensidad del esfuerzo. Muchas de las variables fisiológicas se han relacionadas con los ajustes de la estrategia de carrera, sin embargo, los resultados observados son controvertidos y foco de muchos debates. Por lo tanto, esta revisión tiene como objetivo proporcionar a los profesionales del deporte una mejor comprensión de temas tales como: 1 cuáles son las mejores estrategias adoptadas para un tipo particular de prubea?; 2 cómo los ajustes

  10. AVALIAÇÃO CLÍNICO-ANDROLÓGICA EM TOUROS NELORE E TESTES DE VIABILIDADE ESPERMÁTICA, INTEGRIDADE DE ACROSSOMA E FRAGMENTAÇÃO DE CROMATINA AO LONGO DE TRÊS ESTAÇÕES REPRODUTIVAS BREEDING SOUDNESS EXAMINATION IN NELORE ZEBU BULLS AND SPERM VIABILITY, ACROSSOME AND CHROMATIN INTEGRITY ASSAY FOR THREE BREEDING SEASONS EVALUACIÓN CLÍNICA ANDROLÓGICA DE TOROS NELORE Y TESTS DE VIAVILIDAD ESPERMÁTICA, INTEGRIDAD DE ACROSOMA Y FRAGMENTACIÓN DE CROMATINA A LO LARGO DE TRES ESTACIONES DE MONTA

    Directory of Open Access Journals (Sweden)

    Leonardo Marçal da Silva

    2009-12-01

    Full Text Available

    Com os objetivos de verificar a evolução da qualidade dos ejaculados de touros da raça Nelore ao longo três anos, através do exame clínico-andrológico associado de testes de viabilidade espermática, integridade de acrossoma e a fragmentação da cromatina, e estabelecer relações entre estas características e com a prenhez com grupos de diferentes tipos de fêmeas, utilizaram-se 46 touros da raça Nelore com idade entre 30 e 120 meses, para avaliação da qualidade seminal e da aptidão reprodutiva. Os animais foram mantidos em condições extensivas, com alimentação a pasto, recebendo suplementação mineral e servindo um rebanho com 3.782 fêmeas de várias categorias (novilhas, vacas primíparas e pluríparas. Realizaram-se colheitas de dados que abrangiam medidas de circunferência escrotal e avaliação do sêmen colhido por eletroejaculação e avaliaram-se as características físicas (volume, turbilhonamento, motilidade, vigor, morfológicas (defeitos maiores, menores e totais e de integridade espermática (integridade de membrana plasmática, de acrossoma e de cromatina no período que antecedeu três estações de monta consecutivas (2003, 2004 e 2005. Submeteram-se os dados à analise de variância, compararam-se as médias pelo teste SNK e calculou-se o coeficiente de correlação de Pearson utilizando o SAS. Os touros apresentaram circunferência escrotal de 33,8 ± 2,8cm, 15,6 ± 8,5% de defeitos espermáticos totais, 40,1 ± 23,1% de gametas com membrana e acrossoma íntegros e 8,8 ± 3,8% de cromatina fragmentada. As relações entre circunferência escrotal, as características físicas, morfológicas e de integridade espermática e o desempenho reprodutivo do rebanho foram baixas e não significativas (P>0,05. As características reprodutivas dos touros permaneceram dentro de padrões aceitáveis ao longo de três anos de avaliação. Nos touros deste experimento, os defeitos espermáticos, a integridade de

  11. Sustentabilidade estratégica: existe retorno no longo prazo?

    Directory of Open Access Journals (Sweden)

    Priscila Borin de Oliveira Claro

    2014-06-01

    Full Text Available O objetivo neste artigo é avaliar o impacto de longo prazo que os investimentos em práticas ambientais e sociais têm nas empresas que reportam seus desempenhos em sustentabilidade. Duas hipóteses baseadas na literatura são lançadas: empresas que investem em sustentabilidade de forma estratégica apresentam desempenho melhor após um choque externo; empresas praticam e reportam sustentabilidade com sucesso quando o foco dos investimentos é estratégico. De um painel de 252 empresas, aquelas que investiram em sustentabilidade tiveram resultados melhores no período pós-crise financeira de 2008. Adicionalmente, evidências de uma empresa (Brasil Foods estudada em um contexto histórico expõem a evolução dos investimentos estratégicos em sustentabilidade e a relação deles com as competências e o negócio central da empresa.

  12. Reformas tributária e previdenciária e a economia brasileira no longo prazo

    Directory of Open Access Journals (Sweden)

    Vladimir Kühl Teles

    2006-03-01

    Full Text Available O presente artigo busca simular o efeito das reformas tributária e previdenciária sobre variáveis chave da economia brasileira no longo prazo. Para tanto, um modelo de equilíbrio geral computável de gerações superpostas sob a especificação de um modelo de crescimento endógeno à la Lucas (1988 é utilizado. Dentre os principais resultados pode-se destacar que as reformas por si só não são capazes de melhorar a performance de variáveis como taxa de juros e crescimento no longo-prazo, entretanto, ao criar oportunidades para diminuir a dívida pública e aumentar o investimento em educação, tornam-se fundamentais para uma melhoria em tais variáveis.The paper simulates the effects of tax and social security reforms on the main variables of the Brazilian Economy in the long run. For that matter a computable general equilibrium model of overlapping generations à la Lucas (1988 is employed. The main results are that the reforms in themselves are not capable of affecting the performance of the interest rate and the long run growth rate of the economy. However, as long as they make it possible to reduce the public debt and to increase the investment in education, they become important for the improvement of those variables.

  13. Resultados a longo prazo da cirurgia da otosclerose Long term outcome of otosclerosis surgery

    Directory of Open Access Journals (Sweden)

    Maria Teresa Bernardo

    2012-08-01

    Full Text Available O tratamento da otosclerose é preferencialmente cirúrgico e consiste na estapedotomia/estapedectomia, cujos bons resultados imediatos estão bem documentados. OBJETIVOS: Avaliar os resultados audiométricos da cirurgia da otosclerose a longo prazo. Desenho: Estudo retrospectivo. MATERIAL E MÉTODOS: Incluíram-se os doentes submetidos à estapedotomia/estapedectomia parcial no nosso Serviço e melhoria da audição pós-operatória comprovada. Convocaram-se os doentes para reavaliação audiométrica e compareceram 41 (47 ouvidos. Compararam-se os valores obtidos com os prévios à cirurgia e do pós-operatório imediato. RESULTADOS: A mediana do seguimento tardio foi de 11 anos. Nesta data, 49% dos doentes tinham audição normal ou um grau de hipoacusia ligeira. Os valores médios dos PTA (Pure Tone Average aéreo e ósseo, pré, pós e pós-operatório tardio foram 64,4 e 27,0 dB, 35,6 e 22,3 dB e 44,1 e 29,5 dB, respectivamente. CONCLUSÃO: A cirurgia da otosclerose tem bons resultados a longo prazo porque, apesar do agravamento dos limiares, o grau de hipoacusia, 10 anos depois, é inferior ao pré-operatório.The treatment of otosclerosis is eminently surgical. Good immediate results have been well documented when stapedotomy or stapedectomy are chosen. OBJECTIVES: This study aims to assess long term audiometric performance after otosclerosis surgery. MATERIALS AND METHODS: this retrospective study enrolled stapedotomy and partial stapedectomy patients seen at our service with proven hearing improvement after surgery. Forty-one patients (47 ears accepted the invitation to be reassessed. Audiometry results before and immediately after surgery were compared. RESULTS: the median late follow-up was 11 years. To this date, 49% of the patients had normal hearing or mild dysacusis. Preoperative, postoperative, and late postoperative bone and air pure tone averages were 64.4 and 27.0 dB, 35.6 and 22.3 dB, and 44.1 and 29.5 dB respectively

  14. Learning about the Sky from the Environment: An Experience Working Along One Year with Students of Elementary Education. (Spanish Title: Aprendiendo sobre EL Cielo Desde el Entorno: Una Experiencia Trabajando Durante un Año Junto a Estudiantes del Primario.) Aprendendo sobre o Céu a Partir do Entorno: Uma Experiência de Trabalho ao Longo de um Ano com Alunos de Ensino Fundamental

    Science.gov (United States)

    Longhini, Marcos Daniel; Gomide, Hanny Angeles

    2014-12-01

    percepción limitada que los estudiantes tienen de su alrededor la cual, sin embargo, se expandió debido a las actividades llevadas a cabo, sobre todo en relación con la Luna. Trabajar con medidas sistemáticas revela el manejo cuidadoso de los datos para que sean comprensibles para los estudiantes, así como el trabajo con las sombras para que comprendan primero como se forman estas para después trabajarlas en Astronomía. Por último, llegamos a la conclusión de que el proceso desarrollado consistió en una etapa inicial de una obra que debe ser profundizado en los años posteriores de la formación de estos estudiantes. Projeto de pesquisa desenvolvido com 95 alunos do 6º ano do Ensino Fundamental de uma escola pública estadual de Uberlândia, Minas Gerais. Foi um trabalho contínuo, de fevereiro a dezembro de 2013, o qual levou os alunos a participarem de atividades de observação do entorno, dentre ele, o céu, analisando as mudanças ocorridas. Focamos no estudo das variações de temperaturas, chuvas, duração do dia, variações do tamanho das sombras e mudanças nos aspectos da Lua. Nosso foco de análise centrou-se em discutir os conhecimentos que os referidos alunos tinham acerca dos temas indicados no início e ao término da implementação da proposta. Os resultados mostraram a percepção limitada que os estudantes possuem de seu entorno, todavia, ampliada em função das atividades desenvolvidas, principalmente no que se refere à Lua. O trabalho com medidas sistemáticas revela o cuidado no tratamento dos dados para que eles se tornem compreensíveis aos alunos, assim como o trabalho com as sombras sinaliza para que os alunos primeiramente compreendam como as sombras são formadas para depois trabalhar isso em Astronomia. Por fim, concluímos que o processo vivido constituiu-se em uma etapa inicial de um trabalho que deve ser estimulado para os anos subsequentes da formação desses alunos.

  15. Políticas públicas en la Ciudad de Buenos Aires dirigidas a juventudes vulnerables: Continuidades y transformaciones en la última década Políticas públicas na cidade de Buenos Aires destinadas a jovens vulneráveis: Continuidades e transformações ao longo da última década Public policy in the city of Buenos Aires aimed at vulnerable youth: Continuities and transformations in the last decade

    Directory of Open Access Journals (Sweden)

    Liliana Raggio

    2012-07-01

    Full Text Available En el marco de una investigación más amplia sobre políticas públicas dirigidas a juventudes en situación de vulnerabilidad en la Ciudad de Buenos Aires, se analiza en este artículo un conjunto de programas que parten de diagnósticos sustentados en "la inseguridad" urbana en general y en los jóvenes en situación de riesgo en particular. Específicamente se aborda el denominado "Plan de Prevención del Delito" y diversas acciones de Política Cultural, reflexionando sobre sus características y posibles convergencias, donde se ponen en juego las representaciones sociales sobre la relación delito-cultura-juventudes vulnerables. A partir del estudio de los casos y considerando las recomendaciones de políticas públicas dirigidas a las juventudes desde diversos organismos e instituciones internacionales, se subrayan los énfasis y agendas propias de nuestra región latinoamericana, en función de los cambios políticos recientes, de la última década, y las consecuencias socioculturales de las políticas neoliberales en los países de la región.No âmbito de uma pesquisa mais ampla sobre políticas públicas dirigidas a jovens em situação de vulnerabilidade na Cidade de Buenos Aires, se analisa neste artigo um conjunto de programas que partem de diagnósticos sustentados na "insegurança" urbana, em geral, e dos jovens em situação de risco, em especial. Mais especificamente, aborda o denominado "Plano de Prevenção do Crime" e as diversas ações da Política Cultural, refletindo sobre suas características e possíveis convergências, e colocando em jogo as representações sociais sobre a relação crime-cultura-juventude vulnerável. A partir do estudo dos casos, e considerando as recomendações de políticas públicas dirigidas aos jovens sugeridas por diversos organismos e instituições internacionais, são sublinhadas as ênfases e agendas próprias de nossa região latino-americana em função das mudanças pol

  16. Síndrome do aprisionamento fascial do nervo torácico longo: escápula alada

    Directory of Open Access Journals (Sweden)

    Jefferson Braga Silva

    2015-10-01

    Full Text Available resumo Objetivo: Analisar os resultados de cirurgia de intervenção precoce em pacientes com sín drome do aprisionamento fascial do nervo torácico longo e consequente escápula alada. Métodos: Acompanhamos seis pacientes com uma síndrome de aprisionamento sem restricões específicas de estiramento ao nervo. Resultados: Pacientes tiveram melhoria em seus sintomas seis a 20 meses após o proce dimento. Sintomas motores melhoraram completamente sem qualquer dor persistente. A deformidade medial da escápula alada melhorou em todos os casos sem distúrbios estéticos residuais. Conclusão: A abordagem de liberação cirúrgica precoce parece ser um melhor preditor na recuperação de paralisia não traumática do músculo serrátil anterior.

  17. Sensibilidade da rosa 'Osiana' ao etileno

    OpenAIRE

    Delaine Cristina Cordeiro; Fernando Luiz Finger; Joice Simone dos Santos; Juliane Karsten; José Geraldo Barbosa

    2011-01-01

    Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida) à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando expos...

  18. Comportamento das concentrações séricas e urinárias de creatinina e uréia ao longo de uma periodização desenvolvida em futebolistas profissionais: relações com a taxa de filtração glomerular Comportamiento de las concentraciones séricas y urinarias de creatinina y urea a lo largo de una periodicidad desarrollada en futbolistas profesionales: relaciones con la tasa de filtración glomerular Behavior of the creatinine and urea seric and urinary concentrations during a periodization developed in professional soccer players: relations with the glomerular filtration rate

    Directory of Open Access Journals (Sweden)

    Adelino Sanchez Ramos da Silva

    2006-12-01

    Full Text Available As determinações de creatinina e uréia têm sido utilizadas para avaliar o impacto do treinamento físico. Portanto, o principal objetivo do presente estudo foi verificar o comportamento das concentrações séricas e urinárias de creatinina e uréia em futebolistas profissionais ao longo de uma periodização. Participaram do estudo 18 jogadores de futebol que foram avaliados no início (T1, meio (T2 e fim (T3 de uma periodização específica. Os atletas foram submetidos às avaliações antropométrica e de determinação da capacidade aeróbia e da eficiência do metabolismo anaeróbio alático. As concentrações de creatinina e uréia dos atletas foram mensuradas no soro e na urina, além da taxa de filtração glomerular (TFG, determinada por três métodos distintos, sendo um independente e dois dependentes do volume urinário. A análise das respostas das variáveis em T1, T2 e T3 foi realizada por Anova one-way, seguida de post hoc de Newman-Keuls, assim como foi aplicado teste de correlação de Pearson. Para todos os casos o nível de significância prefixado foi de 5%. Houve melhora nos parâmetros aeróbio (p Las respuestas de urea y creatinina han sido extensamente usadas para evaluar el impacto del entrenamiento físico. De ahí que el propósito de nuestro estudio ha sido el de investigar el comportamiento del suero y la creatinina urinaria y las concentraciones de urea durante el entrenamiento de fútbol. Fueron evaluados 18 jugadores brasileños de fútbol al inicio (T1, a la mitad (T2 y en el final (T3 de un programa de entrenamiento de fútbol. En los atletas se midieron la eficiencia de sus características antropométricas, capacidad aeróbica y metabolismo anaeróbico alatico. Sumadas a las medidas de suero y creatinina urinaria y concentraciones de urea, también se evaluó en los atletas la eliminación de creatinina mediante tres métodos diferentes. Mientras que el primer método fue independiente del volumen

  19. O galego-português e os seus detentores ao longo do século XIII

    Directory of Open Access Journals (Sweden)

    José Carlos Ribeiro MIRANDA

    2012-06-01

    Full Text Available O presente artigo tem por objectivo mostrar como a apropriação do galego-português por parte da aristocracia do ocidente peninsular constituiu um sério entrave à utilização desta língua por parte da monarquia portuguesa, justificando, em última análise, o carácter muito tardio do surgimento tanto de obras jurídicas ou narrativas, como de documentação escrita em galego-português da responsabilidade dos círculos régios do reino de Portugal.Cette étude a pour objet de montrer comment l’appropriation du gallego-portugais par une partie de l’aristocratie de l’occident de la Péninsule Ibérique a constitué un obstacle sérieux à l’usage de cette modalité linguistique vernaculaire par la monarchie portugaise. Ceci justifie l’avènement très tardif, au Portugal, d’œuvres juridiques ou narratives en gallego-portugais qui puissent être directement liées à une initiative royale, aussi bien que le retard, par rapport aux royaumes voisins, avec lequel la rédaction de documents en langue vulgaire entre dans les habitudes de la chancellerie du palais.

  20. Alguns apontamentos das práticas espaciais ao longo da BR-163 (Santarém-Cuiabá

    Directory of Open Access Journals (Sweden)

    Thiago Oliveira Neto

    2017-05-01

    Full Text Available The Brazilian government’s projects for the Amazon regarding the physical infrastructure of circulation in the 21st century, aim at the completion of constructed geographic objects that do not offer satisfactory conditions of continuous trafficability. One of these questions is about the paving of the BR-163 highway, connecting the cities of Santarém (state of Pará and Cuiabá (state of Mato Grosso. The implementation and development of such projects substantially change the geographical area due to the construction of other objects associated with the highway, which will provide transport vehicles flows of midwestern and northern Brazil grain productions through the Amazon River, establishing the holding practices for national and international corporations that are inserting on the highway route a complex of grain harbors.

  1. Análise do comportamento do sódio ao longo de 24 horas de terapia renal substitutiva

    Directory of Open Access Journals (Sweden)

    Thiago Gomes Romano

    Full Text Available RESUMO Objetivo: Investigar os fatores clínicos e laboratoriais associados com a variação dos níveis séricos de sódio durante terapia renal substitutiva contínua e avaliar se a fórmula de mixagem perfeita pode prever a variação do sódio nas 24 horas. Métodos: A partir de uma base de dados coletada de forma prospectiva, recuperamos e analisamos os dados referentes a 36 sessões de terapia renal substitutiva realizadas em 33 pacientes, nas quais a prescrição de afluentes permaneceu inalterada durante as primeiras 24 horas. Aplicamos um modelo linear misto para investigar os fatores associados com grandes variações dos níveis séricos de sódio (≥ 8mEq/L e geramos um gráfico de Bland-Altman para avaliar a concordância entre as variações previstas e observadas. Resultados: Nas sessões de terapia renal substitutiva de 24 horas identificamos que SAPS 3 (p = 0,022 e hipernatremia basal (p = 0,023 foram preditores estatisticamente significantes de variações séricas do sódio ≥ 8mEq/L na análise univariada, porém apenas hipernatremia demonstrou uma associação independente (β = 0,429; p < 0,001. A fórmula de mixagem perfeita para previsão do nível de sódio após 24 horas demonstrou baixa concordância com os valores observados. Conclusões: A presença de hipernatremia por ocasião do início da terapia renal substitutiva é um fator importante associado com variações clinicamente significativas dos níveis séricos de sódio. O uso de citrato 4% ou da fórmula A de ácido citrato dextrose 2,2% como anticoagulantes não se associou com variações mais acentuadas dos níveis séricos de sódio. Não foi viável desenvolver uma predição matemática da concentração do sódio após 24 horas.

  2. Análise do comportamento do sódio ao longo de 24 horas de terapia renal substitutiva

    OpenAIRE

    Thiago Gomes Romano; Cassia Pimenta Barufi Martins; Pedro Vitale Mendes; Bruno Adler Maccagnan Pinheiro Besen; Fernando Godinho Zampieri; Marcelo Park

    2016-01-01

    RESUMO Objetivo: Investigar os fatores clínicos e laboratoriais associados com a variação dos níveis séricos de sódio durante terapia renal substitutiva contínua e avaliar se a fórmula de mixagem perfeita pode prever a variação do sódio nas 24 horas. Métodos: A partir de uma base de dados coletada de forma prospectiva, recuperamos e analisamos os dados referentes a 36 sessões de terapia renal substitutiva realizadas em 33 pacientes, nas quais a prescrição de afluentes permaneceu inalterad...

  3. Trauma no idoso e prevenção ao longo dos anos: revisão integrativa

    OpenAIRE

    Teston, Elen Ferraz; Universidade Estadual de Maringá.; Guimarães, Percival Vitorino; Universidade Estadual de Londrina; Marcon, Sonia Silva; Universidade Estadual de Maringá (UEM) e NEPAAF.

    2014-01-01

    Este artigo teve como objetivo identificar a origem dos traumas sofridos pelas pessoas idosas, bem como as condutas preventivas desenvolvidas para a redução deste evento. Revisão integrativa realizada a partir da seleção de artigos na Biblioteca Virtual em Saúde, em janeiro de 2012, utilizando os descritores trauma, urgência e emergência, enfermagem, causas eternas, idoso e prevenção. O período de publicação não foi delimitado. O estudo foi composto por 25 artigos na íntegra e analisados segu...

  4. Relações amorosas ao longo das décadas: um estudo de cartas de amor

    Directory of Open Access Journals (Sweden)

    Caroline Carpenedo

    2004-06-01

    Full Text Available Este estudo analisa as relações amorosas desde os tempos passados até os atuais por meio da análise de cartas de amor trocadas entre casais. Para tanto foram selecionadas cartas amorosas das décadas de 40-50, 70-80 e 2000 e analisados os conteúdos das mesmas. Oito casais foram escolhidos de forma intencional, considerando-se que ambos deveriam ser originários de cidades do interior do estado e possuírem nível socioeconômico médio. Destes, dois mantinham relacionamento durante as décadas de 40-50, três casais correspondiam-se durante as décadas de 70-80, e por último, outros três casais da década de 2000. A análise das cartas permitiu visualizar que as mudanças socioculturais ocorridas nas últimas décadas influenciaram diretamente nos relacionamentos amorosos. Sendo assim, encontraram-se muitas modificações nestes relacionamentos desde a década de 40-50 até a atualidade, principalmente no que se refere às atitudes do casal e a comunicação estabelecida entre estes. Palavras-chave: casais; relacionamentos amorosos; transformações nas relações amorosas; cartas.

  5. Aprendizagem ao longo da vida: entre a novidade e a reprodução de velhas desigualdades

    Directory of Open Access Journals (Sweden)

    Mariana Gaio Alves

    2010-01-01

    Full Text Available Lifelong Learning has been a central issue, namely within political discourses from the European Commission, and it conveys the idea that this is a new strategy within Education that will allow us to overcome many old problems that have been facing the development of the educational and training systems. In this article we intend to discuss to what extent is lifelong learning a novelty within the educational field. To meet that purpose we consider three inter-related dimensions in our analysis: (1 the meanings and understandings of the idea of lifelong learning, the educational changes occurring within the paradigm of lifelong learning in what concerns (2 educational policy and (3 educational and training processes. We also address the debate on the dynamics of lifelong learning and the ways it contributes to the persistence (or diminishing of inequalities that have been underlying the development of educational systems.

  6. Trauma no idoso e prevenção ao longo dos anos: revisão integrativa

    Directory of Open Access Journals (Sweden)

    Elen Ferraz Teston

    2014-06-01

    Full Text Available Este artigo teve como objetivo identificar a origem dos traumas sofridos pelas pessoas idosas, bem como as condutas preventivas desenvolvidas para a redução deste evento. Revisão integrativa realizada a partir da seleção de artigos na Biblioteca Virtual em Saúde, em janeiro de 2012, utilizando os descritores trauma, urgência e emergência, enfermagem, causas eternas, idoso e prevenção. O período de publicação não foi delimitado. O estudo foi composto por 25 artigos na íntegra e analisados segundo a análise de conteúdo. Evidenciou-se que as principais causas do trauma na pessoa idosa foram as quedas e os acidentes de trânsito. Além disso, as ações de prevenção evidenciadas foram a promoção do exercício físico, hidroterapia e atividades de educação no trânsito. Destaca-se a influência negativa do trauma para a qualidade de vida do idoso e a necessidade de planejamento de ações de prevenção para a redução do trauma geriátrico.  

  7. Estudo da variação da densidade mamográfica ao longo de um ciclo menstrual.

    OpenAIRE

    Kíssiner Pazuello

    2003-01-01

    Há muito que se reconhece que a mama não é um orgão estático. Do nascimento à senilidade a mama esta sujeita à variações que vão desde o formato até a composição e arquitetura tecidual. Estas variações são notórias à simples inspeção, palpação, cortes histológicos, dosagens e outros métodos de estudo. Tais variações são decorrentes de fenômenos da esfera endócrina relacionada à vários hormônios envolvidos com o desenvolvimento, tal como: Estrogênios, FSH, LH, TSH, Mineralocorticóides, Prola...

  8. O regresso de licenciados ao ensino superior: entre a inserção profissional e a educação ao longo da vida

    Directory of Open Access Journals (Sweden)

    MARIANA GAIO ALVES

    2016-01-01

    Full Text Available En este artículo se analiza el retorno de los graduados a la enseñanza superior para continuar la formación académica, discutiendo e interrogando las razones que los llevan a tomar dicha decisión. El análisis se apoya en datos empíricos resultantes de una muestra representativa de graduados que finalizaron sus cursos en 2004/2005 en las Universidade de Lisboa y Universidade Nova de Lisboa (Portugal. Los datos analizados permiten examinar en qué medida la participación en la formación de postgrado se puede entender como una estrategia de empleabilidad. Este debate es particularmente relevante en el contexto actual, teniendo en cuenta, por un lado, que la educación a lo largo de la vida asume una centralidad creciente en las sociedades contemporáneas y, por otro lado, que la precarización del empleo de los graduados ha aumentado significativamente.

  9. LongoVital i forebyggelsen af recidiverende aftøs stomatit. 1

    DEFF Research Database (Denmark)

    Pedersen, A; Hougen, H P; Klausen, B

    1991-01-01

    LongoVital (LV) (DK. reg. no. 5178/75) is a herbal based tablet enriched with recommended doses of vitamins. The present study was undertaken to investigate prevention of recurrent aphthous ulceration (RAU) during daily intake of LV for six months as compared with placebo in a double-blind, rando......LongoVital (LV) (DK. reg. no. 5178/75) is a herbal based tablet enriched with recommended doses of vitamins. The present study was undertaken to investigate prevention of recurrent aphthous ulceration (RAU) during daily intake of LV for six months as compared with placebo in a double...

  10. A exposição ao risco das familias

    OpenAIRE

    dos Santos Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  11. Immunomodulation by LongoVital in patients with recurrent aphthous ulceration

    DEFF Research Database (Denmark)

    Pedersen, A; Klausen, B; Hougen, H P

    1990-01-01

    LongoVital (LV) (DK. Reg. No. 5178/75) is a herbal based tablet enriched with recommended doses of vitamins. Peripheral lymphocyte subsets: T-helper/CD4 (OKT4+) and T-suppressor/cytotoxic/CD8 (OKT8+) were studied quantitatively in 31 otherwise healthy patients with minor recurrent aphthous...

  12. Immunmodulerende effekt af LongoVital hos patienter med recidiverende aftøs stomatit. 2

    DEFF Research Database (Denmark)

    Pedersen, A; Klausen, B; Hougen, H P

    1991-01-01

    LongoVital (LV) (DK. reg. no. 5178/75) is a herbal-based tablet enriched with recommended doses of vitamins. Peripheral lymphocyte subsets: T-helper/CD4 (OKT4+) and T-suppressor/cytotoxic/CD8 (OKT8+) were studied quantitatively in 31 otherwise healthy patients with minor recurrent aphthous...

  13. Determinantes de longo prazo do produto e da Produtividade Total dos Fatores da agropecuária brasileira no período 1974-2005

    Directory of Open Access Journals (Sweden)

    Henrique Brigatte

    2011-12-01

    Full Text Available O presente estudo desenvolve uma análise dos impactos exercidos pelas mais relevantes variáveis no Produto Interno Bruto (PIB e na Produtividade Total dos Fatores (PTF da agricultura ao longo do período entre 1974 e 2005. São considerados como determinantes do crescimento econômico: investimentos em infraestrutura de transportes, de energia elétrica, de pesquisa, irrigação e armazenagem agrícolas, além dos montantes de crédito rural e da educação dos trabalhadores do setor agropecuário. A análise é feita por meio do uso de cointegração pelo método de Johansen, e os resultados indicam que educação e investimentos em infraestrutura exercem impactos positivos no longo prazo sobre o produto e a produtividade da agropecuária. Contrariamente, não são detectadas relações de cointegração entre crédito rural e o produto e a produtividade do setor.

  14. Sensibilidade da rosa 'Osiana' ao etileno

    Directory of Open Access Journals (Sweden)

    Delaine Cristina Cordeiro

    2011-01-01

    Full Text Available Os objetivos deste trabalho foram determinar a sensibilidade e as respostas da rosa cultivar Osiana (Rosa × hybrida à presença de etileno ao longo da vida pós-colheita. Para determinar a sensibilidade da flor ao etileno, hastes foram cortadas e colocadas em câmaras herméticas e em seguida tratadas por 24 horas com diferentes concentrações de etileno variando de 0,0; 0,1; 1,0; 10; 100 e 1000 µL L-1do ar no interior da câmara. A rosa teve a vida pós-colheita reduzida pelo etileno, quando exposta a concentração igual ou superior a 10 µL L-1 de etileno. As flores tratadas com no mínimo de 10 µL L-1de etileno desenvolveram necrose, murcha e abscisão prematura das pétalas ainda túrgidas. As concentrações de 0,1 e 1,0 µL L-1de etileno estimularam a abertura do botão floral durante o período de 24 horas de exposição ao etileno, sem no entanto, reduzir a vida pós-colheita. A rosa 'Osiana' pode ser classificada como uma cultivar sensível ao etileno e a concentração influência os processos estimulados.

  15. UMA PROPOSTA DE ABORDAGEM AO PROBLEMA DE FLÁVIO JOSEFO APLICADA AO ENSINO MÉDIO

    OpenAIRE

    Márcia Erondina Dias de Souza

    2013-01-01

    Neste trabalho, apresentamos uma sequência didática de atividades elaboradas para um grupo de alunos do ensino médio, na faixa etária de 15 a 18 anos, tendo como principal objetivo estudar o problema proposto pelo matemático Flávio Josefo, nos meados do ano 64. Conta a lenda que um grupo de rebeldes, dentre eles Flávio Josefo, foi encurralado numa caverna pelo exército inimigo. Preferindo o suicídio à captura, os rebeldes decidiram formar um círculo e, contando ao longo dest...

  16. Acesso ao tratamento da diabetes na Bahia: por que se recorre ao judiciário?

    OpenAIRE

    Lisboa, Erick Soares

    2015-01-01

    A judicialização da saúde é um fenômeno importante, que tem motivado a realização de inúmeros estudos no país. A Constituição do país estabelece o direito de todos e o dever do Estado em prover acesso universal as ações e serviços de saúde. Ao longo dos 25 anos do SUS houve uma ampliação do acesso a medicamentos, e a cada ano, novos fármacos vem sendo lançados no Brasil pelas indústrias farmacêuticas. A judicialização do acesso a medicamentos tem causado impactos na estruturação, no financiam...

  17. Mudanças na economia mundial: perspectiva histórica de longo prazo

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Almeida

    2010-05-01

    Full Text Available Ensaio síntese sobre as grandes transformações e as tendências de longo prazo da economia mundial, enfatizando os processos de diferenciação, divergências estruturais e novas convergências, nas diferentes etapas da globalização capitalista e da interdependência econômica internacional.

  18. The susceptibility of dental plaque bacteria to the herbs included in Longo Vital®

    DEFF Research Database (Denmark)

    Larsen, T.; Fiehn, N. E.; Østergaard, E.

    1996-01-01

    the in vitro susceptibility of 12 dental plaque bacteria to six individual herbs included in Longo Vital® was determined by a broth dilution method. Paprika, rosemary leaves and peppermint inhibited two thirds of the tested bacteria at 2.8-45 mg/ml, 0.75-12 mg/ml and 3-24 mg/ml corresponding to 0.8-12.5 per...

  19. Evolução da temperatura ambiente em construções sujeitas ao fogo

    OpenAIRE

    Inácio, Pedro Jorge Rita Ledo

    2011-01-01

    Dissertação para a obtenção do Grau de Mestre em Engenharia Civil A perda de bens materiais e de vidas humanas em situações de incêndio tem sido ao longo dos tempos uma preocupação crescente, promovendo assim o conceito de segurança contra incêndio e de diversos mecanismos associados à sua prevenção ou limitação dos danos causados. Um incêndio é algo difícil de prever, assim como a sua consequência nos elementos de construção. Dessa forma, ao longo das ultimas décadas, os elementos d...

  20. Incentivos ao investimento estrangeiro

    OpenAIRE

    Mendes, Valter Nuno Dias

    2015-01-01

    Dissertação de Mestrado apresentada ao Instituto de Contabilidade e Administração do Porto para a obtenção do grau de Mestre em Contabilidade e Finanças, sob orientação de Doutor José de Campos Amorim O presente estudo tem por tema os Incentivos ao Investimento Estrangeiro ao nível das pessoas singulares: o Regime Fiscal do Residente Não Habitual (RNH) e a Autorização de Residência para Atividade de Investimento (ARI) – Vistos Dourados (Golden Visa), tendo por objetivo a análise mais po...

  1. Efeitos de longo prazo do estresse neonatal com lipopolissacarídeo em ratos = Long-term effects of neonatal stress using lipopolysaccharide in rats

    Directory of Open Access Journals (Sweden)

    Lunardelli, Adroaldo

    2014-01-01

    Full Text Available Introdução: Diversos modelos experimentais têm sido utilizados para demonstrar que intervenções no início da vida podem gerar alterações permanentes que perduram ao longo da vida. A administração de lipopolissacarídeo (LPS no período neonatal gera um estímulo imunológico estressante capaz de alterar muitas respostas fisiológicas ao estresse na vida adulta. Objetivo: Revisar a literatura acerca das influências, em longo prazo, que a administração de LPS no período neonatal pode gerar na vida adulta em modelos experimentais. Materiais e Métodos: O presente estudo consiste em uma revisão integrativa da literatura com base na busca de artigos científicos disponíveis nas bases de dados Medline/PubMed e Science Direct, utilizando os descritores neonatal programming, neonatal stress, neonatal LPS e neonatal lipopolysaccharide. Foram incluídas publicações cuja temática abordasse os resultados da utilização de LPS como estressor neonatal em protocolos experimentais, sem limite de data. Resultados: Foram selecionados 15 artigos que mostram modelos experimentais em que a injeção de LPS em ratos neonatos causa modificações funcionais da resposta do eixo hipotálamo-hipófise-adrenal (HPA quando adultos, incluindo elevação nos níveis plasmáticos de corticosterona. Ainda, há diminuição das concentrações circulantes de citocinas pró-inflamatórias, hiperalgesia, aumento na sensibilidade ao estresse e aumento do comportamento de ansiedade e depressão. Conclusão: Os resultados demonstram que a administração neonatal de LPS consiste em um modelo experimental efetivo de programming, provocando uma série de alterações imunológicas e comportamentais na vida adulta

  2. Falha a longo prazo no tratamento do melanoma de coróide com termoterapia transpupilar

    OpenAIRE

    Pasetto,Gabriela Soncini; Freitas,Henrique Pedroso de; Colossi,Carina Graziottin; Vilela,Manuel Augusto Pereira

    2013-01-01

    OBJETIVO: Avaliar, retrospectivamente, num longo intervalo de tempo, os resultados da termoterapia transpupilar em casos selecionados do melanoma de coróide. MÉTODOS: Foram identificados todos os casos com melanoma de coróide tratados com termoterapia transpupilar, como terapia única ou suplementar. Foram excluídos os casos com seguimento inferior a 60 meses, prontuários incompletos ou com o abandono do acompanhamento. RESULTADOS: De um total de 18 olhos, 7 (38.9%) foram incluídos no estudo. ...

  3. The Shadow of a Gnomon Along a Year: Routine Observations and Teaching of Apparent Motion of the Sun and the Four Seasons. (Spanish Title: La Sombra de un Gnomon lo Largo de un Año: Observaciones de Rutina y la Enseñanza del Movimiento Aparente del Sol y Las Cuatro Estaciones.) A Sombra de um Gnômon ao Longo de um Ano: Observações Rotineiras e o Ensino do Movimento Aparente do Sol E das Quatro Estações

    Science.gov (United States)

    Trogello, Anderson Giovani; Danhoni Neves, Marcos Cesar; de Carvalho Rutz da Silva, Sani

    2013-12-01

    , al solsticio de junio, al equinoccio de septiembre y al solsticio de diciembre. Además, se dictaron clases teóricas en la sala de aula. Estos métodos buscaron construir conceptos en torno al movimiento aparente del Sol y la sucesión de las estaciones. Teniendo en cuenta los resultados de las actividades se aplicó una evaluación cuyos datos demuestran la existencia de un aprendizaje deseado por los estudiantes en cuanto a: el reconocimiento de los puntos cardinales, la descripción del movimiento solar aparente y la aparición de las estaciones y su alternancia a partir de observaciones astronómicas visuales sin instrumentos. Muitas concepções alternativas são reconhecidas entre os diversos grupos de estudantes, em especial nos da educação básica. Dentre elas, o movimento aparente do Sol, por mais quotidiano que seja, proporciona variadas interpretações. Deste modo, observar e registrar o movimento dos astros na abóboda celeste é uma tarefa necessária ao ensino de Astronomia. O trabalho que ora se apresenta propõe a apresentação dos resultados da observação do movimento aparente do Sol por intermédio da marcação da sombra de um gnômon vertical por alunos de uma turma do sexto ano do ensino fundamental de uma escola do campo do Paraná. O projeto em si ocorreu em quatro etapas, em datas próximas do equinócio de março, do solstício de junho, do equinócio de setembro e do solstício de dezembro. Além disso, foram desenvolvidas aulas teóricas em sala de aula. Tais métodos buscaram construir conceitos em torno da movimentação aparente do Sol e da alternância das estações do ano. Diante dos resultados provenientes das atividades desenvolvidas foi aplicada uma avaliação e os dados demonstraram um aprendizado desejado dos alunos quanto: ao reconhecimento dos pontos cardeais; à descrição do movimento solar aparente e a ocorrência das estações do ano e sua alternância a partir de observações astronômicas a olho nu.

  4. Falha a longo prazo no tratamento do melanoma de coróide com termoterapia transpupilar

    Directory of Open Access Journals (Sweden)

    Gabriela Soncini Pasetto

    2013-08-01

    Full Text Available OBJETIVO: Avaliar, retrospectivamente, num longo intervalo de tempo, os resultados da termoterapia transpupilar em casos selecionados do melanoma de coróide. MÉTODOS: Foram identificados todos os casos com melanoma de coróide tratados com termoterapia transpupilar, como terapia única ou suplementar. Foram excluídos os casos com seguimento inferior a 60 meses, prontuários incompletos ou com o abandono do acompanhamento. RESULTADOS: De um total de 18 olhos, 7 (38.9% foram incluídos no estudo. Cinco (71,4% pacientes foram tratados exclusivamente com termoterapia transpupilar, em 1 (14,2% olho a crioterapia foi simultânea, 1 (14,2% suplementou braquiterapia - placa episcleral. Três (42.8% sofreram recorrência, 2 (28.5% apresentaram metástases (um óbito, 2 foram enucleados. Complicações foram encontradas em 3 olhos: dobras maculares em 2, hemorragia vítrea em 1. Nos olhos enucleados, não havia extensão extraescleral, porém células interesclerais foram identificadas. CONCLUSÃO: Termoterapia transpupilar mostra um declínio em sua eficácia e conserva os riscos de metástases em períodos mais longos de acompanhamento, sendo necessária uma definição mais exata de seu papel nos melanomas de coróide.

  5. Carta ao Editor

    OpenAIRE

    Correia, Miguel

    2017-01-01

    Exmos. Senhores Editores-Chefe,Li com muito interesse o artigo de Sousa R e colaboradores, intitulado “Que fatores levam ao abandono de crianças do serviço de urgência antes da observação médica?”.

  6. Modified Longo's stapled hemorrhoidopexy with additional traction sutures for the treatment of residual prolapsed piles.

    Science.gov (United States)

    Chen, Chuang-Wei; Kang, Jung-Cheng; Wu, Chang-Chieh; Hsiao, Cheng-Wen; Jao, Shu-Wen

    2008-03-01

    Residual prolapsed piles is a problem after the stapled hemorrhoidopexy, especially in large third- or fourth-degree hemorrhoids. We have developed a method using additional traction sutures along with modified Longo's procedure to manage this problem. From January 2005 to October 2005, 30 consecutive patients with symptomatic third- or fourth-degree hemorrhoids who underwent the modified Longo's stapled hemorrhoidopexy with additional traction sutures in a single institution were collected. The demographics, postoperative pain score, surgical features, outcomes, and early and late complications were recorded. All patients were followed for a mean duration of 8.8 (range, 4-15) months. Thirty patients (17 males) with a mean age of 45 (range, 27-63) years were identified. The mean postoperative pain score on the morning of the first postoperative day was 2.8 (range, 1-4). The mean duration of operation was 30.7 (range, 25-37) min. The mean duration of hospital stay was 2 (range, 1-3) days. The mean days for patients to resume normal work was 6.7 (range, 4-9) days. No other procedure-related complications occurred in all patients. There was no early complication except for fecal urgency found in one patient during the first postoperative days. Regarding the late complications, no residual prolapsed piles, persistent anal pain, incontinence, anal stenosis, or recurrent symptoms were found. Our preliminary experiences indicated that this modified procedures truly contributed to reduce the residual internal hemorrhoids and maintained the benefits of stapled hemorrhoidopexy. Randomized trial and long-term follow-up warrant to determine possible surgical and functional outcome.

  7. Determination of Land Use/ Land Cover Changes in Igneada Alluvial (Longos) Forest Ecosystem, Turkey

    Science.gov (United States)

    Bektas Balcik, F.

    2012-12-01

    Alluvial (Longos) forests are one of the most fragile and threatened ecosystems in the world. Typically, these types of ecosystems have high biological diversity, high productivity, and high habitat dynamism. In this study, Igneada, Kirklareli was selected as study area. The region, lies between latitudes 41° 46' N and 41° 59' N and stretches between longitudes 27° 50' E and 28° 02' E and it covers approximately 24000 (ha). Igneada Longos ecosystems include mixed forests, streams, flooded (alluvial) forests, marshes, wetlands, lakes and coastal sand dunes with different types of flora and fauna. Igneada was classified by Conservation International as one of the world's top 122 Important Plant Areas, and 185 Important Bird Areas. These types of wild forest in other parts of Turkey and in Europe have been damaged due to anthropogenic effects. Remote sensing is very effective tool to monitor these types of sensitive regions for sustainable management. In this study, 1984 and 2011 dated Landsat 5 TM data were used to determine land cover/land use change detection of the selected region by using six vegetation indices such as Tasseled Cap index of greenness (TCG), brightness (TCB), and wetness (TCW), ratios of near-infrared to red image (RVI), normalized difference vegetation index (NDVI), and soil-adjusted vegetation index (SAVI). Geometric and radiometric corrections were applied in image pre-processing step. Selective Principle Component Analysis (PCA) change detection method was applied to the selected vegetation index imagery to generate change imagery for extracting the changed features between the year of 1984 and 2011. Accuracy assessment was applied based on error matrix by calculating overall accuracy and Kappa statistics.

  8. O longo e o curto prazo na aprendizagem da matemática Long term and short term in mathematics learning

    Directory of Open Access Journals (Sweden)

    Gérard Vergnaud

    2011-01-01

    Full Text Available "Longo prazo" refere-se a uma perspectiva de desenvolvimento: entre as primeiras competências adquiridas pelas crianças pequenas, aos cinco e seis anos, e aquelas adquiridas por apenas uma parte dos adolescentes de quinze anos, numerosas etapas e processos, filiações e rupturas são observadas. "Curto prazo" refere-se a situações suscetíveis de serem utilmente propostas aos alunos em um ou outro momento de seu desenvolvimento em função das competências já adquiridas ou parcialmente adquiridas, como também ao acompanhamento que delas o professor faz para facilitar e guiar aquele processo de aquisição. As estruturas aditivas, por exemplo, fornecem diversos casos em que certa categoria de raciocínio e a escolha de uma operação de adição ou de subtração são nitidamente mais delicadas do que em outros casos. Isto exige um arranjo específico, uma ajuda significativa do adulto e, eventualmente, uma representação simbólica original. O mesmo acontece com as estruturas multiplicativas, a geometria, a álgebra, e em outros domínios, afastados da matemática, como o da moral ou da compreensão de textos. O presente artigo limita-se a esse respeito ao exemplo da aprendizagem da matemática."Long term" refers necessarily to a developmental perspective: between the first competencies acquired by young children, at the age of five or six, and those acquired by fifteen year-old adolescents (only part of them, there are several steps and processes: continuities and discontinuities can be observed along this development. "Short term" concerns situations that are likely to be offered to students, for them to learn, at some crucial moment of this development. It is therefore concerned by the discovery, even partially, of new properties by students, owing to the teacher's help in conducting and facilitating the acquisitions course. The additive structures, for example, provide many different situations in which a particular reasoning and

  9. Resposta ao estresse: I. Homeostase e teoria da alostase

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-03-01

    Full Text Available ResumoOs seres vivos desenvolvem ao longo de sua história evolutiva mecanismos de enfrentamento às condições adversas originadas tanto no ambiente geofísico como no ambiente social. Esta resposta adaptativa é coordenada e envolve diferentes sistemas funcionais, particularmente, os sistemas nervoso, endócrino e imune, e é denominada de resposta ao estresse e deve atender a duas demandas principais da vida: sobrevivência e reprodução. Esta revisão tem o objetivo de discutir o emprego do conceito clássico de homeostase e um conceito alternativo, alostase, que inclui os mecanismos preditivos e reativos de regulação, assim como os diferentes níveis de impacto dos estressores crônicos, resultando em sobrecarga alostática que pode ou não se seguir de falha alostática. Os mecanismos neurais, hormonais, imunes, sistêmicos e moleculares, que compreendem os sistemas alóstaticos subjacentes à resposta ao estresse são também apresentados.

  10. Paisagem genética e história populacional de Tropidurus hispidus (Squamata: Tropuridae) ao longo de um mosaico adaptativo do Norte e Nordeste do Brasil

    OpenAIRE

    Brito, Diego Marllus Albanus

    2012-01-01

    A genética da paisagem adaptativa é um tema transversal de estudos, que combina conhecimentos de ecologia da paisagem e dados relativos à genética populacional das espécies. Em lagartos, essa abordagem já foi utilizada para responder questões como mudanças climáticas, fragmentação de habitats e incertezas taxonômicas. Apesar de Tropidurus hispidus parecer ser uma espécie coesa, porém ecologicamente adaptável, apresenta evidências de estruturação populacional. Esse trabalho objetivou avaliar a...

  11. Estudo do isolamento acústico das paredes de vedação da moradia brasileira ao longo da história

    OpenAIRE

    Duarte, Elisabeth de Albuquerque Cavalcanti

    2005-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. Programa de Pós-Graduação em Arquitetura e Urbanismo. A história da arquitetura apresenta um vasto panorama de avanços tecnológicos em construções em diversas partes do mundo. Estes avanços sempre contribuíram na melhoria da qualidade de vida do homem. No entanto, em determinado ponto da história essa situação começou a se reverter. O século XX se deparou com uma constante busca por construções mais leves...

  12. O desafio de ler o mundo ao longo da vida: a vida e voz de estudantes sénior na Universidade de Aveiro

    OpenAIRE

    Machado, Marisa Alexandra Maia

    2015-01-01

    O presente trabalho surgiu do interesse pela população sénior no seu movimento de procura de inserção e de participação em espaços de troca e de produção de conhecimento, entendimento e intervenção no mundo social. A abertura da Universidade tradicional e a criação de iniciativas de base associativa e local, tais como a Universidade Sénior, tem acompanhado o aumento da população idosa e a simultânea redução da população jovem nas comunidades, o que gera mudanças sociais que requerem uma respo...

  13. FAUNA DO SOLO AO LONGO DO PROCESSO DE SUCESSÃO ECOLÓGICA EM VOÇOROCA REVEGETADA NO MUNICÍPIO DE PINHEIRAL – RJ

    Directory of Open Access Journals (Sweden)

    Khalil de Menezes Rodrigues

    2016-01-01

    Full Text Available The diversity, richness and composition of the soil epigeous fauna community were evaluated in a re- vegetated gully at the Instituto Federal de Educação (IFRJ campus Nilo Peçanha, in the municipality of Pinheiral, Rio de Janeiro state. Revegetation was performed in 2000, and consisted of four different strategies involving N-fixing trees: planting Acacia mangium Willd. (PA; planting Mimosa caesalpiniifolia Benth . (PM; on the outer edges of the gully head (PTS; and planting a mix of legume tree species into the gully (IVR2000. Acacia mangium and Mimosa caesalpiniifolia were planted above the gully head. A nearby 20-year secondary forest remnant was used as a reference site. Ten pitfall traps were used for the sampling of epigeous fauna at each one of the five areas (MOLDENKE , 1994. Sampling was performe in May 2000, June 2006, and April 2008. Six years after revegetation has started, fauna group richness and diversity increased both into the gully and in Mimosa caesalpiniifolia plantation. For the 2000 and 2006 samplings a PCA showed that groups were mostly associated to 2006, and completely opposite to 2000. Acacia mangium plantation had the lowest group richness. In the 2008 sampling, pasture showed the lowest group richness, and according to the PCA groups into the gully were associated to 2008, and completely opposite to 2000 and 2006. Formicidae and Collembola (Entomobryomorpha were dominant in all sampled areas, both in 2000 and 2008, and into the gully in 2006 as well.

  14. DETERMINAÇÃO DA DENSIDADE BÁSICA DA MADEIRA DE PEROBA (ASPIDOSPERMA POLINEURON MUELL. ARG. AO LONGO DO FUSTE

    Directory of Open Access Journals (Sweden)

    Alvaro Felipe Valerio

    2008-01-01

    Full Text Available The present work has as objective to determine and compare the variation of basic density of peroba's wood throughout the Aspidosperma polineuron, that specie belongs to Apocynaceae's family, known popularly as Peroba. The sample was carried in three selected trees at random form in dense Ombrófila¿s forest in Apiuna and President Nereus Ramos/SC. The trees were knocked and they had their changeable dendrometrics measured. The basic density was determined in samples of 1,5 x 1,5 x 5 cm, removed of the internal part of the record (cerne and the external part (alburnum, having been these collected the height of chest (DAP, 0%, 10%, 50%, 75% and 95% of morphologic inversion's point. Above this, two samples with branches called G1 and G2 were colleted. The basic density was gotten through the relation between the dry weight and the green volume of samples, revealing increasing of the base for the top of the tree. In the accomplishment of variance's performance (ANOVA was not able to be verified significant differences between the averages of densities throughout the log and the branches. The average basic density was 0, 66 gcm3. The uniformity found for basic density throughout the stem is a characteristic that confers the specie stability and security for its use in structural projects, however it´s necessary deeper studies to better scientific fundaments of its physical and technological properties.

  15. Significados da gerência do cuidado construídos ao longo da formação profissional do enfermeiro

    Directory of Open Access Journals (Sweden)

    Monique Haenscke Senna

    2014-01-01

    Full Text Available El objetivo fue comprender significados de la gerencia de la atención para estudiantes, enfermeros y docentes a lo largo de la formación profesional. Estudio cualitativo, basado en la Teoría Fundamentada en Datos, realizada entre octubre de 2010 y julio de 2011, con 21 participantes en tres grupos de muestras, y analizado por el referencial de evaluación de la calidad de la atención en salud de Donabedian. Tres categorías fueron identificadas: enfermero como gerente de la estructura material y personal; gerencia de enfermería como proceso dinámico y multifactorial; confiriendo al enfermero responsabilidad por el resultado del cuidado ofrecido y su distanciamiento de la practica asistencial. Se desveló la faz gerencial confrontante con proceso de trabajo asistencial, debido a la sobrecarga de actividades del enfermero, responsable por la estructura, proceso y resultado de la atención. Es necesario intensificar la formación profesional y continua del enfermero para práctica de gerencia de la atención.

  16. IMPACTO AMBIENTAL AO LONGO DE TRILHAS EM ÁREAS DE FLORESTA TROPICAL DE ENCOSTA: Maciço da Tijuca Rio de Janeiro - RJ

    Directory of Open Access Journals (Sweden)

    Adriano Severo Figueiró

    2009-01-01

    Full Text Available La meta de esta investigación era identificar y evaluar la pendiente medioambiental generado por la propagación del efecto del borde en el sendero del bosque en dos áreas seleccionadas con los grados diferentes de densidad urbana (el área de Catrambi - densidad alta, y área de Soberbo - densidad baja, en el borde de Floresta da Tijuca - Río de Janeiro (RJ. La hipótesis activa era que el aumento en la presión urbana en el interfaz ciudad-bosque hace un cambio en la dinámica del efecto del borde, acelerando su propagación, sobre todo con respecto a el cambio estructural y el microclimatico, con un impacto directo en la funcionalidad del sistema. Se restringieron los datos del campo a cuatro variables principales: el análisis de estructura de vegetación en la frontera del sendero, Densidad del suelo en el sendero, variabilidad del microclima entre los senderos y, finalmente, análisis de hojarasca en los parcelas del bosque fronterizo.

  17. Análise Multicriterial do Desempenho de Longo Prazo das Carteiras de Ações de Fundos de Investimento Multimercado Macro no Brasil no Período de 2005 a 2010

    Directory of Open Access Journals (Sweden)

    Rodrigo Alves de Melo

    2013-12-01

    Full Text Available Este trabalho tem como objetivo analisar o desempenho de longo prazo das carteiras de ações dos fundos de investimento da categoria multimercado macro no Brasil, no período de abril de 2005 a março de 2010, de forma multicriterial. Para tanto, o estudo busca avaliar: (i a performance por meio da análise de market timing (capacidade de prever oscilações do mercado, mensurada pela medida de Treynor e Mazuy e da análise de seletividade (capacidade de implementar estratégias de stock picking mensurada pelo alpha de Jensen; (ii o desempenho global por meio da utilização da Análise Envoltória de Dados (DEA; (iii a persistência das estratégias de market timing e de stock picking ao longo dos dois períodos de longo prazo analisados (30 meses cada um; (iv a existência de influências do tamanho, do público-alvo e do perfil de risco desses fundos nas medidas de desempenho consideradas. Os instrumentos estatísticos utilizados para verificar a influência das variáveis de controle no desempenho e a persistência de performance foram o teste de Mann-Whitney e o coeficiente de correlação de Spearman, respectivamente. De maneira geral, os portfólios não conseguiram apresentar persistência de performance, nem em relação ao stock picking e nem em relação ao market timing. Foram verificadas influências significativas das variáveis de controle tamanho e perfil de risco, mas apenas em relação à medida de market timing de Treynor e Mazuy (1966. Além disso, a técnica DEA possibilitou a composição de um ranking da eficiência das carteiras, levando-se em consideração o retorno acumulado, o risco sistemático e o risco total das mesmas, e somente um fundo apresentou máxima eficiência para o período estudado. Por fim, foi possível verificar que existe relação entre o sucesso das estratégias de stock picking e de market timing com o desempenho obtido pela aplicação da DEA.

  18. ANÁLISE MULTICRITERIAL DO DESEMPENHO DE LONGO PRAZO DAS CARTEIRAS DE AÇÕES DE FUNDOS DE INVESTIMENTO MULTIMERCADO MACRO NO BRASIL NO PERÍODO DE 2005 A 2010

    Directory of Open Access Journals (Sweden)

    Rodrigo Alves de Melo

    2013-12-01

    Full Text Available Este trabalho tem como objetivo analisar o desempenho de longo prazo das carteiras de ações dos fundos de investimento da categoria multimercado macro no Brasil, no período de abril de 2005 a março de 2010, de forma multicriterial. Para tanto, o estudo busca avaliar: (i a performance por meio da análise de market timing (capacidade de prever oscilações do mercado, mensurada pela medida de Treynor e Mazuy e da análise de seletividade (capacidade de implementar estratégias de stock picking mensurada pelo alpha de Jensen; (ii o desempenho global por meio da utilização da Análise Envoltória de Dados (DEA; (iii a persistência das estratégias de market timing e de stock picking ao longo dos dois períodos de longo prazo analisados (30 meses cada um; (iv a existência de influências do tamanho, do público-alvo e do perfil de risco desses fundos nas medidas de desempenho consideradas. Os instrumentos estatísticos utilizados para verificar a influência das variáveis de controle no desempenho e a persistência de performance foram o teste de Mann-Whitney e o coeficiente de correlação de Spearman, respectivamente. De maneira geral, os portfólios não conseguiram apresentar persistência de performance, nem em relação ao stock picking e nem em relação ao market timing. Foram verificadas influências significativas das variáveis de controle tamanho e perfil de risco, mas apenas em relação à medida de market timing de Treynor e Mazuy (1966. Além disso, a técnica DEA possibilitou a composição de um ranking da eficiência das carteiras, levando-se em consideração o retorno acumulado, o risco sistemático e o risco total das mesmas, e somente um fundo apresentou máxima eficiência para o período estudado. Por fim, foi possível verificar que existe relação entre o sucesso das estratégias de stock picking e de market timing com o desempenho obtido pela aplicação da DEA.

  19. Sensibilidade de laranjeiras-doces ao deficit hídrico

    OpenAIRE

    Ramos, Yuri Caires; Mourão Filho, Francisco de Assis Alves; Stuchi, Eduardo Sanches; Sentelhas, Paulo Cesar; Fadel, André Luiz

    2016-01-01

    Resumo: O objetivo deste trabalho foi avaliar a sensibilidade ao deficit hídrico de 17 seleções de laranja-doce enxertadas sobre tangerineira 'Sunki', ao longo de cinco safras. Empregou-se um modelo agrometeorológico de penalização da produtividade pelo deficit hídrico, tendo-se avaliado a relação entre os valores estimados e observados. As seleções podem ser classificadas como de alta, média e baixa sensibilidade ao deficit hídrico, classificação que é inédita para as condições brasileiras. ...

  20. A Exposição ao Risco das Famílias

    OpenAIRE

    Amaro, Ana Raquel

    2014-01-01

    A presente Dissertação de Mestrado aborda a exposição ao risco financeiro das famílias. Ao longo do trabalho serão abordados temas como a heurística, as finanças comportamentais, a percepção do risco e a exposição ao risco. Estes são os conceitos que foram considerados como sendo fundamentais e os principais responsáveis pela tomada de decisões a nível financeiro das famílias. Este estudo é de natureza quantitativa e pretenderá tirar conclusões da população em geral tendo em consideraçã...

  1. AO Group Annual Report

    Energy Technology Data Exchange (ETDEWEB)

    Olivier, S

    2005-10-04

    The Adaptive Optics (AO) Group in I Division develops and tests a broad range of advanced wavefront control technologies. Current applications focus on: Remote sensing, High power lasers, Astronomy, and Human vision. In the area of remote sensing, the AO Group leads a collaborative effort with LLNL's Nonproliferation, Arms Control & International Security (NAI) Directorate on Enhanced Surveillance Imaging. The ability to detect and identify individual people or vehicles from long-range is an important requirement for proliferation detection and homeland security. High-resolution imaging along horizontal paths through the atmosphere is limited by turbulence, which blurs and distorts the image. For ranges over {approx}one km, visible image resolution can be reduced by over an order of magnitude. We have developed an approach based on speckle imaging that can correct the turbulence-induced blurring and provide high resolution imagery. The system records a series of short exposure images which freeze the atmospheric effects. We can then estimate the image magnitude and phase using a bispectral estimation algorithm which cancels the atmospheric effects while maintaining object information at the diffraction limit of the imaging system.

  2. Linhas paralelas: as distintas aproximações da Psicologia em relação ao trabalho

    OpenAIRE

    BERNARDO,Marcia Hespanhol; OLIVEIRA,Fábio de; SOUZA,Heloisa Aparecida de; SOUSA,Caroline Cristiane de

    2017-01-01

    Resumo Este artigo analisa diferentes aproximações da Psicologia em relação ao mundo do trabalho, trazendo elementos para o debate sobre a unicidade, ou não, das abordagens construídas ao longo da história dessas aproximações, com foco nas vertentes da Psicologia Social do Trabalho e da Psicologia Organizacional. Para tanto, buscou-se compreender a história dessas tradições, suas origens e seu lugar no contexto contemporâneo. Concluiu-se que elas possuem diferentes abordagens e compreensões s...

  3. Memória de longo prazo modulada pela memória de curto prazo

    Directory of Open Access Journals (Sweden)

    Viviane Moreira-Aguiar

    2008-01-01

    Full Text Available Quando um estímulo ocorre aleatoriamente à esquerda ou à direita, a resposta é mais rápida quando estímulo e resposta estão no mesmo lado (condição compatível do que em lados opostos (condição incompatível. Na tarefa de Simon, embora a resposta seja selecionada pela forma (ou cor do estímulo, a posição deste influencia o Tempo de Reação Manual (TRM. O efeito Simon corresponde à diferença entre as médias dos TRMs nas duas condições (incompatível e compatível. Neste trabalho, estudamos como uma tarefa prévia de compatibilidade realizada com um dedo indicador modula o efeito Simon. Vinte e oito voluntários realizaram uma tarefa de compatibilidade seguida pela tarefa de Simon. No grupo compatível (14 voluntários, encontramos um efeito Simon de 24 ms. No incompatível (14 voluntários, ocorreu um efeito Simon inverso de -16 ms. Estes resultados mostram uma modulação da memória de longo prazo por uma tarefa envolvendo a memória de curto prazo.

  4. Mecanismos e fatores associados aos sintomas gastrointestinais em pacientes com diabetes melito

    OpenAIRE

    Mônica Loureiro Celino Rodrigues; Maria Eugênia Farias Almeida Motta

    2012-01-01

    OBJETIVOS: Apresentar a frequência, os principais fatores causadores dos sintomas gastrointestinais em pacientes portadores do diabetes melito e controvérsias quanto à sua ocorrência em crianças e adolescentes. FONTES DOS DADOS: Revisão não sistemática nas bases de dados MEDLINE/PubMed e SciELO (1983-2011), além de capítulos de livros relevantes. Foram selecionados os artigos mais atuais e representativos do tema. SÍNTESE DOS DADOS: A prevalência do diabetes melito vem aumentando ao longo dos...

  5. Desfecho de Curto e Longo Prazo na Cardiomiopatia Induzida por Estresse: O que Podemos Esperar?

    Directory of Open Access Journals (Sweden)

    Vania Filipa Andrade Ribeiro

    2013-11-01

    Full Text Available Fundamento: A cardiomiopatia de estresse/Takotsubo (CT é uma entidade diagnóstica cada vez mais reconhecida. Objetivo: Este estudo teve como objetivo avaliar a prevalência e os preditores clínicos de complicações de curto e longo prazo de pacientes (pts com CT. Métodos: Foram incluídos todos os pts consecutivamente admitidos no nosso centro, entre novembro de 2006 e agosto de 2011, que preenchiam os critérios diagnósticos da Clínica Mayo. Resultados: Analisaram-se 37 pts (35 mulheres, com idade média de 63 ± 13 anos. A CT foi precipitada na maioria dos casos por eventos de estresse emocional (57% e dor torácica foi o sintoma de apresentação mais frequente (89%. O electrocardiograma na admissão mostrou supradesnivelamento do segmento ST em 12 pts (32% e inversão da onda T em 15 casos (41%. Verificou-se disfunção sistólica ventricular esquerda (VE grave em 16 pts (45% e a elevação média de troponina I foi de 2,6 ± 1,8 ng/mL. A taxa de complicações intra-hospitalares foi de 30%, sendo o choque cardiogênico a situação mais comum. O estresse físico, a disfunção sistólica grave do VE e o valor de pico do peptídeo natriurético cerebral (BNP foram preditores de complicações agudas. Não foi encontrada associação entre o pico de troponina I e a apresentação eletrocardiográfica. Trinta e cinco pacientes foram acompanhados por um tempo médio de 482 ± 512 dias, sem recorrência clínica. Conclusão: Na nossa série de pacientes, a CT foi associada a uma alta taxa de complicações intra-hospitalares. O estresse físico, a disfunção sistólica do VE e o valor de pico do BNP foram preditores de desfechos adversos agudos.

  6. Variabilidade óptica de longo período e precessão de jato: o caso de BL Lacertae

    Science.gov (United States)

    Caproni, A.; Abraham, Z.

    2003-08-01

    Variabilidade é tipicamente uma característica de AGNs, sendo observada em toda a faixa eletromagnética. Em relação às escalas de tempo, variações desde horas até de algumas décadas foram encontradas por vários autores. Em alguns casos, análises temporais de curvas de luz mostram a existência de periodicidade nas variações observadas. Um exemplo de objeto que preenche as características mencionadas acima é BL Lacertae, o protótipo da classe BL Lac dos AGNs. Neste trabalho, nós interpretamos a variabilidade periódica de longo período detectada na curva de luz na banda B (~7,5 anos) como o resultado da periodicidade na amplificação da radiação oriunda do jato relativístico. Neste cenário, a amplificação periódica seria induzida pela precessão, que muda o ângulo entre o jato e a linha de visada. Com esta abordagem e vínculos adicionais fornecidos por observações em altas energias, nós podemos impor limites para os parâmetros do modelo de precessão, tais como o fator de Lorentz associado ao movimento global do jato, o ângulo de abertura do cone de precessão e o ângulo entre o eixo do cone e a linha de visada.

  7. O custo da captação de recursos nas empresas e o processo decisório desta captação no curto e longo prazo: estudo de caso de empresa do ramo cerâmico de Santa Catarina

    OpenAIRE

    Volk, Sergio

    2008-01-01

    O estudo das decisões relacionadas à estrutura de capital no mercado brasileiro sempre motiva. Principalmente no Brasil onde, as dificuldades de captação de recurso de longo prazo no mercado financeiro muitas vezes levam as empresas ao endividamento a prazos mais curtos. Vários estudos e evidências empíricas têm demonstrado que as decisões de estrutura de capital podem afetar o valor das companhias no mercado, e avaliam a questão considerando as imperfeições no mercado, como im...

  8. Escala multidimensional aplicada aos estudos de apreciação musical

    Directory of Open Access Journals (Sweden)

    Raquel Cocenas da Silva

    2009-08-01

    Full Text Available A escala multidimensional (MDS provém de uma família de técnicas de análise de proximidade de dados, obtida por meio do julgamento do participante que compara vários estímulos em vários traços, concomitantemente. A análise dos julgamentos de proximidade produz um espaço em que pontos representam a relação entre os estímulos em um espaço euclidiano. O ordenamento dos estímulos ao longo das dimensões neste espaço permite que inferências possam ser feitas sobre o universo perceptual subjacente ao grupo de pesquisa. A literatura mostra que a MDS vem ampliando o estudo da música e a mensuração de suas propriedades estruturais.

  9. Contribuições ao dimensionamento de torres eólicas de concreto.

    OpenAIRE

    Paulo Vitor Calmon Nogueira da Gama

    2015-01-01

    O trabalho dedica-se ao estudo das torres eólicas protendidas de concreto, com a finalidade de promover a discussão sobre os critérios de dimensionamento, tema de grande relevância na atualidade. Para tal, foi considerada uma torre eólica de 100 m de altura provida de turbina de 5 MW, cujas ações foram obtidas da literatura. O carregamento de vento ao longo da torre foi tratado como estático equivalente de acordo com disposições normativas, através de uma forma simplificada para a adoção de u...

  10. Evolução histórica da teoria hermenêutica: do formalismo do século XVIII ao pós-positivismo

    Directory of Open Access Journals (Sweden)

    Sergio André Rocha

    2009-02-01

    Full Text Available O propósito deste estudo é a apresentação de considerações acerca de aspectos relevantes das principais escolas hermenêuticas que se sucederam ao longo dos dois últimos séculos, com vistas a formar uma compreensão de como se apresenta a questão da interpretação jurídica hodiernamente.

  11. Anemia e peso ao nascer Anemia and birthweight

    Directory of Open Access Journals (Sweden)

    Taqueco T Uchimura

    2003-08-01

    Full Text Available OBJETIVO: Verificar a influência do baixo peso ao nascer (BPN na anemia e desnutrição da criança, ao longo do primeiro ano de vida. MÉTODOS: A população amostral foi constituída por todas as crianças menores de um ano de idade atendidas nas unidades de saúde do Município de Maringá, PR, em 1998, num total de 587. Considerou-se baixo peso ao nascer, todas as crianças com peso OBJECTIVE: To verify the influence of Low Birthweight (LBW on child anemia and malnutrition during the first year of life. METHODS: Sample population included all children under one year seen at Health Units of the municipality of Maringá, southern Brazil, in 1998. Total sample size was 587 children. LBW was defined as birthweight below 2 500 g. The analysis of growth for the weigh-for-age and height-for-age indicators was based on NationalCenter for HealthSstatiscs standards. For anemia diagnosis, a biochemical hemoglobin concentration dosage, using HemoCue direct colorimetric method was employed. Children with [Hb] <11,0 g/dL were considered as anemic. RESULTS: Fifty-eight percent of the studied population were anemic, and 37 children (6.3% presented LBW. Anemia was more prevalent during the second semester of life (p=0.0093. Undernutrition, as indicated by the height-for-age indicator, was high especially for children aged 0-3 months with LBW. CONCLUSIONS: Although LBW rates among the studied population were similar to those of developed countries, we suggest the implementation of specific antenatal care for high-risk women, aiming at reducing LBW, an event that affects the child, hampering its growth and increasing the risk of anemia and its countless deleterious consequences.

  12. Morfologia e Crescimento dos 6 aos 10 anos de idade em Viana do Castelo, Portugal

    Directory of Open Access Journals (Sweden)

    Luis Paulo Rodrigues

    2008-09-01

    Full Text Available Ao longo de quatro anos, o Estudo Morfofuncional da Criança Vianense observou 1911 crianças entre os 6e os 10 anos de idade, resultando em 4064 observações individuais(2054 de raparigas, 2006 de rapazes.Os resultados encontrados nos indicadores morfológicos simples(altura, peso, pregas adiposas, diâmetros ósseos e perímetros muscularese no somatótipo, são descritos normativamente (valores percentílicose comparados com outros estudos nacionais e internacionais. As crianças vianenses demonstraram possuir uma estatura média ligeiramente superior às reportadas nos estudos portugueses e um ritmo de crescimento diferente das norte-americanas; peso semelhante ao das congéneres nacionais mas inferior ao das EUA; valores de pregas adiposas geralmente inferiores aos encontrados em Portugal e EUA; perímetros musculares e diâmetros ósseos semelhantes aos seus pares portugueses; e uma tendência para o aumento, com a idade, do ectomorfismo nos rapazes e do endomorfismo em ambos os sexos. Este panorama parece indicar que as crianças vianenses apresentam características de aptidão morfologia que estão longe de espelhar as preocupações internacionais nesta matéria.

  13. A estrutura do conhecimento nas universidades ocidentalizadas: racismo/sexismo epistêmico e os quatro genocídios/epistemicídios do longo século XVI

    Directory of Open Access Journals (Sweden)

    Ramón Grosfoguel

    2016-04-01

    Full Text Available Este artigo discute a estrutura epistêmica do mundo moderno em relação aos quatro genocídios/epistemicídios do longo século XVI (1450-1650. Argumenta-se que o privilégio epistêmico do homem ocidental foi construído às custas do genocídio/epistemicídios dos sujeitos coloniais. O artigo relaciona o racismo/sexismo epistêmico da estrutura das universidades ocidentalizadas e do mundo moderno ao genocídio/epistemicídio contra muçulmanos e judeus na conquista de Al-Andalus, contra povos nativos na conquista das Américas, contra povos africanos na conquista da África e a escravização dos mesmos nas Américas e, finalmente, contra as mulheres europeias queimadas vivas acusadas de bruxaria. Esses quatro genocídios/epistemicídios são fundantes da estrutura epistêmica moderno-colonial e das universidades ocidentalizadas. A tese principal deste artigo é que a condição de possibilidade para o cartesianismo idolátrico dos anos 1640 que assume o olho de Deus e arroga-se o direito de dizer "penso, logo existo" é o "extermino, logo existo".

  14. A mudança de paradigma em sociologia urbana: do paradigma ecológico ao socioespacial

    Directory of Open Access Journals (Sweden)

    Lucas Pizzolatto Konzen

    2011-01-01

    Full Text Available http://dx.doi.org/10.5007/2178-4582.2011v45n1p79 O artigo discute a mudança do paradigma ecológico ao socioespacial na so ciologia urbana, ocorrida nos países centrais do capitalismo ao longo das décadas de 1970 e 1980. Os dois paradigmas são descritos em suas feições principais, ao que se segue uma análise específica das obras dos três autores que lideraram a mudança de paradigma: Henri Lefebvre, Manuel Castells e David Harvey. A análise referencia-se teoricamente na contribuição de Thomas Kuhn à sociologia do conhecimento.

  15. Exercício físico como fator de prevenção aos processos inflamatórios decorrentes do envelhecimento

    OpenAIRE

    Brito,Ciro José; Volp,Ana Carolina Pinheiro; Nóbrega,Otávio de Toledo; Silva Júnior,Fernando Lopes e; Mendes,Edmar Lacerda; Roas,Aendria Fernanda Castro Martins; Barros,Jonatas de França; Córdova,Cláudio

    2011-01-01

    Ao longo do processo de envelhecimento observa-se complexa remodelagem do sistema imunitário. Estas alterações estão associadas ao desenvolvimento de patologias responsáveis por grande parte da mortalidade em população idosa. Recentemente, a prática regular de atividades físicas tem sido proposta como intervenção não-medicamentosa com amplos benefícios sobre a regulação de processos decorrentes da imunossenescênia. Neste sentido, o presente trabalho revisou e discutiu estudos que abordam a aç...

  16. Retinosquise juvenil ligada ao X

    Directory of Open Access Journals (Sweden)

    Cesar Gomes da Silveira

    2015-08-01

    Full Text Available RESUMO Relatar o caso de um paciente masculino de 28 anos que foi encaminhado ao Centro de Estudos e Pesquisas Oculistas Associados (RJ para avaliação de retina e apresentou os achados típicos de retinosquise juvenil ligada ao cromossomo X: maculopatia cistóide com formação de cistos na fóvea e retinosquise periférica. Foi realizado o manejo conservador, com atenção para as complicações.

  17. Monitoramento em longo prazo da contenção vegetativa em talude rodoviário de saprolito de gnaisse em Minas Gerais

    Directory of Open Access Journals (Sweden)

    Rosilene Einloft

    2013-02-01

    Full Text Available A sucessão de eventos após a revegetação de uma área, em geral, não é estudada. Com o passar do tempo, um consórcio vegetal que se apresentou favorável na fase inicial pode não ser adequado no futuro, deixando a área com o solo descoberto e suscetível à ação dos fatores intempéricos. O objetivo deste trabalho foi monitorar características associadas à contenção vegetativa e, em longo prazo, o surgimento de novas formas de cobertura ou exposição do solo em resposta à revegetação com gramíneas e leguminosas em talude rodoviário de declividade acentuada. Após quatro anos, foi observada, nas parcelas experimentais, a presença de novas formas de cobertura ou exposição do solo, denominadas tipologias, como: cobertura de braquiária, leguminosa, capim-gordura, espécies invasoras, biomanta, resíduos em decomposição, crostas microfíticas, crosta física, solo exposto, erosão e afloramento de rochas. Essas tipologias foram quantificadas em dois levantamentos: antes e após o período chuvoso. Foram confeccionados mapas de cobertura para cada parcela experimental e analisadas a dinâmica, distribuição espacial, frequência e competição entre as tipologias encontradas nos dois levantamentos. Das 11 tipologias encontradas, as espécies vegetais e as crostas microfíticas foram as mais importantes no estádio primário da sucessão ecológica, resultando em rápida estabilização e recuperação da superfície degradada e favorecendo o aparecimento de espécies invasoras. A variação sazonal entre os dois levantamentos levou à diminuição da erosão e ao solo exposto, pelo incremento da cobertura vegetal e das crostas microfíticas.

  18. Análise em longo prazo na síndrome coronariana aguda: existem diferenças na morbimortalidade?

    Directory of Open Access Journals (Sweden)

    Adolfo Alexandre Farah de Aguiar

    Full Text Available FUNDAMENTO: A insuficiência cardíaca (IC tem grande importância como preditor de morbimortalidade em pacientes com síndrome coronariana aguda (SCA. OBJETIVO: Avaliar os preditores de morbimortalidade na SCA em longo prazo. MÉTODOS: Foi um estudo de coorte de 403 pacientes consecutivos com queixas de dor torácica. Descreveram-se dados demográficos, clínicos, laboratoriais e terapêuticos, sendo avaliados durante a internação e até oito anos após alta, em relação à presença ou ausência de eventos cardiovasculares e óbitos. RESULTADOS: Foram 403 pacientes com queixas de dor torácica, em que 65,8% apresentavam diagnóstico de SCA sem supra de ST, 27,8% SCA com supra de ST e 6,5% sem SCA. Destes, foram avaliados os 377 pacientes com SCA, em que 37,9% eram do sexo feminino, e a média de idade foi de 62,2 ± 11,6 anos. A presença de IC antes ou durante a hospitalização influenciou a mortalidade. Dos fatores prognósticos, a creatinina inicial merece destaque, sendo o ponto de corte de 1,4 mg/dl (acurácia = 62,1%; HR = 3,27; p < 0,001. Notamos pior prognóstico para cada acréscimo de dez anos de idade (HR = 1,37; p < 0,001 e para cada incremento de 10 bpm na frequência cardíaca (HR = 1,22 p < 0,001. Quanto às terapias utilizadas antes e após 2002, houve aumento de uso de betabloqueadores, inibidores da enzima conversora da angiotensina (IECAs, estatinas e antiplaquetários, tendo impacto na mortalidade. CONCLUSÃO: Presença de IC admissional, creatinina, idade e FC foram preditores independentes de mortalidade. Observou-se que pacientes com IC atendidos antes de 2002 apresentaram pior sobrevida em relação aos atendidos após 2002 e que a mudança na terapia foi a responsável por isso.

  19. MEMS AO for Planet Finding

    Science.gov (United States)

    Rao, Shanti; Wallace, J. Kent; Shao, Mike; Schmidtlin, Edouard; Levine, B. Martin; Samuele, Rocco; Lane, Benjamin; Chakrabarti, Supriya; Cook, Timothy; Hicks, Brian; hide

    2008-01-01

    This slide presentation reviews a method for planet finding using microelectromechanical systems (MEMS) Adaptive Optics (AO). The use of a deformable mirror (DM) is described as a part of the instrument that was designed with a nulling interferometer. The strategy that is used is described in detail.

  20. Das portarias aos bloquinhos: arte e apoio institucional ao Projeto Mais Médicos para o Brasil

    Directory of Open Access Journals (Sweden)

    Heloísa Germany

    Full Text Available Este ensaio apresenta experiências vivenciadas por uma artista visual integrante da equipe de Apoio Institucional do Ministério da Educação para o Projeto Mais Médicos para o Brasil (PMMB, uma proposta interministerial que aproxima de forma significativa processos de trabalho e formação relacionados à saúde e à educação. Por meio do que Roland Barthes chama de obtuso e por meio de uma metodologia hifográfica, investe-se na leveza e reinvenção de ações no campo da Saúde Coletiva na interface das artes como processos educativos sensíveis experimentados ao longo de dois anos junto com o PMMB. Por meio de pequenos blocos de anotações produzidos individualmente e por um coletivo de apoiadores, delineia-se um processo singular e sensível, contribuindo na discussão sobre o fortalecimento das coletividades, das redes de Atenção Básica, da formação para o Sistema Único de Saúde e da composição de olhares poético-políticos acerca do PMMB.

  1. Desenvolvimento e avaliação de equipamento de tração, para redução de fraturas de ossos longos de cães

    Directory of Open Access Journals (Sweden)

    E.A. Tudury

    Full Text Available RESUMO Fraturas costumam ocorrer com encavalgamento das extremidades ósseas, dificultando, assim, sua redução. Esta pesquisa teve como objetivo desenvolver um equipamento de tração esquelética a ser utilizado em caninos acometidos de fraturas de ossos longos. Foram utilizados 21 cães de raças variadas, pesando entre dois e 27kg, com idade entre dois meses e 11 anos, com fraturas diafisárias ou metafisárias ocorridas entre três e 24 dias. Enquanto a fixação do corpo do paciente à mesa foi efetuada com cintas de náilon, a força de tração aplicada ao longo do eixo ósseo do membro fraturado foi realizada mediante cintas de náilon ou pinos transfixados e estribos (sendo os pinos implantados na epífise distal do osso fraturado, com a força de tração medida por um dinamômetro, não sendo aplicada carga maior que 25kg. Em todos os casos, a força de tração iniciava com o valor de cinco quilogramas, exceto em animais com peso inferior a esta, a qual começava com carga equivalente a esse peso; e em todos, se necessário, era aumentada a cada cinco minutos para se manter tração igual ao peso ou aos valores que oscilavam do seu peso até cinco quilogramas, dependendo do tamanho do animal, até se atingir a tração necessária para se proceder à redução. Para essa progressão de distensão, o equipamento possuía haste rosqueada de 25mm de diâmetro, uma porca com sistema timão e cilindro deslizante por fora da haste, este conectado ao animal por uma corrente, e o dinamômetro. Todos os animais tiveram as fraturas reduzidas sem haver perda óssea, o que evidencia que o aparelho se mostrou eficiente tanto na redução como na manutenção da redução da fratura, e eles não apresentaram, no pós-operatório, sinais de prejuízos neurológicos, vasculares, cutâneos e articulares. O distensor ósseo aqui desenvolvido tem como características: ser de simples confecção, ter baixo custo, não gerar danos ao paciente e

  2. Adesão ao Tratamento em Gestação de Alto Risco

    Directory of Open Access Journals (Sweden)

    Fabíola Langaro

    Full Text Available No Brasil, aproximadamente 15% das gestações são de alto risco, sendo os diagnósticos de diabetes gestacional e hipertensão as causas mais frequentes dessa condição. Para a efetividade dos tratamentos indicados nesses casos, bem como alcance de desfechos favoráveis, é essencial a adesão da paciente às recomendações fornecidas pelas equipes de saúde, o que torna fundamental a avaliação desse indicador. A pesquisa apresentada avaliou a adesão de participantes de um programa de atendimento interdisciplinar a gestantes de alto risco desenvolvido em um hospital geral privado por meio de três instrumentos: Questionário Morisky-Green de adesão ao uso de medicação, Questionário de Adesão ao Tratamento e Pergunta descritiva de avaliação qualitativa. Durante oito meses, 83 gestantes responderam aos questionários, que possibilitaram identificar níveis de adesão ao longo do tempo de participação no programa, situações de não adesão mais frequentes, bem como variáveis que interferem nas medidas de adesão ao uso de medicação e ao tratamento global. Considera-se que os índices levantados são passíveis de uso como indicadores clínicos e gerenciais, possibilitando a comprovação da efetividade e melhoria constante das rotinas de saúde. Tais mecanismos são úteis para definição de protocolos, discussão de casos clínicos e mesmo para feedbackàs próprias pacientes.

  3. REALIDADE AUMENTADA APLICADA AO DESIGN

    OpenAIRE

    Fernandes, Bruno Chagas Alves; Sánchez, Joaquín Fernández

    2008-01-01

    Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  4. Realidade aumentada aplicada ao design

    OpenAIRE

    Fernández Sánchez, Joaquín

    2008-01-01

    Este artigo apresenta o estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  5. Cometas: Das Lendas aos Fatos

    Science.gov (United States)

    Voelzke, M. R.

    O descobrimento de cometas, devido ao seu aparecimento espetacular, tem registro nas mais antigas culturas humanas. A primeira referência situa-se no ano de 1095 antes de Cristo [a.C.; HO; HO, 1962]. A quantidade de registros de descobrimentos cometários, principalmente provenientes do território chinês em particular e do oriente em geral, aumentou gradualmente a partir do quarto século depois de Cristo (d.C.). É de origem chinesa a primeira referência ao cometa P/Halley no ano de 240 a.C. [VOELZKE, 1993]. Com o desenvolvimento da astronomia relativamente às técnicas observacionais os descobrimentos bem como as observações cometárias aumentaram sensivelmente a partir do século XVII, sendo que a partir do século XIX um novo incremento ocorreu devido ao emprego da fotografia e a resultante melhora de sensibilidade na observação.

  6. AoS28D, a proline-Xaa carboxypeptidase secreted by Aspergillus oryzae.

    Science.gov (United States)

    Salamin, Karine; Eugster, Philippe J; Jousson, Olivier; Waridel, Patrice; Grouzmann, Eric; Monod, Michel

    2017-05-01

    Prolyl peptidases of the MEROPS S28 family are of particular interest because they are key enzymes in the digestion of proline-rich peptides. A BLAST analysis of the Aspergillus oryzae genome revealed sequences coding for four proteases of the S28 family. Three of these proteases, AoS28A, AoS28B, and AoS28C, were previously characterized as acidic prolyl endopeptidases. The fourth protease, AoS28D, showed high sequence divergence with other S28 proteases and belongs to a phylogenetically distinct cluster together with orthologous proteases from other Aspergillus species. The objective of the present paper was to characterize AoS28D protease in terms of substrate specificity and activity. AoS28D produced by gene overexpression in A. oryzae and in Pichia pastoris was a 70-kDa glycoprotein with a 10-kDa sugar moiety. In contrast with other S28 proteases, AoS28D did not hydrolyze internal Pro-Xaa bonds of several tested peptides. Similarly, to human lysosomal Pro-Xaa carboxypeptidase, AoS28D demonstrated selectivity for cleaving C-terminal Pro-Xaa bonds which are resistant to carboxypeptidases of the S10 family concomitantly secreted by A. oryzae. Therefore, AoS28D could act in synergy with these enzymes during sequential degradation of a peptide from its C-terminus.

  7. REALIDADE AUMENTADA APLICADA AO DESIGN

    Directory of Open Access Journals (Sweden)

    Bruno Chagas Alves Fernandes

    2008-07-01

    Full Text Available Este artigo apresenta o atual estado da arte da Realidade Aumentada aplicada ao design. São apresentados exemplos de aplicações da Realidade Aumentada em áreas como design de produtos, arquitetura, indústria automotiva, educação e design colaborativo. Também é apresentada uma rápida visão geral sobre as tecnologias envolvidas na criação de aplicações de Realidade Aumentada.

  8. Limites e garantias do direito ao sigilo bancário em face da gestão de recursos públicos

    OpenAIRE

    Padilha Rebelo Marques, Karla

    2005-01-01

    A presente dissertação tem por escopo analisar o direito ao sigilo bancário sob diversos enfoques, situando-o ao longo da história da civilização mundial, demarcando-se, assim, sua íntima relação com a evolução do comércio, ainda antes de qualquer desenvolvimento de idéias relacionadas aos direitos da intimidade ou privacidade, típicos do pensamento liberal. Buscou-se, ainda, enfatizar a problemática da distinção entre o público e o privado no desenvolvimento do Estado brasilei...

  9. Efeitos a curto e longo prazo de um grupo de desenvolvimento de habilidades sociais para universitários

    Directory of Open Access Journals (Sweden)

    Vinicius Santos Ferreira

    Full Text Available Apesar da introdução na atuação comunitária de práticas baseadas em evidências, sabemos pouco sobre a eficácia das intervenções fora de contextos de pesquisa. A área dos treinamentos de habilidades sociais carece de estudos em settings de mundo real, com números suficientes de participantes e follow-up. Investigou-se, em 34 universitários, o efeito a curto e longo prazo de um grupo de treinamento de habilidades sociais, num contexto de mundo real. Escores de habilidades sociais (IHS e ansiedade (IDATE foram verificados antes, depois da intervenção e após um intervalo de follow up. Os escores em ambos os testes melhoraram do pré-teste para o pós-teste, e se mantiveram estáveis do pós-teste para o follow-up no intervalo de três meses a cinco anos.

  10. Teófilo Braga e Adolfo Coelho: duas posições face aos irmãos Grimm e à colecção Kinder-und Hausmärchen

    OpenAIRE

    Cortez, Maria Teresa

    2001-01-01

    No presente artigo pretendo documentar as diferentes posições assumidas pelos dois fundadores do movimento etnográfico português, Teófilo Braga (1843-1924) e Adolfo Coelho (1847-1919), face ao trabalho de investigação e recolha de contos populares alemães realizado pelos Irmãos Grimm. Ao longo da sua obra, Teófilo Braga testemunhou repetidamente uma enorme admiração pelos Irmãos Grimm, muito em especial por Jacob, cujo exemplo procurou seguir. Teófilo Braga orientou-se na sua pesquisa pela...

  11. Resultados preliminares de la hemorroidectomía circular mecánica según técnica de Longo Preliminary results of circular mechanical hemorrhoidectomy according to Longo's technique

    Directory of Open Access Journals (Sweden)

    Francisco Menárguez Pina

    2008-06-01

    Full Text Available INTRODUCCIÓN. La mucosectomía circunferencial con máquina de autosutura descrita por Longo como técnica para el tratamiento de las hemorroides de grado III y IV se ha extendido en los últimos años. El objetivo del presente estudio es analizar los resultados preliminares obtenidos con esta técnica. MÉTODOS. Durante un período de 16 meses fueron intervenidos 50 pacientes con patología hemorroidal sintomática de grado III-IV, y se analizó el tiempo quirúrgico y las complicaciones posoperatorias. Para la medición del dolor se recurrió a una escala analógica visual. RESULTADOS. El tiempo quirúrgico medio fue de 22 min y la estancia media postoperatoria de 2,3 días. Entre las complicaciones posoperatorias, se registraron 2 pacientes (4 % reintervenidos por sangrado y 4 pacientes (8 % precisaron sondaje vesical por retención urinaria. La intensidad del dolor en el primer día posoperatorio fue: intenso en 6 pacientes (12 %, medio en 10 (20 %, leve en 30 (60 % y nulo en los 4 restantes (8 %. Durante el tiempo de seguimiento ningún paciente ha referido incontinencia postoperatoria, ni se ha encontrado estenosis en la línea de grapado. CONCLUSIONES. Nuestra experiencia a corto plazo ha sido satisfactoria. Es una técnica sencilla y segura, con una curva de aprendizaje corta. La principal complicación postoperatoria, el dolor, se comportó de forma similar a lo que han publicado otros autores y fue fácilmente controlado con antiinflamatorios no esteroideos. Sin embargo, es necesario un seguimiento a largo plazo para la valoración de complicaciones tardías, tales como la estenosis y la recurrencia de los síntomas hemorroidales.INTRODUCTION. Circumferencial mucosectomy with autosuture stapler described by Longo as a technique for treating grade III and IV hemorrhoids have extended in the last years. The objective of the present study was to analyze the preliminary results obtained with this technique. METHODS. 50 patients with grade

  12. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-12-01

    Full Text Available http://dx.doi.org/10.5007/1984-784X.2013v13n19p13 Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube.   Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  13. Como responder ao momento presente?

    Directory of Open Access Journals (Sweden)

    Maria Filomena Molder

    2013-06-01

    Full Text Available Foi com esta pergunta — já um efeito de um primeiro encontro entre Irene Pimentel e eu própria — que decidimos desafiar colegas, estudantes e funci­onários da nossa Faculdade, FCSH (Faculdade de Ciências Sociais e Huma­nas, de outras Faculdades da Universidade Nova de Lisboa, de outras Uni­versidades e todos os interessados em con­siderar e discutir em comum aquilo que se passava em Portugal e que no anúncio da Jornada de 6 de De­zembro de 2012 se descrevia como um “processo de desmantela­mento social, económico e cultural sem precedentes — pese embora tantas compara­ções, baseadas na premissa da ‘eterna repetição’ — e cujas consequências não param de exceder as previsões dos responsáveis por esse desmantelamento”. Acedendo com todo o empenho e gratidão ao convite que me foi dirigido por Humberto Brito para fazer uma resenha da Jornada a publicar no primeiro número de Forma de Vida (saúdo a revista e o título, decidi-me, no entanto, a pôr de lado a resenha, que sob a forma de “Editorial” será em breve publi­cada no blogue Responder ao Momento Presente, entre­tanto criado, conjuntamente com os textos escritos pelos nossos convidados, com as parti­cipações de pessoas que corresponderam ao nosso apelo e ainda com contri­bui­ções que se alargaram para lá da Jornada; a que se juntará uma gravação em video, também disponível no Youtube. Texto publicado originalmente em Forma de Vida, Lisboa, n.1, fev. 2013. Agrade­cemos à autora por permitir a republicação neste número do Boletim. [N.E.

  14. Astigmatismo induzido na cirurgia extracapsular da catarata: acompanhamento a longo prazo Induced astigmatism in extracapsular cataract extraction: long-term follow-up

    Directory of Open Access Journals (Sweden)

    Almir Ghiaroni

    2004-02-01

    Full Text Available OBJETIVO: Estudar o comportamento do astigmatismo induzido a longo prazo em uma série de pacientes submetidos à cirurgia extracapsular da catarata, nos quais foi utilizada incisão límbica posterior superior suturada com pontos separados de mononylon 10-0. MÉTODOS: Foram estudados 38 olhos, de 35 pacientes, sendo 21 do sexo feminino e 14 do sexo masculino, com idades variando entre 47 e 85 anos (média = 70,17 anos. Todos os casos foram operados pelo mesmo cirurgião. O período de acompanhamento pós-operatório variou de 15 a 33 meses (média = 22,07 meses. Nenhum dos casos teve qualquer dos pontos seccionado ou removido. Todos os pacientes atingiram acuidade visual corrigida igual ou superior a 0,5. Para o cálculo do astigmatismo induzido foram consideradas as medidas ceratométricas pré e pós-operatórias e foi utilizado um programa desenvolvido por Jaffe. RESULTADOS: O astigmatismo induzido variou de 0,13 dioptria (D a 2,74 D (média = 1,19 D. Em relação aos eixos, na maioria dos casos houve indução de astigmatismo a favor da regra (60,52%. Foi observada mudança significativa no valor dióptrico do astigmatismo quando foram comparadas as leituras ceratométricas registradas pré-operatoriamente até a segunda semana pós-operatória, entre o primeiro e o terceiro meses pós-operatórios, entre o terceiro e o sexto meses pós-operatórios e após o décimo-segundo mês pós-operatório. CONCLUSÃO: Quando o mononylon 10-0 é utilizado como material de sutura na cirurgia extracapsular da catarata, os valores de astigmatismo a favor da regra inicialmente observados tendem a diminuir com o tempo.PURPOSE: To study the long-term behavior of induced astigmatism in a series of patients who underwent extracapsular extraction in which a superoposterior limbal incision sutured with interrupted 10-0 mononylon sutures was performed. METHODS: 38 eyes of 35 patients were studied, 21 females and 17 males, with ages varying from 47 to 85 year

  15. Cocleostomia transcanal: resultados em longo prazo de um estudo de coorte Transcanal cochleostomy in cochlear implant surgery: long-term results of a cohort study

    Directory of Open Access Journals (Sweden)

    Michelle Lavinsky-Wolff

    2012-04-01

    Full Text Available A técnica de acesso combinado (TAC ao implante coclear (IC é uma variação da técnica clássica de mastoidectomia e timpanotomia posterior (MPTA. A TAC combina um acesso transcanal à cocleostomia com uma timpanotomia posterior reduzida para a inserção dos eletrodos. OBJETIVO: Avaliar e comparar a segurança e efetividade em longo prazo alcançados com a TAC e MPTA em pacientes submetidos a IC em um centro brasileiro. Desenho científico: Estudo de série. MATERIAL E MÉTODO: Pacientes submetidos a IC usando TAC e MPTA foram acompanhados em um estudo de coorte. Os desfechos avaliados foram complicações, avaliação audiométrica e radiológica pós-operatórias. RESULTADOS: Quarenta e quatro pacientes foram implantados usando a TAC e 31 usando MPTA. Não houve casos de paralisia facial, mastoidite, colesteatoma ou fístula após 3,4±1,0 anos. A avaliação radiológica da posição dos eletrodos a mediana de eletrodos fora da cóclea foi de 0 no grupo TAC e de 3 no MPTA (p The combined approach technique (CAT is a variation of the classical the mastoidectomy-posterior tympanotomy technique (MPTA that combines a transcanal approach to cochleostomy with a reduced posterior tympanotomy for insertion of electrodes. AIM: To compare and evaluate long-term safety and effectiveness outcomes obtained with the CAT and with MPTA approach in patients submitted to cochlear implant (CI surgery. Design: series study. METHODS: Patients who underwent CI using CAT or MPTA at a Brazilian center were followed in a cohort study. Main outcomes were complications,audiometric performance and radiological evaluation of electrode position. RESULTS: Fourty-four patients were implanted using CAT and 31 MPTA. There were no cases of facial nerve paralysis, mastoiditis, cholesteatoma or cerebrospinal fluid leaks after 3.4±1.0 years. Radiological evaluation of electrode position revealed that the median number of electrodes outside the cochlea was 0 in CAT and 3 in

  16. Aerosol Observing System (AOS) Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Jefferson, A

    2011-01-17

    The Aerosol Observing System (AOS) is a suite of in situ surface measurements of aerosol optical and cloud-forming properties. The instruments measure aerosol properties that influence the earth’s radiative balance. The primary optical measurements are those of the aerosol scattering and absorption coefficients as a function of particle size and radiation wavelength and cloud condensation nuclei (CCN) measurements as a function of percent supersaturation. Additional measurements include those of the particle number concentration and scattering hygroscopic growth. Aerosol optical measurements are useful for calculating parameters used in radiative forcing calculations such as the aerosol single-scattering albedo, asymmetry parameter, mass scattering efficiency, and hygroscopic growth. CCN measurements are important in cloud microphysical models to predict droplet formation.

  17. Sensibilizando as enfermeiras para o cuidado transpessoal no atendimento aos portadores de HIV e doenças de AIDS : relato de experiência

    OpenAIRE

    Kohlrausch, Eglê Rejane

    1999-01-01

    O presente trabalho descreve a experiência do uso de oficinas de saúde como recurso para sensibilizar as enfermeiras que cuidam de portadores de HIV e doentes de AIDS no desenvolvimento de um cuidado humanizado a sua clientela, tendo como marco referencial a Teoria do Cuidado Transpessoal de Jean Watson. Para tanto, parte-se de reflexões feitas ao longo da trajetória profissional para fundamentar a importância do uso dessa abordagem. Através da problematização se descreve uma experiência dese...

  18. REPRESENTAÇÕES MATERNAS NO CONTEXTO DO HIV: GESTAÇÃO AO SEGUNDO ANO DA CRIANÇA

    Directory of Open Access Journals (Sweden)

    Evelise Rigoni Faria

    2016-05-01

    Full Text Available O estudo investigou a relação mãe-bebê no contexto do HIV, da gestação ao segundo ano da criança, a partir das representações maternas. Participaram quatro mães soropositivas, entre 19 e 39 anos, entrevistadas na gestação e aos 3, 12 e 24 meses da criança. Análise de conteúdo qualitativa examinou os relatos maternos com base em duas categorias de representações: sobre si mesma e sobre o bebê. Os resultados indicaram que a relação mãe-bebê foi acompanhada de satisfações e desafios associados à maternidade, ao desenvolvimento infantil e à convivência com HIV. As representações sugeriram, inicialmente, um bebê vulnerável e uma mãe com sentimentos de culpa, temendo o preconceito e o estigma associado à infecção. Ao longo do tempo, as representações indicaram uma criança fortalecida e uma mãe mais segura frente à infecção e à maternidade. Preocupações com o HIV foram menos enfatizadas diante dos desafios impostos pelo desenvolvimento infantil, sobretudo entre mães que aceitavam o diagnóstico e focavam o seu enfrentamento.

  19. CONTRIBUIÇÃO AO ESTUDO ANATÔMICO DA FOLHA E DO CAULE DO CACAUEIRO (Theobroma cacao L.

    Directory of Open Access Journals (Sweden)

    NAKAYAMA L.H.I

    1996-01-01

    Full Text Available O presente estudo teve como objetivo descrever a anatomia da folha e do caule adulto enfatizando a caracterização dos tricomas e das estruturas secretoras do cacaueiro. Foram analisadas amostras de caule e folhas (limbo e pecíolo, correspondente ao 3º nó, além de folhas novas de 5cm de comprimento. A lâmina foliar é hipoestomática, com estômatos do tipo anomocítico. Em ambas as faces do limbo ocorrem quatro tipos de tricomas: sendo dois tectores e dois glandulares. Na epiderme adaxial estão presentes as glândulas secretoras de mucilagem. O mesofilo é dorsiventral; o parênquima paliçádico é formado por duas ou três camadas. O parênquima lacunoso apresenta células coletoras. Ao longo do mesofilo predomina feixes colaterais envolvidos por bainha esclerenquimática que se estende até as epidermes. O padrão de venação é do tipo Camptodroma com ramificações mistas Brochidrodomas e Eucamptodromos. O pecíolo e o caule apresentam a epiderme com os tricomas descritos para o limbo; No parênquima cortical e medular do pecíolo e caule, há células contendo grãos de amido, idioblastos contendo drusas e canais de mucilagem. O sistema vascular ao longo do pecíolo se diferencia quanto a organização. O caule apresenta camadas de clorênquima, e de colênquima. Ocorre a esclerificação das células deste último, com o desenvolvimento. Segue-se um anel descontínuo de fibras do floema primário. A medula é ampla e se esclerifica com o desenvolvimento.

  20. Diagnosis of AOS: definition and criteria.

    Science.gov (United States)

    Croot, Karen

    2002-11-01

    Presented in this article is a discussion of current progress in behavioral, cognitive, and neuroanatomic definitions of apraxia of speech (AOS). A behavioral definition summarizes the speech symptoms that should be considered diagnostic of AOS with or without co-occurring aphasia and dysarthria. AOS is defined in cognitive terms as an impairment in the translation of phonological representations into specifications for articulation. Progress toward a neuroanatomic definition of AOS will rely on mapping the processes described by increasingly sophisticated cognitive models of normal speech production to the brain. The article describes criteria that have been proposed for differentiating apraxic from phonological and dysarthric disorders and suggests that syndrome-based approaches to the diagnosis of AOS may obscure important differences between individual presentations of apraxic disruption as well as similarities between AOS and other speech-language disorders.

  1. Valvoplastia sem suporte para insuficiência mitral degenerativa: resultados a longo prazo Unsupported valvuloplasty for degenerative mitral regurgitation: long-term results

    Directory of Open Access Journals (Sweden)

    Alexsandra L. Balbinot

    2008-06-01

    Full Text Available FUNDAMENTO: As vantagens do reparo valvar para tratamento de insuficiência mitral degenerativa estão bem estabelecidas. O procedimento está associado com baixas taxas de morbimortalidade, e foram relatados baixos índices de reoperação, eventos tromboembólicos e endocardite. Na maior parte das séries, são implantados anéis para anuloplastia, mas algumas instituições preferem valvoplastia sem suporte. OBJETIVO: Avaliar a evolução clínica de pacientes submetidos à valvoplastia sem suporte para tratamento de insuficiência mitral degenerativa. MÉTODOS: Entre janeiro de 1980 e janeiro de 2003, 116 pacientes foram submetidos ao procedimento. Sessenta e dois (53,4% eram do sexo masculino, e a media de idade era 47,2 ± 16,5 anos. Os procedimentos empregados foram: Anuloplastia tipo Wooler (65,5%, anuloplastia unilateral (15,5%, ressecção quadrangular da cúspide posterior (35,3%, encurtamento de corda tendínea anterior (20,7%, encurtamento de corda tendínea posterior (6,9% e desbridamento do cálcio (0,9%. O período médio de acompanhamento foi de 6,5 ± 5,1, e o acompanhamento mais longo foi de 24 anos. RESULTADOS: A mortalidade precoce foi de 0,86% (1 paciente, e a mortalidade tardia foi de 6,03% (7 pacientes. A sobrevida atuarial foi de 85,3% em vinte anos. A maioria dos pacientes (55,2% apresentava classe funcional III no período pré-operatório, enquanto no período pós-operatório a classe funcional I foi mais freqüente (66,4%. Quatro pacientes (3,4% tiveram complicações tromboembólicas, e não foi observada correlação com fibrilação atrial. A sobrevida livre de eventos tromboembólicos foi de 94,8%, e resultados semelhantes foram observados para endocardite bacteriana. A sobrevida livre de reoperação foi de 79% e 53% aos 5 e 10 anos, respectivamente. CONCLUSÃO: Valvoplastia sem suporte é um procedimento eficaz e seguro para tratamento de insuficiência mitral degenerativa, representando uma alternativa terap

  2. Mecanismos e fatores associados aos sintomas gastrointestinais em pacientes com diabetes melito

    Directory of Open Access Journals (Sweden)

    Mônica Loureiro Celino Rodrigues

    2012-02-01

    Full Text Available OBJETIVOS: Apresentar a frequência, os principais fatores causadores dos sintomas gastrointestinais em pacientes portadores do diabetes melito e controvérsias quanto à sua ocorrência em crianças e adolescentes. FONTES DOS DADOS: Revisão não sistemática nas bases de dados MEDLINE/PubMed e SciELO (1983-2011, além de capítulos de livros relevantes. Foram selecionados os artigos mais atuais e representativos do tema. SÍNTESE DOS DADOS: A prevalência do diabetes melito vem aumentando ao longo dos anos em vários países do mundo. No sistema digestório, é conhecida a ocorrência de complicações do diabetes melito, entre elas os sintomas gastrointestinais (náuseas, vômitos, dor abdominal, azia, disfagia, constipação, diarreia e incontinência fecal. A patogênese das alterações das funções gastrointestinais no diabetes melito está ainda sob investigação, e o papel do sistema nervoso entérico e seus neurotransmissores tem ganhado significância. Em decorrência do comprometimento do sistema digestório, com danos ao sistema nervoso entérico, portadores do diabetes melito podem apresentar quadros específicos de distúrbios de motilidade, alguns de grande relevância clínica, como gastroparesia diabética, constipação e diarreia. A disfunção deste sistema contribui para aumentar a morbidade desta doença e piora a qualidade de vida de seus portadores. CONCLUSÕES: O diabetes melito, ao longo dos anos, afeta o sistema digestório. Por ser uma condição que piora a qualidade de vida dos portadores e também pode indicar complicação da doença, deve ser valorizada no acompanhamento e tratamento do paciente com diabetes melito. Na infância e na adolescência, ainda existem poucos estudos que abordam o problema.

  3. Do encanto ao encontro de vozes afro-brasileiras na tradição oral

    Directory of Open Access Journals (Sweden)

    Josiley Francisco de Souza

    2010-12-01

    Full Text Available Ao longo da história, é possível perceber que, em todas as sociedades, a arte de contar sempre fez parte da nossa vida e garantiu a manutenção de memórias e saberes transmitidos no tecido das narrativas. Um dos lugares onde essa arte se faz presente com vigor é a África. As tradições orais têm sido apontadas por diversos pesquisadores como um traço distintivo da cultura africana. E, no exercício dessa arte, é possível ouvir diálogos e ressonâncias entre vozes africanas e brasileiras. Por intermédio de uma arte marcada pelo exercício do contar de novo, percebe-se contatos entre vozes que não se calam, que se traduzem e se inscrevem em histórias que se transmitem de boca a ouvido e da letra ao verbo. Portanto, o que se pretende neste artigo é, no processo de intensos entrecruzamentos de vozes e culturas que permeiam a tradição oral, analisar diálogos e ressonâncias transtextuais entre contos orais registrados no Brasil e em Angola.Palavras-chave: Tradição; Arte de contar; Conto oral; Memória; África; Brasil; Chatelain.

  4. Taxa de câmbio, poupança e produtividade: impactos de curto e longo prazo Exchange rates, savings and productivity: short and long-term impacts

    Directory of Open Access Journals (Sweden)

    Paulo Gala

    2011-08-01

    Full Text Available O trabalho tem por objetivo analisar, sob o ponto de vista teórico, a relação entre nível da taxa de câmbio e desenvolvimento econômico. A hipótese principal segue a literatura de "doença holandesa" e baseia-se na ideia de que câmbios competitivos contribuem para a formação e manutenção do setor manufatureiro da economia. A existência de retornos crescentes nesse setor influencia fortemente o aumento da produtividade no longo prazo. Discute-se, também, como a manutenção de uma taxa de câmbio competitiva poderá estimular a formação de poupança doméstica ao evitar aumentos artificiais do salário real pela via da sobrevalorização cambial.The objective of this paper is to analyze, from a theoretical point of view, the relation between real exchange rates and economic development. The main hypothesis is very much in line with the Dutch disease literature and states that competitive currencies contribute to the existence and maintenance of the manufacturing sector in the economy. This, in turn, brings about higher growth rates in the long run, given the existence of increasing returns in the industrial sector and its importance in generating technological change and increasing productivity in the overall economy. We also show from a theoretical perspective how a competitive exchange rate can stimulate domestic savings by avoiding consumption booms based on currency overvaluation.

  5. Estudo da clientela de um programa de atenção em saude mental junto ao estudante universitario de São Carlos

    OpenAIRE

    Michelle Selma Hahn

    1994-01-01

    Resumo: O presente estudo se propôs a caracterizar os estudantes universitários de São Carlos que se utilizam do Serviço de Orientação e Educação em Saúde (SOES), buscando verificar seus principais problemas e sintomatologia relatados referentes ao campo da saúde mental e sua iniciativa quanto à procura de ajuda, através de uma pesquisa retrospectiva de prontuários ao longo de quatro anos (1990-1993). Este trabalho também se propôs a dar uma contribuição à literatura e a prática da terapia oc...

  6. Direito e Risco: do Consumo ao Ambiente

    OpenAIRE

    Marques, Carlos Alexandre Michaello

    2014-01-01

    A presente Dissertação tem como tema de investigação “Direito e Risco: do Consumo ao Ambiente”. Para tanto, essa temática foi delimitada através da investigação sobre a capacidade do Direito a partir de uma leitura Sociológica e Antropológica de compreender e promover aprendizagem nas questões que envolvem o Risco como elemento decorrente do Consumo e que externa suas consequências ao Ambiente. Neste sentido, se direcionou a responder ao problema de saber: em que medida é possível e necessári...

  7. Da casa ao hotel: entre a hospitalidade e a economia do turismo

    Directory of Open Access Journals (Sweden)

    Felipe José Comunello

    2015-01-01

    Full Text Available O município de São Joaquim, na região serrana de Santa Catarina, tem sido destacado pela imprensa escrita e televisiva nacional como a cidade mais fria do Brasil, ao longo dos últimos vinte anos. Em pesquisa realizada para tese de doutorado, identifiquei que muitas proprietárias de pousadas, as “pousadeiras” como elas mesmas se chamam, começaram abrigando turistas em dificuldades em dias de frio intenso, quando não há hotéis e pousadas suficientes na cidade. A partir disso, elas acreditaram ser possível transformar suas casas em pousadas, tendo diante de si um problema também compartilhado com os profissionais do turismo, a chamada sazonalidade dos turistas. Tal fato provoca dúvidas sobre a sustentação econômica das pousadas e inquietação aos profissionais quanto ao sucesso econômico do turismo. Nesse artigo, isso é analisado tendo como referência uma proposta de parceria recebida por meus interlocutores por parte da operadora de turismo CVC e da empresa de eventos da RBS, afiliada da Rede Globo em Santa Catarina. A discussão é em torno de questões a partir de uma antropologia da hospitalidade. A análise sugere que essa parceria ameaça uma ordem moral estabelecida com base em determinados valores de hospitalidade para com estranhos, principalmente o aquecimento perante o frio.

  8. Ocorrências bicarbonatadas sódicas associadas ao acidente de Gerês - Lobios : diversidade composicional e termalidade

    OpenAIRE

    Lima, Alberto da Silva

    2011-01-01

    O acidente Gerês – Lobios constitui a porção intermédia de uma megaestrutura de orientação N17ºE que recorta o Maciço Ibérico ao longo de uma extensão de cerca de 250 km. A este acidente estão associadas emergências bicarbonatadas sódicas, exóticas em termos regionais, nomeadamente nas localidades de Gerês (Portugal) e Lobios (Espanha), onde ocorrem manifestações de termalidade significativa. São águas de mineralização relativamente baixa, com valores de condutividade de 350...

  9. Falácias acadêmicas, 11: o mito da transição do capitalismo ao socialismo

    Directory of Open Access Journals (Sweden)

    Paulo Roberto Almeida

    2009-08-01

    Full Text Available Análise critica do conceito de modo de produção na tradição marxista e revisão histórica dos processos de desenvolvimento do capitalismo e do socialismo ao longo do século 20, tanto no plano conceitual como empírico. Expõe as contradições do modelo analítico marxista e suas insuficiências teóricas, concluindo pela inaplicabilidade desse modelo para as condições concretas das economias de mercado contemporâneas, e a falência intelectual e prática do aparato conceitual marxista para explicar os desenvolvimentos ocorridos nessas economias e nas alegadamente socialistas.

  10. Criminosos popularizados na narrativa de divulgação (De 1838 aos Alvores da República)

    OpenAIRE

    Pacheco, Graça Maria Miranda Lérias

    2015-01-01

    O presente estudo incide sobre obras impressas que tomaram como motivo central as «façanhas» de criminosos com referência histórica celebrizados em Portugal na segunda metade do século XIX e inícios de XX e mostra que, enquanto narrativas elaboradas para o grande público, os textos foram não só um reflexo da popularidade prévia dos famigerados transgressores, como também um fator incontornável da sua «lendarização» ao longo de décadas. São as seguintes as figuras dos infratores que protagoniz...

  11. Diel horizontal distribution of microcrustaceans and predators throughout a year in a shallow neotropical lake Distribuição horizontal de microcrustáceos e predadores ao longo do ano em um lago neotropical

    Directory of Open Access Journals (Sweden)

    MS. Arcifa

    2013-02-01

    Full Text Available The focus of this study is to investigate if microcrustaceans undergo diel horizontal migration (DHM in a tropical shallow lake on a yearly basis and analyse the adaptive value regarding predation. Abundance of invertebrate predators, chaoborid larvae and water mites, and microcrustaceans (cladocerans and copepods were evaluated on a monthly basis in three stations located on a transect during the day and at night. Both invertebrate predators were predominantly pelagic. Cladocerans did not undergo significant DHM, distributing indistinctly onshore and offshore or being mostly pelagic. Nauplii, copepodites of two copepod species and adults of Tropocyclops prasinus meridionalis Kiefer were mostly distributed offshore, and did not perform DHM. The limnological features (temperature, dissolved oxygen, pH, and conductivity were suitable for the organisms in both zones of the lake. Algal food concentration was a little lower in the littoral than in the limnetic zone during the day, but it seems to be suitable for the organisms. However, as the algae quality was not evaluated, it is not possible to be conclusive concerning its influence. The results indicated that DHM was not performed by the microcrustaceans and is not, therefore, a strategy for decreasing predation by both invertebrates, Chaoborus brasiliensis Theobald and Krendowskia sp., on a yearly basis in this shallow lake.O foco deste estudo é verificar se microcrustáceos apresentam migração horizontal diária (MHD em um lago raso tropical, durante um ano, e o valor adaptativo com relação à predação. A abundância de predadores invertebrados, larvas de caoborídeos e ácaros aquáticos, e de cladóceros e copépodos foi avaliada mensalmente em três estações de coleta localizadas em um transecto, de dia e à noite. Ambos os predadores invertebrados foram predominantemente pelágicos. Os cladóceros não realizaram MHD, distribuindo-se indistintamente nas zonas litorânea e pelágica, ou foram mais abundantes na zona limnética. Os náuplios e copepoditos de duas espécies de copépodos e os adultos de Tropocyclops prasinus meridionalis Kiefer ocuparam principalmente a zona limnética, não migrando horizontalmente. As características limnológicas (temperatura, oxigênio dissolvido, pH e condutividade foram adequadas nas duas zonas do lago. A concentração de alga foi um pouco menor no litoral do que na zona limnética durante o dia e parece ser adequada para os organismos; contudo, como a qualidade das algas não foi avaliada, não é possível ser conclusivo sobre sua influência. Os resultados indicaram que os microcrustáceos não realizaram MHD, a qual não constitui, portanto, uma estratégia para diminuir a predação dos dois invertebrados, Chaoborus brasiliensis Theobald e Krendowskia sp., em uma base anual, neste lago raso.

  12. Produção de progesterona in vitro pelas células do corpo lúteo bovino ao longo da gestação In vitro progesterone production from bovine corpus luteum throughout gestation

    Directory of Open Access Journals (Sweden)

    Mariana N. La Paz

    2007-09-01

    Full Text Available O presente trabalho foi desenvolvido para testar a hipótese de que células luteínicas bovinas em cultivo, provenientes dos três terços de gestação, comportam-se da mesma maneira que células in vivo em relação à produção de P4. Foram coletadas amostras de corpos lúteos (CL de 90 (n=3, 150 (n=3 e 210 (n=3 dias de gestação obtidos em abatedouro. Sob condições assépticas, as células foram mecanicamente dispersas e cultivadas em placas de 96 poços. Após 24 horas de cultivo foram feitas a lavagem dos poços e a adição do precursor pregnenolona. Os tratamentos foram realizados em octuplicata para cada tempo de tratamento (24, 48 e 96 horas com três repetições de cada período gestacional. As amostras de meio de cultura e as células foram coletadas 24, 48 e 96 horas após adição do precursor e acondicionadas em freezer a -20ºC até o processamento. A progesterona foi dosada através de radioimunoensaio e o conteúdo protéico pelo método de Lowry. Os resultados foram analisados estatisticamente e considerados diferentes quando pThe aim was to test the hypothesis that cultivated bovine luteal cells from three different thirds of pregnancy behave the same way as in vivo luteal cells relative to P4 production. Corpus luteum samples from days 90 (n=3, 150 (n=3 and 210 (n=3 of pregnancy were obtained at a local slaughterhouse. Under aseptic conditions cells were mechanically dispersed and cultivated in a 96 wells-plate. After 24 hours of culture, cells were washed and the precursor pregnenolone was added. Experiments were conducted eight times for each studied time period (24, 48 and 96 h and three times for each gestational age. Culture medium and cells were collected after 24, 48 and 96 hours of precursor addition and kept frozen at -20ºC until processing. Progesterone was measured by RIA and protein content by Lowry's method. Results were statistically analyzed and considered different when p <0.05. A higher P4 production was observed on day 90 of gestation (35.277±0.075, then this production was decreased at day 150 (28.820±0.231 and increased again at day 210 (32.777±0.099. After 24 hours of culture, luteal cells P4 production reached maximum values in the group of 90 days (2.912±0.047 when compared to 150 (2.669±0.137 and 210 days (2.741±0.088. At 48 and 96 hours of culture, bovine luteal cells from day 90 of gestation produced more P4 than cells from day 210 (2.934±0.029 and 2.976±0.121 respectively x 2.760±0.059 and 2.695±0.149, respectively; p<0.05, which in turn, produced more P4 than cells from day 150 (2.334±0.084 for 48 h and 2.205±0.136 for 96 h. Luteal cells from day 150 of gestation presented a decreasing P4 production throughout the 96 hours of culture. These differences could be explained by differential gene expression of enzymes and/or factors belonging to the esteroidogenic cascade in accordance to the gestational period. The established luteal cell culture model could be used for further functional studies once P4 secretion pattern in vitroresembled what occurs in vivo.

  13. FREQUÊNCIA FENOTÍPICA DE ASAS E OLHOS AO LONGO DE GERAÇÕES EM POPULAÇÕES DE LABORATÓRIO DE Chrysoperla externa (NEUROPTERA: CHRYSOPIDAE

    Directory of Open Access Journals (Sweden)

    SERGIO ANTONIO DE BORTOLI

    2014-01-01

    Full Text Available In massal rearing of natural enemies with the goal of biological control, the procedures adopted for establishment and maintenance of the individual founders of the colonies may have undesirable effects on population genetic structure of laboratory. This situation influences the success of rearing and effectiveness in the field. The objective of this study was to evaluate, along of generations two laboratory populations (Jaboticabal and Piracicaba of Chrysoperla externa (Hagen (Neuroptera: Chrysopidae, founded with different numbers of adults (1, 5, 10, 15 and 20 couples, the frequency of morphological variants, size of wings and eye color, such as parameters for inferences about the homozygosity degrees. For eye color were assessed the frequency, while for the size of wings was measured the width and the length of the right mesothoracic wings. The eye color variants for C. externa populations may be monitored in the laboratory aiming at detecting inbreeding, whereas the measurements of length and width of wings should not be adopted for this purpose.

  14. Efeito do 1-metilciclopropeno sobre a emissão dos ésteres voláteis de bananas ao longo do amadurecimento Efferct of 1-MCP on esters volatiles eission of bananas along the ripening

    Directory of Open Access Journals (Sweden)

    Baraquizio Braga do Nascimento Junior

    2008-01-01

    Full Text Available Fresh green bananas (Musa sp., subgroup Prata were treated with a dose of only 90 ηg g-1 of 1-MCP for 13 hours and the evolution of the volatile compounds along the ripeness was studied. A method to quantify the emission of esters was developed by cryogenic headspace and gas chromatography. Esters of acetate, butyrate, isobutyrate and isovalerate were found as major compounds. The application of the 1-MCP for 13 hours delayed the appearance of the coloration 8 of the peel for 3 days and decreased quantitatively in about 46% the total production of esters in the banana until the 15° day of harvested.

  15. Perfil florístico e estrutural do componente lenhoso em seis áreas de cerradão ao longo do bioma Cerrado Structural and floristic profile of the woody component of six cerradão areas

    Directory of Open Access Journals (Sweden)

    Alexandro Solórzano

    2012-06-01

    Full Text Available Inúmeros trabalhos descrevem tanto o aspecto fisionômico e florístico do cerradão, no entanto, não há padronização do critério de inclusão, esforço amostral e tamanho das unidades amostrais o que dificulta as comparações e emergência de perfil estrutural para a vegetação lenhosa desta fitofisionomia. Buscamos com este trabalho descrever o perfil florístico-estrutural do componente lenhoso do cerradão, bem como avaliar o grau de sobreposição de espécies florestais, savânicas e generalistas. O trabalho foi realizado em seis áreas distribuídas nos estados de: MG, MS, MT, TO, PI e DF. A vegetação lenhosa do cerradão não apresentou estrutura homogênea ou consistência florística, apresentando-se como fisionomia bastante heterogênea. Estruturalmente a vegetação lenhosa apresentou grandes variações, com formações mais abertas e mais densas (densidade variando de 652 a 1.732 ind. ha-1 e área basal variando de 12,83 a 22,45 m² ha-1. A riqueza de espécies nas áreas vaiou de 49 (MS a 124 (MT. Das 308 espécies registradas nas seis áreas apenas seis ocorreram em todas elas e 184 espécies foram exclusivas de uma das áreas. Florísticamente houve grande variação na composição de espécies e marcada dissimilaridade entre as áreas. Apesar de haver uma mistura de elementos florísticos savânicos e florestais, detectamos maior domínio de espécies savânicas com exceção da área MT que apresentou maior proporção de espécies florestais. O padrão geral de dissimilaridade florística e estrutural nas seis áreas indicaram grande heterogeneidade da distribuição da flora lenhosa do cerradão, seguindo o padrão de outras fitofisionomias do bioma Cerrado.A large number of studies describes the structure and composition of cerradão, however there is no standardization regarding data collection, rendering it difficult to conduct ample comparisons and the emergence of a structural and floristic profile for the cerradão. Our aim is to establish a structural-floristic profile of the cerradão woody component and verify the overlap of forest, savanna and generalist species. We conducted the vegetation survey in sites in six states: DF, MG, MS, MT, PI and TO. The cerradão did not present a homogenous structure or floristic consistency among sites, presenting itself as a heterogeneous phytophysiognomy. Structurally it presented great variations, with both open and closed formations (density 652-1732 ind. ha-1; basal area 12.83-22.45 m² ha-1. Species richness varied from 49 (MS to 129 (MT. Floristical variation and dissimilarity was strong among the six sites with only six species occurring in all sites, where as 184 species are exclusive to one site. Although species composition is comprised of a mixture of forest and savanna species, we detected a greater participation of savanna species, with the exception of the MT site that presented a larger proportion of forest species. The general floristic and structural dissimilarity pattern observed indicate a great heterogeneity of cerradão woody flora distribution following the general patter for the Cerrado biome.

  16. Use of radon as tracer for identification of aquifer discharge along the Matinha stream, MG, Brazil; O uso do radonio como tracador para identificacao de descarga de aquiferos ao longo do corrego da Matinha, MG

    Energy Technology Data Exchange (ETDEWEB)

    Chagas, Claudio Jose

    2017-11-01

    Within the framework of 'Nuclear Techniques' is the use of natural and artificial isotopes as tracers for the study of the environment. The use of natural tracers in hydrology is a very useful tool that has been used in several scenarios. One such tracer is the isotope of radon, {sup 222}Rn, a noble gas from natural sources as a consequence of alpha decay of {sup 226}Ra. Radon can be found, to a greater or lesser degree, in all groundwater, as well as in soils and rocks from where it exudes into the atmosphere through spaces arising from fissures and or nanopores present. It can emerge into the water bodies by the leaching of water or other liquids through these interstices. In this research, the {sup 222}Rn gas diluted naturally by the leaching of the water that infiltrated the soils and rocks of the aquifers was used as a tracer in order to identify sections of discharge of these aquifers along the Stream of Matinha. The study area is about 70 km from Belo Horizonte and is in the city of Itauna, MG. The Matinha stream is about 2,200 m in length and is part of the network of tributaries of the water reservoir called Serra Azul, in the Juatuba River Basin, MG. The results presented express the studies that occurred between the second half of 2014 and the first half of 2016, in ten campaigns for water sampling, flow and natural gamma radiation measurements. Water samples were collected near the bottom and very close to the thalweg in the watercourse using syringe and or peristaltic suction pump at low flow to avoid gas leakage. The {sup 222}Rn analyzes were performed in the field during the collections and in the laboratory of the CDTN - Centro de Desenvolvimento da Tecnologia Nuclear, all of which were carried out with the radon detector RAD 7. The flow measurements counted on the use of the fluorescent tracer's technique: rhodamine and fluorescein were used for injection at points upstream and downstream of sections with higher {sup 222}Rn activities. The fluorimeter used to recover the mass of injected fluorescence tracer was the GGUN FL-30 connected to a notebook so that it could follow the tracer cloud passage. The gamma radiation measurements were fitted with AT6101C detector installed inside a backpack so that they could be scanned along the thalweg and along the banks of the stream. The results showed the presence of significant amounts of the radioisotope in several sections of Matinha stream, which indicates the interconnection between the groundwater and the surface waters. This interconnection with aquifers justifies the increase of the flows found between upstream and downstream of the sections with larger activities of {sup 222}Rn, since there were no other superficial contributions along the section studied. The gamma radiation found denotes proximity to the base rock along with the minerals brought by the groundwater and sedimented on the flood surfaces. (author)

  17. Competências profissionais em Educação Física: uma abordagem ao longo da carreira docente Professional competences in Physical Education: an approach along the educational career

    Directory of Open Access Journals (Sweden)

    Gelcemar Oliveira Farias

    2012-12-01

    Full Text Available O objetivo deste estudo foi verificar as competências profissionais elucidadas na carreira docente de professores de Educação Física escolar. Participaram 64 professores de Educação Física da rede pública municipal de Porto Alegre - RS. Na coleta de dados, utilizou-se um questionário composto por perguntas abertas e fechadas, cujas respostas foram categorizadas a partir do modelo de competência profissional de Cheetham; Chivers (1998, com o emprego do Software Nvivo 7.0. No conjunto de competências analisadas, identificou-se que professores mais experientes são aqueles que em suas trajetórias se sobressaem as competências funcionais, caracterizadas pela competência específica do ofício e de organização e gestão. Destaca-se que a dimensão social e vocacional foi preponderante no decorrer da carreira docente, em detrimento da dimensão intrapessoal da competência social e pessoal. Apesar da importância da ética à profissão docente, a dimensão competência ética e valores não foi expressiva nas unidades de registro deste estudo.The objective of this study was to analyze the professional competences elucidated in the educational career of Physical Education teachers from school. 64 teachers of Physical Education of the municipal public net of Porto Alegre (RS participated in the study. In the collection of data a questionnaire was used composed by open and closed questions, whose answers were classified based on the model of professional competence of Cheetham; Chivers (1998, with the application of the Software Nvivo 7.0. In the group of analyzed competences, it was identified that teachers with more experience are those that stand out the functional competences in their paths, characterized by the specific competence of the occupation and of the organization and administration. It stands out that the social and vocational dimension was preponderant in elapsing of the educational career, in the detriment of the interpersonal dimension of the social and personal competence. In spite of the importance of the ethics to the educational profession, the ethical competence and values was not expressive in the units of registration of this study.

  18. Caracterização de cascalho e lama de perfuração ao longo do processo de controle de sólidos em sondas de petróleo e gás

    OpenAIRE

    Pereira, Marina Seixas

    2010-01-01

    A perfuração, uma das etapas da exploração de petróleo e gás, hoje objetiva cenários geológicos de grande complexidade, com elevadas profundidades. Como efluente da atividade exploratória há a geração de cascalhos contaminados ou revestidos com fluido de perfuração. Uma legislação ambiental mais rigorosa e a necessidade de reduzir os custos de perfuração (prospecção e produção) apontam para a necessidade de otimização da separação e reciclagem do fluido de perfuração de poços d...

  19. Production and productivity of sugar cane bagasse during 2008/2009 crop season for electrical energy conservation; Producao e produtividade de bagaco de cana-de-acucar ao longo da safra 2008/2009, visando a cogeracao de energia

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Tulibio F. da; Silva Neto, Helio F. da; Tasso Junior, Luiz Carlos; Marques, Diogo; Marques, Marcos O. [Universidade Estadual Paulista (FCAV/UNESP), Jaboticabal, SP (Brazil). Fac. de Ciencias Agrarias e Veterinarias], E-mail: tulibio_fernandes@yahoo.com.br

    2010-07-01

    In order to diversify sources of energy generation, Brazil has encouraged cogeneration of energy from biomass. Among the various biomasses sources, sugar cane bagasse is one that combines the best economic attributes to be due mainly to industrial production in large quantities. This study aimed to evaluate the bagasse productive potential of two varieties of sugarcane during the harvest period. The experiment was conducted at UNESP, Jaboticabal County. The experimental design was completely randomized split plot, having the two sugarcane cultivars as plots, and the split times of the 11 tests during the season and 3 replications. Were estimated production (kg tc{sup -1}) and productivity (t ha{sup -1}) residue for each cultivar in their own times. The cultivars showed differences from the average production of mulch. However, obtained similar behavior throughout the season, characterized by progressive cuts. For bagasse Productivity, the cultivars showed differences in average values and behavior throughout the season. The cultivar IACSP95-5000 had the best performance in relation to production and productivity of bagasse, can be used for cogeneration for most of the season. The cultivar RB855536 presented a lower performance, achieving low production and productivity of bagasse, indicating its lower potential in relation to energy generation. (author)

  20. CONTRIBUIÇÃO AO ENTENDIMENTO DA SENSIBILIDADE AMBIENTAL AO DERRAMAMENTO DE ÓLEO NO LITORAL DE MARICÁ NO ESTADO DO RIO DE JANEIRO

    Directory of Open Access Journals (Sweden)

    Érika Cardoso da Silva Baptista

    2016-01-01

    Full Text Available Desastres associados ao transporte marinho e terrestre de hidrocarbonetos causam sérios impactos aos ambientes costeiros, afetando a fauna e a flora marinha, além de prejudicar diversas atividades econômicas, inclusive àquelas tradicionais, como é o caso da pesca artesanal. Assim, faz-se necessário conhecer a geologia e a geomorfologia da costa, em especial as praias devido à elevada dinâmica e vulnerabilidade desses ambientes. A construção de megaempreendimentos na zona costeira e o tráfego de navios petroleiros e pequenas embarcações, ou mesmo a implantação de dutos, localizados junto à linha de costa, representam uma ameaça ao equilíbrio dos ecossistemas. Para tal, foram analisados diversos aspectos da geomorfologia costeira de Maricá, para posterior identificação do grau de sensibilidade deste litoral a eventos de derramamento de óleo, a partir do Índice de Sensibilidade Ambiental (ISA proposto pelo Ministério do Meio Ambiente. O litoral de Maricá, ao longo de 34 km de extensão entre Itaipuaçú (no extremo oeste e Ponta Negra (a leste, apresenta quatro áreas distintas quanto à sensibilidade à poluição decorrente de derramamento de óleo, sendo: ISA1, para as áreas de costões rochosos localizados nas extremidades leste e oeste deste litoral; ISA4, para a quase totalidade das praias, formadas por areias quartzosas grossa e média, exceto o extremo-oeste de Itaipuaçú, que possui areia muito grossa e cascalhos sendo, portanto, representada pelo ISA5; e ISA10, para as lagoas costeiras e canais na retaguarda das barreiras arenosas, sujeitas à contaminação por meio dos canais e por transposição por grandes ondas de tempestades. Os índices compreendem os extremos dessa classificação, devido à grande variedade de elementos na paisagem costeira de Maricá e mostra a elevada sensibilidade deste litoral, frente à ameaça de desastres causados por derramamento de óleo.

  1. DA UTOPIA FOURIERISTA AOS PRINCÍPIOS DE ECONOMIA SOLIDÁRIA: INTERFACES ENTRE O PASSADO E O PRESENTE

    Directory of Open Access Journals (Sweden)

    Luiz Célio Souza Rocha

    2013-05-01

    Full Text Available A partir de pesquisa bibliográfica, este texto evidencia, teoricamente, por vias fenomenológicas e ontológicas, como as idéias principais do Socialismo Utópico de Fourier estão presentes nos princípios da Economia Solidária. A situação sócio-econômica da sociedade contemporânea, centrada no consumismo e na competitividade, tem gerado restrições, tanto para a economia capitalista quanto para a maioria dos indivíduos. É, pois, em tempos de crise, que a Economia Solidária aparece como resposta às desigualdades e injustiças inerentes ao sistema capitalista, pois, privilegia, além da dimensão econômica, as esferas social e ambiental. Esta tendência não fragmentada de vida foi pensada no passado e vem ocorrendo – ainda que de modo limitado – nos dias atuais. Para evidenciar tal entendimento, ao longo do trabalho são resgatadas características do pensamento de Fourier que, hoje, aparecem fortemente vinculadas ao construto da Economia Solidária. O exercício procedido evidencia a vitalidade dos ideais do socialismo utópico na atualidade.

  2. Estudo do comportamento da aderência e do conforto ao rolamento em pistas de pouso e decolagem

    Directory of Open Access Journals (Sweden)

    Francisco de Oliveira

    2016-09-01

    Full Text Available Este artigo analisa as relações existentes entre a aderência e o conforto ao rolamento em pistas de pouso e decolagem. Por intermédio dos dados de macrotextura, de coeficiente de atrito e do índice de irregularidade internacional, obtidos entre 2013 e 2014 no Aeroporto Internacional de Fortaleza, foi possível comparar esses parâmetros e suas alterações ao longo da pista. As análises foram efetuadas com base na literatura técnico-científica e nas exigências normativas da Organização da Aviação Civil Internacional e da Agência Nacional de Aviação Civil. Verifica-se que em alguns trechos da pista em estudo, sobretudo no segmento central, o comportamento entre os parâmetros analisados apresenta tendência divergente. Com esta análise, espera-se contribuir para o incremento da segurança das operações de pousos e decolagens, especialmente na resistência à derrapagem, no controle direcional e no conforto ao rolamento das aeronaves.

  3. Customer satisfaction and response to AOS

    Science.gov (United States)

    1999-01-01

    Passenger surveys were conducted in each of three successive springs in order to track passenger perception of changes in service quality during AOS implementation. In general, no improvement in passenger perceptions was observed relative to a high b...

  4. Standard Triaxial Ellipsoid Asteroids from AO Observations

    Science.gov (United States)

    Drummond, Jack D.; Merline, W. J.; Conrad, A.; Dumas, C.; Carry, B.

    2008-09-01

    As part of our study of resolved asteroids using adaptive optics (AO) on large telescopes (>8; m), we have identified several that can serve as Standard Triaxial Ellipsoid Asteroids (STEAs), suitable for radar and thermo-physical calibration. These objects are modeled well as triaxial ellipsoids, having: 1) small uncertainties on their three dimensions as determined with AO; 2) rotational poles well determined from both lightcurves and AO; and 3) good sidereal periods from lightcurves. Although AO allows the opportunity to find an asteroid's dimensions and rotational pole in one night, we have developed a method to combine AO observations from different oppositions to pool into a global solution. The apparent orientation and sizes of STEAs can be predicted to within a few degrees and a few km over decades. Currently, we consider 511 Davida, 52 Europa, 2 Pallas, and 15 Eunomia as STEAs. Asteroids that are not well modeled as ellipsoids, clearly showing departures from ellipsoid figures in AO images, include 129 Antigone and 41 Daphne. We will show movies of images and models of these asteroids.

  5. Efeito em longo prazo da aplicação de etanol na resistência adesiva de pinos de fibra de vidro cimentados à dentina radicular = Long-term effect of ethanol on the bond strength of fiber-glass posts to root dentin

    Directory of Open Access Journals (Sweden)

    Bordin, Dimorvan

    2014-01-01

    Full Text Available Objetivo: Avaliar o efeito em longo prazo da aplicação de etanol (EtOH na resistência adesiva de sistemas adesivos utilizados na cimentação de pinos à dentina radicular. Métodos: Raízes bovinas (n=40 tiveram o canal radicular preparado para receber pino, sendo realizado o condicionamento com ácido fosfórico 37% (15 s. Os espécimes foram distribuídos de acordo o sistema adesivo e aplicação de EtOH. Grupos controles receberam apenas aplicação dos adesivos Adper ScothBond Multi-Purpose Plus (ASb, ou Adper Single Bond (SB. Grupos experimentais receberam aplicação prévia de EtOH durante 1 minuto (EtOH+ASb e EtOH+SB. Após a cimentação, os espécimes, foram armazenados por 24 h, ou 12 meses, sendo submetidos ao teste push out (n=5. Os dados foram avaliados estatisticamente por análise de variância a 3 critérios e teste Tukey (a0,05. Após 12 meses, observou-se redução estatisticamente significante da resistência adesiva (p0,05. Conclusão: O pré-tratamento com EtOH contribui para manutenção da resistência de união em longo prazo, quando utilizado sistema adesivo a base de água e etanol

  6. Soil methane oxidation in a long-term no-tillage system in Southern BrazilOxidação de metano em solo a longo prazo sob plantio direto no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    Cimélio Bayer

    2013-09-01

    Full Text Available Conservation management systems are usually suggested as alternative to restore the soil methane (CH4 oxidation capacity of degraded soils; however, little information is available on tropical and subtropical soils. Our objective was to evaluate the long-term (19 years effect of no-tillage (NT versus conventional tillage (CT management systems on CH4 fluxes in a formerly degraded Acrisol in Southern Brazil. Annual CH4 fluxes of two cropping systems [O/M-black oat (Avena strigosa/maize and V/M-vetch (Vigna sativa/maize] were measured in NT and CT soils. Static chambers were used for air sampling, while chromatography was used for CH4 analysis. Analysis of the historical dataset at this experimental site indicated improvements in soil quality under the NT system, especially in legume-based cropping system (V/M that exhibited the highest annual biomass input. CH4 fluxes ranged from −42 ± 2 to 38 ± 16 μg C m-2 h-1, and annual CH4 emissions ranged from −825 ± 117 (CT V/M to 453 ± 185 g C ha-1 (NT O/M. Thus, the annual CH4 oxidation capacity of the soil was not related to the soil quality produced by the soil management systems. On the basis of our results and published literature, we postulate that conservation management systems improve the methane oxidation and soil quality in distinct soil layers, which result in a slow effect of these management systems on the methane oxidation capacity. Sistemas conservacionistas de manejo de solo são considerados usualmente uma alternativa para restaurar a capacidade de solos agrícolas degradados em oxidar metano (CH4, mas escassa informação é disponível para solos tropicais e subtropicais. O objetivo do presente estudo foi avaliar o efeito de longo prazo (19 anos do plantio direto (PD nos fluxos de CH4 em um Argissolo Vermelho (Classificação Brasileira degradado da região Sul do Brasil, em comparação ao preparo convencional (PC. Fluxos anuais de CH4 do solo foram avaliados nos sistemas PD e

  7. Homens de letras e homens de leis ao serviço da monarquia portuguesa (séculos XII-XIII

    Directory of Open Access Journals (Sweden)

    Armando Norte

    2014-06-01

    Full Text Available Ao longo da primeira dinastia, os letrados ao serviço da Coroa portuguesa desempenharam um papel decisivo e cada vez mais importante na afirmação do poder real. Homens de leis e homens de letras serviram à casa real como oficiais, representaram os reis portugueses em atos políticos e diplomáticos e exerceram um grande leque de funções na esfera da administração central - políticas, jurídicas, médicas, económicas, administrativas. A presença desses elementos ao lado dos monarcas fez-se sentir desde a fundação do reino, logo desde o reinado de D. Afonso Henriques, coincidindo o corolário deste processo de recrutamento com a chegada de D. Afonso III ao trono, numa política continuada, de forma firme, por D. Dinis. O conjunto de eruditos recenseados junto dos reis portugueses da época fundacional constitui, nessa medida, um interessante estudo de caso para compreender, em parte, em que consistia um círculo áulico, à luz dos valores do século XII e XIII.

  8. Macrófitas aquáticas de um lago marginal ao rio Embu-mirim, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Zuleika Beyruth

    1992-08-01

    Full Text Available Durante os anos de 1984/1985 obtiveram-se amostras sazonais para determinação de parâmetros físicos, químicos e biológicos de um lago marginal ao rio Embu-mirim, em Itapecerica da Serra, na bacia do reservatório de Guarapiranga (São Paulo, Brasil. Além de discutir os resultados obtidos quanto à flora de macrófitas aquáticas e suas relações com os outros parâmetros ambientais, são também analisados os efeitos da variação sazonal. As espécies encontradas estão presentes em diversos corpos d'água marginais, bem como ao longo do rio Embu-mirim, permitindo avaliar seu comportamento em corpos d'água semelhantes, da mesma bacia. A macrófita predominante foi Eichhornia crassipes (Mart. Solms. Os resultados obtidos demostram a tendência de uma eutrofização acelerada e o risco de macrófitas potencialmente problemáticas, como E. crassipes e Salvinia auriculata, formarem camalotes de altas densidades, que podem chegar ao reservatório de Guarapiranga, através do rio Embu-mirim, causando problemas aos diversos usos da água.

  9. Macrófitas aquáticas de um lago marginal ao rio Embu-mirim, São Paulo, Brasil

    Directory of Open Access Journals (Sweden)

    Beyruth Zuleika

    1992-01-01

    Full Text Available Durante os anos de 1984/1985 obtiveram-se amostras sazonais para determinação de parâmetros físicos, químicos e biológicos de um lago marginal ao rio Embu-mirim, em Itapecerica da Serra, na bacia do reservatório de Guarapiranga (São Paulo, Brasil. Além de discutir os resultados obtidos quanto à flora de macrófitas aquáticas e suas relações com os outros parâmetros ambientais, são também analisados os efeitos da variação sazonal. As espécies encontradas estão presentes em diversos corpos d'água marginais, bem como ao longo do rio Embu-mirim, permitindo avaliar seu comportamento em corpos d'água semelhantes, da mesma bacia. A macrófita predominante foi Eichhornia crassipes (Mart. Solms. Os resultados obtidos demostram a tendência de uma eutrofização acelerada e o risco de macrófitas potencialmente problemáticas, como E. crassipes e Salvinia auriculata, formarem camalotes de altas densidades, que podem chegar ao reservatório de Guarapiranga, através do rio Embu-mirim, causando problemas aos diversos usos da água.

  10. Nao adesao ao tratamento medicamentoso continuo: prevalencia e determinantes em adultos de 40 anos e mais

    Directory of Open Access Journals (Sweden)

    Felipe Assan Remondi

    2014-01-01

    Full Text Available O presente estudo investiga os fatores associados a não adesão à terapia medicamentosa contínua em indivíduos de 40 anos e mais de idade. Foi realizado um inquérito de base populacional em Cambé, Paraná, Brasil. A adesão à terapia foi avaliada pela escala de quatro itens de Morisky et al. e analisaram-se também variáveis sociodemográficas, de utilização dos serviços de saúde e do uso de medicamentos. Foram entrevistados 1.180 indivíduos, dos quais 78% utilizaram medicamentos nos 15 dias anteriores à entrevista e em 55% registrou-se o uso contínuo. A amostra do estudo consistiu em 639 indivíduos, com predominância do sexo feminino, idade entre 40 e 59 anos, baixa escolaridade. A prevalência de não adesão foi de 63,5%. Após análise ajustada, permaneceram associados a não adesão: não ser acompanhado pelo agente comunitário de saúde, ter tido descontinuidade no acesso aos medicamentos e a elevada frequência de utilização dos medicamentos ao longo do dia. Os resultados indicam uma alta prevalência da não adesão com possíveis impactos negativos para os indivíduos e para a sociedade.

  11. Gorgonids from Curaçao Island

    NARCIS (Netherlands)

    Gordon, Isabella

    1925-01-01

    This report contains an account of a collection of Gorgonids made by Dr. C. J. VAN DER HORST at the island of Curaçao and also of a few specimens collected in the same locality by Ir. G. J. H. MOLENGRAAFF. The Majority of the specimens are taken from Caracas bay at a depth of not more than five

  12. Estados Unidos: do Iraque ao Brasil

    Directory of Open Access Journals (Sweden)

    Virgílio Caixeta Arraes

    2010-12-01

    Full Text Available O presente artigo busca analisar os recentes temas recorrentes na política externa norte-americana, caracterizada pela “guerra contra o terror”, e seus impactos para a agenda a ser discutida na vindoura visita do presidente dos Estados Unidos, Geoge W. Bush, ao Brasil.

  13. AoB PLANTS: origins and features.

    Science.gov (United States)

    Jackson, Michael B

    2009-01-01

    AoB PLANTS is a peer reviewed, Open Access (OA) journal owned and run by plant biologists and published by Oxford University Press. The journal publishes research papers, reviews and opinion papers on all aspects of land based plant biology. They are made available rapidly online and can be accessed without the need for subscriptions or payment. Several difficulties in conventional publishing of peer-reviewed manuscripts encouraged AoB PLANTS to adopt OA. Open Access helps sidestep library budgets which are struggling to purchase the increasing numbers of journals. Open Access makes research freely available both to the academic community and beyond while publishing online only eliminates the need to reject good manuscripts simply to control the size of the printed journal. Finally, the journal chose to go OA to ensure the widest possible international readership for the growing amount of high-quality plant science research being carried out worldwide in response to problems such as climate change and food shortages. Responses to a wide-ranging online questionnaire indicated strong international support for a journal such as AoB PLANTS. AoB PLANTS strives for fair and rapid peer review followed by fast publication of accepted papers. For an initial period, there will be no OA fees, and fees will remain modest once introduced. AoB PLANTS adopts double-blind peer review using published criteria for acceptability as a basis for decision-making. Accepted papers are published shortly after acceptance together with referees' analyses using Stanford University Libraries High Wire Press H2O platform. Authors retain ownership of the copyright in their papers.

  14. Interacionismo simbólico: origens, pressupostos e contribuições aos estudos em Psicologia Social

    Directory of Open Access Journals (Sweden)

    Virgínia Donizete de Carvalho

    Full Text Available O estudo aborda a perspectiva teórica denominada interacionismo simbólico, com o objetivo de resgatar suas origens, consolidação, pressupostos centrais e contribuições ao campo da Psicologia social. com base em revisão de literatura, são examinadas algumas concepções de pensadores reconhecidos como precursores dessa corrente, com destaque para o trabalho de George Mead. Os marcos iniciais da estruturação do movimento interacionista simbólico (cujo nome e principais pressupostos foram estabelecidos por Herbert Blumer e as diferentes possibilidades de operacionalização do conceito, representadas pelas divergências conceituais e metodológicas das Escolas de chicago e Iowa, constituem os pontos centrais da discussão. No intuito de identificar os principais desdobramentos oriundos das concepções interacionistas, são brevemente expostas as abordagens de estudiosos como Strauss, Shibutani, Berger e Luckmann, e Stryker. Por fim, com base na revisão empreendida, que permitiu identificar diferentes pontos de vista acerca da abordagem interacionista simbólica, conclui-se que sua evolução e fortalecimento ao longo do tempo contribuíram para que pudesse se sustentar como uma perspectiva teórica com amplas possibilidades de aplicação nos estudos da vida social.

  15. Identificação de rotavirus associado ao sorotipo G2 em Yucatan, México

    Directory of Open Access Journals (Sweden)

    Gonzales-loza María del R.

    2000-01-01

    Full Text Available Neste estudo reporta-se a identificação de rotavirus sorotipo G2 proveniente de amostras fecais de crianças com gastroenterite, da Cidade de Mérida, Yucatán, México. O diagnóstico virológico foi feito através da eletroforese em gel de poliacrilamidia e ensaio imunoenzimático. Das 149 amostras estudadas, 25 (16,7% foram positivas para rotavirus do grupo A; dessas 23 (92% foram sorotipo G2, subgrupo I e padrão eletroforético curto e 2 (8% subgrupo II e padrão eletroforético longo, porém, não foi possível determinar o sorotipo G. Desde 1985, até hoje, foi a única vez que o sorotipo G2 foi identificado, em mais de 90% das amostras analisadas. Acredita-se que, provavelmente, nos últimos anos tem acumulado na população, um grupo de pessoas suscetíveis ao sorotipo de RV, e num futuro poderia ter um surto importante de gastroenterite, associado ao sorotipo G2 de rotavirus.

  16. Estudo anatômico das inserções distais do tendão extensor longo do polegar Anatomical studies of the distal insertion of the extensor pollicis longus

    Directory of Open Access Journals (Sweden)

    Maurício Benedito Ferreira Caetano

    2004-06-01

    Full Text Available Registramos pelo presente estudo que o músculo (ELP e seu tendão apresentaram poucas variações anatômicas. Não registramos a presença de tendões acessórios e nem a ausência desse músculo ou de seu tendão. Verificamos em todas as preparações a passagem do tendão pelo terceiro compartimento osteofibroso, cruzando sobre os extensor radial curto (ERCC e longo (ERLC do carpo e dirigindo-se ao polegar. A alteração no trajeto tendinoso, desviando-se no sentido radial foi verificada em uma das preparações (1,6%. A duplicação parcial do tendão proximal a articulação metacarpofalângica (AMFP foi verificada em 3 observações (4,8%, sendo 1 bilateral, e distal à articulação em 5 (8,3%, 2 bilateralmente. A inserção óssea na base da falange distal (BFD foi encontrada em todas as observações. Durante sua passagem pela articulação metacarpofalângica, registramos sua inserção na cápsula articular em 14 observações (23,3%, porém não registramos a inserção óssea nesse local. O padrão mais comum em relação ao músculo ELP foi a presença constante de 1 tendão, passando pelo terceiro compartimento osteofibroso dorsal do punho com inserção óssea na base da falange distal do polegar.We recorded with this study that the EPL muscle and its tendon show a few anatomical variations. Any accessories tendons either the absence of this muscle or its tendon was found. In all preparation the passage of the tendon through the third osteofibroses compartment, crossing on the ERBC and ERLC going to the thumb was seen. The change of the tendinuous trajectory, deviating itself to the radial direction in one of the preparations was checked (1,6%. The partial duplication of the proximal tendon to the metacarpophalangeal joint (AMP was seen in three observations (4,8%, one bilateral and distal to the articulation in five (8,3%, 2 bilaterally. The bone insertion at the base of distal (BFD phalanx in all observations were found

  17. Análise da influência da bandagem funcional de tornozelo no tempo de reação do fibular longo em sujeitos saudáveis Analysis of ankle taping influence in the peroneal reaction time in healthy subjects

    Directory of Open Access Journals (Sweden)

    Maurício Couto Meurer

    2010-06-01

    Full Text Available OBJETIVOS: O objetivo deste estudo foi analisar a influência da bandagem funcional de tornozelo no tempo de reação do fibular longo de indivíduos sadios. MÉTODOS: A amostra foi composta por oito indivíduos do gênero masculino, fisicamente ativos, sem histórias prévias de lesões de tornozelo e, com os resultados negativos aos testes de instabilidade articular de tornozelo. Foram usados como instrumentos da pesquisa, a bandagem funcional de tornozelo tipo bota fechada, para realizar o teste uma plataforma capaz de inclinar 30o no plano frontal simulando a entorse lateral do tornozelo e um eletromiógrafo de oito canais (Bortec Electronics Incorporation, Canadá para aquisições dos sinais eletromiográficos. Os sinais EMG foram coletados juntamente com o sinal da plataforma (sincronismo. A coleta dos dados foi realizada em dois momentos, primeiramente sem a bandagem e logo após com a bandagem. RESULTADOS: Os indivíduos tinham idade média de 23,3 anos (± 2,8, massa corpórea de 74,4kg (± 9,4, estatura de 1,7m (± 0,4 e IMC de 23,7kg/m2 (± 2,4. O estudo encontrou diferença estatisticamente significativa p = 0,018 na situação da bandagem funcional de tornozelo com diminuição do tempo de reação do fibular longo. CONCLUSÃO: Acreditamos que esta melhora se deva ao íntimo contato da bandagem com os receptores cutâneos do tornozelo, aumentando a ativação do reflexo fibular, com consequente ganho proprioceptivo e, assim, aumentando a habilidade dos sujeitos em responder a situações súbitas de entorses. O estudo demonstrou diminuição no tempo de reação do fibular longo de indivíduos sadios com o uso da bandagem funcional de tornozelo quando submetidos à inclinação lateral súbita do tornozelo.OBJECTIVE: The aim of this study was to analyze the influence of the ankle functional tape on long fibular reaction time in health subjects. METHODS: The sample was composed of eight physically active male subjects, without ankle

  18. Análise dos fatores de risco para mortalidade na estimulação pediátrica endocárdica transfemoral: experiência em longo prazo Risk factors analysis in transvenous pediatric pacing through femoral access: long-term experience

    Directory of Open Access Journals (Sweden)

    Roberto Costa

    2005-06-01

    Full Text Available OBJETIVO: A estimulação cardíaca permanente melhora a sobrevida de crianças com bradicardia congênita ou adquirida, embora a mortalidade após o implante de marcapasso permaneça relativamente alta. O objetivo deste estudo foi avaliar os resultados em longo prazo de crianças submetidas a implante de marcapasso endocárdico pela veia femoral, incluindo a identificação de fatores de risco associados à mortalidade. MÉTODO: De 1981 a 2000, 99 pacientes variando em idade de um dia a 13 anos (4,1 ± 3,6 com mediana = 3 anos foram submetidos a implante de marcapasso permanente pela via femoral devido a bradicardia de origem congênita (39,4%, pós-cirúrgica (54,5% ou adquirida não cirurgicamente (6,1%. RESULTADOS: Ao final de 7,1 ± 5,3 anos (708,3 pacientes-anos de seguimento, 18 (18,2% pacientes haviam morrido. A sobrevida atuarial foi de 85%, 79,5%, e 74,2%, aos cinco, 10, e 15 anos, respectivamente. Os fatores independentes de mortalidade identificados pela análise proporcional de Cox foram: menor idade ao implante (p = 0,028, presença de anomalias cardíacas não corrigidas ou presença de próteses intracardíacas (p = 0,0001 e evidências radiográficas de cardiomegalia (p = 0,035. CONCLUSÕES: A estimulação cardíaca endocárdica permanente pela via femoral apresenta expectativa de sobrevida comparável a outras técnicas, com baixas taxas de complicações devidas ao implante de marcapasso. A sobrevida em longo prazo foi limitada pela menor idade e dilatação cardíaca no momento do implante, assim como pela presença de defeitos cardíacos sem correção ou de próteses valvares.OBJECTIVE: Permanent cardiac pacing improves survival of children with congenital or acquired bradycardia, although mortality after pacing remains relatively high. The aim of this study was to evaluate the long-term outcomes of children who undergo permanent endocardial cardiac pacing via the femoral vein, including the identification of associated

  19. ECOPERSONALISMO E DIREITO AO MEIO AMBIENTE

    Directory of Open Access Journals (Sweden)

    Jesús Ballesteros

    2008-04-01

    Full Text Available O objetivo do presente artigo consiste em refletir brevemente sobre as conseqüências, no âmbito do direito ao meio ambiente, das diferentes concepções sobre a relação entre o ser humano e a natureza, isto é, o modelo tecnocrático, o biologista e o ecológico-personalista

  20. ROTEIRO DE VIAGEM AO PAÍS DE LACAN

    Directory of Open Access Journals (Sweden)

    Laéria Fontenele

    2015-12-01

    existentes, a versão de Žižek, além de sua original edificação estilística e criativa, distingue-se das demais por propor que o leitor possa ler Lacan se fazendo valer do próprio método por ele utilizado quando de sua leitura da obra freudiana, ocasião em que propõe o retorno à verdade de sua letra: o inconsciente pensa e fala. Nele reside não uma verdade profunda, mas uma verdade insuportável e com que cada sujeito deveria aprender a viver. Um dos argumentos do livro é o de que em seu retorno à Freud, Lacan, buscou acompanhar-se de outros autores não integrantes do campo psicanalítico, dentre eles estavam: Saussure, Levi-Strauss, Jakobson, Edgar Allan Poe, Cantor, Platão, Kant, Hegel, Heidegger, Karl Marx. O mesmo é proposto pelo autor ao seu leitor, levando-o através da leitura com Lacan de autores e obras artísticas, bem como eventos de nossa cultura, a iluminar conceitos antes tidos como obscuros. Cada capítulo do livro foi construído no sentido de confrontar um conceito lacaniano com um fragmento proveniente da literatura, do cinema, de produções da mídia, da política, dentre outros, mostrando que os conceitos psicanalíticos, assim como sua dimensão clínica, estão disseminados nos diversos domínios de que é feita nossa vida. Assim, por exemplo, os conceitos de “ideal do eu” e “supereu” são transmitidos na medida em que Lacan torna-se espectador do filme “Casablanca”. O conceito de real, por sua vez, emerge da posição de Lacan como espectador de Alien. Zizek faz, também, com que Lacan  assista até mesmo novela mexicana para mencionar suas teses. É exemplar o trecho em que procura informar o leitor das teses Lacanianas acerca da dissimetria que existe, devida à incidência subjetiva da diferença sexual, no encontro amoroso entre homem e mulher. Refere-se, então, a uma peça publicitária de cerveja – veiculada pela TV britânica -, onde uma bela moça passeia ao longo da margem de um rio e depara um sapo, ao que o

  1. Adaptação das plantas ao fogo: enfoque na transição floresta - campo

    Directory of Open Access Journals (Sweden)

    Heringer Ingrid

    2001-01-01

    Full Text Available A presença de campos entremeados pela floresta de araucária, na região do planalto meridional sul brasileiro, surpreende os estudiosos, pois a vigorar o clima atual, de maiores precipitações, a tendência seria o desenvolvimento de vegetação florestal. Os distúrbios, sobretudo a interação fogo-pastejo, e as baixas temperaturas da região, são os grandes responsáveis pelos limites e expansão da floresta latifoliada, e predomínio daquele tipo de vegetação. A vegetação campestre e arbórea submetida por longo período a fogos recorrentes desenvolveu uma série de estratégias no sentido de tolerar, evitar ou responder ao fogo. A resposta individual das plantas ao fogo envolve alterações morfológicas e fisiológicas, enquanto, na comunidade, observam-se mudanças na dinâmica da associação entre espécies. Na vegetação campestre, as gramíneas são o componente da comunidade mais tolerante ao fogo, devido ao contínuo crescimento dos meristemas intercalares e de novos afilhos que crescem protegidos no solo ou na bainha de folhas velhas. O fogo estimula o florescimento em plantas cuja forma de crescimento evita grande perda de material na queima. Também promove a liberação de sementes através do choque térmico ou de substâncias liberadas na fumaça. Na comunidade, os efeitos do fogo sobre as plantas são sentidos em relação ao modo de sobrevivência, natureza e localização dos tecidos regenerados. O comportamento das plantas em relação à queima pode ser como dependentes (estímulo à reprodução, resistentes (estímulo ao rebrote, ou plantas que evitam o fogo (ciclo anual. Portanto, o fogo tem complexos efeitos sobre a estrutura da vegetação, sendo que espécies vegetais sensíveis e tolerantes à queima tem diferentes sítios de preferência no ambiente.

  2. Anestesia e síndrome do QT longo Anestesia e síndrome del QT largo Anesthesia and the long QT syndrome

    Directory of Open Access Journals (Sweden)

    Michelle Nacur Lorentz

    2007-10-01

    Full Text Available JUSTIFICATIVA E OBJETIVOS: As disritmias cardíacas são fatores importantes de morbimortalidade no período perioperatório. Dentre as causas de disritmias, a síndrome do QT longo, tanto em sua forma genética como adquirida deve ser lembrada, já que muitos fármacos usados em anestesia, bem como ocorrências no período perioperatório podem prolongar o intervalo QT e precipitar disritmias cardíacas potencialmente malignas. CONTEÚDO: Revisão da síndrome do QT longo (LQTS, abordando suas causas e sua definição, assim como os mecanismos da doença. Além de citar vários fármacos implicados no prolongamento do intervalo QT, as abordagens anestésicas mais adequadas para os pacientes afetados são sugeridas. CONCLUSÃO: A síndrome do QT longo, possível causa de morbimortalidade intra e pós-operatória, pode estar relacionada com fármacos utilizados durante anestesia. Essa condição demanda conhecimento do anestesiologista a fim de evitar desfecho desfavorável do ato operatório.JUSTIFICATIVA Y OBJETIVOS: Las arritmias cardíacas son factores importantes de morbi mortalidad en el período perioperatorio. Entre las causas de arritmias, el síndrome del QT largo, tanto en su forma genética como adquirida debe ser recordado ya que muchos fármacos usados en anestesia, e incidencias en el período perioperatorio pueden prolongar el intervalo QT y precipitar arritmias potencialmente malignas. CONTENIDO: Revisión del Síndrome del QT largo (LQTS, abordando sus causas y definición, y los mecanismos de la enfermedad. Además de citar varios fármacos implicados en el prolongamiento del intervalo QT, los abordajes anestésicos más adecuadas para los pacientes afectados son sugeridas. CONCLUSIÓN: El síndrome del QT largo, posible causa de morbimortalidad intra y postoperatoria, puede estar relacionada a fármacos utilizados durante anestesia. Esa condición demanda conocimiento del anestesiólogo para evitar un desenlace no deseado de

  3. Compostos bioativos em polpas de mangas 'rosa' e 'espada' submetidas ao branqueamento e congelamento

    Directory of Open Access Journals (Sweden)

    Lucimara Piauí Soares

    2013-06-01

    Full Text Available A manga (Mangifera indica L. constitui uma importante fonte de compostos bioativos, dentre os quais se destacam os carotenoides e a vitamina C, que contribuem para a promoção da saúde. Vários métodos podem ser utilizados para conservação de alimentos a fim de aproveitar melhor os frutos durante a safra e permitir seu armazenamento fora de época de produção. No entanto, podem alterar a qualidade nutricional do alimento. Dessa forma, sendo o branqueamento e o congelamento métodos que são utilizados no processamento industrial para conservação de polpas de frutas, objetivou-se, neste trabalho, analisar a influência do branqueamento e do congelamento sobre os teores de carotenoides totais e ácido ascórbico em mangas 'Rosa' e 'Espada' em relação ao tempo de armazenamento. As mangas no estádio maduro, após serem colhidas, lavadas, cortadas e despolpadas, foram submetidas ao congelamento (-18ºC ou branqueamento por imersão em água (75ºC, por 3 minutos ou branqueamento por vapor em água fervente, por 3 minutos. Em seguida, foram realizadas as determinações bioquímicas dos teores de carotenoides totais e ácido ascórbico no tempo zero e após 20; 40 e 60 dias de armazenamento sob congelamento. Após análise dos resultados obtidos, conclui-se que, na forma in natura (tempo zero, as variedades Rosa e Espada apresentam os máximos teores de ácido ascórbico, porém o uso do branqueamento com vapor e o congelamento após 60 dias de armazenamento provocam perdas de, respectivamente, 53% ('Rosa' e 35% ('Espada'; 72% ('Rosa' e 60% ('Espada' destes compostos. No branqueamento por imersão em água, há perda completa do ácido ascórbico nas polpas das variedades Rosa e Espada. Em relação aos carotenoides totais, os valores foram semelhantes em polpas branqueadas a vapor e sem branqueamento no tempo zero,com tendência de redução durante o longo da armazenagem.

  4. Efeito de dias longos no crescimento e florescimento de cultivares de café Effect of long days on growth and flowering of Coffea arabica cultivars

    Directory of Open Access Journals (Sweden)

    L. C. Monaco

    1978-01-01

    Full Text Available Informações iniciais indicavam que o cafeeiro arábica comportava-se como planta de dias curtos. Crescimento vegetativo mais intenso e inibição de florescimento são a conseqüência de exposição a dias longos, superiores a 14 horas. Dados recentes demonstram que essa reação não é tão clara. No presente estudo são apresentados dados relativos a ensaios realizados visando estabelecer a reação de plantas dos cultivares mundo novo, catuaí-amarelo, burbom-vermelho, geisha e semperflorens a fotoperíodos de 12 e 18 horas. Os resultados indicaram que 18 horas de luz induzem crescimento mais intenso na altura e número de internódios. O florescimento não foi afetado pelo comprimento do dia, embora os cultivares tenham reagido com diferentes intensidades. É sugerido que o cafeeiro, uma vez induzido, independe de novos períodos de indução. O efeito parece permanecer por longo tempo. A idade dos tecidos parece ser elemento determinante na capacidade de indução e diferenciação das gemas florais.The initial reports indicated that coffee is a short day plant. Data later reported, however, revealed that coffee may flower under long day photoperiod. The present study was carried out in order to evaluate the effect of day length on plants of Mundo Novo, Catuaí Amarelo, Burbom Vermelho, Semperflorens and Geisha cultivars grown under photoperiod of 12 and 18 hours. Vegetative growth was intensified by 18 hours of light. Flowering occurred more intensely in long day treatment. The data available indicate that induced coffee plants may keep the flowering capacity independently of day length. It is suggested that the age of the coffee branch tissues play an important rôle to the flowering process.

  5. Sinal filogenético e conservação filogenética de nicho : integrando métodos aos conceitos ecológicos

    OpenAIRE

    Vanderlei Julio Debastiani

    2016-01-01

    Compreender os fatores que afetam a distribuição das espécies tem sido um dos principais objetivos dos ecólogos. Atualmente, sabe-se que os processos ecológicos e evolutivos moldam a dinâmica de especiação e extinção de espécies, e determinam a distribuição e abundância das mesmas. Ao longo dos últimos anos, tem havido um aumento no número de estudos que utilizam informação filogenética para explicar as dinâmicas populacionais e as distribuições de espécies, e que buscam identificar os mecani...

  6. Ambiente digital como possibilidade para o exercício da contra-hegemonia: Jornalistas Livres, transmissões ao vivo e #GreveGeral

    Directory of Open Access Journals (Sweden)

    Iluska Coutinho

    2017-07-01

    Full Text Available A internet e as redes sociais poderiam ser espaço para  o exercício do direito à comunicação em meios que poderiam ser compreendidos como uma contra-mídia-hegemônica? Em busca de uma resposta à essa questão, o trabalho lança luz sob as potencialidades do ambiente digital para o exercício da contra-hegemonia a partir de outros olhares e iniciativas que emergem neste cenário. O objetivo é entender de que maneira um coletivo de mídia independente pode se apropriar das possibilidades do ambiente digital para realizar narrativas que caminham na direção contrária ao que é característico de uma mídia hegemônica. A análise empreendida nesse texto tem como foco as transmissões ao vivo realizadas pelo coletivo Jornalistas Livres na data em que aconteceram paralisações contra reformas trabalhistas, convocadas por entidades sindicais e movimentos sociais como Greve Geral. Por meio da análise da materialidade audiovisual, o enfoque se dá em quatro momentos ao longo do dia. 

  7. ROBO-AO M DWARF MULTIPLICITY SURVEY

    Science.gov (United States)

    Lamman, Claire; Berta-Thompson, Zachory; Baranec, Christoph; Law, Nicholas; Schonhut, Jessica

    2018-01-01

    We analyzed over 7,000 observations from Robo-AO’s field M dwarf survey taken on the 2.1m Kitt Peak telescope. Results will help determine the multiplicity fraction of M dwarfs as a function of primary mass, which is a crucial step towards understanding their evolution and formation mechanics. Through its robotic, laser-guided, and automated system, the Robo-AO instrument has yielded the largest adaptive-optics M dwarf survey to date. I developed a graphical user interface to quickly analyze this data. Initial data analysis included assessing data quality, checking the result from Robo-AO’s automatic reduction pipeline, and determining existence as well as the relative position of companions through a visual inspection. This program can be applied to other datasets and was successfully tested by re-analyzing observations from a separate Robo-AO survey. Following the preliminary results from this data analysis tool, further observations were done with the Keck II telescope by using its NIRC2 imager to follow up on ten select targets for the existence and physical association of companions. After a conservative initial cut for quality, 356 companions were found within 4” of a primary star out of 2,746 high quality Robo-AO M dwarf observations, including four triple systems. We will present a preliminary estimate for the multiplicity rate of wide M dwarf companions after accounting for observation limitations and the completeness of our search. Future research will yield insights into low-mass stellar formation and provide a database of nearby M dwarf multiples that will potentially assist ongoing and future surveys for planets around these stars, such as the NASA TESS mission.

  8. Deformable mirror designs for extreme AO (XAO)

    Science.gov (United States)

    Cavaco, Jeffrey; Wirth, Allan

    2014-08-01

    One of the science missions for the next generation of extremely large ground based telescopes (30-42m apertures) is the imaging and spectroscopy of exoplanets. To achieve that goal an Adaptive Optics (AO) subsystem with a very large number of corrected modes is required. To provide contrast ratios in the range of 10-9 or better for a 42m telescope an AO system with 25,000 to 60,000 channels will be needed. This is approximately an order of magnitude beyond the current state of the art. Adaptive Optics Associates Xinetics has developed the Photonex Module Deformable Mirror (DM) technology specifically to address the needs of extreme AO for high contrast applications. A Photonex Module is a monolithic block of electrostrictive ceramic in which a high density of individually addressable actuators are formed by screen printing of electrodes and partial wire saw cutting of the ceramic. The printed electrode structures also allow all electrical connections to be made at the back surface of the module via flex circuits. Actuator spacings of 1mm or less have been achieved using this approach. The individual modules can be edge butted and bonded to achieve high actuator count. The largest DMs fabricated to date have 4096 actuators in a 64X64mm array. In this paper the engineering challenges in extending this technology by a factor of ten or more in actuator count will be discussed. A conceptual design for a DM suitable for XAO will be presented. Approaches for a support structure that will maintain the low spatial frequency surface figure of this large (~0.6m) DM and for the electrical interface to the tens of thousands of actuators will be discussed. Finally, performance estimates will be presented.

  9. Violência sexual e coocorrências em crianças e adolescentes: estudo das incidências ao logo de uma década

    Directory of Open Access Journals (Sweden)

    Jacqueline Reiter de Oliveira

    2014-03-01

    Full Text Available O presente estudo analisa a evolução da incidência da violência sexual (VS e coocorrências, ao longo de 2001 a 2010. Constitui série histórica de casos a partir dos Conselhos Tutelares e CREAS de Feira de Santana (BA, Brasil. Foram calculados coeficientes de incidência da violência sexual e outras violências concomitantes e elaboradas curvas desses eventos. No total dos casos de violência sexual registrados, 21,8% tiveram outras coocorrências; a maioria do sexo feminino, com maior frequência na adolescência, embora com alta proporção de abuso em crianças do sexo masculino; a maior parte dos agressores era conhecido ou familiar. A incidência da VS mostrou tendência crescente em ambos os sexos, ao longo da década, expressivamente no feminino: em 2002 e 2009; as faixas etárias mostraram a mesma tendência, com maior proporção de casos na adolescência. O registro das coocorrências à VS foi mais expressivo na 2ª metade da década: violência psicológica em 2008; negligência em 2008; violência física, em 2009. O aumento dos coeficientes de VS e coocorrências sugerem aprimoramento do sistema de notificação das instâncias de referência, bem como maior participação popular, através do Disque 100. Os indicadores contribuem para a prevenção e controle da violência infanto-juvenil.

  10. Um modelo integrado econométrico+insumo-produto para previsão de longo prazo da demanda de combustíveis no Brasil

    Directory of Open Access Journals (Sweden)

    Flaviane Souza Santiago

    2012-05-01

    Full Text Available O artigo apresenta um modelo integrado de tipo econométrico+insumo-produto para previsões de longo prazo da demanda de combustíveis no Brasil. O modelo é baseado na integração por ligação de um modelo vetorial de correção de erros com um modelo de insumo-produto híbrido para a economia brasileira e permite fazer previsões anuais de consumo para quatro grupos de combustível: gasolina, óleo diesel, óleo combustível e álcool. No processo de desenvolvimento, tanto o modelo econométrico quanto o modelo integrado foram submetidos a testes de desempenho preditivo, com o último sendo calibrado para melhor performance, usando-se dados disponíveis para o período de 2004 a 2007. Posteriormente, o modelo integrado é usado para gerar previsões no período de 2008 a 2017. As previsões são baseadas em dois cenários alternativos, um prevendo duração curta, e o outro, duração longa para a atual crise econômica mundial. Os resultados obtidos indicam que, em ambos os casos, ocorrerá significativo aumento da demanda de combustíveis nos próximos 10 anos.

  11. Investigação da memória de longo prazo na taxa de câmbio no Brasil

    Directory of Open Access Journals (Sweden)

    Sergio R. S. Souza

    2006-06-01

    Full Text Available Neste trabalho, é medida a evolução da memória de longo prazo da taxa de câmbio diária, Real contra Dólar dos Estados Unidos, no período de 1995 a 2004. Essa medição é realizada por meio da análise R/S clássica, com janela móvel de dados. O trabalho focaliza o abandono do regime de câmbio administrado em favor do de câmbio flutuante, ocorrido em 1999, identificando antipersistência da taxa de câmbio durante a vigência do primeiro regime e memória longa a partir do início da vigência do segundo regime. Mostra também evidência de memória longa para as volatilidades dos retornos das taxas analisadas.This paper presents measures of long-range dependence in daily exchange rates of the Brazilian Real against the US Dollar, taken from 1995 to 2004 employing the classical R/S analysis with a rolling sample. It analyses the switch from a crawling peg exchange regime to a floating exchange regime, in 1999, finding antipersistence in the exchange rate during the first exchange regime, and long memory in the exchange rates along the second one. Also, it finds long memory for the exchange rates' volatilities along the whole period.

  12. O PAPEL DO BANCO NACIONAL DE DESENVOLVIMENTO ECONÔMICO E SOCIAL COMO FINANCIADOR DOS INVESTIMENTOS DE LONGO PRAZO: O CASO DO GRUPO EBX - BRASIL

    Directory of Open Access Journals (Sweden)

    Claudia Oliveira

    2015-05-01

    Full Text Available O Banco Nacional de Desenvolvimento Econômico e Social (BNDES vem desempenhando um papel relevante com os financiamentos de longo prazo às grandes empresas privadas nacionais, a partir dos anos 2000. Mesmo após as privatizações, quando deixou de ser o Estado-empresário, o setor público continua sendo importante ordenador da estrutura produtiva brasileira. Este artigo analisa como o BNDES, a subsidiária de participação acionária BNDESPAR, os fundos de pensão e as empresas privadas são atores centrais na compreensão das redes de proprietários no Brasil. A expansão do grupo EBX em setores estratégicos, os dados apresentados sobre os desembolsos do BNDES e as importantes alianças políticas do empresário Eike Batista ajudam a ilustrar a dinâmica de laços entre Estado e empresas privadas nacionais, e corroborar a ideia de que, apesar de mudanças na atuação, o Estado não perdeu centralidade no comando da economia brasileira.

  13. Reabilitação pulmonar em longo prazo na doença pulmonar obstrutiva crônica (DPOC

    Directory of Open Access Journals (Sweden)

    Cintia Laura Pereira de Araújo

    2014-04-01

    Full Text Available Introdução: A Doença Pulmonar Obstrutiva Crônica (DPOC prejudica o estado funcional, com consequente limitação das Atividades de Vida Diária (AVD. Este estudo teve como objetivo investigar o efeito de um programa de Reabilitação Pulmonar (RP, em longo prazo, no estado funcional, na dispneia e no índice BODE em pacientes com DPOC. Relato de caso: Trata-se de um estudo retrospectivo e documental, com análise dos prontuários de cinco pacientes participantes de um programa de RP por um ano. Destes prontuários foram coletados dados referentes às avaliações: espirometria, Índice de Massa Corporal (IMC, escalas London Chest Activity of Daily Living (LCADL e Medical Research Council e (MRC teste de caminhada de seis minutos. Após um ano participando do programa de exercício físico, a maioria dos pacientes apresentou maior capacidade funcional, menor dispneia e redução no risco de mortalidade. Conclusão: Um ano de RP parece ter função de manutenção da melhora da capacidade funcional de pacientes com DPOC, após 24 sessões de treinamento.

  14. Epidemiologia da tricomoniose e sensibilidade ao metronidazol

    OpenAIRE

    Alves, Maria José Gonçalves

    2006-01-01

    A Trichomonas vaginalis é o agente etiológico da tricomoniose, a doença sexualmente transmissível (DST) não viral mais comum no mundo. Actualmente é sabido que promove a transmissão do vírus do HIV, é causa de baixo peso em bebés, bem como de nascimentos prematuros, predispõe mulheres a doença inflamatória pélvica atípica, neoplasia cervical e infertilidade. Acresce ao problema o facto de serem usadas metodologias de diagnóstico com baixa sensibilidade e ainda o aumento de c...

  15. Esta é minha carta ao mundo

    Directory of Open Access Journals (Sweden)

    Fernanda Mourão

    2009-01-01

    Full Text Available A partir da primeira carta de Emily Dickinson (1830-1886 a Thomas Higginson, que então seria seu “preceptor” e interlocutor para sempre, este texto propõe uma leitura da obra da escritora norte-americana a partir do biografema da carta e da ideia de sua obra como “carta ao mundo” – conforme um de seus mais famosos poemas –, com todas as implicações trazidas pelo termo, e à luz das teorias de Roland Barthes, Maurice Blanchot e Silvina Rodrigues Lopes, entre outros.

  16. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    OpenAIRE

    Mónica Brinquinho; Ana Andresa Sousa; Janine Resende; João Valente

    2017-01-01

    O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores ...

  17. Meloxicam associado ou não ao tramadol no controle da dor após ovário-histerectomia videoassistida em cadelas

    Directory of Open Access Journals (Sweden)

    M.T. Oliveira

    2016-02-01

    Full Text Available O objetivo deste estudo foi avaliar a eficácia do meloxicam associado ou não ao tramadol, no controle da dor após ovário-histerectomia (OVH laparoscópica com dois portais. Foram selecionadas 14 cadelas hígidas. Os animais foram separados de forma aleatória, em dois grupos. O grupo M (GM recebeu meloxicam (0,2mg kg-1, s.i.d., enquanto os animais do grupo MT (GMT receberam a associação de meloxicam (0,2mg kg-1, s.i.d. e tramadol (4mg kg-1, t.i.d., ambos durante dois dias de pós-operatório. Para avaliação da dor pós-cirúrgica, foram utilizadas as escalas de Melbourne e escala visual analógica (EVA, além de mensurações de glicemia e cortisol sérico. Não houve diferença ao se avaliarem os grupos GM e GMT pela escala de Melbourne nem pela EVA. As mensurações de cortisol não atingiram valores superiores aos de referência para a espécie, enquanto os valores de glicemia não apresentaram variação significativa ao longo do tempo de avaliação nem entre grupos. Com os resultados deste estudo, foi possível concluir que a utilização de meloxicam associado ou não ao tramadol, nas doses e posologias propostas, é eficaz para controlar a dor pós-operatória de cadelas submetidas à OVH laparoscópica com dois portais.

  18. Avaliação clínica a longo prazo - pelo sinal de Phalen, Tinel e parestesia noturna - dos pacientes submetidos a cirurgia de liberação do túnel do carpo com instrumento de Paine® Long-term clinical evaluation - by Phalen, Tinel sign and night paresthesia - of patients submitted to carpal tunnel release surgery with Paine® retinaculatome

    Directory of Open Access Journals (Sweden)

    Sergio Eiti Carbone de Paula

    2006-01-01

    Full Text Available A liberação do retináculo dos flexores para o tratamento da síndrome do túnel do carpo (STC é uma das cirurgias mais realizadas. Existem diversos métodos para a realização deste procedimento cirúrgico, como endoscópicos, via aberta clássica e mini-incisões. A longo prazo, poucos trabalhos mostram os resultados destas cirurgias. Este estudo tem como finalidade avaliar os pacientes submetidos à liberação do túnel do carpo com instrumento de Paine®, com no mínimo 84 meses de pós-operatório. Foram avaliados os parâmetros clínicos: teste de Phalen, sinal da percussão dolorosa e a queixa de parestesia noturna no pré e pós-operatório. Os resultados mostram que há significante melhora dos sinais avaliados (p....., quando comparados com a avaliação inicial, e que estes sinais clínicos permanecem negativos ao longo do tempo.The release of flexors retinaculum for carpal tunnel syndrome (CTS treatment is one of the most frequently performed surgeries. There are many methods for performing this surgical procedure, such as endoscopic, classical open port and mini-incisions. Few papers show the long-term results of those surgeries. This study is aimed to evaluate patients submitted to carpal tunnel syndrome release using the Paine® instrument, in at least 84 months postoperatively. The following clinical parameters were assessed: Phalen test, painful percussion sign, and complaints of nighttime paresthesia pre- and postoperatively. The results show that there is a significant improvement of the signs assessed (p....., when compared to baseline evaluation, and that those clinical signs remain negative with time.

  19. O TEMA DA JUSTIFICAÇÃO NAS CARTAS AOS ROMANOS E AOS GÂLATAS

    Directory of Open Access Journals (Sweden)

    James N. F. Alisson

    1990-01-01

    Full Text Available Uma das dificuldades para entender a doutrina de Paulo sobre a justificação é o fato de esse tema constar em escritos que retomam a exposição anteriormente apresentada em forma oral à comunidade cristã da Galácia e de Roma. Ele escreve aos destinatários com a finalidade de esclarecer assunto anteriormente explicado. É o que se vê nas referências ao quérigma que recordam o primeiro anúncio da salvação em Cristo, já comunicado aos destinatários em outra ocasião. O uso freqüente da fórmula "acaso não sabeis?" é indício do conhecimento que os destinatários têm sobre o assunto.

  20. Fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes

    OpenAIRE

    Morais, Caroline Neves de

    2015-01-01

    O excesso de peso e o ganho ponderal estão associados a um conjunto complexo de fatores que atuam desde a vida fetal. O presente estudo teve como objetivo verificar os fatores associados ao elevado ganho ponderal e ao excesso de peso de lactentes. Trata-se de um estudo realizado com dados secundários de uma pesquisa de corte transversal que envolveu 967 mães e lactentes do estado de Pernambuco. Na caracterização do estado nutricional utilizou-se o índice de massa corporal para ...

  1. AO Observations of Three Powerful Radio Galaxies

    Energy Technology Data Exchange (ETDEWEB)

    de Vries, W; van Bruegel, W; Quirrenbach, A

    2002-08-01

    The host galaxies of powerful radio sources are ideal laboratories to study active galactic nuclei (AGN). The galaxies themselves are among the most massive systems in the universe, and are believed to harbor supermassive black holes (SMBH). If large galaxies are formed in a hierarchical way by multiple merger events, radio galaxies at low redshift represent the end-products of this process. However, it is not clear why some of these massive ellipticals have associated radio emission, while others do not. Both are thought to contain SMBHs, with masses proportional to the total luminous mass in the bulge. It either implies every SMBH has recurrent radio-loud phases, and the radio-quiet galaxies happen to be in the ''low'' state, or that the radio galaxy nuclei are physically different from radio-quiet ones, i.e. by having a more massive SMBH for a given bulge mass. Here we present the first results from our adaptive optics imaging and spectroscopy pilot program on three nearby powerful radio galaxies. Initiating a larger, more systematic AO survey of radio galaxies (preferentially with Laser Guide Star equipped AO systems) has the potential of furthering our understanding of the physical properties of radio sources, their triggering, and their subsequent evolution.

  2. Nefrocalcinose associada ao uso de esteroide anabolizante

    Directory of Open Access Journals (Sweden)

    Weverton Machado Luchi

    2015-03-01

    Full Text Available Os esteroides anabolizantes têm sido usados como arma terapêutica em diversas condições clínicas. Entretanto, o uso abusivo e indiscriminado, associado a outros suplementos nutricionais, tem gerado efeitos adversos graves. Relato do caso: Sexo masculino, 21 anos, admitido com náuseas, astenia, hiporexia, cefaleia e hipertensão arterial. Exames no sangue evidenciaram Cr: 3,9 mg/dl U:100 mg/dl e Cálcio total 14 mg/dl. Ultrassonografia e biópsia renal compatíveis com nefrocalcinose. Houve melhora gradativa da função renal e da calcemia após hidratação vigorosa e furosemida. Entretanto, após 1 ano, persistiram depósitos renais de cálcio e relação córticomedular reduzida ao ultrassom e creatinina estável em 1,4 mg/dl. Casos anteriores evidenciaram necrose tubular aguda e nefrite intersticial com poucos depósitos de cálcio no interstício renal. Nesse caso, encontramos nefrocalcinose acentuada associada à nefroesclerose. O objetivo deste estudo é relatar a ocorrência de injúria renal aguda com nefrocalcinose associada ao uso de esteroide anabolizante e oferecer uma revisão do assunto.

  3. Escala de valores relativos ao trabalho : EVT

    Directory of Open Access Journals (Sweden)

    Porto Juliana Barreiros

    2003-01-01

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  4. Escala de valores relativos ao trabalho: EVT

    Directory of Open Access Journals (Sweden)

    Juliana Barreiros Porto

    Full Text Available Na literatura internacional são encontradas várias escalas para medir valores relativos ao trabalho, porém a maioria apresenta problemas com relação à definição do conceito ou a falta de integração com os modelos teóricos sobre valores pessoais. No Brasil foram encontrados dois instrumentos, um não foi validado para a população brasileira e o outro foi validado para uma população de baixa escolaridade. Foi objetivo do presente estudo desenvolver e validar uma Escala de Valores relativos ao Trabalho. Para o desenvolvimento da EVT foi realizado um levantamento de instrumentos anteriores e foram entrevistados trabalhadores. Após a análise de juízes e validação semântica, o instrumento foi respondido por 394 pessoas. A análise fatorial apontou para quatro fatores: Realização no trabalho, Relações sociais, Prestígio e Estabilidade. O instrumento após validação é composto por 45 itens. Os resultados corroboraram o modelo teórico previsto e conclui-se que a escala foi devidamente estabelecida e pode ser utilizada para pesquisa e diagnóstico.

  5. Mudança de estrutura moraica do latim ao português

    Directory of Open Access Journals (Sweden)

    Evellyne Patrícia Figueiredo de Sousa Costa

    2011-12-01

    Full Text Available Este estudo tem como objetivo investigar a evolução da estrutura moraica do latim ao português. A língua latina apresenta distinção quantitativa vocálica e consonantal: (i sílabas leves, portadoras de uma mora (e.le.men.tum; (ii sílabas pesadas, portadoras de duas moras (bul.ga; (iii sílabas superpesadas, portadoras de três moras segundo a nossa proposta (paul.lum. Diacronicamente, há a perda da distintividade quantitativa dentre as vogais e, na passagem às línguas neorromânicas, a estrutura moraica tem seus efeitos. Diante desse cenário e a partir dos pressupostos da Teoria Moraica de Hayes (1989, investigamos os efeitos dessa mudança através de processos fonológicos envolvidos, tais como ditongação e monotongação. A Teoria Moraica busca caracterizar de que modo as línguas atribuem estrutura moraica e que princípios atuam nessas línguas. Hayes (1989 define mora como uma unidade de peso do tier prosódico que caracteriza o contraste entre sílabas longas e breves, além de contar como uma posição fonológica (segmento longo é representado como duplamente ligado. Propomos que as escolhas feitas pela língua portuguesa, tais como ditongação e monotongação, para lidar com a estrutura moraica latina já estão disponíveis em latim vulgar e que princípios como Stray Erasure e Parasitic Delinking, relacionados com Licenciamento Prosódico atuam na referida mudança.

  6. Da ortopedia ao controle do corpo: o discurso da saúde na publicidade

    Directory of Open Access Journals (Sweden)

    Luciane Lucas

    2008-09-01

    Full Text Available RESUMO Este artigo aborda as transformações da concepção de corpo da sociedade disciplinar – Foucault – para a de controle – Deleuze –, com base na análise das representações de corpo presentes em anúncios3 de medicamentos e cosméticos em dois momentos da publicidade brasileira: a década de 1920 e a atualidade – segunda metade da década de 1990 até o presente momento. Embora os cuidados com o corpo tenham se transformado significativamente ao longo do século passado, observa-se, nas campanhas e peças analisadas, que a noção de imperfeição e a necessidade de aprimoramento permanecem como traço constitutivo do imaginário de corpo. Palavras-chave: Corpo; publicidade brasileira; medicamento; cosmético. ABSTRACT This article deals with the transformations undergone by the conception of body, from the disciplinary society – Foucault – to the society of control – Deleuze –, using as our starting point representations of the body found in advertisements for medicines and cosmetics in two moments of Brazilian publicity: the 1920’s and now – from the second half of the 1990’s to the present day. In spite of significant changes in body care throughout the 20th century, we can notice in the campaigns and advertisements under analysis that the notions of imperfection and the need of improvement are still constituent features in the cultural imaging of the body. Keywords: Body; Brazilian advertising; medicine; cosmetic.

  7. Diferentes Metodologias Aplicadas ao Ensino de Astronomia

    Science.gov (United States)

    Albrecht, E.; Voelzke, M. R.

    2007-08-01

    Espera-se que o educando ao final da educação básica, adquira uma compreensão atualizada das hipóteses, modelos e formas de investigação sobre a origem e evolução do Universo em que vive. O presente trabalho tem como principal objetivo compreender dentre três práticas pedagógicas adotadas no Ensino de Astronomia, na terceira série do Ensino Médio, da Escola Estadual Colônia dos Pescadores, qual melhor cumpre o papel de formação e aprendizagem para vida. A pesquisa preliminar foi através de um questionário onde o intuito foi diagnosticar o conhecimento já existente acerca do tema em questão. O questionário é composto de vinte questões dissertativas e objetivas, onde os educandos das três turmas envolvidas o responderam. Este trabalho utiliza as seguintes metodologias: a tradicional, onde o professor é um repassador de informações, fazendo uso exclusivo de lousa e giz; a segunda também de forma tradicional, porém com auxílio de multimídia para desenvolvimento das aulas e aterceira sob forma de seminários, elaborados e apresentados pelos educandos, no qual o educador faz apenas as intervenções necessárias. Ao final do trabalho os alunos responderão novamente o questionário inicial para diagnosticar dentre as três metodologias utilizadas qual apresentou melhor resultado. Os resultados preliminares obtidos, já podem ser observados e, dos 119 alunos entrevistados, as respostas obtidas são as mais diversas e evidenciam que a grande maioria nunca teve em sua vida escolar o tema Astronomia. Ao serem questionados se já haviam estudado Astronomia as respostas foram: turma A: sim 43%; turma B: sim: 21%; turma C: sim: 24%. Porém quando questionados a respeito do significado de Astronomia observou-se que: turma A: 100% de acertos; turma B: 64% acertos; turma C: 84% de acertos, demonstrando claramente a aprendizagem em diferentes esferas, não dependendo unicamente da escola. Até o presente momento, verificou-se que há interesse em

  8. Hepatotoxicidade associada ao uso de esteroides anabolizantes

    Directory of Open Access Journals (Sweden)

    Mónica Brinquinho

    2017-06-01

    Full Text Available O consumo de esteroides androgénicos anabolizantes tem vindo a aumentar no meio desportivo amador, sendo de fácil acesso apesar de se tratarem de substâncias proibidas. Estão descritos múltiplos efeitos laterais, sendo a hepatotoxicidade uma das mais reportadas. Apresentam-se dois casos clínicos representativos da lesão hepática associada ao consumo de esteroides anabolizantes. Ambos evidenciaram morbilidade significativa, embora nenhum deles tenha evoluído para falência hepática. Os autores pretendem chamar a atenção para o consumo destes fármacos, particularmente frequente em indivíduos jovens, praticantes de desporto amador.

  9. Acesso ao aborto e liberdades laicas

    Directory of Open Access Journals (Sweden)

    Roberto Arriada Lorea

    2006-12-01

    Full Text Available Enfrentar o tema do aborto no Brasil requer uma perspectiva laica, na medida em que a liberdade de consciência assegurada na Constituição Federal impõe ao Estado contemplar não apenas as diferentes visões oriundas de distintas religiões, mas, principalmente, assegurar o direito à diversidade existente no seio de uma mesma religião, garantindo o direito de divergir da hierarquia de sua própria igreja. Assim, não havendo obstáculo jurídico à descriminalização do aborto no país, resta aos legisladores reformar a lei vigente, para descriminalizar o aborto, atendendo os compromissos assumidos pelo Brasil perante organismos internacionais de proteção dos direitos humanos e assegurando a eficácia das liberdades laicas.In Brazil, face an issue like abortion requires a lay perspective considering that the freedom of conscience assured by the Federal Constitution lays upon the State the need to look not only at different views from different religions but specially assure the right to the existing diversity within the same religion, as well as, the right to diverge from the hierarchy of his/her own religion. Therefore there is no legal barrier for the decriminalization of abortion in the country. It is up to the legislators to reform the present law to decriminalize abortion, assuming the commitments made by Brazil upon international organizations for the protection of the human rights assuring the efficacy of lay liberties.

  10. Panencefalite subaguda esclerosante: transmissão de agente encefalitogênico humano ao macaco rhesus

    Directory of Open Access Journals (Sweden)

    Alexandre Alencar

    1971-12-01

    ônica" neuronal e espongiose cortical bem como pelo período longo de incubação, deva pertencer ao grupo dos chamados vírus lentos.

  11. Baixo peso ao nascer e obesidade: associação causal ou casual?

    Directory of Open Access Journals (Sweden)

    Adolfo Monteiro Ribeiro

    2015-09-01

    Full Text Available ResumoObjetivo:Apresentar as bases conceituais que explicam como eventos na vida intrauterina podem influenciar o desenvolvimento corporal e enfatizar a interrelação entre baixo peso ao nascer e risco de obesidade ao longo da vida.Fontes de dados:Google Scholar, Scientific Electronic Libraty Online (SciELO, EBSCO, Scopus e PubMed foram as bases de dados. “Catch-up growth”, “lifecourse health”, “disease”, “child”, “development”, “early life”, “perinatal programming”, “epigenetics”, “breastfeeding”, “small baby syndrome”, “phenotype”, “micronutrients”, “maternal nutrition”, “obesity” e “adolescence” foram descritores isolados ou associados para localizar revisões, estudos epidemiológicos, de intervenção ou experimentais publicados entre 1934 e 2014, com textos integrais, em português e inglês. Excluíram-se duplicidades, editoriais, resenhas e abordagens de doença diferente da obesidade.Síntese dos dados:Nos 47 artigos selecionados dentre 538 elegíveis, identificaram-se as hipóteses do fenótipo poupador, dos mecanismos epigenéticos e da plasticidade do desenvolvimento como fundamentais para explicar mecanismos envolvidos na saúde e nas doenças durante a vida. Elas admitem a possibilidade de eventos cardiometabólicos e obesidade terem origem em deficiência intraútero de nutrientes que, associados a suprimento alimentar excessivo às necessidades metabólicas nas fases precoces da vida, provoca alterações endócrinas. Todavia pode haver reprogramação fenotípica que supere ambiente restritivo intrauterino para nascidos com baixo peso a partir de oferta nutricional adequada. Assim, o catch-up growth indicaria recuperação da restrição intrauterina e se associaria a benefícios em curto prazo ou prejuízos no adulto.Conclusões:Na dependência de adequação nutricional nos primeiros anos de vida, a plasticidade do desenvolvimento pode levar à reprogramação fenot

  12. A Influência da Confiança, Dependência e Comprometimento na Orientação de Longo Prazo de Varejistas para com os Fabricantes Líderes do Mercado de Bebidas

    Directory of Open Access Journals (Sweden)

    Ivan Lapuente Garrido

    2013-09-01

    Full Text Available O objetivo principal deste estudo é analisar como a confiança, o comprometimento e a dependência influenciam a orientação de longo prazo de varejistas para com o relacionamento com as empresas fabricantes de cervejas e refrigerantes líderes no mercado nacional. Para atingir o objetivo proposto, fizeram-se necessárias duas etapas de pesquisa. Na primeira etapa de cunho exploratório, foram realizadas entrevistas em profundidade com varejistas que possuíam relacionamento comercial com as empresas líderes do mercado nacional de cervejas e refrigerantes; esta etapa possibilitou aprofundamento sobre o campo de estudo e adequação de escalas aplicadas a segunda etapa de pesquisa. Na segunda etapa de pesquisa, por meio de questionário composto por questões fechadas, 299 varejistas avaliaram seu relacionamento com os fabricantes líderes de mercado. Utilizando-se de regressão múltipla, os resultados indicam que: (a a dependência dos varejistas influencia positivamente o comprometimento para com os fabricantes, (b a confiança influencia positivamente a orientação de longo prazo dos varejistas para com os fabricantes e, (c o comprometimento influencia positivamente a orientação de longo prazo dos varejistas para com os fabricantes. As hipóteses que consideravam a relação entre confiança e comprometimento e entre dependência e orientação de longo prazo não obtiveram significância estatística. DOI: 10.5585/remark.v12i3.2328

  13. Do Brincar Com Jogos Digitais ao Brincar Para Jogos Digitais em Comunidades de Prática

    Directory of Open Access Journals (Sweden)

    Georgia Daniella Feitosa de Araújo Ribeiro

    2016-09-01

    Full Text Available Resumo: Este artigo aborda algumas implicações de práticas sociais para o desenvolvimento de jogos digitais na educação infantil, com a participação de crianças e de suas culturas infantis ao longo do processo de desenvolvimento. Fundamenta-se em categorias epistemológicas centrais, as quais se relacionam com: Cognição/Aprendizagem Situada e Comunidades de Prática; Culturas Infantis/ Culturas de Pares; Design Participativo com crianças. Desse modo, são tecidas reflexões sobre as consequências de uma mudança de paradigma na educação formal escolar (especificamente educação infantil, em que à criança possa ser dada a possibilidade de criação de brinquedos típicos da contemporaneidade, realçando seu lugar de atores sociais. Palavras-chave: Jogos digitais; Comunidades de Prática; Infância

  14. Papel da informação na área da qualidade: do fordismo ao capitalismo cognitivo

    Directory of Open Access Journals (Sweden)

    Vanessa de Arruda JORGE

    Full Text Available Este artigo objetiva analisar o papel da informação nas principais mudanças ocorridas na área da qualidade, de modo associado às transformações no trabalho. Com base em pesquisa e análise bibliográfica, desenvolveu-se um quadro analítico, em que se apresenta uma periodização dando conta da evolução das mudanças da informação, ao longo das diferentes fases históricas da qualidade, em sua relação com as transformações no trabalho, desde o fordismo até o capitalismo cognitivo. Conclui-se que a informação ganhou maior destaque nos processos de qualidade a partir do momento em que ganha também importância o trabalho imaterial, cognitivo e linguístico, como gerador de valor e inovação, configurando-se como elemento chave para a qualidade.

  15. Hospital Amigo da Criança: prevalência de aleitamento materno exclusivo aos seis meses e fatores intervenientes

    Directory of Open Access Journals (Sweden)

    Sonia Fontes Figueredo

    2013-12-01

    Full Text Available O objetivo da pesquisa foi identificar o padrão de aleitamento materno exclusivo nos primeiros seis meses de vida de crianças nascidas em um Hospital Amigo da Criança e os fatores que contribuíram para o desmame precoce. Estudo de coorte prospectivo com 261 mães e crianças. Os dados foram avaliados utilizando-se a análise de sobrevivência através da construção da curva de Kaplan-Meier e teste de Log-Rank para a análise univariada. Foi realizada análise multivariada utilizando-se o modelo de Regressão de Cox com riscos proporcionais. Ao longo dos seis meses, o aleitamento materno exclusivo praticado com 30, 90, 120, 150 e 180 dias foi 75%, 52%, 33%, 19% e 5,7%, respectivamente. Na análise multivariada, as variáveis que mostraram risco para o desmame precoce foram a intercorrência mamária hospitalar e, na consulta de retorno, a posição inadequada e a associação das duas anteriores. A Iniciativa Hospital Amigo da Criança favoreceu o aleitamento materno exclusivo.

  16. A capacidade de estar só: um contraponto winnicottiano ao ideal contemporâneo de autonomia absoluta

    Directory of Open Access Journals (Sweden)

    Beatriz Gang Mizrahi

    2007-12-01

    Full Text Available Segundo Robert Castel, o projeto moderno de liberdade ea u t o n omi a e x i g i u a c o n s t r u ç ã o d e s u p o r t e s s o c i a i s q u ecompensaram a vulnerabilidade do indivíduo, deixado inicialmenteà mercê de si mesmo na aurora da modernidade. Esta análise sugerea tese paradoxal de que a liberdade individual não contradiz, pelocontrário, supõe a consistência dos laços sociais que permitam olivre exercício da autonomia. Winnicott, por sua vez, contribuipara a compreensão desse paradoxo, do ponto de vista subjetivo,mostrando como, ao longo do processo maturacional, nas suasdiferentes fases, a autonomia do indivíduo, representada pelacapacidade de estar só, depende da presença de um ambientesuficientemente forte para suportar que ele se discrimine sem riscode ruptura e solidão. Este trabalho representa, portanto, umatentativa de articulação das contribuições da sociologia e dapsicanálise no entendimento da crise que atravessa a sociedadecontemporânea, conseqüente da dissolução dos suportes sociais.

  17. Políticas sociais de atendimento às crianças e aos adolescentes no Brasil Social policies for children and adolescents in Brazil

    Directory of Open Access Journals (Sweden)

    José Roberto Rus Perez

    2010-08-01

    Full Text Available Este artigo analisa a emergência e o desenvolvimento das políticas sociais de atendimento infanto-juvenil concomitante ao processo de desenvolvimento do sistema de proteção social nacional, focalizando algumas das principais representações atribuídas à infância, de acordo com o período histórico e político de cada época. Busca-se apresentar a noção de infância instituída sob a constituição do aparato do Estado de Bem-Estar brasileiro, de forma a situá-la em um contexto mais amplo de transformações históricas e políticas que envolveram a emergência e consolidação das políticas sociais destinadas ao atendimento à criança e ao adolescente no Brasil ao longo do século XX e início do século XXI.This article analyses the emergence and development of social policies for children and adolescents attendance that are in line with the development process of the Brazilian social protection system, focusing on some of the main representations attributed to childhood, according to the historical and political periods. It seeks to present the notion of childhood instituted under the constitution of the Brazilian welfare state, in such a way as to place it within the broader context of the historical and political transformations that involved the emergence and consolidation of the social policies directed towards children and adolescents in Brazil in the 20th century and the beginning of the 21st.

  18. Review of AO calibrations, or how to best educate your AO system

    Science.gov (United States)

    Kolb, Johann

    2016-07-01

    If the Real-Time Computer is the heart of an AO system, the Wavefront Sensor (WFS) its eyes, the Deformable Mirror (DM) its hands and the control strategy its nervous system, the sum of all those parts is made into a harmonious entity thanks to calibrations. This paper does not have the ambition to provide an overview of all the currently existing calibration strategies, but rather to focus on a few challenging problems and their recent evolution in the era of adaptive telescopes, mostly based on the experience of ESO's Adaptive Optics Instruments in general and the AO Facility in particular. Single most important calibration in post-focal AO system, the recording of the Interaction Matrix (IM) between WFS and DM has since long evolved to use fast modulation techniques, has shown to be feasible on-sky and is now almost free from measurements thanks to its pseudo-synthetic generation, quasi-mandatory solution in an adaptive telescope. Pseudo- because it requires an unprecedented knowledge of the components' characteristics, especially the WFS, DM and the optical registration between the two. Bigger telescopes and the use of Laser Guide Stars (LGS) also mean that the properties of the system will change in time and thus need to be constantly updated thanks to online diagnosis tools for spot size measurement, atmosphere monitoring, Wavefront Sensing and control optimization. New loops come into play like the one to minimize LGS Jitter and the one taking over the telescope active optics by means of offloading the DM low orders, and they all require calibration. More calibration means more time and one has to carefully balance the calibrations that require precious telescope night time, day time or for the best, no telescope time at all. Their importance sometimes underestimated, calibrations have repeatedly shown to be a vital part in the optimum functioning of present and future AO systems.

  19. Fatores associados ao estado nutricional de idosos de duas regiões do Brasil Factors associated with nutritional status of the elderly in two regions of Brazil

    Directory of Open Access Journals (Sweden)

    Daniele Fares

    2012-08-01

    Full Text Available OBJETIVO: Verificar a associação do estado nutricional com fatores sociodemográficos, estilo de vida e condições de saúde em idosos de dois municípios de regiões distintas do Brasil. MÉTODOS: Estudo epidemiológico transversal, de base domiciliar, envolvendo 477 e 316 idosos (> 60 anos dos municípios de Antônio Carlos (AC-SC e Lafaiete Coutinho (LC-BA, respectivamente. O estado nutricional foi verificado usando-se o índice de massa corporal (IMC. As variáveis explanatórias do estudo foram: sexo, idade, escolaridade, arranjo familiar, ocupação ao longo da vida, tabagismo, consumo de álcool, tempo sentado, hipertensão, diabetes, artrose, doenças respiratórias e uso de medicamentos. Utilizou-se análise de regressão logística (bruta e ajustada. RESULTADOS: O baixo peso (IMC 27,0 kg/m² foi mais prevalente entre os indivíduos de AC-SC (52,8% vs. 28,2%. Em AC-SC, o baixo peso foi positivamente associado ao grupo etário mais velho (> 75 anos e aos fumantes, e inversamente associado ao maior tempo sentado (> 6h/dia. O excesso de peso foi positivamente associado ao maior tempo sentado, à hipertensão e à artrose, e inversamente associado aos idosos mais velhos, ao sexo masculino, ao trabalho na zona rural e ao consumo de álcool. Em LC-BA, nenhuma variável explanatória foi associada ao baixo peso. O excesso de peso foi positivamente associado à hipertensão e inversamente associado aos idosos de 75 anos e mais e ao fato de viverem sozinhos. CONCLUSÃO: O baixo peso foi mais prevalente em LC-BA e o excesso de peso em AC-SC. Os fatores associados ao estado nutricional são específicos a cada município.OBJECTIVE: To verify the association of nutritional status with sociodemographic factors, lifestyle, and health status in elderly individuals from two cities in different regions of Brazil. METHODS: Cross-sectional epidemiological home-based study, involving 477 and 316 elderly individuals (> 60 years from the towns of Ant

  20. Adesão ao tratamento da Hanseníase: dificuldades inerentes aos portadores

    Directory of Open Access Journals (Sweden)

    Izaildo Tavares Luna

    2010-12-01

    Full Text Available Esta pesquisa, realizada em Guaiúba, CE, Brasil, objetivou identificar as dificuldades de adesão ao tratamento pelos portadores de hanseníase, relacionando os fatores associados. Estudo qualitativo, cujos dados foram coletados a partir de uma visita domiciliária com roteiro de entrevista contendo sete questões norteadoras. Participaram pacientes com diagnóstico de hanseníase e histórico de não adesão ao tratamento. Utilizou-se o Modelo de Atividade de Vida de Roper, Logan e Tierney. As falas dos sujeitos foram categorizadas de acordo com as doze atividades de vida. A utilização do modelo possibilitou uma abordagem holística sobre as barreiras vivenciadas pelo hanseniano na adesão ao tratamento medicamentoso, de modo a conhecer as atividades de vida destes pacientes para possível adequação de ações voltadas a essa clientela.

  1. Biochemical evaluation of glycemic levels of long-term tacrolimus therapy in rats Avaliação bioquímica dos níves glicêmicos da terapia com tacrolimo por longo período em ratos

    Directory of Open Access Journals (Sweden)

    Carlos Augusto Nassar

    2007-12-01

    estudo foi avaliar o efeito glicêmico de uma terapia por longo período com tacrolimo em ratos. Um grupo foi tratado com tacrolimo com doses diárias subcutâneas de 1 mg/kg de peso corporal. A escolha dessa dose foi suficiente para a obtenção dos níveis séricos terapêuticos desejados com tacrolimo. Os períodos experimentais foram 60, 120, 180 e 240 dias. Outro grupo foi usado como controle e recebeu injeções salinas subcutâneas diariamente durante todos os períodos. Houve uma tendência ao aumento do nível glicêmico nos períodos iniciais (60 e 120 dias. Entretanto, após 180 e 240 dias, os níveis de glicemia não foram estatisticamente diferentes dos obtidos nos grupos controles de mesmo período. Assim, pode-se concluir que os efeitos glicêmicos adversos provocados pela terapia com tacrolimo podem ser relacionados ao tempo.

  2. Directly Imaging Planets with SCExAO: First Results

    Science.gov (United States)

    Currie, Thayne M.; Guyon, Olivier; Jovanovic, Nemanja; Lozi, Julien; Tamura, Motohide; Kudo, Tomoyuki; Uyama, Taichi; Garcia, Eugenio

    2017-01-01

    We present the first science results from the newly commissioned Subaru Coronagraphic Extreme Adaptive Optics project, an experimental system dedicated to image faint jovian planets around nearby stars. SCExAO is now achieving true extreme AO capability. We describe the typical performance of SCExAO, the first images of benchmark exoplanets and planet-forming disks, and SCExAO’s first science results. Finally, we briefly chart the path forward for SCExAO to achieve its full scientific capability, including imaging mature planets in reflected light.

  3. Investigação de variantes gênicas de canais iônicos em pacientes com síndrome do QT longo

    Directory of Open Access Journals (Sweden)

    Ernesto Curty

    2011-03-01

    Full Text Available FUNDAMENTO: A síndrome do QT longo (SQTL é uma síndrome arrítmica herdada com aumento do intervalo QT e risco de morte súbita. Mutações nos genes KCNQ1, KCNH2 e SCN5A respondem por 90% dos casos com genótipo determinado, e a genotipagem é informativa para aconselhamento genético e melhor manejo da doença. OBJETIVO: Investigação molecular e análise computacional de variantes gênicas de KCNQ1, KCNH2 e SCN5A associadas à SQTL em famílias portadoras da doença. MÉTODOS: As regiões codificantes dos genes KCNQ1, KCNH2 e SCN5A de pacientes com SQTL e familiares foram sequenciadas e analisadas utilizando o software Geneious ProTM. RESULTADOS: Foram investigadas duas famílias com critérios clínicos para SQTL. A probanda da Família A apresentava QTC = 562 ms, Escore de Schwartz = 5,5. A genotipagem identificou a mutação G1714A no gene KCNH2. Foi observado QTC = 521 ± 42 ms nos familiares portadores da mutação contra QTC = 391 ± 21 ms de não portadores. A probanda da Família B apresentava QTc = 551 ms, Escore de Schwartz = 5. A genotipagem identificou a mutação G1600T, no mesmo gene. A análise dos familiares revelou QTC = 497 ± 42 ms nos portadores da mutação, contra QTC = 404 ± 29 ms nos não portadores. CONCLUSÃO: Foram encontradas duas variantes gênicas previamente associadas à SQTL em duas famílias com diagnóstico clínico de SQTL. Em todos os familiares portadores das mutações foi observado o prolongamento do intervalo QT. Foi desenvolvida uma estratégia para identificação de variantes dos genes KCNQ1, KCNH2 e SCN5A, possibilitando o treinamento de pessoal técnico para futura aplicação na rotina diagnóstica.

  4. Photon counting arrays for AO wavefront sensors

    CERN Document Server

    Vallerga, J; McPhate, J; Mikulec, Bettina; Clark, Allan G; Siegmund, O; CERN. Geneva

    2005-01-01

    Future wavefront sensors for AO on large telescopes will require a large number of pixels and must operate at high frame rates. Unfortunately for CCDs, there is a readout noise penalty for operating faster, and this noise can add up rather quickly when considering the number of pixels required for the extended shape of a sodium laser guide star observed with a large telescope. Imaging photon counting detectors have zero readout noise and many pixels, but have suffered in the past with low QE at the longer wavelengths (>500 nm). Recent developments in GaAs photocathode technology, CMOS ASIC readouts and FPGA processing electronics have resulted in noiseless WFS detector designs that are competitive with silicon array detectors, though at ~40% the QE of CCDs. We review noiseless array detectors and compare their centroiding performance with CCDs using the best available characteristics of each. We show that for sub-aperture binning of 6x6 and greater that noiseless detectors have a smaller centroid error at flu...

  5. A VIA DEMOCRÁTICA AO AUTORITARISMO

    Directory of Open Access Journals (Sweden)

    Paulo César Nascimento

    2013-09-01

    Full Text Available Este artigo analisa as teorias de Aristóteles, Tocqueville e Hannah Arendt a respeito de como alguns aspectos da democracia como a busca do igualitarismo e o voto majoritário podem conduzir ao despotismo. Examinando os casos da democratização da Rússia pós-comunista e o sistema político da Venezuela durante a presidencia de Hugo Chavez, o texto procura demonstrar a importância das idéias daqueles pensadores para a compreensão de regimes autoritários legitimados pelo voto popular. --- The democratic route of autoritarism This article reviews the theories of Aristotle, Tocqueville and Hannah Arendt with respect to some elements of democracy such as the pursue of egalitarianism and the reliance on the will of the majority that can lead to despotism. On the basis of post-communist Russia’s transition to democracy and Venezuela’s political system under the presidency of Hugo Chavez, the article shows the importance of those thinker’s insights to understand current authoritarian regimes which rely on popular vote. keywords: democracy, autoritarian regimes, voting.

  6. Adesao ao guia alimentar para populacao brasileira

    Directory of Open Access Journals (Sweden)

    Eliseu Verly Junior

    2013-12-01

    Full Text Available OBJETIVO : Analisar a adesão ao Guia Alimentar para População Brasileira. MÉTODOS : Amostra composta por participantes do Inquérito de Saúde de São Paulo (n = 1.661 que preencheram dois recordatórios de 24 horas. Foi utilizado modelo bivariado de efeito misto para a razão entre o consumo de energia do grupo de alimentos e o consumo calórico total. A razão estimada foi utilizada para calcular o percentual de indivíduos com consumo abaixo ou acima da recomendação. RESULTADOS : Pelo menos 80,0% da população consome abaixo do recomendado para: leite e derivados; frutas e sucos de frutas; e cereais, tubérculos e raízes; aproximadamente 60,0% para legumes e verduras; 30,0% para feijões; e 8,0% para carnes e ovos. Adolescentes apresentaram a maior inadequação para legumes e verduras (90,0%, e o estrato de maior renda foi associado à menor inadequação para óleos, gorduras e sementes oleaginosas (57,0%. CONCLUSÕES : Foi observado consumo inadequado dos grupos de alimentos relacionados com aumento do risco de doenças crônicas.

  7. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Letícia M.K. Forster

    1994-04-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  8. Toxicologia do tolueno: aspectos relacionados ao abuso

    Directory of Open Access Journals (Sweden)

    Forster Letícia M.K.

    1994-01-01

    Full Text Available O tolueno está presente em muitos produtos de uso doméstico e industrial e é o principal solvente envolvido no abuso de substâncias e na exposição ocupacional. O problema mais grave no estudo de patologias relacionadas ao tolueno é que este está geralmente associado, em suas preparações comerciais, a outras substâncias. O potencial tóxico do tolueno foi abordado nos seguintes aspectos: parâmetros farmacológicos; características físico-químicas; exposição; estudos clínicos; diagnóstico; pesquisa experimental; tolerância e dependência; efeitos agudos e crônicos; neurotoxicidade; teratogenicidade; doenças psiquiátricas; carcinogenicidade e tratamento. Conclui-se ser de grande importância e urgência que se realizem estudos clínicos com amostras maiores para definição mais precisa das conseqüências do uso crônico

  9. Impacto da insuficiência renal crônica na eficácia de stents farmacológicos: estudo de seguimento de longo prazo

    OpenAIRE

    Vitor Osório Gomes; Patrícia Blaya; Ricardo Lasevitch; Denise de Oliveira; Patrícia Hickmann; Luís Smidt; Carisi Polanczyk; Paulo Caramori

    2011-01-01

    FUNDAMENTO: Pacientes com Insuficiência Renal Crônica (IRC) submetidos à angioplastia coronária apresentam maiores taxas de revascularização da lesão alvo (RLA) e mortalidade. Os stents farmacológicos (SF) estão associados com taxas menores de reestenose, quando comparados aos stents não farmacológicos (SNF), embora em pacientes com IRC os dados da eficácia e segurança do SF sejam limitados. OBJETIVO: Buscamos avaliar a segurança e eficácia dos SF em pacientes com IRC significante, quando com...

  10. Resultados a curto e longo prazo de moxifloxacina comparada com o tratamento antibiótico convencional nas exacerbações agudas da bronquite crónica (Estudo MOSAIC

    Directory of Open Access Journals (Sweden)

    R. Wilson

    2004-09-01

    érios de Anthonisen em doentes com DPOC (obstrução de 5 dias com moxifloxacina comparativamente a um regime terapêutico convencional de 7 dias (amoxicilina, cefuroxime ou claritromicina.Este é o primeiro estudo concebido especificamente para avaliar a efectividade de um antibiótico (moxifloxacina nas exacerbações infecciosas de doentes com DPOC.É de lamentar que estes doentes sejam aqui designados de bronquíticos crónicos, o que não é rigoroso, mas parece que os motivos se prendem com a aprovação pelas entidades reguladoras dos medicamentos.Outro aspecto também ligado à aprovação por essas entidades prende-se com a demonstração de equivalência clínica de um novo antibiótico, o que ficou demonstrado neste estudo.Ora, se é equivalente, porquê utilizar o antibiótico mais recente, se os antibióticos mais convencionais atingem taxas de sucesso iguais quando avaliadas aos 7 a 10 dias?Este é o aspecto fundamental deste estudo, e a utilizar em futuros ensaios, uma vez que fica demonstrado que parâmetros de médio e longo prazos (superiores aos 7 a 10 dias na DPOC são fundamentais como critérios de avaliação de efectividade clínica de um novo antibiótico nas exacerbações agudas da DPOC.Aguardam-se os resultados deste estudo no que respeita à qualidade de vida e à fármaco-economia.Por fim, é de salientar que este estudo contou com a participação de 2 centros portugueses (H. Pulido Valente Dr.ª Cecília Nunes, e H. S. João Dr. João Almeida, o que nem sempre acontece com outros estudos multinacionais no âmbito da DPOC e asma.

  11. Long-term results of photorefractive keratectomy for myopia and myopic astigmatism Resultados a longo prazo de ceratectomia fotorefrativa para miopia e astigmatismo miópico

    Directory of Open Access Journals (Sweden)

    Ester Sakae Yamazaki

    2007-12-01

    Full Text Available PURPOSE: To assess the long-term refractive outcomes of photorefractive keratectomy in myopia and myopic astigmatism. METHODS: A retrospective study of 120 photorefractive keratectomy operated eyes with at least four-year follow-up (maximum of 96 months, mean follow-up 55 months. We divided patients into group 1 (G1 spherical equivalent (SE up to -4.00 diopters (D and group 2 (G2 SE >-4.00 D. The Summit Apex Plus® excimer laser was used for ablation. All eyes were analyzed in terms of uncorrected and best spectacle corrected visual acuity (UCVA/BSCVA and cycloplegic refraction. Data were analyzed using the Refractive Surgery Consultant Elite database software. RESULTS: G1 with 85 eyes (49 patients presented mean SE -2.42 D and G2 with 35 eyes (22 patients and mean SE of -4.45 D. Ninety-four percent of eyes in G1 and 82.9% of G2 were within ±1.00 D of emmetropia at 4 years. The UCVA was 20/30 or better in 82.0% of G1 eyes and 77.0% of G2 in the last postoperative follow-up. No patient lost more than one line in G2 compared to 13.0% in G1. Eyes that gained one or more lines after 4-year follow-up were 11.9% G1 and 2.9% in G2, respectively. A statistically significant positive correlation was found between achieved versus attempted refractive correction in both groups (r=0.925, pOBJETIVO: Relatar os resultados a longo prazo da cirurgia de ceratectomia fotorefrativa em miopia e astigmatismo miópico. MÉTODOS: Estudo retrospectivo de120 olhos operados de ceratectomia fotorefrativa com um mínimo intervalo de 4 anos de seguimento pós-operatório (máximo de 96 meses e seguimento médio de 55 meses. Dividimos em grupo 1 (G1 com equivalente esférico (SE até -4.00 dioptrias (D e grupo 2(G2 SE > -4.00 D. O excimer laser Summit Apex Plus® foi usado na ablação. Foram obtidas acuidade visual não corrigida (UCVA e melhor acuidade visual corrigida (BSCVA e refração sob cicloplegia. Os dados foram analisados utilizando o programa Refractive Surgery

  12. Phosphorus and root distribution and corn growth as related to long-term tillage systems and fertilizer placement Distribuição de fósforo e raízes e crescimento do milho em sistemas de manejo do solo e modos de aplicação de fertilizante no longo prazo

    Directory of Open Access Journals (Sweden)

    Sérgio Ely Valadão Gigante de Andrade Costa

    2009-10-01

    Full Text Available Soil and fertilizer management during cultivation can affect crop productivity and profitability. Long-term experiments are therefore necessary to determine the dynamics of nutrient and root distribution as related to soil profile, as well as the effects on nutrient uptake and crop growth. An 18-year experiment was conducted at the Federal University of Rio Grande do Sul State (UFRGS, in Eldorado do Sul, Brazil, on Rhodic Paleudult soil. Black oat and vetch were planted in the winter and corn in the summer. The soil management methods were conventional, involving no-tillage and strip tillage techniques and broadcast, row-and strip-applied fertilizer placement (triple superphosphate. Available P (Mehlich-1 and root distribution were determined in soil monoliths during the corn grain filling period. Corn shoot dry matter production and P accumulation during the 2006/2007 growing season were determined and the efficiency of P utilization calculated. Regardless of the degree of soil mobilization, P and roots were accumulated in the fertilized zone with time, mainly in the surface layer (0-10 cm. Root distribution followed P distribution for all tillage systems and fertilizer treatments. Under no-tillage, independent of the fertilizer placement, the corn plants developed more roots than in the other tillage systems. Although soil tillage systems and fertilizer treatments affected P and root distribution throughout the soil profile, as well as P absorption and corn growth, the efficiency of P utilization was not affected.O manejo do solo e de fertilizantes ao longo do tempo de cultivo pode contribuir para o rendimento e lucratividade das lavouras. Há, então, a necessidade de se ter e avaliar experimentos de longo prazo para que se consiga entender a dinâmica da distribuição de nutrientes e raízes no perfil do solo e seu efeito na absorção de nutrientes e no crescimento e desenvolvimento da cultura. Foi utilizado um experimento de 18 anos de

  13. Adubação orgânica da batata com esterco e, ou, Crotalaria juncea: I - produtividade vegetal e estoque de nutrientes no solo em longo prazo Organic fertilization of potato with manure and, or, Crotalaria juncea: I - long term plant productivity and soil nutrient stocks

    Directory of Open Access Journals (Sweden)

    Tácio Oliveira da Silva

    2007-02-01

    Full Text Available No Agreste paraibano, a batata (Solanum tuberosum L. é importante cultura comercial, embora seja limitada pela variabilidade e escassez de chuvas e pela baixa fertilidade do solo. O esterco é a principal fonte de nutrientes utilizada para fertilização do solo, porém geralmente não é disponível em quantidade suficiente nas propriedades rurais para suprir a demanda das culturas agrícolas. Como alternativa tem sido recomendada a adubação verde com Crotalaria juncea L. Realizou-se um experimento, de 1996 a 2002, em um Neossolo Regolítico, com o objetivo de quantificar a produtividade da batata e o estoque de nutrientes no solo, após incorporações anuais de esterco e, ou, crotalária. Os tratamentos consistiram de: incorporação da crotalária (C, adição de 15 t ha-1 de esterco caprino (E, incorporação de crotalária + 7,5 t ha-1 de esterco (CE e testemunha (T. No final do experimento, o tratamento E promoveu aumentos de 73, 45, 221 e 43 % nos teores de N total, P total, P e K extraíveis (Mehlich-1 do solo, respectivamente, em relação à testemunha. Os tratamentos C e CE aumentaram o N total do solo em 76 e 63 %, mas não aumentaram o teor dos outros nutrientes. Os acúmulos médios de massa seca, N, P e K na parte aérea da crotalária nos tratamentos, ao longo dos cinco anos, foram de 3.550, 69, 6 e 55 kg ha-1, respectivamente. As produtividades médias de tubérculos, ao longo dos cinco anos de colheita, foram de 15.204, 12.053, 11.085 e 7.926 kg ha-1 nos tratamentos CE, C, E e T, respectivamente. Apesar de a adição de 15 t ha-1 de esterco ter proporcionado os maiores aumentos nos nutrientes do solo, as maiores produtividades de tubérculos ao longo do período do estudo foram obtidas quando se combinou o plantio e a incorporação de crotalária com a adição de 7,5 t ha-1 de esterco.Potato (Solanum tuberosum L. is an important cash crop in the semi-arid region of Paraíba, Brazil. However, potato productivity is limited

  14. A tensão entre capitalismo e democracia em Habermas: do pós-guerra aos dias de hoje

    Directory of Open Access Journals (Sweden)

    Leonardo da Hora Pereira

    2015-10-01

    Full Text Available O objetivo desse artigo é o de compreender a evolução do diagnóstico do capitalismo tardio ao longo da trajetória intelectual de Habermas. O nosso interesse é o de investigar se há mudanças significativas no modo pelo qual Habermas concebe a relação entre capitalismo tardio e democracia efetiva. Como hipótese geral, defenderemos a ideia de que há ao menos uma grande ruptura no modelo crítico habermasiano, entre o fim dos anos 70 e início dos anos 80. Tal ruptura pode ser resumida, grosso modo, pela ideia segundo a qual, pelo menos até Problemas de Legitimação no Capitalismo Tardio, obra de 1973, capitalismo e democracia efetiva não eram vistos como compatíveis. Por outro lado, a partir da Teoria da Ação Comunicativa, publicada em 1981, ambos passam a poder conviver, apesar das tensões e mediante um novo equilíbrio de poderes. Finalmente, iremos ver como Habermas concebe esta tensão entre capitalismo e democracia hoje, a partir de seu debate recente com o sociólogo alemão Wolfgang Streeck, notadamente tendo em vista a crise da União Europeia.

  15. Sensibilidade de estirpes de Bradyrhizobium ao glyphosate

    Directory of Open Access Journals (Sweden)

    Rodrigo Josemar Seminoti Jacques

    2010-02-01

    Full Text Available A aplicação do glyphosate sobre a soja resistente a este herbicida pode causar prejuízos à simbiose com o rizóbio. O objetivo deste trabalho foi avaliar a sensibilidade ao herbicida glyphosate de três estirpes de Bradyrhizobium recomendadas para a produção de inoculantes de sementes de soja no Brasil. Avaliou-se o efeito das concentrações de 0,0; 5,4; 10,8; 21,6 e 43,2 µg L-1 do ingrediente ativo do glyphosate [N-(fosfonometil glicina] no meio YM líquido sobre o crescimento de B. japonicum (estirpe SEMIA 5079 e de B. elkanii (estirpe SEMIA 5019 e estirpe SEMIA 587, por meio de leituras das densidades óticas e geração de curvas de crescimento. As reduções de crescimento na presença da menor concentração do glyphosate foram de 18% para SEMIA 5079, 29% para SEMIA 5019 e de 35% para SEMIA 587, sendo, de modo geral, quanto maior a concentração do herbicida no meio de cultura maior a inibição do crescimen­to. As estirpes apresentaram sensibilidade diferencial somente às concentrações mais baixas do glyphosate; nesse caso, foi possível determinar a seguinte ordem de sensibilidade: SEMIA 587 > SEMIA 5019 > SEMIA 5079. Essa sensibilidade diferencial é dependente da concentração do herbicida, pois na presença de 43,2 µg L-1 todas as estirpes tiveram seu crescimento severamente reduzido, não havendo diferença entre elas.

  16. WIYN active optics: a platform for AO

    Science.gov (United States)

    Code, Arthur D.; Claver, Charles F.; Goble, Larry W.; Jacoby, George H.; Sawyer, David G.

    1998-09-01

    The WIYN 3.5 meter telescope is situated on the southwest ridge of Kitt Peak yielding excellent atmosphere seeing conditions. As such, the telescope and enclosure design was directed towards exploiting this feature. The primary mirror was spun cast and figured by the Steward Observatory Mirror Laboratory and the secondary mirror by Contraves. In both cases the performance exceeded the design specifications. The borosilicate primary is actively temperature controlled to within 0.2 C of the desired temperature, typically 0.5 degrees C below the ambient air. The telescope structure is also temperature controlled and the enclosure is opened to the outside ion all sides, which all heat sources are vented to ducts carrying air downwind of the facility. The primary mirror is actively controlled for low order aberrations by 66 axial actuators which are adjusted open loop via force matrix look-up tables and closed loop via real-time wavefront curvature sensing measurements. The active optics also included real-time collimation and focus control. The telescope drive and guider are capable of providing tracking to a few hundredths of a second of arc. By employing active telescope control at this level, it is possible to maintain telescope and local wavefront distortion to a level where atmospheric effects dominate the image quality. Since a significant fraction of the power in the atmospheric disturbances is contained in image motion the first step in adaptive optics control will be simple tip tilt. Studies of higher order AO system are being carried out, as well as additional test characterizing the telescope and site. It is intended to continue such studies in an attempt to establish long term variances.

  17. Impacto da insuficiência renal crônica na eficácia de stents farmacológicos: estudo de seguimento de longo prazo

    Directory of Open Access Journals (Sweden)

    Vitor Osório Gomes

    2011-05-01

    Full Text Available FUNDAMENTO: Pacientes com Insuficiência Renal Crônica (IRC submetidos à angioplastia coronária apresentam maiores taxas de revascularização da lesão alvo (RLA e mortalidade. Os stents farmacológicos (SF estão associados com taxas menores de reestenose, quando comparados aos stents não farmacológicos (SNF, embora em pacientes com IRC os dados da eficácia e segurança do SF sejam limitados. OBJETIVO: Buscamos avaliar a segurança e eficácia dos SF em pacientes com IRC significante, quando comparados a pacientes com função renal normal em um registro da "vida real". MÉTODOS: 504 pacientes submetidos à intervenção coronariana percutânea com SF em dois centros foram incluídos. Os desfechos foram estratificados baseados na presença de IRC, definida como taxa de filtração glomerular basal < 60 ml/min/1,73 m². RESULTADOS: O acompanhamento médio foi de 22,7 meses. A IRC estava presente em 165 pacientes (32,7%. Pacientes com IRC eram mais velhos, tinham mais hipertensão e diabete. Pacientes com IRC apresentaram maior incidência de morte (12,3% vs 2,4%, p < 0,001 e infarto do miocárdio (IM (7,4% vs 3,3%, p = 0,04, quando comparados aos pacientes sem IRC. Taxas de RLA foram similares entre os grupos (4.8% vs 5.6%, p = 0,7, pacientes com e sem IRC, respectivamente. Preditores independentes de morte foram a IRC (HR 6,93; 2,4 - 19,5, p < 0,001, tabagismo atual (HR 3,66; 1,20 - 11,10, p = 0,02 e diabete (HR 2,66; 1,3 - 6,60, p = 0,045. CONCLUSÃO: Neste registro, a intervenção coronariana com SF em pacientes com IRC foi associada com RLA similar comparada aos pacientes sem IRC, demonstrando a eficácia dos FS na prevenção da reestenose intra-stent nessa população de pacientes. A IRC foi relacionada a um aumento significativo das taxas de IM e mortalidade.

  18. Tratamento a longo prazo com budesonido inalado em pessoas com doença pulmonar obstrutiva crónica, que mantêm hábitos tabágicos

    Directory of Open Access Journals (Sweden)

    R.A. Pawels

    2000-01-01

    éfico na função pulmonar que ocorre no inicio do tratarnento e o possivel efeito benético mais pronunciado no subgrupo de doentes com menor carga tabágica, devem ser contrabalançados com o risco de efeitos secundáios locais e sistémicos. COMENTÁRIO: O processo innamatório que envolve as vias aéreas na asma e na DPOC em tase clinicamente estável é diferente, predominando na asma os linfocitos CD4+, os eosinófilos e os mastócitos, enquanto que na DPOC, o infiltrado inflamatório é sobretudo composto por neutrófilos, macrófagos e linfocitos CD8+. A eosinofilia das vias aéreas não é patognomónica da asma, ocorrendo também nas exacerbações da DPOC (1.A reversibilidade aos corticosteróides na DPOC é encontrada em cerca de 10 a 15% dos doentes (2. O número de neutrófilos obtido a partir do liquido do lavado brônquico correlacionase com o grau de limitação da função pulmonar e com a carga tabágica (3. O tratamento de doentes com DPOC com 1500 μg de dipropionato de beclomctasona por dia durante 2 meses, induziu uma redução de 27% dos neutrófilos e de 42% do total de células nas amostras obtidas por expectoração induzida, mas não teve qualquer efetto nos parametros espirométricos (4.A reversibllidade obtida em 12 dos 25 doentes com DPOC submetidos a um curso de 1.5 mg/kg/dia de prednisolona durante 15 dias, definida como um aumento do valor de FEV1 de pelo menos 12% com um aumento absoluto≥200 ml, correlaciona-se com um número significativamente aumentado de eosmófilos na biópsta pulmonar, valores mais elevados de proteína catiónica do eosinófilo no liquido do lavado bronco-alveolar e um espessamento marcado da membrana basal reticular, comparativamente aos doentes que não responderam a esta terapêutica (5.A reversibllidade aos corticóides na DPOC parecc pois relacionarse com marcadores que são comuns na asma

  19. Sequelas a longo prazo de fracturas do corpo e colo do astrágalo Long-term results of body and neck talus fractures

    Directory of Open Access Journals (Sweden)

    Ricardo Jorge Gomes de Sousa

    2009-10-01

    Full Text Available OBJETIVO: As fracturas do colo e corpo do astrágalo são lesões infrequentes. O objectivo deste estudo é avaliar a prevalência de sequelas a longo prazo. MÉTODOS: Foi feita uma análise retrospectiva que incluiu um total de 11 doentes sujeitos a tratamento cirúrgico por fracturas do corpo ou colo do astrágalo entre Janeiro de 1997 e Dezembro de 2005. A avaliação final foi clínica (utilizando a escala AOFAS e radiológica. RESULTADOS: O seguimento médio foi 58,5 meses. A prevalência de lesões ósseas associadas foi de 60% (6/10. O resultado AOFAS médio foi 72 [19-100] pontos. A necrose avascular e/ou artrose pós-traumática ocorreu em metade dos doentes. A qualidade da redução cirúrgica, as fracturas do corpo e a ausência de alterações degenerativas relacionaram-se com melhores resultados funcionais. As fracturas do colo, a osteonecrose e a presença de artrose pós-traumática conduziram a piores resultados. CONCLUSÃO: Há um grande potencial para sequelas tardias e compromisso funcional devido a artrose e dor crónica após esse tipo de fracturas. A redução anatómica cirúrgica é a melhor hipótese de as evitar, mas não é infalível. A taxa de necrose avascular relaciona-se com o grau de desvio inicial da fractura, mas a sua ocorrência em cada caso específico é imprevisível.OBJECTIVES: Talar neck and body fractures are unusual fractures. The purpose of this study is to determine the prevalence of long term results. MATERIAL AND METHODS: A retrospective analysis was carried out including 11 patients that underwent surgical treatment for body or neck talus fractures between January 1997 and December 2005. Final follow-up examination included a clinical evaluation (AOFAS score and standard radiographs. RESULTS: The mean follow-up time was 58.5 months. The prevalence of associated fractures was 60% (6/10. Overall AOFAS score averaged 72 [19-100]. Avascular necrosis and posttraumatic arthritis were present in half of

  20. Uso de quercetina a longo prazo em ratos cirróticos The long term use of quercetin in cirrhotic rats

    Directory of Open Access Journals (Sweden)

    Aline Miltersteiner

    2003-06-01

    Full Text Available OBJETIVO: Avaliar o uso a longo prazo do flavonóide quercetina em ratos cirróticos por ligadura de ducto biliar comum (LDB. MÉTODOS: Foram utilizados 32 ratos machos Wistar, sendo submetidos à LDB ou simulação, e distribuídos em 4 grupos: 1 controle, 2 cirróticos, 3 cirróticos tratados com quercetina 50mg/kg, intraperitonealmente, desde o segundo dia após o procedimento cirúrgico; e 4 cirróticos tratados após o décimo quarto dia do procedimento cirúrgico. Analisou-se a função hepática por meio de testes bioquímicos (BT e BD e atividade enzimática (ALT, AST, FA e GGT. Na análise anatomopatológica, utilizou-se a coloração de Hematoxilina & Eosina (H&E e de Picrosírius para fibrose. A análise estatística para avaliação de sobrevivência foi realizada pelo teste Kaplan-Meier. RESULTADOS: Os resultados de sobrevivência dos oito animais de cada grupo foram: Grupo 1 = 200 dias de sobrevivência; Grupo 2 = 46 dias; Grupo 3 = 71 dias; e o Grupo 4 = 90 dias. Nos animais com ligadura de ducto biliar comum houve aumento das provas de função hepática e enzimáticas que se reduziu hipoteticamente com o tratamento com quercetina. Foram identificadas cirrose, congestão vascular porta e centrolobular na análise histopatológica por H&E e Picrosírius. CONCLUSÃO: O uso da quercetina diminuiu de maneira significante as alterações bioquímicas provocadas pela cirrose, aumentando o tempo de sobrevivência dos animais com cirrose biliar secundária à LDB, como verificado pelo teste de análise de sobrevivência.PURPOSE: The long term use of quercetin flavonoid was evaluated in cirrhotic rats by common biliary duct bondage (LDB. METHODS: 32 male Wistar rats were submitted to LDB or simulation, and distributed in 4 groups: 1 control, 2 cirrhotic, 3 cirrhotic treated with quercetin the second day after the surgical procedure; and 4 cirrhotic treated with quercetin after the fourteenth day of the surgical procedure. The hepatic

  1. SCExAO: First Results and On-Sky Performance

    Science.gov (United States)

    Currie, Thayne; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; McElwain, Michael; Thalmann, Christian; Jovanovic, Nemanja; Singh, Garima; Kudo, Tomoyuki

    2013-01-01

    We present new on-sky results for the Subaru Coronagraphic Extreme Adaptive Optics imager (SCExAO) verifying and quantifying the contrast gain enabled by key components: the closed-loop coronagraphic low-order wavefront sensor (CLOWFS) and focal plane wavefront control ("speckle nulling"). SCExAO will soon be coupled with a high-order, Pyramid wavefront sensor which will yield greater than 90% Strehl ratio and enable 10(exp 6) -10(exp 7) contrast at small angular separations allowing us to image gas giant planets at solar system scales. Upcoming instruments like VAMPIRES, FIRST, and CHARIS will expand SCExAO's science capabilities.

  2. OS XERENTE AKWÉN, OS ANIMAIS E AS PLANTAS: UMA REVISITA AOS INALIENÁVEIS COM A SEMÂNTICA DA GRAMÁTICA

    Directory of Open Access Journals (Sweden)

    Sílvia Lúcia Bigonjal Braggio

    2011-03-01

    Full Text Available Depois de muitos anos trabalhando com os Xerente Akwén, povo indígena da família linguística Jê e observando o modo como esse povo classifica­se a si mesmo e também a fauna e a flora, decidi tratar das propriedades dos in­ alienáveis, as quais, em meu ponto de vista, ligam os Akwén à fauna e à flora, em uma categoria sobreposta às demais classificações da língua. Para tanto, utilizo a teoria da etnossintaxe ou semântica da gramática, baseada em uma revisita de vários estudiosos aos escritos de Sapir e Whorf, em uma versão relativista denominada “narrow”, ou “fraca”, não determinista como anteri­ ormente eram considerados os estudos de Sapir e Whorf. Foram utilizados vários dados coletados ao longo de meu trabalho, a partir dos quais elaborei um questionário específico que foi aplicado ao meu pesquisador auxiliar, Sisdaze Akwén, na faixa da geração considerada mais velha (acima de 40 anos. Os da­ dos descritos e analisados mostram as diferentes formas de classificação dessa língua, diversas das ocidentais, as quais, seguramente, podem contribuir para a ciência da linguagem, para os povos de etnias diversas e para a sistematização das classificações singulares que elas elaboram e, consequentemente, para a educação escolar indígena.

  3. DAS FERRAMENTAS AOS COLABORADORES: a avaliação individual de desempenho em um dos maiores grupos de inspeção veicular do Brasil

    Directory of Open Access Journals (Sweden)

    Victor Ribeiro Martins

    2016-12-01

    Full Text Available A máxima “de aquilo que não se mede não se conhece, não se controle e não melhora” nunca foi tão aplicável como no cenário competitivo atual. O processo de avaliação de desempenho nas organizações visa justamente avaliar o quão bem desenvolvidos são os colaboradores. A investigação e o mapeamento do processo de AD se dão em um dos maiores grupos de organismos de inspeção veicular do país, sediado na cidade de Cuiabá, Mato Grosso. Para isso, ao longo do desenvolvimento, descreve-se a estrutura interna da empresa e são propostas oportunidades para ajustes no modelo atual de avaliação. Os dados foram coletados por meio de entrevista com roteiro semiestruturado cujas questões visavam captar a percepção dos mesmos sobre o processo de AD. Sugere-se, com base nos resultados, o desenvolvimento de um método de AD mais eficiente, em direção ao modelo de Avaliação 360º. Ao fim do estudo, foi possível inferir o quão necessário é a Avaliação de Desempenho para o desenvolvimento do colaborador e por isso propôs-se que a empresa a tome como constante, com o objetivo de incentivar os funcionários a buscarem um constante desenvolvimento profissional.

  4. RESPOSTAS MORFODINÂMICAS E FISIOGRÁFICAS DA ZONA COSTEIRA AO NORTE DA BACIA DE CAMPOS FRENTE À EVENTOS DE TEMPESTADE

    Directory of Open Access Journals (Sweden)

    Mayte Gomes Ribeiro

    2017-01-01

    Full Text Available As barreiras arenosas no litoral norte fluminense estão distribuídas com tipologias e orientações distintas, relativas às principais direções de incidência de ondas oceânicas atuantes no litoral fluminense. A capacidade de resiliência destas feições quando submetidas a eventos de ondas de tempestade está associada ao estoque pretérito de sedimentos. O objetivo é a avaliação da vulnerabilidade física da zona costeira norte da Bacia de Campos, sob o ponto de vista dos impactos de ondas de tempestade na dinâmica de praia, envolvendo erosão costeira e transporte de sedimentos. Simulações de ondas extremas para a Bacia de Campos permitiram avaliar o comportamento ao longo de pontos selecionados. Dados morfológicos permitiram identificar áreas mais ou menos vulneráveis à erosão costeira. Áreas mais vulneráveis estão relacionadas ao déficit de sedimentos induzidos por transporte longitudinal e aonde a barreira arenosa se eleva a cotas inferiores a 3 metros. Áreas menos vulneráveis são as áreas de progradação da barreira arenosa pela incorporação atual de sedimentos. A posição sul do município de São João da Barra recebe as maiores ondulações independente das direções de propagação e o município de São Francisco de Itabapoana é protegido das ondulações mais fortes em função do aspecto embaiado da linha de costa.

  5. Ondaletas aplicadas à análise de variabilidade de baixa frequência em séries de afluência aos reservatórios hidrelétricos brasileiros

    OpenAIRE

    Anjos, Sarah Lopes dos

    2016-01-01

    A análise da variabilidade espaço-temporal de séries históricas de vazão é de suma importância para a gestão dos recursos hídricos, pois leva a um melhor entendimento das flutuações naturais de sistemas hidrológicos e forma a base de conhecimento para construção e aperfeiçoamento de modelos de previsão e simulação de vazões. Neste trabalho, busca-se avaliar, nas séries de afluência aos reservatórios brasileiros, tendências cíclicas que ocorrem com períodos relativamente longos (a partir de...

  6. Avaliação das alterações morfológicas cardíacas secundárias ao enfisema pulmonar: estudo experimental em ratos

    OpenAIRE

    Monteiro,Rosangela; Jatene,Fabio Biscegli; Pazetti,Rogério; Correia,Aristides Tadeu; Manoel,Luiza Antônia; Bernardo,Wanderley Marques; Rivero,Dolores Helena Rodrigues Ferreira; Oliveira,Sérgio Almeida de

    2004-01-01

    OBJETIVO: Este trabalho tem como objetivo avaliar a ocorrência e as repercussões de enfisema pulmonar quimicamente induzido e as alterações morfológicas presentes em corações de ratos após sua indução, acompanhando sua progressão ao longo do tempo. MÉTODO: Foram avaliados 75 ratos divididos em dois grupos, papaína (N=50) e controle (N=25), submetidos à instilação intratraqueal de papaína e solução fisiológica, respectivamente. Os animais foram sacrificados 30, 60, 90, 120 ou 180 dias após a i...

  7. Combined supra/infratentorial approach to tentorial meningiomas Abordagem combinada supra e infratentorial aos meningiomas tentoriais

    Directory of Open Access Journals (Sweden)

    Igor de Castro

    2005-03-01

    Full Text Available In spite of significant advancements in imaging technology, monitoring, and microsurgical techniques, complete and safe removal of tentorial meningiomas remains a challenge for most neurosurgeons. Classifications of tentorial meningiomas are revised. The combined supra/infratentorial approach to resects tentorial meningioma is discussed. This approach provides a wider exposure of the supra/infratentorial region with less brain retraction. With this approach the occipital lobe and the cerebellum are exposed along the tentorium. Two illustrative cases are presented. The patients were studied with computerized tomography, magnetic resonance and angiography. The anatomy of the transverse sinus and the confluence of the sinus could be appreciated with these studies. The operative technique is described stepwise. Emphasis is placed on pre-operative evaluation and surgical technique, leading to a total surgical removal of the lesion with margins of safety. The goal of surgical treatment of tentorial meningiomas is their complete and safe removal. With this unique approach we sought to confirm that it offers a safe means of resection not only the neoplasm but also the infiltrated dura.Apesar dos significativos avanços na tecnologia de imagens, nas técnicas de monitorização e microcirúrgicas, a ressecção completa e segura dos meningiomas tentoriais permanece um desafio para maioria dos neurocirurgiões. A abordagem supra e infra-tentorial proporciona ampla exposição das regiões supra e infratentoriais diminuindo a retração cerebral. Com esse tipo de abordagem o lobo occiptal e o cerebelo são expostos ao longo da superficie tentorial. Dois casos ilustrativos são apresentados. Os pacientes foram avaliados com tomografia computadorizada, ressonância magnética e angiografia, o que permitiu estudar a anatomia do seio transverso, a confluência e dominancia dos seios. O objetivo do tratamento cirúrgico dos meningiomas tentoriais é a remo

  8. Marketing Verde como uma abordagem estratégica frente ao novo perfil de consumo

    Directory of Open Access Journals (Sweden)

    Pedro Carlos Schenini

    2015-11-01

    Full Text Available Este artigo teve como objetivo o de verificar a aplicação de conceitos do marketing verde, no comércio de produtos orgânicos, em negócios atuantes em feiras e sacolões no mercado de hortifrutigranjeiros de Florianópolis. No trabalho foram apresentadas diferentes formas de aplicação de elementos da gestão mercadológica - como imagem de negócio, comportamento do consumidor em relação à comercialização de produtos orgânicos e estratégia mercadológica – no marketing verde de produtos orgânicos. A metodologia partiu de um estudo de casos múltiplos, de natureza descritiva, realizado com comerciantes de hortifrutigranjeiros de Florianópolis- SC. A etapa de coleta de dados foi fundamentada principalmente na coleta de dados primários, através das técnicas de observação e realização de entrevista estruturada, com comerciantes de hortifrutigranjeiros em feiras e sacolões de Florianópolis-SC, escolhidos de forma aleatória. A análise fundamentou-se em análise de conteúdo. Os principais resultados foram: 1. o consumidor adepto ao marketing verde e produtos orgânicos é um indivíduo informado e formador de opinião, o que aumenta a probabilidade de sucesso, a longo prazo, de negócios adotantes de tal estratégia que apliquem de forma efetiva; 2. um aspecto crucial para o crescimento do mercado de orgânicos é o esclarecimento entre características, vantagens e benefícios entre produtos orgânicos e inorgânicos. O atual contexto aponta para uma situação em que o produto inorgânico, ou com “veneno”, é o mesmo denominado “normal”.

  9. LGS-AO Imaging of Every Kepler Planet Candidate: the Robo-AO KOI Survey

    Science.gov (United States)

    Law, Nicholas Michael; Baranec, Christoph; Morton, Timothy; Ziegler, Carl; Atkinson, Dani; Riddle, Reed

    2015-08-01

    The Robo-AO Kepler Planetary Candidate Survey is observing every Kepler planet candidate host star with laser adaptive optics imaging, to search for blended nearby stars which may be physically associated companions and/or responsible for transit false positives. We will present the results from searching for companions around over 3,000 Kepler planet hosts in 2012-2015. We will describe our first data release covering 715 planet candidate hosts, and give a preview of ongoing results including improved statistics on the likelihood of false positive planet detections in the Kepler dataset, many new planets in multiple star systems, and new exotic multiple star systems containing Kepler planets.We will also describe the automated Robo-AO survey data reduction methods, including a method of using the large ensemble of target observations as mutual point-spread-function references, along with a new automated companion-detection algorithm designed for extremely large adaptive optics surveys.Our first data release covered 715 objects, searching for companions from 0.15” to 2.5” separation with contrast up to 6 magnitudes. We measured the overall nearby-star-probability for Kepler planet candidates to be 7.4+/-1.0%, and we will detail the variations in this number with stellar host parameters. We will also discuss several KOIs of particular interest, including KOI-191 and KOI-1151, which are both multi-planet systems with detected stellar companions whose unusual planetary system architecture might be best explained if they are ``coincident multiple'' systems, with several transiting planets shared between the two stars. Finally, we will discuss and update the 98%-confidence evidence from our survey that third bodies in star/planet systems produce an excess of close-in giant planets.

  10. Passagem ao ato e acting-out: duas respostas subjetivas

    Directory of Open Access Journals (Sweden)

    Roberto Calazans

    2010-08-01

    Full Text Available O presente artigo delimita o conceito de passagem ao ato em relação ao acting-out e distingue as respostas subjetivas que envolvem. A partir das distinções propostas por Lacan entre eles com base no conceito de objeto a, busca-se situar o sujeito em ambas as modalidades de ato, com os objetivos de submeter à discussão clínica as passagens ao ato discretas e de interrogar o papel de suplência que supostamente desempenham. Para tal, são retomados dois fragmentos de casos de anorexia discutidos na literatura psicanalítica; no primeiro, o objeto ao qual o sujeito se identifica é circunscrito, enquanto no segundo, trata-se do objeto posto em cena pelo sujeito.

  11. Resultados em longo prazo da cirurgia endoscópica nasossinusal no tratamento da rinossinusite crônica com e sem pólipos nasais Long-term outcomes of endoscopic sinus surgery for chronic rhinosinusitis with and without nasal polyps

    Directory of Open Access Journals (Sweden)

    Juliana Gama Mascarenhas

    2013-06-01

    Full Text Available Rinossinusite crônica (RSC afeta significativamente a qualidade de vida e o tratamento clínico e cirúrgico visa apenas seu controle clínico. OBJETIVO: Avaliar a qualidade de vida e o controle clínico da RSC em longo prazo em pacientes submetidos à cirurgia endoscópica nasossinusal. MÉTODO: Estudo observacional longitudinal prospectivo que seguiu pacientes com diagnóstico clínico de RSC no pré-operatório, pós-operatório de 3 meses e depois por no mínimo 2 anos após cirurgia nasossinusal endoscópica com a utilização do questionário Sinonasal Outcome Test 22 (SNOT-22 como principal medida de resposta ao tratamento, além da avaliação do controle clínico a longo prazo. RESULTADOS: Trinta e oito pacientes foram avaliados em todos os intervalos. Houve uma grande melhora dos valores do SNOT-22 entre o pré-operatório (61,3 e o pós-operatório de 3 (16,9 e 24 meses (32,3. Não houve diferença estatisticamente significante entre os pacientes com e sem pólipos nasais. Nota-se pouca proporção de pacientes controlados em ambos os grupos, e 7,89% foram submetidos à cirurgia revisional no período estudado. CONCLUSÃO: A cirurgia endoscópica nasossinusal promoveu importante melhora da qualidade de vida nos pacientes com rinossinusite crônica, atingindo controle clínico aceitável com baixa necessidade de reintervenção cirúrgica, mesmo após dois anos de seguimento pós-operatório.Chronic rhinosinusitis (CRS significantly affects patient quality of life. Medical and surgical treatments aim to clinically manage the condition. OBJECTIVE: To assess the long-term quality of life and clinical management of CRS in patients submitted to endoscopic sinus surgery. METHOD: This prospective cross-sectional cohort study enrolled 38 patients and looked into the follow-up data of subjects diagnosed with CRS before surgery, three months after surgery, and at least two years after surgery. The Sinonasal Outcome Test 22 (SNOT-22 was used to

  12. Resultados a longo prazo da reconstrução da via de saída do ventrículo direito com monocúspide porcina

    Directory of Open Access Journals (Sweden)

    Fernando Antônio Fantini

    1997-10-01

    Full Text Available O benefício hemodinâmico e funcionamento tardio das monocúspides implantada na via de saída do ventrículo direito são pontos que continuam controversos na literatura. Com o objetivo de se estudar o comportamento tardio de uma monocúspide porcina montada em remendo de pericárdio bovino, 45 pacientes selecionados, portadores de diversos tipos de cardiopatia congênita operados entre junho de 1989 e abril de 1996, foram acompanhados até dezembro de 1996. A idade variou de 2 semanas a 18 anos (média 4,8 ± 4,7 anos. Ocorreram 5 óbitos hospitalares, diretamente relacionados à condição clínica pré-operatória e à complexidade da doença. Com 3 pacientes não tendo sido encontrados para acompanhamento, 37 foram seguidos por um período que variou de 6 a 90 meses (média 4,8 ± 19,0 meses. Não houve mortalidade tardia. Dois pacientes foram reoperados, sendo o primeiro após 24 meses devido a insuficiência pulmonar grave em criança portadora de síndrome da valva pulmonar ausente e o segundo após 23 meses devido a estenose pulmonar infundibular residual. À reoperação, os enxertos mostravam-se bem conservados e sem sinais de calcificação, o que foi confirmado pelos estudos histológicos das peças retiradas. O segundo paciente recebeu uma nova monocúspide. Os demais 35 pacientes encontram-se assintomáticos. Trinta e seis pacientes têm sido avaliados periodicamente, através de ecocardiogramas seriados. A monocúspide permanece móvel e funcionante em todos os casos, sem sinais de calcificação, estenose ou dilatação. O gradiente sistólico médio de pico através da via de saída do ventrículo direito tem sido de 19,0 ± 5,8 mmHg. Regurgitação pulmonar está ausente em (33% 12 pacientes, é leve em 15 (42% e moderada em 9 (25%. Em conclusão, a monocúspide porcina apresenta excelente desempenho hemodinâmico a longo prazo, sem evidências de estenose tardia. Apresenta-se funcional e sincrônica com o ciclo cardíaco at

  13. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF)

    OpenAIRE

    Audigé, L.; Slongo, T; Lutz, N.; Blumenthal, A.; Joeris, A

    2016-01-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more ...

  14. A UNIVERSIDADE DO SÉCULO XXI RUMO AO DESENVOLVIMENTO SUSTENTÁVEL [doi: 10.5329/RECADM.20040302006

    Directory of Open Access Journals (Sweden)

    Maria Elisabeth Pereira Kraemer

    2004-11-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 Resumo As atividades humanas sobre o meio ambiente vêm se intensificando ao longo do tempo e de forma mais acentuada a partir da Revolução Industrial, no final do século XIX, resultando na miséria, na exclusão social e econômica, no consumismo, no desperdício e na degradação ambiental. A universidade é o lugar privilegiado para uma educação dirigida às exigências de nossos tempos. Atribuí-se a ela a responsabilidade de educar para o desenvolvimento sustentável, quer diretamente os seus alunos, quer por influência, junto de decisores e outros agentes-chave implicados no processo.   Palavras-chave: desenvolvimento sustentável, educação, meio ambiente e universidade.   Abstrat The human activities on the environment are intensifying along the time and in a more  accentuated way starting from the Industrial Revolution, in the end of the XIX century, resulting in poverty, social and economic exclusion, consumerism, waste and  environmental degradation. The university is the privileged place for an education driven to the demands of our time. It is attributed to it the responsability of educating for the maintainable development, as its students directly or for influence of its managers and other key agents implied in the process.   Keywords: education, environment, maintainable development, university.

  15. Resiliência e Busca de Sentido de Vida na Velhice Frente aos Desafios do Caminho da Existência

    Directory of Open Access Journals (Sweden)

    Ivana de Oliveira

    2016-07-01

    Full Text Available O trabalho objetiva investigar de que maneira o indivíduo, principalmente, o velho, pode enfrentar de modo eficaz e adequado os desafios que se apresentam no decorrer do caminho da existência. Tem por base uma revisão da literatura especializada dos subsídios teóricos da Psicologia Positiva e da Logoterapia, segundo os quais é possível aprender a ser resiliente, como também aumentar, fortalecer e desenvolver o nível de resiliência, por meio do desenvolvimento de recursos internos, tendo em vista que os desafios que o velho encontra ao longo da vida podem ser reconhecidos como oportunidades para a adoção de decisões melhores e mais responsáveis, mantendo-se íntegro nas adversidades, não só superando-as, mas se transformando, crescendo e reinventando-se a partir das mesmas. Infere-se que a proposta de atuação do psicólogo na velhice visa à ajuda na construção conjunta de estratégias alternativas para o enfrentamento dos desafios da vida cotidiana, já que esse último estágio do ciclo de vida é marcado por inúmeras perdas nos âmbitos biopsicosociocultural, o que torna imprescindível tanto o resgate do bem-estar psicológico, como a busca de sentido de vida do indivíduo velho.

  16. PROJOVEM ADOLESCENTE ENQUANTO POLÍTICA PÚBLICA SÓCIOEDUCATIVA NO COMBATE AO TRABALHO INFANTIL

    Directory of Open Access Journals (Sweden)

    Analice Schaefer de Moura

    2015-05-01

    Full Text Available O presente estudo pretende averiguar como o Direito da Criança e do Adolescente estabelece estratégias de ação no sistema de garantias de direitos para a prevenção e erradicação do trabalho infantil, notadamente quanto às políticas públicas. Neste trabalho abordar-se-á o Serviço de Convivência e Fortalecimento de Vínculos para Adolescentes e Jovens de 15 a 17 anos (Projovem Adolescente, enquanto política pública efetiva e impactante para recuperar o desenvolvimento humano de jovens explorados pelo trabalho precoce. A técnica de pesquisa utilizada no decorrer da pesquisa foi a bibliográfica (artigos e livros e o método utilizado foi o hipotético-dedutivo. Ao longo do trabalho é possível constatar que a integração entre os programas sociais, característica marcante do Projovem Adolescente, tem se mostrado uma ferramenta interessante e eficaz no combate à exploração da mão de obra de crianças e adolescentes. Contudo, para garantir maior abrangência das políticas públicas direcionadas à infância ainda é necessária uma colaboração mais eficaz entre família, Estado e sociedade, conforme preconiza o art. 227 da Constituição Federal.

  17. Dos trilhos aos palacetes: refletindo sobre o acervo arquitetônico da Av. Rio Branco, Santa Maria, RS

    Directory of Open Access Journals (Sweden)

    Maria Dinair Machado

    2015-12-01

    Full Text Available Este artigo propõe uma análise sobre a preservação e conservação do patrimônio cultural edificado no centro do município de Santa Maria, mais precisamente o patrimônio localizado na Avenida Rio Branco, na área central da cidade. O município possui sua história vinculada à ferrovia que se pode observar no patrimônio cultural edificado,  sua riqueza e diversidade, localizado no centro urbano. O nosso recorte espacial é focado na antiga Avenida Progresso, atual Avenida Rio Branco, eixo que ligava a estação férrea a Praça Saldanha Marinho e a Rua do Acampamento na área central. Para este trabalho foi  realizada  pesquisa  exploratória qualitativa, utilizando-se de observação por meio de registros fotográficos do centro histórico de Santa Maria, delimitando-se à  Avenida Rio Branco. No trabalho consta um breve histórico desta avenida, uma descrição dos prédios de valor histórico e as ações realizadas ao longo dos últimos anos. Nas conclusões, é proposta uma possibilidade de intervenção territorial a partir das necessidades como políticas públicas de preservação decorrentes do atual estado de abandono das edificações naquele local.

  18. Characterizing and mitigating vibrations for SCExAO

    Science.gov (United States)

    Lozi, Julien; Guyon, Olivier; Jovanovic, Nemanja; Singh, Garima; Goebel, Sean; Norris, Barnaby; Okita, Hirofumi

    2016-07-01

    The Subaru Coronagraphic Extreme Adaptive Optics (SCExAO) instrument, under development for the Subaru Telescope, has currently the fastest on-sky wavefront control loop, with a pyramid wavefront sensor running at 3.5 kHz. But even at that speed, we are still limited by low-frequency vibrations. The current main limitation was found to be vibrations attributed mainly to the rotation of the telescope. Using the fast wavefront sensors, cameras and accelerometers, we managed to identify the origin of most of the vibrations degrading our performance. Low-frequency vibrations are coming from the telescope drive in azimuth and elevation, as well as the elevation encoders when the target is at transit. Other vibrations were found at higher frequency coming from the image rotator inside Subaru's adaptive optics facility AO188. Different approaches are being implemented to take care of these issues. The PID control of the image rotator has been tuned to reduce their high-frequency contribution. We are working with the telescope team to tune the motor drives and reduce the impact of the elevation encoder. A Linear Quadratic Gaussian controller (LQG, or Kalman filter) is also being implemented inside SCExAO to control these vibrations. These solutions will not only improve significantly SCExAOs performance, but will also help all the other instruments on the Subaru Telescope, especially the ones behind AO188. Ultimately, this study will also help the development of the TMT, as these two telescopes share very similar drives.

  19. Recommended screening and preventive practices for long-term survivors after hematopoietic cell transplantation Práticas recomendadas para triagem e prevenção de complicações em sobreviventes de longo prazo após transplante de células hematopoéticas

    Directory of Open Access Journals (Sweden)

    Navneet Singh Majhail

    2012-01-01

    Full Text Available Advances in hematopoietic cell transplantation (HCT technology and supportive care techniques have led to improvements in long-term survival after HCT. Emerging indications for transplantation, introduction of newer graft sources (e.g. umbilical cord blood and transplantation of older patients using less intense conditioning regimens have also contributed to an increase in the number of HCT survivors. These survivors are at risk for developing late complications secondary to pre-, periand post-transplant exposures and risk-factors. Guidelines for screening and preventive practices for HCT survivors were published in 2006. An international group of transplant experts was convened in 2011 to review contemporary literature and update the recommendations while considering the changing practice of transplantation and international applicability of these guidelines. This review provides the updated recommendations for screening and preventive practices for pediatric and adult survivors of autologous and allogeneic HCT.Os avanços na tecnologia do transplante de células hematopoéticas (TCH e do tratamento de suporte levaram a melhoria na sobrevida a longo prazo após os TCH. Indicações emergentes de transplante, introdução de novas fontes de células (p.ex. sangue de cordão umbilical e transplante de pacientes mais velhos utilizando regimes de condicionamento menos intensos também contribuíram para o aumento no número de sobreviventes após TCH. Estes sobreviventes estão sob risco de desenvolver complicações tardias devido a exposições e fatores de risco pré, peri e pós-transplante. Práticas recomendadas para a triagem e a prevenção de complicações em sobreviventes de TCH foram publicadas em 2006. Um grupo internacional de especialistas foi formado em 2011 para rever a literatura contemporânea e atualizar as recomendações, considerando as mudanças nas práticas de transplante e a aplicabilidade internacional destas recomenda

  20. Trajectories of cognitive decline over 10 years in a Brazilian elderly population: the Bambuí cohort study of aging Trajetória no longo prazo do declínio cognitivo entre idosos Brasileiros: estudo de coorte de idosos de Bambuí

    Directory of Open Access Journals (Sweden)

    Erico Castro-Costa

    2011-01-01

    Full Text Available Few population-based studies have examined long term cognitive trajectory, and these studies were conducted in high income countries. We investigated the association of age, gender and education with 10-year cognitive trajectory in a well-defined population of elderly using data from the Bambuí Cohort Study of Aging, in Brazil. Cognition was measured using the Mini- Mental State Examination (MMSE. Cohort members underwent annual follow-ups. This analysis was based on 12,206 MMSE measurements from 1,461 (91% baseline participants. We used mixed effects models to study MMSE as outcome. The key findings from this analysis are that women and people with a higher schooling level at baseline had high scores of MMSE, while older participants started off lower. Regarding cognitive decline, women, older people and those with a higher schooling level declined faster.Poucos estudos de base populacional examinaram a trajetória no longo prazo do declínio cognitivo. Os estudos existentes foram conduzidos em países de alta renda. Nós investigamos as associações entre idade, sexo e escolaridade e o declínio cognitivo em uma população idosa bem definida, utilizando dados de 10 anos de seguimento da coorte de Bambuí, Minas Gerais, Brasil. A cognição foi aferida anualmente por meio do Mini-Exame do Estado Mental (MEEM. Essa análise foi baseada em 12.206 medidas do MEEM de 1.461 (90% participantes da linha de base. Foram utilizados modelos de efeitos mistos, considerando-se o escore do MEEM como variável de desfecho. As mulheres e os indivíduos com maior escolaridade apresentaram resultados mais altos no MEEM na linha de base, enquanto que os idosos mais velhos apresentaram pontuações mais baixas. Com relação ao declínio cognitivo, participantes do sexo feminino, com maior escolaridade e mais velhos, apresentam reduções mais rápidas dos escores do MEEM.

  1. Aplicação do escore MELD em pacientes submetidos a transplante de fígado: análise retrospectiva da sobrevida e dos fatores preditivos a curto e longo prazo The application of MELD score in patients submitted to liver transplantation: a retrospective analysis of survival and the predictive factors in the short and long term

    Directory of Open Access Journals (Sweden)

    Ilka de Fátima Santana Ferreira Boin

    2008-12-01

    Full Text Available RACIONAL: Utiliza-se o escore MELD (Model End-Stage Liver Disease para o prognóstico da mortalidade em lista de espera para transplante de fígado e, em alguns estudos, para predição da sobrevida pós-operatória a longo prazo. OBJETIVO: Verificar a aplicação do escore MELD como predição da sobrevida após o transplante. MÉTODOS: Por intermédio de dados coletados prospectivamente efetuou-se um estudo de coorte longitudinal retrospectivo em 232 pacientes. Excluíram-se os retransplantes, insuficiência hepática aguda, crianças e enxertos duplos ou reduzidos. Avaliaram-se os dados dos doadores: idade, sexo, peso, creatinina, bilirrubina, sódio, aspartato aminotransferase, antecedentes pessoais, causa da morte, presença de esteatose, número de critérios expandidos do doador e índice de risco do doador. Em relação aos receptores, analisaram-se as variáveis: sexo, idade, peso, doença hepática, pontos de Child-Turcotte-Pugh, escore MELD, depuração de creatinina, sódio, tempos de isquemia e de hospitalização, quantidade de hemoderivados transfundidos, presença e grau de disfunção do enxerto. A análise estatística foi efetuada usando-se a análise de regressão univariada e/ou múltipla, estatística 'c', teste exato de Fisher, método de Kaplan-Meier (teste log-rank para sobrevida, e análise de regressão de Cox para risco de óbito ajustado para as condições clínicas. RESULTADOS: O ponto de corte MELD para sobrevida foi 20 e de Child-Turcotte-Pugh foi 11,5. Para escore MELD maior ou igual a 20, os fatores preditivos de sobrevida foram: volume de sangue transfundido, disfunção do enxerto e o sódio do doador. Para os hiponatrêmicos os fatores preditivos de sobrevida foram: volume de sangue transfundido, disfunção do enxerto e sódio do doador. A sobrevida estimada para pacientes com escore MELD >25 foi menor ao final de 12 meses (68,86% vs 39,13%. A sobrevida estimada para os pacientes sem hiponatremia foi maior

  2. Adesão ao tratamento da ambliopia

    OpenAIRE

    Arakaki Mara Regina; Schellini Silvana Artioli; Heimbeck Felipe Jorge; Furuya Margareth Tiemi; Padovani Carlos Roberto

    2004-01-01

    OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de ...

  3. Violência relacionada ao trabalho: uma proposta conceitual

    OpenAIRE

    Oliveira,Roberval Passos de; Nunes,Mônica de Oliveira

    2008-01-01

    p. 22-34 O aumento de situações de violência no âmbito do trabalho vem se constituindo um importante problema de Saúde Pública, que tem impacto na dignidade e na qualidade de vida dos trabalhadores. Nessa perspectiva, este artigo tem como objetivo propor, a partir da discussão do fenômeno da violência e de sua faceta concernente ao trabalho, o conceito de violência relacionada ao trabalho, como referência para futuros estudos no campo da Saúde do Trabalhador. Trata-se de um artigo conceitu...

  4. High-Performance CCSDS AOS Protocol Implementation in FPGA

    Science.gov (United States)

    Clare, Loren P.; Torgerson, Jordan L.; Pang, Jackson

    2010-01-01

    The Consultative Committee for Space Data Systems (CCSDS) Advanced Orbiting Systems (AOS) space data link protocol provides a framing layer between channel coding such as LDPC (low-density parity-check) and higher-layer link multiplexing protocols such as CCSDS Encapsulation Service, which is described in the following article. Recent advancement in RF modem technology has allowed multi-megabit transmission over space links. With this increase in data rate, the CCSDS AOS protocol implementation needs to be optimized to both reduce energy consumption and operate at a high rate.

  5. Do teatro grego ao teatro romano de Lisboa

    OpenAIRE

    Maciel, Manuel Justino

    2006-01-01

    A tipologia do teatro nasceu na Grécia e foi apropriada por Roma, com alterações significativas que constituem instrumento importante da investigação em História da Arte. Assim acontece com o teatro romano de Lisboa que, foi construído “ao modo grego”. Parece evidente que o Teatro foi adaptado para “espectáculos aquáticos”, embora o aprofundamento da reflexão exija a continuação de trabalhos arqueológicos, sob a Rua de São Mamede ao Caldas.

  6. Abuso sexual: um trajeto da fantasia ao real

    OpenAIRE

    Malgarim, Bibiana Godoi

    2015-01-01

    O presente trabalho visou apresentar a Dissertação de Mestrado realizada junto ao Programa de Pós-Graduação de Psicologia da Universidade do Vale do Rio dos Sinos, cujo título é Abuso Sexual: Um trajeto da fantasia ao real. O objetivo desta pesquisa foi compreender e interpretar a dinâmica das representações das relações objetais de duas pré-adolescentes encaminhadas por suspeita de abuso sexual, através de métodos projetivos, como o Rorschach e o HTP.

  7. Glomerulonefrite lúpica: estudo da evolução a longo prazo Lupus nephritis: a long term follow-up

    Directory of Open Access Journals (Sweden)

    R. S. Martins

    2000-06-01

    Full Text Available OBJETIVO: Estudar a apresentação clínica e a evolução de pacientes portadores de glomerulonefrite lúpica. CASUÍSTICA E MÉTODOS: Foram estudados 37 pacientes portadores de glomerulonefrite lúpica, atendidos pela Disciplina de Nefrologia - Faculdade de Medicina de Botucatu, com seguimento médio de 52,4 ± 13,3 meses. Os dados foram obtidos através do levantamento retrospectivo dos prontuários. RESULTADOS: A idade média foi de 26,05 ± 11,12 anos, com predomínio do sexo feminino (84% sendo que a glomerulonefrite classe IV foi a mais freqüente (80%. No início do seguimento a média da creatinina sérica foi de 1,74 ± 1,15 mg/dl, e a da proteinúria de 24h foi de 2,62 ± 2.89 g. Cinqüenta e um porcento dos pacientes com creatinina sérica elevada apresentaram, durante o seguimento, diminuição desses valores. Dentre diferentes variáveis estudadas, à época da biopsia renal, (idade, sexo, proteinúria, presença de hipertensão arterial e creatinina sérica a única que se associou com pior prognóstico foi a elevação da creatinina sérica. Remissão da síndrome nefrótica ocorreu em 65% das vezes. A sobrevida atuarial foi de 96%, 82%, 70% e 70% em 1, 5, 10 e 12 anos. Cinco pacientes desenvolveram insuficiência renal crônica terminal e sete morreram, sendo infecção a principal causa de óbito (57% CONCLUSÃO: Em pacientes com nefropatia lúpica, o aumento da creatinina sérica, à época da biópsia, se associou com o desenvolvimento de insuficiência renal crônica ao fim do seguimento e a principal causa de óbito foi processo infeccioso.PURPOSE: To evaluate and the long term course of patients with lupus nephritis, METHOD: Thirty seven patients with lupus nephritis followed in a referral, tertiary care center of a developing country (Brazil were studied. The length of follow up was 52.4 + 13.3 months and mean age was 26.05 +11.12 years. 84% of the patients were females and class IV nephritis was found to be the most

  8. Manejo de longo prazo em crianças com transtornos neuromusculares Long-term management of children with neuromuscular disorders

    Directory of Open Access Journals (Sweden)

    Eugen-Matthias Strehle

    2009-10-01

    Full Text Available OBJETIVO: A distrofia muscular de Duchenne é o tipo mais comum de miopatia genética. Contudo, existe um grande número de doenças neuromusculares hereditárias que são individualmente muito raras e sobre as quais não há muita informação clínica disponível. Este artigo de revisão baseia-se na experiência do autor em uma clínica pediátrica para tratamento de doenças musculares e apresenta orientação prática e planos terapêuticos para os problemas frequentemente encontrados. FONTES DE DADOS: O banco de dados da MEDLINE foi pesquisado com o objetivo de localizar artigos recentes e relevantes para o manejo de crianças com miopatias e neuropatias hereditárias. Uma coorte de 200 pacientes foi avaliada através de análise estatística descritiva. SÍNTESE DOS DADOS: A distrofia muscular de Duchenne representou quase metade dos diagnósticos, seguida da atrofia muscular espinhal (12%, da distrofia muscular de Becker e da distrofia miotônica (7% cada. Dezesseis pacientes (9% apresentaram miopatia de origem desconhecida. CONCLUSÕES: Assim como ocorre com outras doenças crônicas, esses pacientes devem passar por acompanhamento periódico realizado por profissionais de saúde desde cedo para aumentar sua expectativa de vida e melhorar sua qualidade de vida. É útil para os médicos adotarem uma abordagem estruturada ao atender crianças com transtornos neuromusculares e monitorar todos os sistemas de órgãos afetados.OBJECTIVE: Duchenne muscular dystrophy is the commonest genetic myopathy but there exist a large number of inherited neuromuscular diseases which individually are very rare and where clinical information is not widely available. This review is based on the author's experience in a pediatric muscle clinic and provides practical guidance and treatment plans for frequently encountered problems. SOURCES: A MEDLINE search was conducted to retrieve recent articles relevant to the management of children with

  9. Eficiência de uso do fósforo em sistemas de manejo do solo e adubação fosfatada por um longo período

    OpenAIRE

    Nunes,Rafael de Souza

    2014-01-01

    Por ser obtido a partir de um recurso natural não renovável, o fertilizante fosfatado deve ser usado de forma a maximizar sua eficiência de uso. No entanto, o melhor entendimento do efeito de práticas agrícolas nesse processo só pode ser obtido em experimentos de longa duração. O objetivo deste trabalho foi compreender os efeitos do sistema de manejo do solo e da adubação fosfatada por um longo período na produtividade de grãos e eficiência de uso do fósforo por soja e milho. Para isso, um La...

  10. Endividamento de longo prazo e desempenho em tempos de crise: evidências de empresas no Brasil e América Latina = Long-term debt and performance in crisis times: evidences of firms from Brazil and Latin America

    Directory of Open Access Journals (Sweden)

    Dermeval Martins Borges Junior

    2017-04-01

    Full Text Available Este trabalho teve como objetivo examinar o efeito do endividamento de longo prazo no desempenho de empresas brasileiras e latino-americanas, de modo a abranger o cenário econômico anterior, durante e após a crise mundial de 2008. Considerou-se no estudo os dados contábeis referentes às companhias abertas listadas nas Bolsas de Valores do Brasil, Chile, Argentina, Colômbia, México e Peru, durante o período compreendido entre 2007 e 2015. Foi elaborado um modelo de regressão linear múltipla com dados em painel baseados na literatura sobre o tema. O software Stata foi utilizado para a análise dos dados. Os resultados indicaram que para as empresas da América Latina, exceto para as do Brasil, existe relação negativa entre o endividamento de longo prazo e o desempenho. No caso das empresas brasileiras, para tal relação, os resultados se mostraram inconclusivos. This study aimed at examining the effect of long-term debt on the performance of Brazilian and Latin American companies, encompassing the previous economic scenario, during and after the global crisis of 2008. It was considered in this study the accounting data from public companies listed in stock exchanges of Brazil, Chile, Argentina, Colombia, Mexico and Peru within the period of 2007 to 2015. It was elaborated a multiple linear regression model with panel data based on the literature of the subject. It was used Stata software for data analysis. The results indicated that for companies from Latin America, except Brazilians, there is a negative relationship between long-term debt and performance. In the case of Brazilian companies, for such relationship, the results were inconclusive.

  11. POLÍTICAS PÚBLICAS DE SAÚDE PARA A POPULAÇAO LGBT NO BRASIL: IDENTIDADES SEXUAIS E NOVAS ZONAS DE EXCLUSÃO

    Directory of Open Access Journals (Sweden)

    Rodrigo Broilo

    2015-12-01

    Full Text Available A história das lutas por políticas públicas para a população LGBT teve início na década de 1980, com o advento da epidemia mundial de HIV/AIDS. Ao longo das décadas subsequentes as políticas públicas, em especial de saúde, foram tomando rumos que intencionavam pensar na integralidade dos sujeitos LGBT. Porém, o que se percebe é que a maior parte dessas políticas está embasada na construção de identidades sexuais, marcadas pelos binarismos homem/mulher, masculino/feminino, heterossexual/homossexual, sendo os primeiros termos ainda hegemônicos. A análise aqui proposta mostra como essas identidades acabam por criar novas segregações, promover a manutenção da heteronormatividade e a homofobia, em suas variantes. Através de críticas pós-identitárias, originadas da teoria queer, este artigo convida para uma desconstrução crítica da visão dos indivíduos como seres acabados em termos de sexualidade, gênero, práticas sexuais e desejos. Palavras chaves: políticas públicas; LGBT; identidades sexuais; saúde; teoria queer. 

  12. Resistência de cultivares de videira ao ácaro-rajado Tetranychus urticae na região de Jales, estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Gisele Santos Valadão

    2012-12-01

    Full Text Available As videiras da região de Jales, Estado de São Paulo, têm sido intensamente atacadas pelo ácaro-rajado, Tetranychus urticae Koch. O presente trabalho teve por objetivo comparar cultivares de uva quanto à adequação como hospedeiras da espécie. Em experimento de campo, naquele local, a ocorrência da praga, ao longo de 12 meses, foi acompanhada nas cultivares de uvas finas, Itália e Benitaka, e na cultivar de uva rústica, Niagara Rosada. No laboratório, a biologia de T. urticae foi estudada nessas três cultivares e na 'Redimeire'. Na cultivar Niagara Rosada, o ácaro-rajado apresentou menor fecundidade e menor sobrevivência, indicando a presença de mecanismos de resistência por antibiose. Além disso, houve maior tentativa de fuga dessa cultivar, sugerindo resistência por não preferência.

  13. Do corpo produtivo ao corpo rascunho: aproximações conceituais a partir de relações entre corpo e tecnologia

    Directory of Open Access Journals (Sweden)

    Dulce Filgueira de Almeida

    2014-12-01

    Full Text Available O presente artigo tem o propósito de examinar relações entre "corpo e tecnologia" no contexto do projeto social moderno, tomando como referência as noções de "corpo produtivo" e "corpo rascunho". A análise é desenvolvida por meio de fontes bibliográficas do campo da sociologia do corpo, permeando esse debate com autores da área de educação física. O conceito de corpo rascunho revelou-se heurístico para entendimento de relações do corpo com processos tecnológicos, em nossa época. Concluiu-se, preliminarmente, que a concepção de corpo sofreu mudanças e representações distintas ao longo da história, mas, atualmente, tais modificações acontecem de forma rotineira, produzindo uma noção fluida, segundo a qual poder-se-ia ser, a qualquer momento, o que se desejasse ser.

  14. Implementação de modelo para balanceamento de fluxos aplicado ao gerenciamento de tráfego aéreo

    Directory of Open Access Journals (Sweden)

    Bueno Borges de Souza

    2009-10-01

    Full Text Available

    Este trabalho descreve um sistema de auxílio à decisão com metodologias de Teoria dos Grafos e Inteligência Artificial para dar suporte ao Gerenciamento de Fluxo de Tráfego Aéreo Brasileiro. Trata-se de um modelo de gerenciamento de fluxo baseado em grafos com adaptações heurísticas para a regulação dinâmica do fluxo. O modelo fundamenta a arquitetura do Módulo de Balanceamento de Fluxo (MBF integrante do Sistema Distribuído de Apoio a Decisão aplicado ao Gerenciamento Tático do Fluxo de Tráfego(SISCONFLUX, em desenvolvimento, e tem o objetivo de melhorar o gerenciamento do espaço aéreo nacional. O MBF foi proposto para dar suporte ao sistema em operação no Primeiro Centro Integrado de Defesa Aérea e Controle de Tráfego Aéreo (CINDACTA I, fornecendo informações adicionais para o processo aplicado pelos controladores a fim de amenizar a carga de trabalho e melhorar os resultados de suas ações. Usando técnicas de maximização de fluxo adaptados da Teoria dos Grafos, o MBF foi desenvolvido como um modelo de análise que determina o tempo de separação entre decolagens a partir das terminais integrantes da Região de Informação de Vôo de Brasília (FIR-BS e distribui a folga do fluxo ao longo do espaço aéreo controlado, objetivando prevenir ou reduzir o congestionamento nos diversos setores da FIR-BS. O MBF dá suporte à regulação do fluxo de tráfego auxiliando os controladores e as outras unidades dentro do SISCONFLUX.

  15. Balizas do conhecimento: análise das instruções aos autores das revistas brasileiras da área de saúde

    Directory of Open Access Journals (Sweden)

    Stella Regina Taquette

    Full Text Available Resumo Pesquisadores da área da saúde referem que a dificuldade em publicar é uma barreira à realização de estudos qualitativos. Buscou-se identificar que periódicos brasileiros indexados no SciELO na área de ciências da saúde incluem instruções aos autores que possibilitam a publicação de estudos originais realizados com métodos qualitativos. Dos 88 títulos analisados, mais da metade (52 impõem condições incompatíveis com a pesquisa qualitativa, sendo a maioria revistas médicas. Alguns periódicos (19 não disponibilizam informações relativas ao tipo de estudo, mas não fazem exigências típicas de pesquisas quantitativas, como testes estatísticos e reprodutibilidade. Revistas que demonstram aceitar investigações qualitativas (17 permitem textos mais longos, desenhos de estudo que incluem entrevistas e algumas explicitam a aceitação de estudos com abordagens qualitativas. Em geral estas são da área de saúde coletiva ou enfermagem, e têm pontuações mais altas na CAPES. A falta de instruções claras para manuscritos de natureza qualitativa e a exigência de quantificação são barreiras à publicação de estudos qualitativos, não favorecendo a ampliação do olhar do clínico para os fenômenos humanos relacionados à saúde. Critérios de cientificidade e rigor devem ser revistos.

  16. Dimensões Conceituais do Desvio: do Formalismo ao Homoerotismo

    Directory of Open Access Journals (Sweden)

    José Luiz Foureaux de Souza Júnior

    2016-06-01

    Full Text Available O que vai aqui dito é simplesmente uma tentativa de síntese de um longo e intrincado processo de investigação teórica acerca da Literatura. O pressuposto básico é o de que é necessário, mais que possível, produzir um conhecimento específico acerca do literário, para que esta “disciplina”, a Teoria da Literatura, não se torne apenas um exercício retórico de descrição de um objeto alheio a este mesmo exercício. Daí a idéia de que a leitura do texto literário não perde, nunca, a sua efetividade. O conhecimento teórico que se procura produzir, então, terá a marca do exercício da leitura crítica que interpreta, projetando sentidos discursivos possíveis, a partir de uma subjetividade que se constitui e se submete, paradoxal e simultaneamente, neste mesmo discurso. O leitor deixa de ser a figura decorativa entronizada por um acerta tradição teórica, para ocupar o lugar de cento do discurso teórico-crítico-interpretativo da literatura, instituído a partir dos estudos da Estética da recepção.

  17. Resposta ao estresse: II. Resiliência e vulnerabilidade

    Directory of Open Access Journals (Sweden)

    Nicole Leite Galvão-Coelho

    2015-06-01

    Full Text Available ResumoA crescente exposição a estressores na vida cotidiana aumentou significativamente a investigação da resposta ao estresse nas duas últimas décadas. Embora associada a consequências negativas, pois muitas patologias físicas e mentais são desencadeadas por exposição crônica a estressores, esta resposta é indispensável para sobrevivencia do indivíduo e é extremamente adaptativa quando ativada de forma aguda. Na parte I desta revisão foram abordados os conceitos de homestase e alostase e os sistemas fisiológicos ativados durante a resposta ao estresse. Na parte II serão discutidos fatores que modulam a resposta ao estresse tais como sexo, temperamento, períodos críticos do desenvolvimento e a presença ou ausência de suporte social. A interação entre os fatores genéticos e ambientais gera os perfis da resposta psicofisiológica que caracterizam os fenótipos de susceptibilidade e resiliência frente aos estressores e sua relação com uma patologia mental cada vez mais presente na sociedade moderna, o transtorno de estresse pós-traumático.

  18. Reptiles and Amphibians of Curaçao

    NARCIS (Netherlands)

    Rooij, de Nelly

    1922-01-01

    The Zoological Museum of Amsterdam received some collections of reptiles from Curaçao made by Dr. J. BOEKE in 1905, by Dr. C. J. VAN DER HORST in 1920 and by Mr. G. J. H. MOLENGRAAFF „Engineer” in 1921. I had the opportunity of studying them and will here give an enumeration of all the reptiles

  19. Variability in olecranon AO fracture fixation: A radiological study ...

    African Journals Online (AJOL)

    Background: Tension Band Wire(TBW) fixation of olecranon fracture is a commonly used technique by orthopaedic surgeons. However surgeons do not strictly adhere to the AO standard. Objectives: To determine the use and variability of this technique by surgeons at the hospital. Design: A hospital based retrospective ...

  20. Adesão ao tratamento da ambliopia

    Directory of Open Access Journals (Sweden)

    Arakaki Mara Regina

    2004-01-01

    Full Text Available OBJETIVO: Avaliar a influência da adesão no resultado do tratamento da ambliopia. MÉTODOS: Foi feito estudo retrospectivo avaliando a resposta ao tratamento da ambliopia em 151 crianças portadoras de ambliopia, tratadas com esquema de oclusão diária, com o número de dias variando de acordo com a idade da criança. Os pacientes foram separados em dois grupos que diferiam entre si pela adesão ou não ao tratamento. RESULTADOS: Observou-se que o tratamento teve melhores resultados nas crianças de 4 a 7 anos e que aderiram ao tratamento; as crianças que aderiram ao tratamento necessitaram de tempo menor de permanência em tratamento. Mesmo crianças com idade superior a 7 anos tiveram resultados positivos com a oclusão. CONCLUSÃO:O tratamento oclusivo é um meio terapêutico eficiente desde que haja a cooperação do paciente.

  1. The Foraminifera of Piscadera Bay, Curaçao

    NARCIS (Netherlands)

    Hofker, J.

    1971-01-01

    Piscadera Bay is situated 4 km West of Willemstad, Curaçao, between two limestone hills which have a height of about 100 m. It is a drowned river system, the entrance of which is almost completely blocked by a bar of coral debris reaching to about 2 meters above sea level. The following parts may be

  2. On some Polychaetous Annelids from Curaçao

    NARCIS (Netherlands)

    Horst, R.

    1922-01-01

    Though we know already a rather large number of Polychaetous Annelids from the Caribbean Sea, hitherto, as far as I know, no Annelids have been described from the coast of the island Curaçao and I therefore was very glad, that my colleague Dr. VAN DER HORST kindly placed in my hands for

  3. Do GIZ ao AVA: a importância de um centro virtual de ensino de língua e cultura hispano-americana para discentes da rede pública de ensino da cidade de Salvador-Bahia

    Directory of Open Access Journals (Sweden)

    Elissandro dos Santos Santana

    2013-05-01

    Full Text Available Este trabalho é fruto de um projeto de intervenção e de lei em torno das contribuições de um Centro Virtual de Ensino Língua e Cultura Hispano-americana para discentes da rede pública de ensino da cidade do Salvador, Bahia. Para tanto, optou-se por uma pesquisa bibliográfica, por meio do levantamento de fontes primárias e secundárias, com vistas à fundamentação necessária para a consubstanciação de um plano de caráter interventivo que culminou em um trabalho de conclusão de especialização em Metodologia do ensino de língua espanhola. Ao longo do texto são abordados os seguintes tópicos: o contexto histórico-social e leis no tangente ao ensino de língua estrangeira no Brasil, a importância do turismo e qualificação de profissionais em língua espanhola para a cidade do Salvador e as possíveis contribuições de um Centro Virtual de ensino de espanhol.

  4. Nitrogenous metabolism in Thoroughbred and Arabian foals from birth to five months of age Metabolismo do nitrogênio em potros PSI e Árabe do nascimento aos cinco meses de idade

    Directory of Open Access Journals (Sweden)

    G. Piccione

    2006-08-01

    Full Text Available The maturation of nitrogen metabolism was studied in six Thoroughbred and six Arabian foals. Rectal temperature, heart and respiratory rates and serum concentration of several hematochemical parameters (total protein, urea, uric acid, creatinine, and albumine were monitored from birth to 5 months of age. In both breeds, all the parameters except albumine showed significant differences over time (PA maturação do metabolismo do nitrogênio foi estudada em seis potros da raça Puro-Sangue Inglês e seis da raça Árabe. A temperatura retal, batimento cardíaco e concentração sérica de várias características hematoquímicos (proteína total, uréia, ácido úrico, creatinina e albumina foram investigadas do nascimento aos cinco meses de idade. Em ambas as raças, todas as características, exceto a albumina, mostraram diferenças significativas ao longo da maturação (P<0,05. As duas raças não diferiram uma da outra durante os períodos de vida equivalentes. Reduções significativas das concentrações de uréia e creatinina mostraram as necessidades de crescimento dos potros durante esse período crítico de desenvolvimento.

  5. Controlo clínico e histopatológico da asma quando utilizada a hiperreactividade brônquica como um indicador adicional no tratamento da asma a longo prazo

    Directory of Open Access Journals (Sweden)

    Jacob K. Sont

    2000-01-01

    ligeira a moderada, observados trimestralmente no período de 2 anos. Em cada visita foi avaliado o Volume Expiratório Máximo no 1° Segundo (VEMS e realizada Prova de Provocação Inalada (PPI com metacolina. Os doentes tinham cartões diários de registo de sintomas, de uso de β2-agonistas e determinações do DEMI.A terapêutica com corticosteróides (em 4 niveis foi ajustada de acordo com as indicações 'em degraus' do Consenso Internacional (estratégia de refêrenda as quais adicionaram 4 classes de gravidade da HRB (estrategia HRB: Nível I- HRB com metacolina - >4.0 mg/ml; Nível II-1.0 - 4.0 mg/ml; Nível III - 0.25 -1.0 mg/ml; Nível IV-<0.25 mg/ml.Foram obtidas biópsias por broncofibroscopia, no início e dois anos depois.Os autores veriticaram que os doentes tratados de acordo com a estratégia HRB tiveram menor incidência de exacerbações ligeiras do que os doentes do grupo de referência (0.23 e 0.43 exacerbações/ano/doente, respectivamente. O VEMS também melborou significativamente no grupo de estratégia HRB (p<0.05.As biópsias brônquicas revelaram uma maior redução na espessura da camada reticular subendotelial no grupo de estrategia HRB relativamente ao grupo de referência As alterações da HRB em ambos os grupos de estratégia correlacionaram-se com as contagens de eosinófilos nas biópstas (r=- 0.48; p=0.0003.Os autores concluem que a redução da HRB conjugada com a optimização dos sintomas e da função pulmonar conduzem a um controlo mais efectivo da Asma. bem como à melhoria da inflamação das vias aéreas. Deste modo, a monitorização da HRB poderia ser um marcador da inflamação a considerar nas estratégias de tratamento a longo prazo da asma. COMENTÁRIO: Nos últimos anos, têm-se procurado criar normas de orientarção no diagnóstico e terapêutica da Asma Brônquica, atraves da

  6. Prevenção ao crime e teoria social

    OpenAIRE

    Sento-Sé, João Trajano

    2011-01-01

    O artigo estabelece um diálogo entre a criminologia positivista e algumas correntes contemporâneas da prevenção ao crime inspiradas em teorias sociológicas. Através desse exercício, busca-se evidenciar que algumas das formulações focadas no campo da prevenção já aparecem, em estado embrionário, na agenda teórica positivista. Do mesmo modo, torna-se possível explicitar que alguns postulados empíricos e práticos do positivismo são menos estranhos às teorias contemporâneas de prevenção ao crime ...

  7. Cuidado ao desenvolvimento: intervenções de proteção ao desenvolvimento inicial de recém-nascidos pré-termo Developmental care: protection approach for early development of preterm infants

    Directory of Open Access Journals (Sweden)

    Cláudia Maria Gaspardo

    2010-03-01

    Full Text Available OBJETIVO: Revisar ensaios clínicos randomizados, publicados entre 2002 e 2009, sobre a eficácia de intervenções em Cuidado ao Desenvolvimento em recém-nascidos pré-termo em Unidade de Terapia Intensiva Neonatal. FONTES DE DADOS: Foram selecionados estudos randomizados dos bancos de dados Medline, PsycINFO, ISI Web of Science, LILACS e SciELO, usando-se as palavras-chave "developmental care" e "neonate". Realizou-se uma análise metodológica dos estudos, com base nos critérios: randomização, estimativa do tamanho amostral, perda amostral, critérios de inclusão e exclusão, controle de variáveis de confusão, validade dos instrumentos, condição "cega" do pesquisador, realização de seguimento, validades externa e ecológica e cuidados éticos. SÍNTESE DOS DADOS: As intervenções em Cuidado ao Desenvolvimento promoveram melhora em curto prazo nos resultados fisiológicos, comportamentais, neurológicos e clínicos dos recém-nascidos. Observou-se diminuição da reatividade à dor nos recém-nascidos durante procedimentos de pesagem e troca de fraldas. Os pais que receberam intervenções em Cuidado ao Desenvolvimento passaram a apresentar maior senso de competência para cuidar do recém-nascido. Os profissionais treinados em Cuidado ao Desenvolvimento demonstraram melhor desempenho na assistência ao recém-nascido e valorizaram mais os estímulos ambientais, físicos e sociais. CONCLUSÕES: Intervenções em Cuidado ao Desenvolvimento na Unidade de Terapia Intensiva Neonatal promoveram benefícios ao desenvolvimento e saúde dos recém-nascidos pré-termo no período neonatal e no primeiro ano de vida. Em estudos futuros, recomenda-se maior rigor metodológico no que se refere à condição de pesquisador "cego" em relação às intervenções e controle das variáveis de confusão. Estudos prospectivo-longitudinais são necessários para avaliar a eficácia das intervenções em médio e longo prazo no desenvolvimento

  8. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    Directory of Open Access Journals (Sweden)

    Cenir Gonçalves Tier

    2008-06-01

    Full Text Available Instituições de Longa Permanência para Idosos (ILPI são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar Morin. Primeiro, se reflete sobre a complexidade; depois, se relaciona o cuidado ao idoso deprimido e residente em ILPI, com os princípios dialógico, recursivo e hologramático. Percebeu-se que a Complexidade pode sustentar teoricamente, não só a compreensão do fenômeno depressão no idoso residente em uma ILPI, como também inspirar o modo de cuidar que direcione aos trabalhadores da saúde, que atuam junto à pessoa idosa, a abordarem o idoso de forma mais global. Para tanto deve ser utilizada a Avaliação Multidimensional do Idoso, que analisa as várias dimensões da pessoa idosa, contribuindo no desenvolvimento de um plano de cuidado/tratamento e acompanhamento multidisciplinar e interdisciplinar adequados. A Complexidade vem sendo utilizada, por enfermeiros, para entender melhor a enfermagem e prestar cuidado mais adequado ao ser humano.

  9. Da esclerodermia ao síndrome de poems

    Directory of Open Access Journals (Sweden)

    Ana Sofia Montez

    2015-12-01

    Full Text Available Homem, 84 anos, com antecedentes de hipotiroidismo e alterações cutâneas recentes compatíveis com esclerodermia, confirmadas em biópsia cutânea, mas com estudo auto-imune negativo. Foi internado por queixas constitucionais. Ao exame objetivo, apresentava-se emagrecido, com lesões de vitiligo nas mãos além das de esclerodermia (figura 1 e distensão abdominal com ascite

  10. High-Resolution Imaging of Asteroids/Satellites with AO

    Science.gov (United States)

    Merline, William

    2012-02-01

    We propose to make high-resolution observations of asteroids using AO, to measure size, shape, and pole position (spin vectors), and/or to search for satellites. We have demonstrated that AO imaging allows determination of the pole/dimensions in 1 or 2 nights on a single target, rather than the years of observations with lightcurve inversion techniques that only yield poles and axial ratios, not true dimensions. Our new technique (KOALA) combines AO imaging with lightcurve and occultation data for optimum size/shape determinations. We request that LGS be available for faint targets, but using NGS AO, we will measure several large and intermediate asteroids that are favorably placed in spring/summer of 2012 for size/shape/pole. Accurately determining the volume from the often-irregular shape allows us to derive densities to much greater precision in cases where the mass is known, e.g., from the presence of a satellite. We will search several d! ozen asteroids for the presence of satellites, particularly in under-studied populations, particularly NEOs (we have recently achieved the first-ever optical image of an NEO binary [Merline et al. 2008b, IAUC 8977]). Satellites provide a real-life lab for testing collisional models. We will search for satellites around special objects at the request of lightcurve observers, and we will make a search for debris in the vicinity of Pluto, in support of the New Horizons mission. Our shape/size work requires observations over most of a full rotation period (typically several hours).

  11. Atitudes dos profissionais de enfermagem relacionadas ao Processo de Enfermagem

    Directory of Open Access Journals (Sweden)

    Erika de Souza Guedes

    2012-10-01

    Full Text Available Os objetivos do estudo foram descrever a disposição sobre o Processo de Enfermagem (PE e a percepção de poder clínico dos profissionais de enfermagem; analisar associações entre atitudes relacionadas ao PE e variáveis selecionadas. Participaram 1.605 auxiliares de enfermagem e enfermeiros (86,9% mulheres, idade média 44,12 anos; DP=9,55. O escore médio no instrumento Posições sobre o Processo de Enfermagem (PPE foi 112,37 (DP=22,28 e no Power as Knowing Participation in Change Tool - versão brasileira (PKPCT foi 281,12 (DP= 38,72. Os escores nos instrumentos foram mais altos para enfermeiros quando comparados aos auxiliares. Houve correlação positiva moderada entre escores do PPE e PKPCT. Para os auxiliares houve associação entre os escores no PPE, sexo e pós-graduação; e entre percepção de poder e sexo. Para os enfermeiros houve associação entre PKPCT e cargo de chefia. Mais estudos devem ser desenvolvidos com vistas a identificar variáveis potencialmente associadas ao uso do Processo de Enfermagem na prática clínica.

  12. Análise perceptiva e nasométrica da hipernasalidade após a veloplastia intravelar para correção da insuficiência velofaríngea: efeitos a longo prazo

    Directory of Open Access Journals (Sweden)

    Renata Paciello Yamashita

    2014-06-01

    Full Text Available Objetivo investigar o efeito, a longo prazo, da veloplastia intravelar realizada para a correção cirúrgica da insuficiência velofaríngea (IVF residual, sobre a hipernasalidade de indivíduos com fissura de palato reparada. Métodos foram avaliados 60 pacientes com fissura de palato±lábio operada e IVF residual, de ambos os sexos, com idade entre 4 e 52 anos, os quais foram submetidos à palatoplastia secundária com veloplastia intravelar. A avaliação perceptivo-auditiva da fala foi realizada para classificação da hipernasalidade, durante a conversação espontânea e a repetição de vocábulos e frases, utilizando-se escala de 6 pontos, onde 1=ausência e 6=hipernasalidade grave. A nasometria foi utilizada para determinação do escore de nasalância (correlato acústico da nasalidade, durante a leitura de 5 sentenças contendo sons exclusivamente orais, utilizando-se como limite de normalidade o escore de 27%. As avaliações foram realizadas 4 dias antes e 16 meses, em média, após a cirurgia e o sucesso cirúrgico foi analisado com base na proporção de redução e eliminação/normalização da hipernasalidade e da nasalância. Resultados verificou-se, após a cirurgia, redução da hipernasalidade e da nasalância em 75% e 52% dos pacientes, respectivamente. Proporções menores foram identificadas quando utilizado o critério mais rigoroso de análise (eliminação/normalização, ou seja, 32% de eliminação da hipernasalidade e 38% de normalização da nasalância, respectivamente. Conclusão aveloplastia intravelarmostrou ser um procedimento efetivo, a longo prazo, na redução do sintoma mais significante da IVF residual e deve ser considerada como uma primeira opção no tratamento cirúrgico da IVF residual.

  13. Volumetric and superficial characterization of carbon activated; Caracterizacion volumetrica y superficial de carbon activado

    Energy Technology Data Exchange (ETDEWEB)

    Carrera G, L.M.; Garcia S, I.; Jimenez B, J.; Solache R, M.; Lopez M, B.; Bulbulian G, S.; Olguin G, M.T. [Departamento de Quimica, Gerencia de Ciencias Basicas, Instituto Nacional de Investigaciones Nucleares, A.P. 18-1027, 11801 Mexico D.F. (Mexico)

    2000-07-01

    The activated carbon is the resultant material of the calcination process of natural carbonated materials as coconut shells or olive little bones. It is an excellent adsorbent of diluted substances, so much in colloidal form, as in particles form. Those substances are attracted and retained by the carbon surface. In this work is make the volumetric and superficial characterization of activated carbon treated thermically (300 Centigrade) in function of the grain size average. (Author)

  14. Aggregate stability as affected by short and long-term tillage systems and nutrient sources of a hapludox in southern Brazil Efeitos de curto e de longo prazo da aplicação de sistemas de manejo do solo e de fontes de nutrientes sobre a estabilidade de agregados, em um nitossolo vermelho

    Directory of Open Access Journals (Sweden)

    Milton da Veiga

    2009-08-01

    sources on GMD AD and GMD WS was small and did not affect SI.A capacidade do solo em manter sua estrutura diante da ação de agentes erosivos como a água é geralmente alta em condições naturais e reduz quando o solo é sujeito a um preparo frequente e intensivo. O efeito de curto e de longo prazo de cinco sistemas de preparo do solo (PD = plantio direto; PE = escarificação e gradagem; PC = aração e duas gradagens; PCq = PC com resíduos queimados; e PCr = PC com resíduos retirados associados com cinco fontes de nutrientes (T = testemunha; AM = adubação mineral de acordo com a recomendação para manutenção de cada cultura; EA = 5 Mg ha-1 ano-1 de cama de aviário, base úmida; EB = 60 m³ ha-1 ano-1 de esterco líquido de bovinos; e 40 m³ ha-1 ano-1 de esterco líquido de suínos sobre a estabilidade dos agregados foi determinado ao final do nono ano de experimentação (coleta em quatro camadas e em cinco épocas de amostragens efetuadas durante o décimo ano (coleta em duas camadas, em um Nitossolo Vermelho com alto teor de argila, no Sul do Brasil. A distribuição de tamanho de agregados secos ao ar foi fortemente alterada pela densidade do solo, e os maiores valores de diâmetro médio geométrico (DMG SA encontrado em alguns sistemas de preparo ou camadas podem ser parcialmente devidos ao maior estado de compactação do solo. Depois de nove anos, o PD e o PE apresentaram maior DMG SA na camada superficial, em comparação com os sistemas de preparo convencional (PC, PCq e PCr, devido ao maior conteúdo de matéria orgânica, bem como à menor mobilização do solo. A estabilidade dos agregados em água, por outro lado, foi influenciada pela pequena variação na umidade das amostras por ocasião da realização do teste, resultando em alto coeficiente de variação dessa determinação. O PD apresentou maior diâmetro médio geométrico dos agregados estáveis em água (DMG EA na camada de 0,00-0,05 m; o PC, nas camadas de 0,05-0,10 e 0,12-0,17 m; e

  15. Fatores associados a baixa adesao ao tratamento medicamentoso em idosos

    Directory of Open Access Journals (Sweden)

    Noemia Urruth Leao Tavares

    2013-12-01

    Full Text Available OBJETIVO : Analisar fatores associados à baixa adesão ao tratamento medicamentoso em idosos. MÉTODOS : Estudo transversal de base populacional, com amostra representativa de 1.593 indivíduos com 60 anos ou mais, residentes na região urbana de Bagé, RS, em 2008. A amostragem foi realizada em múltiplos estágios. Os dados foram coletados em entrevistas individuais nos domicílios. Analisou-se a associação entre a baixa adesão referida ao tratamento medicamentoso mensurado pelo Brief Medication Questionnaire (BMQ e fatores demográficos, socioeconômicos, comportamentais e de saúde, assistência e prescrição. Foi utilizado modelo de regressão de Poisson para estimar as razões de prevalência bruta e ajustada, os respectivos intervalos de confiança de 95% e p-valor (teste de Wald. RESULTADOS : Cerca de 78,0% dos indivíduos referiram ter usado algum medicamento nos sete dias precedentes à entrevista. Desses, cerca de 1 / 3 foram considerados com baixa adesão ao tratamento. Os fatores significativamente associados à baixa adesão foram: idade (65 a 74 anos, não ter plano de saúde, ter que comprar (totalmente ou em parte os seus medicamentos, ter três ou mais morbidades, possuir incapacidade instrumental para a vida diária e usar três ou mais medicamentos. CONCLUSÕES : A utilização elevada de medicamentos, decorrente da alta prevalência de doenças crônico-degenerativas em idosos, e o acesso ao tratamento devem ser considerados pelos profissionais de saúde para adoção de estratégias que visem diminuir a baixa adesão ao tratamento, aumentando a resolutividade terapêutica e a qualidade de vida desses pacientes.

  16. Suppression of Plant Immune Responses by the Pseudomonas savastanoi pv. savastanoi NCPPB 3335 Type III Effector Tyrosine Phosphatases HopAO1 and HopAO2

    Science.gov (United States)

    Castañeda-Ojeda, María Pilar; Moreno-Pérez, Alba; Ramos, Cayo; López-Solanilla, Emilia

    2017-01-01

    The effector repertoire of the olive pathogen P. savastanoi pv. savastanoi NCPPB 3335 includes two members of the HopAO effector family, one of the most diverse T3E families of the P. syringae complex. The study described here explores the phylogeny of these dissimilar members, HopAO1 and HopAO2, among the complex and reveals their activities as immune defense suppressors. Although HopAO1 is predominantly encoded by phylogroup 3 strains isolated from woody organs of woody hosts, both HopAO1 and HopAO2 are phylogenetically clustered according to the woody/herbaceous nature of their host of isolation, suggesting host specialization of the HopAO family across the P. syringae complex. HopAO1 and HopAO2 translocate into plant cells and show hrpL-dependent expression, which allows their classification as actively deployed type III effectors. Our data also show that HopAO1 and HopAO2 possess phosphatase activity, a hallmark of the members of this family. Both of them exert an inhibitory effect on early plant defense responses, such as ROS production and callose deposition, and are able to suppress ETI responses induced by the effectorless polymutant of P. syringae pv. tomato DC3000 (DC3000D28E) in Nicotiana. Moreover, we demonstrate that a ΔhopAO1 mutant of P. savastanoi NCPBB 3335 exhibits a reduced fitness and virulence in olive plants, which supports the relevance of this effector during the interaction of this strain with its host plants. This work contributes to the field with the first report regarding functional analysis of HopAO homologs encoded by P. syringae or P. savastanoi strains isolated from woody hosts. PMID:28529516

  17. Estudo exploratório do uso da vinhaça ao longo do tempo: II. Características da cana-de-açúcar Exploratory study of the stillage use along the time: II. Characteristics of the sugarcane crop

    Directory of Open Access Journals (Sweden)

    Janaina Paulino

    2011-03-01

    Full Text Available O presente trabalho foi realizado em Cidade Gaúcha, PR, e teve como objetivo avaliar a resistência mecânica do solo, compactação, níveis de cálcio, magnésio e potássio, além da saturação de bases no solo e a densidade de raízes de cana-de-açúcar fertirrigados com vinhaça durante 1, 2, 3, 4, 12 e 20 anos e em uma área que não recebeu aplicação. A compactação foi avaliada com um penetrômetro de cone até 0,50 m de profundidade; a cada 0,02 m as análises químicas foram realizadas em amostras de solo coletadas entre 0 e 0,20 e 0,20 e 0,40 m de profundidade e a densidade de raízes avaliada com a pesagem de massa seca das raízes extraídas de monólitos de solos retirados a cada 0,10 m de profundidade, até 0,50 m. A maior resistência mecânica do solo ocorreu na área com vinte anos de aplicação de vinhaça. A concentração de cálcio decresceu após 2 anos de aplicação de vinhaça, acompanhando a fertilidade atual dos solos, não tendo ligação direta com a produtividade; já a concentração de potássio no solo apresentou relação direta com a produtividade; A quantidade de raízes no perfil do solo aumentou com o tempo de aplicação de vinhaça.This work was conducted in the Cidade Gaúcha PR, with the objective to evaluate the mechanical resistance of soil, the levels of calcium, magnesium, potassium, base saturation in the soil, the roots distribution and yield of sugarcane fertigated with wastewater (stillage of sugarcane industry for 1, 2, 3, 4, 12 and 20 consecutive years and a control without application. The soil compaction was evaluated with penetrometer cone to 0.50 m depth in intervals of 0.02 m. The results of chemical analysis of soil samples collected between the depths of 0 to 0.20 and 0.20 to 0.40 m were evaluated. The root density was evaluated with the weight of the dry matter of roots with the monolith method retreats to each 0.10 m depths to 0.50 m. The high soil mechanical resistance occurred where wastewater of sugarcane industry was applied for 20 years. The concentration of calcium decreased after two years of application of wastewater, accompanying the fertility of the soils not showing direct connection with the productivity as well as the magnesium. The concentration of the potassium in soil presented linear relation with the productivity. The roots of the sugarcane presented a direct relation with the application time of wastewater of sugarcane industry

  18. Willmot concordance index applied to the selection of Neutron probe calibration curve more suitable to the soil profile; Aplicacao do indice de concordancia de Willmott para selecao da curva de calibracao de sonda de neutrons mais adequada ao longo do perfil do solo

    Energy Technology Data Exchange (ETDEWEB)

    Moraes, Sergio Oliveira; Libardi, Paulo Leonel [Sao Paulo Univ., Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz. Dept. de Fisica e Meteorologia; Marciano, Claudio Roberto [Sao Paulo Univ., Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz

    1997-07-01

    The present work performed a time analysis on he results of soil water contents obtained from specific layers (CE) and general (CG) calibration curves for the profile. The Willmot index has been successful used for quantification the resemblance between CG and CE, giving evidence that not always the CG can replace the CE, depending on both the layer and the soil water content.

  19. Efeito da tosquia sobre o comportamento de ovelhas das raças Texel e Hampshire Down, ao longo do período noturno, no Noroeste do Estado do Paraná Effect of shearing on the behavior of Texel and Hampshire Down sheep during the night period in the northwestern region of Paraná

    Directory of Open Access Journals (Sweden)

    Walber Mendonça Onorato

    2001-05-01

    Full Text Available Avaliou-se o comportamento (pastejo, ruminação e ócio, de abril de 1999 a março de 2000, durante três noites mensais, das 18 às 6 h, em 16 ovelhas, com idade entre três a quatro anos, sendo oito da raça Texel e oito Hampshire Down, tosquiando-se quatro animais por raça. Avaliou-se a qualidade da pastagem. Os dados climáticos foram registrados a cada hora e a precipitação, mensalmente. As condições de pastagem e as variáveis climáticas podem ter alterado o comportamento. A baixa produção de folhas verdes e proteína bruta e altos teores de FDA no inverno podem ter elevado o tempo de pastejo e ruminação. O comportamento de ócio alcançou menores tempos no inverno e primavera. A condição da lã não exerceu efeito sobre o comportamento dos animais.The behavior (grazing, rumination and rest of 16 three- and four-year old Texel and Hampshire Down sheep is provided. Experiment was conducted from April 1999 to March 2000, during three nights a month, from 18 h to 6 h, with eight sheep of each breed. Four animals of each breed were sheared. Pasture quality was evaluated, climate data were reported hourly and rainfall monthly. Conditions of pasture and climatic variables might have altered sheep’s behavior. Low yield of green leaves, crude protein and high FDA levels during the winter might have raised grazing and rumination time. Period of rest decreased during the winter and spring. Wool did not have any effect on the behavior of animals.

  20. Measurement of nuclear reaction rates and spectral indices along the radius of fuel pellets from IPEN/MB-01 reactor; Medidas de taxas de reacao nuclear e de indices espectrais ao longo do raio das pastilhas combustiveis do reator IPEN/MB-01

    Energy Technology Data Exchange (ETDEWEB)

    Mura, Luis Felipe Liambos

    2010-07-01

    This work presents the measurements of the nuclear reaction rates along the radial direction of the fuel pellet by irradiation and posterior gamma spectrometry of a thin slice of fuel pellet of UO{sub 2} with 4,3% enrichment. From its irradiation the rate of radioactive capture and fission have been measured as a function of the radius of the pellet disk using a HPGe detector. Lead collimators has been used for this purpose. Simulating the fuel pellet in the pin fuel of the IPEN/MB-01 reactor, a thin UO{sub 2} disk is used. This disk is inserted in the interior of a dismountable fuel rod. This fuel rod is then placed in the central position of the IPEN/MB-01 reactor core and irradiated during 1 hour under a neutron flux of around 9 x 10{sup 8} n/cm{sup 2}s. For gamma spectrometry 10 collimators with different diameters have been used, consequently, the nuclear reactions of radioactive capture that occurs in atoms of {sup 238}U and fissions that occur on both {sup 235}U and {sup 238}U are measured in function of 10 different region (diameter of collimator) of the fuel pellet disk. Corrections in the geometric efficiency due to introduction of collimators on HPGe detection system were estimated using photon transport of MCNP-4C code. Some calculated values of nuclear reaction rate of radioactive capture and fission along of the radial direction of the fuel pellet obtained by Monte Carlo methodology, using the MCNP-4C code, are presented and compared to the experimental data showing very good agreement. Besides nuclear reaction rates, the spectral indices {sup 28{rho}} and {sup 25{delta}} have been obtained at each different radius of the fuel pellet disk. (author)

  1. Diferenças entre bananas de cultivares Prata e Nanicão ao longo do amadurecimento: características físico-químicas e compostos voláteis Differences between Prata and Nanicão banana cultivars during ripening: physicochemical characteristics and volatile compounds

    Directory of Open Access Journals (Sweden)

    Baraquizio Braga do Nascimento Junior

    2008-09-01

    Full Text Available Bananas verdes [Nanicão (Musa sp., subgrupo Cavendish e Prata (Musa sp., subgrupo Prata] foram estudadas durante o seu amadurecimento. As propriedades físicas (firmeza, físico-químicas (pH, acidez total titulável e sólidos solúveis e químicas (açúcares, compostos fenólicos e voláteis foram analisadas e demonstraram diferenças significantes (p Fresh green bananas [Nanicão (Musa sp., subgroup Cavendish and Prata (Musa sp., subgroup Prata] were studied during their ripening. Physical (firmness, physicochemical (pH, total titrable acidity and soluble solids and chemical properties (sugars, phenolics and volatile compounds were analyzed and showed significant differences (p < 0.05. Prata presented higher values of phenolic compounds, soluble solids, sugars and firmness than Nanicão. A method to quantify the emission of esters was developed by cryogenic headspace and gas chromatography. Acetates, butyrates, isobutyrates and isovalerates were predominant. Prata produced a higher volatile concentration than Nanicão, except for acetates. In most cases, the amount of volatiles increased continuously until peel browning, followed by a decrease or a plateau.

  2. Padrão de deslocamento do camarão marinho Litopenaeus vannamei (Boone (Crustacea, Decapoda, Penaeidae nas fases clara e escura ao longo de 24 horas Displacement pattern of marine shrimp Litopenaeus vannamei (Boone, 1931 (Crustacea, Decapoda, Penaeidae in light and dark phases during a 24-hour period

    Directory of Open Access Journals (Sweden)

    Cibele S. Pontes

    2006-03-01

    Full Text Available O padrão diário de atividade de Litopenaeus vannamei (Boone, 1931 (Crustacea, Decapoda, Penaeidae é ainda pouco entendido. Com o objetivo de fornecer subsídios para otimizar o manejo nas fazendas de cultivo através do estudo do comportamento deste animal, foram desenvolvidos experimentos com juvenis (7,57 ± 1,01 g, mantidos em aquários (30 l. Para registro da atividade, os aquários foram submetidos a fotoperíodo artificial (fase do claro e do escuro, 12h:12 h, sendo monitorados 16 camarões (33 m² em cada fase, durante 20 dias, em janelas de 15 min a cada hora. A alimentação foi fornecida em horários aleatórios, sendo registrados os deslocamentos horizontal e vertical (focal contínuo e os comportamentos de natação e exploração (focal instantâneo. Os deslocamentos horizontal e vertical dos camarões foram mais acentuados na fase escura, predominando o comportamento de natação. A exploração do substrato ocorreu em ambas fases, acentuando-se entre cinco e sete horas após o acendimento das luzes.Litopenaeus vannamei (Boone, 1931 daily behavior pattern is still poorly understood. With the aim of optimizing the management of shrimp farms through the study of this animal behavior, experiments were performed with juvenile (7.57 ± 1.01, which were marked and kept in aquariums (30 l. To record activity, the aquariums were submitted to an artificial photoperiod (light and dark phases, 12h:12 h, with 16 shrimp (33 m² monitored in each phase for 20 days, for 15-minute periods every hour. Food was provided at random times and a record kept of horizontal and vertical displacement (continuous focal, swimming and exploration behavior (instantaneous focal. The horizontal and vertical displacements of the shrimp were greater during the dark phase, with a predominance of the swimming behavior. Exploration of the substrate occurred in both phases, with a peak between five and seven hours after the lights were turned on.

  3. Avaliação das características antropométricas e capacidades físicas ao longo de uma época desportiva em futebol: comparação entre sub-15, sub-17 e sub-19

    National Research Council Canada - National Science Library

    Rui Silva; Pedro Morouço

    2017-01-01

    ... a análise das capacidades físicas foram avaliadas a resistencia aeróbia, o trabalho dos membros inferiores durante o salto vertical, a potencia dos membros inferiores na corrida, a agilidade e a flexibilidade...

  4. Assessment of tributyltin contamination based on imposex in Stramonita rustica (Mollusca: Gastropoda) along southern Bahia coast, northeastern Brazil/Avaliação da contaminação por tributil-estanho baseada em imposex em Stramonita rustica (Mollusca: Gastropoda) ao longo do Litoral Sul da Bahia

    National Research Council Canada - National Science Library

    G C Zeidan; G Boehs

    2017-01-01

    .... For this, 330 specimens were collected during the summer of 2014 at eight sampling points to ascertain whether male sex organs had developed in addition to the complete female genital tract in females (= imposex...

  5. PROGRAMA DE DESARROLLODE COMPETENCIAS PARA EL APRENDIZAJE A LO LARGO DE LA VIDA PARA ESTUDIANTES DE EDUCACIÓN SUPERIOR/LIFELONG LEARNING COMPETENCES DEVELOPMENT PROGRAM FOR HIGHER EDUCATION/PROGRAMA DE DESENVOLVIMENTO DE COMPETÊNCIAS PARA A APRENDIZAGEM AO LONGO DA VIDA DE ESTUDANTE DO ENSINO SUPERIOR

    National Research Council Canada - National Science Library

    Catalina Martínez Mediano; Nuria Riopérez Losada; Susan M Lord

    2013-01-01

    .... To this end, we have designed a program on "Lifelong learning competencies for Higher Education students', which we have applied to students at University of San Diego, California, USA and to the...

  6. Amadurecimento de filtros lentos de areia e remoção de microrganismos indicadores de qualidade da água ao longo da profundidade do leito: uma avaliação em instalação piloto Maturation of slow sand filters and removal of microorganisms' indicators of water quality along the media depth: an evaluation in pilot plant

    Directory of Open Access Journals (Sweden)

    Ludmila Ladeira Alves de Brito

    2005-12-01

    Full Text Available O potencial da filtração lenta como opção tecnológica para o tratamento de água nos países em desenvolvimento e sua capacidade de remoção de contaminantes, sobretudo patogênicos, são reconhecidos. Contudo, ainda permanece incompleto o conhecimento acerca dos mecanismos que predominantemente atuam na remoção dos microrganismos. Objetivando avançar nessa compreensão, desenvolveu-se uma investigação experimental, em unidades piloto, em filtros lentos de areia com escoamento descendente e ascendente, operados com água sintética e duas taxas de filtração (3 e 6m³/m2.d. A retenção dos microrganismos indicadores foi avaliada em cinco camadas, com 0,15 m de espessura cada, em dois momentos da carreira. A maturidade biológica do leito filtrante foi menos favorecida pela taxa mais alta de filtração e pelo fluxo ascendente. Os 0,45 m iniciais do leito filtrante foram importantes na remoção de microrganismos sob as condições estudadas, mas a remoção não se restringiu a estas camadas, tendo sido observada para todos os indicadores retenção nas camadas de 0,45-0,60 m e de 0,60-0,75 m. A schmutzdecke parece desempenhar papel efetivo na remoção de indicadores microbiológicos apenas quando bem desenvolvida. Há uma indicação de que a camada suporte exerce algum papel na retenção de sólidos e microrganismos no fluxo ascendente.The potential of the slow sand filtration as technological option for drinking-water treatment in developing countries and its capacity of contaminants removal, mainly pathogens, are recognized.However, the knowledge concerning the predominant mechanisms that act in microorganism's removal still remains incomplete. Aiming to advance in the understanding of these themes, an experimental investigation was carried out, working with pilot plants of downflow and upflow slow sand filters, operated with synthetic water and two filtration rates (3 and 6 m³/m².d. The microorganisms indicators removal was evaluated in five layers, with 0.15 m of thickness each, in two run phases. The biological maturation of the filter media was less favoured by the highest rate and by the upflow filter. The initial 0.45 m of the filter media were important in the microorganism's removal in the conditions evaluated, but removal was not limited to these layers, since all indicators were retained also in 0.45-0.60 m and 0.60-0.75 m layers, in different proportions among the filter runs.The schmutzdecke seems to play an effective role in the microbiological indicators removal only when well developed. an indication of the role of the support layer in solids and microorganisms retention was observed in the upflow filter.

  7. Suporte relacionado ao cuidado em saúde ao doente com aids: o modelo de comboio e a enfermagem

    Directory of Open Access Journals (Sweden)

    Edilene Aparecida Araújo da Silveira

    2011-06-01

    Full Text Available O presente estudo teve como objetivo conhecer a relação e a troca de suporte entre o doente com AIDS e pessoas à sua volta. O estudo está baseado no modelo de comboio das relações sociais que tem como uma de suas características a representação da rede em três círculos concêntricos. Os participantes eram pessoas que estavam internadas e que falaram sobre o suporte relacionado ao cuidado em saúde proporcionado por pessoas próximas, ou seja, que pertenciam ao círculo interno do comboio. A maioria dos participantes descreveu o círculo como sendo composto por no máximo cinco integrantes, sendo que pessoas da família foram as mais citadas. Os profissionais de saúde precisam conhecer o paciente e seu comboio, reconhecendo-os no contexto psicossocial e cultural de forma a favorecer a aceitação da soropositividade, mudanças no estilo de vida, ajuda nos cuidados de saúde e adesão ao tratamento.

  8. Uma Análise Prospectiva dos Efeitos da Implantação do Complexo Intermodal da Ferronorte ao Município de Rondonópolis-MT

    Directory of Open Access Journals (Sweden)

    Luís Otávio Bau Macedo

    2015-06-01

    Full Text Available O presente artigo visa avaliar os impactos da implantação do terminal intermodal da Ferronorte que liga Santa Fé do Sul, em São Paulo a Rondonópolis, no sudeste de Mato Grosso. O terminal se tornará a principal via de escoamento da produção de grãos do estado ao porto de Santos/SP, com funcionamento iniciado em setembro de 2013. No artigo é descrito o processo operacional do terminal, incluindo armazenagem, pesagem, tombamento, classificação, recepção e estacionamento de caminhões, carregamento e expedição, entre outros. Em seguida é realizada a avaliação do cenário econômico de Rondonópolis e da evolução da produção agrícola de Mato Grosso. Após realiza-se a avaliação econômica do empreendimento focando em seus efeitos para a geração do produto adicionado fiscal ao município de Rondonópolis. A análise foi desenvolvida de um cenário de tendência central onde apenas 60% da produção seriam escoados via ferrovia. A variável que distingue os dois cenários é a previsão quanto à capacidade de tráfego de caminhões ao longo do trecho da BR163 entre a área urbana de Rondonópolis e o sítio do terminal.

  9. Piggyback secundário com LIO de PMMA para correção de surpresa refracional pós-facoemulsificação: resultados a longo prazo de 20 casos

    Directory of Open Access Journals (Sweden)

    Fernando Cançado Trindade

    2013-02-01

    Full Text Available OBJETIVO: Avaliar os resultados a longo prazo da técnica do piggyback secundário utilizada para a correção de ametropia indesejável pós-facoemulsificação. MÉTODOS: Estudo retrospectivo que compreendeu 20 olhos (19 pacientes. A LIO utilizada foi de peça única de PMMA de 12,5 mm de comprimento total, com óptica oval de 5x6mm, com borda fina e arredondada e angulação de 10 graus com as hápticas. A mesma técnica cirúrgica foi utilizada em todos os casos, consistindo na confecção de túnel esclero-corneano com 5mm de largura, através do qual foi implantada a lente secundária no sulco ciliar. RESULTADOS: A ametropia indesejável foi corrigida em todos os casos. Não foi observado qualquer tipo de complicação durante ou após a cirurgia do piggyback secundário. CONCLUSÃO: A utilização de LIO de peça única de PMMA foi segura e eficaz no piggyback secundário para a correção das surpresas refracionais pós-facoemulsificação.

  10. Anatomia ecológica do lenho de espécies arbustivas e arbóreas que ocorrem naturalmente em bosques com drástico gradiente de precipitação ao Noroeste da Patagônia, Argentina

    OpenAIRE

    Tássio Ticiano Trevizor

    2016-01-01

    A utilização de gradientes ambientais no estudo de comunidades vegetais possibilita a eleição de sítios onde há a predominância de um fator abiótico que determina o sucesso ou o fracasso de espécies ao longo de sua extensão. Entre as inúmeras ferramentas utilizadas no estudo de gradientes climáticos, se destaca a anatomia do lenho, pois, é um ramo da ciência que permite analisar, além dos aspectos espaciais, os aspectos temporais dos sítios por meio dos anéis de crescimento. Além disso, a amp...

  11. O profissional de controladoria no mercado Brasileiro: do surgimento da profissão aos dias atuais

    Directory of Open Access Journals (Sweden)

    José Ricardo Maia de Siqueira

    2001-12-01

    Full Text Available Em um trabalho anterior, o pesquisador selecionou quatro anos de anúncios publicados no Jornal do Brasil - 1960, 1970, 1980 e 1989 - buscando a identificação do perfil do profissional de controladoria em cada um destes períodos. O objetivo era avaliar a evolução do controller no Brasil baseado nos anúncios publicados na seção de classificados. Neste trabalho percebe-se no ano de 1960 uma baixa procura por executivos em geral e de controllers em particular. Em contraste com 1960, o ano de 1970 apresentava um número bastante elevado de anúncios um total de 38 - que não se modificaria relevantemente nos demais períodos da pesquisa. Tal constatação é um indício de que em algum momento durante a década de 60 houve um crescimento considerável na demanda por estes profissionais. Este trabalho tem por objetivo identificar quando ocorre este incremento na demanda por controllers, buscando localizar indícios do nascimento da profissão no país. Além disso procura-se traçar um perfil da profissão ao longo dos anos até a atualidade.In a former work, the researcher analyzed ads recruiting controllers published in the "Jornal do Brasil" in 1960, 1970, 1980, and 1989.The objective then was to evaluate the evolution of the profession in Brazil, and to identify the professional profile of the controller in each of these years. It was noticed that the search for executives in general (and controllers in particular was low in 1960 when compared to 1970. The number of ads published in 1970, 38, would not change considerably in the subsequent periods. This indicates that demand for controllers has presented a great variation at some point between 1960 and 1970. The objective of the present work is to detect when this happens. This way, it aims not only to investigate when the profession of the controller was born in Brazil, but also to observe how the characteristics of this professional have changed throughout the years.

  12. Data of evolutionary structure change: 1AO5B-3BSQC [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-3BSQC 1AO5 3BSQ B C VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTA...AHCYVDQYEVWLGKNKLFQEEPSAQHRLVSKSFPHPGFNMSLLMLQTIPPGADFSDDLMLLRLSKPADITDVVKPIALPTKEPKPGSKCLASGWGSITPT-WQKPDDLQC...bChain>C 3BSQC TTTSPDVTFPS 3BSQ C 3BSQC DT

  13. Data of evolutionary structure change: 1AO5B-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-2AGEX 1AO5 2AGE B X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  14. Data of evolutionary structure change: 1AO5A-2AGEX [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5A-2AGEX 1AO5 2AGE A X VVGGFNCEKNSQPWQVAVYYQKEHICGGVLLDRNWVLTAAHCYVDQYEVWLGKNKL...KCLASGWGSITPT-WQKPDDLQCVFITLLPNENCAKVYLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICDGILQGTTSYGPVPCGKPGVPAIYTNLIKFNSWIKDTMMKNA... 2AGE X 2AGEX 1 2AGE X 2AGEX 2 2AGE X 2AGEX

  15. Operação de Bentall e De Bono para correção das doenças da raiz aórtica: análise de resultados a longo prazo Bentall and De Bono surgery for correction of valve and ascending aortic disease: long-term results

    Directory of Open Access Journals (Sweden)

    Virgílio Figueiredo Silva

    2008-06-01

    Full Text Available OBJETIVO: Um estudo retrospectivo foi desenhado tendo como fator de inclusão a cirurgia de Bentall e De Bono. MÉTODOS: Dados foram retirados de prontuários médicos e informações de seguimento a longo prazo obtidas por meio de retornos ambulatoriais e contatos diretos com o paciente. Trinta e nove pacientes foram acompanhados no período de janeiro de 1996 a dezembro de 2005. RESULTADOS: A mediana de idade foi 47 anos, sendo 85% dos pacientes do sexo masculino. Onze (25,5% pacientes apresentavam síndrome de Marfan e um (2,5% síndrome de Turner. Entre os fatores de risco, listaram-se: hipertensão em 19 (48,5% pacientes, tabagismo em oito (20,5%, etilismo em seis (15,5%, dislipidemia em oito (20,5%, diabetes melito em dois (5% e presença de IAM prévio em um (2,5%. Vinte e oito (72% pacientes estavam em classe II-III NYHA ao momento da operação. Ectasia ânulo-aórtica era diagnóstico em 14 (36% pacientes e aneurisma da aorta em 16 (41%. O tempo médio de permanência na UTI foi 8,8 dias, com intervalo de 2-23 dias. A taxa de sobrevida em 30 dias (intra-hospitalar foi de 94,87% (2/39. Em um ano, 37 (94,87% pacientes estavam vivos, e em 5 e 10 anos, 33 (84,61%. O tempo de acompanhamento médio foi de 46,5 meses, com intervalo de 14-120 meses. CONCLUSÃO: A técnica descrita por Bentall e De Bono obteve excelentes resultados a curto e longo prazo, sendo eficaz e segura no tratamento de doenças da valva aórtica e aorta ascendente em nosso serviço. Nossos resultados são condizentes com dados atuais da literatura.OBJECTIVE: A retrospective study was perfomed in a series of consecutive patients who underwent a Bentall and De Bono procedure. Methods: Data were removed of medical records and follow-up data were obtained from clinical records and direct contact with patients. A total of 39 patients were studied between January 1996 and December 2005. RESULTS: The median age was 47 years (range 14-70. There were 33 males and six females

  16. Probing circumplanetary disks with MagAO and ALMA

    Science.gov (United States)

    Wu, Ya-Lin

    2018-01-01

    The dedication of the Magellan Adaptive Optics (MagAO) on the 6.5 m Clay Telescope has opened a new era in high-contrast imaging. Its unique diffraction-limited wavelengths of 0.6 to 1 micron helps to probe circumplanetary disks by measuring the amount of dust reddening as well as by searching for the strongest gas accretion indicator H-alpha (0.65 micron). Using MagAO, I found that two wide-orbit planetary-mass companions CT Cha B and 1RXS 1609 B have a significant dust extinction of Av ~ 3 to 5 mag likely from their disks. For GQ Lup B, I found that it is actively accreting material from its disk and emitting strong H-alpha emission. My research with MagAO demonstrates that circumplanetary disks could be ubiquitous among young giant planets. I later carried out a survey using ALMA to image accretion disks around several wide planet-mass companions at 1.3 mm continuum and CO (2-1). This is the first systematic study aiming to measure the size, mass, and structure of planetary disks. However, except for FW Tau C (which was shown to actually be a low-mass star from the dynamical mass measurement) no disks around the companions were found in my ALMA survey. This surprising null result implies that circumplanetary disks are much more compact and denser than expected, so they are faint and optically thick in the radio wavelengths. Therefore, mid- to far-infrared may be more favorable to characterize disk properties. The MIRI camera on the JWST can test this compact optically-thick disk hypothesis by probing disk thermal emission between 10 and 25 micron.

  17. Identification of system misregistrations during AO-corrected observations

    Science.gov (United States)

    Béchet, C.; Thiébaut, É.; .; Tallon, M.; Kolb, J.; Madec, P.-Y.

    2011-09-01

    The E-ELT will be equipped with a deformable mirror inside the telescope. The performance of reconstruction and control depends on the calibration of the interaction matrix- or a model of the interaction matrix- , which characterizes the system and the relationship between the commands sent to the deformable mirrors (DM) and the wavefront sensors (WFS) slopes. Such a calibration will be more complex than for the current systems at the VLT since it will have to be at least partly measured on sky and for a much larger number of degrees of freedom (more than 5000). In addition, gravity or temperature variations for instance are likely to introduce slow evolution of the matching between the M4 Deformable mirror and the WFS geometry. This can occur during observations and therefore degrade the adaptive optics (AO) correction. To relax the need of frequent painful calibrations and to prevent a loss of performance due to misregistrations, we investigate how to track the evolution of the interaction matrix errors in closed-loop without introducing any degradation in the observations. This is done thanks to identification methods and optimization theory. First, we formally describe the problem and the difficulties of such an identification in closed-loop configuration. Then, we present 2 solutions, based on the optimization of the error of estimates of the WFS slopes, at the output of the closed-loop AO. The performance of the methods and their limitations are discussed formally and thanks to numerical simulations of a high order AO system. We finally explore to which extent these methods currently studied for the Adaptive Optics Facility (AOF) at the VLT can be applied to the E-ELT.

  18. Child abuse: a common problem in Curaçao?

    Science.gov (United States)

    Klein, K; Boersma, A A; Meyboom-de Jong, B; de Bruijn, J

    2013-02-01

    To assess the prevalence of child abuse among high school students in Curacao. A questionnaire survey among high school students up to 17 years of age was conducted. The questionnaire was based on existing literature and validated questionnaires. The questionnaire used was analysed and adapted to the situation in Curaçao by a panel of experts on child abuse. The primary objective was to gain insight into the incidence, prevalence and various forms of child abuse among students in Curaçao. Five forms of child abuse are distinguished in the literature: physical abuse, emotional abuse, sexual abuse, neglect and exploitation. Furthermore, the degree of confidence of the students in general practitioners (GPs) as care providers in the field of child abuse was explored. Questionnaires from 545 of the 628 respondents were included. In total, 43% of the respondents had ever-experienced an event which could be defined as (a form of) child abuse. More than one-third of the respondents reporting child abuse ever had an experience that could be interpreted as physical abuse. More than 15% of the respondents reporting child abuse had experienced sexual abuse. Girls experienced significantly more sexual abuse than boys. Emotional abuse in the last year was experienced by 3% of the respondents. One per cent of the respondents ever-experienced neglect. According to most respondents, GPs were not seen as care providers in cases of child abuse; they believed that GPs were mainly to be consulted for illnesses or physical symptoms and not for forms of child abuse. The prevalence of ever-having-experienced a form of child abuse is estimated at 431 per 1000 students. Child abuse, particularly physical abuse, is common in Curaçao, and is probably comparable to other surrounding countries. General practitioners were not seen as care providers in identifying and reporting cases of child abuse according to most respondents.

  19. Assistência de enfermagem humanizada ao paciente em UTI

    OpenAIRE

    Vieira, Claudir Aparecido; Maia, Luiz Faustino dos Santos

    2013-01-01

    Hoje em dia a humanização é ponto de pauta nos encontros nacionais e internacionais da área da saúde. Assim, cada vez mais enfermeiros nas unidades de terapia intensiva tem se preocupado com a sua prática. O presente estudo foi desenvolvido com o objetivo de compreender, reconhecer e entender como o comportamento humanizado reflete ao paciente e identificar a percepção da equipe de enfermagem sobre o processo de humanização. Trata-se de uma pesquisa de revisão bibliográfica descritiva com aná...

  20. Resistencia ao brometo de etidio em aspergillus nidulans

    OpenAIRE

    Maria Elizabeth Scarazzatti Frau

    1985-01-01

    Resumo: O presente trabalho teve por objetivo isolar e ana-lisar geneticamente mutantes de Aspergillus nidulans resistentes ao Brometo de Etídio (BE), bem como estudar os efeitos da riboflavina em relação a toxicidade do BE. Foram isolados mutantes espontâneos e induzidos. Dos mutantes isolados espontaneamente apenas 3 continuaram a apresentar resistência, sendo 1 da linhagem A e 2 da linhagem biAl methGl. Os outros mutantes (16) foram obtidos por indução com luz ultravioleta. Destes apenas 9...

  1. Stream-Field Interactions in the Magnetic Accretor AO Piscium

    Science.gov (United States)

    Hellier, Coel; van Zyl, Liza

    2005-06-01

    UV spectra of the magnetic accretor AO Psc show absorption features for half the binary orbit. The absorption is unlike the wind-formed features often seen in similar stars. Instead, we attribute it to a fraction of the stream that overflows the impact with the accretion disk. Rapid velocity variations can be explained by changes in the trajectory of the stream depending on the orientation of the white dwarf's magnetic field. Hence, we are directly observing the interaction of an accretion stream with a rotating field. We compare this behavior to that seen in other intermediate polars and in SW Sex stars.

  2. Atenção ao Suicídio

    Directory of Open Access Journals (Sweden)

    Berenice Rheinreimer

    2015-11-01

    Full Text Available De acordo com a OMS a cada ano ocorrem 1 milhão de mortes causadas por suicídio, número maior que a soma das mortes causadas por guerras e homicídios (1. Até 2030, as mortes por suicídio podem chegar a 1 milhão e quinhentos mil, caso sejam mantidos os índices de crescimento atuais (2, 3. Para cada morte, ocorrem de 10 a 40 tentativas de suicídio, ou seja, 10 a 40 milhões de tentativas de suicídio ao ano (4.

  3. Aspect-Oriented Business Process Modeling with AO4BPMN

    Science.gov (United States)

    Charfi, Anis; Müller, Heiko; Mezini, Mira

    Many crosscutting concerns in business processes need to be addressed already at the business process modeling level such as compliance, auditing, billing, and separation of duties. However, existing business process modeling languages including OMG's Business Process Modeling Notation (BPMN) lack appropriate means for expressing such concerns in a modular way. In this paper, we motivate the need for aspect-oriented concepts in business process modeling languages and propose an aspect-oriented extension to BPMN called AO4BPMN. We also present a graphical editor supporting that extension.

  4. Apple fruit copper amine oxidase isoforms: peroxisomal MdAO1 prefers diamines as substrates, whereas extracellular MdAO2 exclusively utilizes monoamines.

    Science.gov (United States)

    Zarei, Adel; Trobacher, Christopher P; Cooke, Alison R; Meyers, Ashley J; Hall, J Christopher; Shelp, Barry J

    2015-01-01

    4-Aminobutyrate (GABA) accumulates in apple fruit during controlled atmosphere storage. A potential source of GABA is the polyamine putrescine, which can be oxidized via copper-containing amine oxidase (CuAO), resulting in the production 4-aminobutanal/Δ(1)-pyrroline, with the consumption of O2 and release of H2O2 and ammonia. Five putative CuAO genes (MdAO genes) were cloned from apple (Malus domestica Borkh. cv. Empire) fruit, and the deduced amino acid sequences found to contain the active sites typically conserved in CuAOs. Genes encoding two of these enzymes, MdAO1 and MdAO2, were highly expressed in apple fruit and selected for further analysis. Amino acid sequence analysis predicted the presence of a C-terminal peroxisomal targeting signal 1 tripeptide in MdAO1 and an N-terminal signal peptide and N-glycosylation site in MdAO2. Transient expression of green fluorescent fusion proteins in Arabidopsis protoplasts or onion epidermal cells revealed a peroxisomal localization for MdAO1 and an extracellular localization for MdAO2. The enzymatic activities of purified recombinant MdAO1 and MdAO2 were measured continuously as H2O2 production using a coupled reaction. MdAO1 did not use monoamines or polyamines and displayed high catalytic efficiency for 1,3-diaminopropane, putrescine and cadaverine, whereas MdAO2 exclusively utilized aliphatic and aromatic monoamines, including 2-phenylethylamine and tyramine. Together, these results indicate that MdAO1 may contribute to GABA production via putrescine oxidation in the peroxisome of apple fruit under controlled atmosphere conditions. MdAO2 seems to be involved in deamination of 2-phenylethylamine, which is a step in the biosynthesis of 2-phenylethanol, a contributor to fruit flavor and flower fragrance. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  5. Checklist of the birds of Aruba, Curaçao and Bonaire, South Caribbean

    NARCIS (Netherlands)

    Prins, T.G.; Reuter, J.H.; Debrot, A.O.; Wattel, J.; Nijman, V.

    2009-01-01

    We present an updated checklist of the birds of the islands of Aruba, Curaçao and Bonaire, and the islets of Klein Curaçao and Klein Bonaire, southern Caribbean, and compare this with earlier checklists (K.H. Voous, Stud. Fauna Curaçao Carib. Isl. 7: 1-260, 1957; Ardea 53: 205-234, 1965; Birds of

  6. Tempo de fornecimento da dieta pré-inicial para frangos de corte com diferentes pesos ao alojamento Period of feeding a pre-starter diet for broiler chickens with different body weights at housing

    Directory of Open Access Journals (Sweden)

    Gilson Alexandre Gomes

    2008-10-01

    Full Text Available Avaliaram-se os efeitos do fornecimento da dieta pré-inicial (DPI e do peso ao alojamento sobre o desempenho e as características de carcaça de frangos de corte. Utilizaram-se 960 frangos machos, linhagem comercial Cobb-500, alojados em 32 boxes, em um delineamento inteiramente casualizado em esquema fatorial 2 x 4, composto de dois pesos ao alojamento (42 e 46 g e quatro períodos de fornecimento da dieta pré-inicial (0, 1 a 7, 1 a 10 e 1 a 14 dias de idade, durante 49 dias. Os programas alimentares compreenderam três ou quatro fases (pré-inicial e/ou inicial; engorda; final e as dietas fornecidas eram à base de milho e farelo de soja. De modo geral, aves mais pesadas ao alojamento apresentaram, ao longo de todo o período experimental, maior consumo de ração (CR e ganho de peso (GP. Não foram observadas diferenças significativas na conversão alimentar (CA dos animais. Considerando todo o período experimental, as aves alimentadas com a dieta pré-inicial durante sete dias apresentaram maior consumo de ração e ganho de peso, porém, menor rendimento de carcaça. O peso ao alojamento determina o desempenho e o oferecimento da dieta pré-inicial durante sete dias beneficia o desempenho das aves.The effects of feeding a pre-starter diet (PSD and weight at housing on performance and carcass characteristics broilers were evaluated. A total of 960 day-old male chickens, commercial line Cobb-500, was housed in 32 floor pens as a completely randomized design in a 2 x 4 factorial arrangement [weight at housing (42 and 46 g and periods of feeding pre- starter diet (0, 1 to 7, 1 to 10 and 1 to 14 days old for 49 days. The feeding regimes contained three or four phases (pre-starter and/or starter; grower; finisher diets and diets were based on corn and soybean meal. Overall, birds with heavier weights at housing showed, throughout the trial period, greater feed consumption and weight gain. No differences were observed for feed conversion of

  7. Predictive factors for neuromotor abnormalities at the corrected age of 12 months in very low birth weight premature infants Fatores preditivos para anormalidades neuromotoras aos 12 meses de idade corrigida em prematuros de muito baixo peso

    Directory of Open Access Journals (Sweden)

    Rosane Reis de Mello

    2009-06-01

    Full Text Available BACKGROUND: The increase in survival of premature newborns has sparked growing interest in the prediction of their long-term neurodevelopment. OBJECTIVE: To estimate the incidence of neuromotor abnormalities at the corrected age of 12 months and to identify the predictive factors associated with altered neuromotor development in very low birth weight premature infants. METHOD: Cohort study. The sample included 100 premature infants. The outcome was neuromotor development at 12 months classified by Bayley Scale (PDI and neurological assessment (tonus, reflexes, posture. A multivariate logistic regression model was constructed. Neonatal variables and neuromotor abnormalities up to 6 months of corrected age were selected by bivariate analysis. RESULTS: Mean birth weight was 1126g (SD: 240. Abnormal neuromotor development was presented in 60 children at 12 months corrected age. CONCLUSION: According to the model, patients with a diagnosis including bronchopulmonary dysplasia, hypertonia of lower extremities, truncal hypotonia showed a 94.0% probability of neuromotor involvement at 12 months.INTRODUÇÃO: O aumento na sobrevida de recém-nascidos prematuros tem suscitado interesse crescente na predição do seu neurodesenvolvimento a longo prazo. OBJETIVO: Estimar a incidência de anormalidades neuromotoras aos 12 meses de idade corrigida e identificar os fatores associados ao desenvolvimento neuromotor alterado em prematuros de muito baixo peso. MÉTODO: Estudo de coorte. A amostra incluiu 100 crianças prematuras.O desfecho foi o desenvolvimento neuromotor aos 12 meses. Modelo de regressão logística multivariado foi construído. Variáveis neonatais e anormalidades neuromotoras até os 6 meses de idade corrigida foram selecionadas por análise bivariada. RESULTADOS: O peso de nascimento médio foi 1126g (DP:240. Aos 12 meses 60% das crianças apresentaram desenvolvimento neuromotor alterado. CONCLUSÃO: De acordo com o modelo, pacientes com diagn

  8. Titanium alloys (AoN) and their involvement in osseointegration.

    Science.gov (United States)

    Danza, Matteo; Zollino, Ilaria; Candotto, Valentina; Cura, Francesca; Carinci, Francesco

    2012-12-01

    Osseointegration is essential for a long-term successful and inflammation-free dental implant. Such a result depends on osteoblastic cells growth and differentiation at the tissue-implant interface. The aim of this study was to compare two different AoN titanium layers (GR4 and GR5) to investigate which one had a greater osteoconductive power using human osteoblasts (HOb) culture at two different time-points. The expression levels of some bone-related (ALPL, COL1A1, COL3A1, SPP1, RUNX2, and SPARC) were analyzed using real time reverse transcription-polymerase chain reaction (real time RT-PCR). Real-time RT-PCR data showed that after 3 days of treatment with TiA4GR, the genes up-regulated were COL3A1, ALPL, SPP1, and RUNX2. Moreover, no difference in gene expression was noticed 4 days later. On the other hand, the genes that overexpressed after 3 days of treatment with AoN5GR were ALPL, SPP1, and RUNX2. In both cases, the expression of COL1A1 and SPARC was negatively regulated. Our data showed that both titanium surfaces led to osteoblasts recruitment, maturation, and differentiation, thus promoting osseointegration at the tissue-implant interface.

  9. Atribuições de significados ao transplante renal

    Directory of Open Access Journals (Sweden)

    Quintana, Alberto M.

    2011-01-01

    Full Text Available Este trabalho teve foco na investigação das atribuições de significados ao transplante renal de pacientes com Insuficiência Renal Crônica (IRC de um Hospital Universitário da Região Sul. Foi utilizado um método qualitativo e participaram doze pessoas na pesquisa. Os instrumentos utilizados foram a entrevista semidirigida e a autofotografia. Para a análise dos dados foi empregada a técnica de análise de conteúdo, o que permitiu que fossem construídas quatro categorias temáticas: a ansiedade da espera, os conflitos ante o doador, as expectativas em relação ao devir e a vida antes e depois do transplante. Constatou-se que a possibilidade deste traz consigo uma série de repercussões psíquicas devido o fato de ser visto como algo que restitui a vida, proporciona bem-estar e sentimento de liberdade, mesmo levando em consideração que ainda persistem os cuidados com o corpo, com a alimentação e com os remédios

  10. New Results from the AO327 Drift Pulsar Survey

    Science.gov (United States)

    Deneva, Julia S.; Stovall, K.; McLaughlin, M.; Bates, S.; Freire, P.; Martinez, J.; Jenet, F.; Bagchi, M.

    2014-01-01

    The Arecibo 327 MHz drift pulsar survey (AO327) has operated since 2010 and aims to cover the entire Arecibo sky (declinations of -1 to 38 degrees). We present details on the progress of the survey and a new set of discoveries over the past year. Phase 1 of AO327 targets declinations of -1 to 28 degrees and is 55% complete; Phase 2 will target declinations of 28 to 38 degrees. The survey is expected to be completed in 2017. Out of a total of 28 new pulsars, 12 were found in 2013, including three millisecond pulsars. PSR J2234+06 has a rotation period of 3.58 ms and is in a 32-day orbit in a binary system with a white dwarf companion. This pulsar is bright and a very stable rotator, making it suitable for inclusion in Pulsar Timing Arrays. The orbit of J2234+06 has an eccentricity of 0.13, which cannot be accounted for by stellar evolution but may be explained by an origin in a subsequently disrupted hierarchical triple, or by an exchange interaction. PSR J0509+08 has a period of 4.06 ms and is in a 4.9-day binary system with a white dwarf companion. This pulsar is also a candidate for inclusion in PTAs.

  11. OBSOLESCÊNCIA PROGRAMADA E TEORIA DO DECRESCIMENTO VERSUS DIREITO AO DESENVOLVIMENTO E AO CONSUMO (SUSTENTÁVEIS)

    OpenAIRE

    Oliveira da Silva, Maria Beatriz Beatriz; UNiversidade Federal de Santa Maria (UFSM)

    2012-01-01

    Inspirado em um documentário intitulado “Prêt à Jeter”, este texto tem como objetivo central colocar em apreciação algumas reflexões acerca da obsolescência programada como uma das estratégias do modelo de desenvolvimento capitalista e ensaiar uma reposta às seguintes questões: para combater a obsolescência programada se faz necessária a defesa de uma “teoria do decrescimento”? Sendo a obsolescência programada uma das estratégias da sociedade de consumo, é possível combatê-la e, ao mesmo temp...

  12. Telescópio de pequeno porte como suporte ao ensino em cidades com intensa poluição luminosa II

    Science.gov (United States)

    Pereira, P. C. R.; Santos-Júnior, J. M.; Cruz, W. S.

    2003-08-01

    Para a maioria dos estudantes, sua passagem pelo ensino formal fundamental envolve a transmissão de fatos que devem ser guardados para um exame, a habilidade para lembrar fórmulas e, eventualmente, a repetição de experimentos que devem produzir resultados exigidos pelo professor. O resultado deste modelo de ensino, ao longo dos anos, é conhecido por todos: desconhecimento e descontentamento, por parte dos estudantes, de temas relativos ao papel e aos processos da ciência. Acreditamos que a Astronomia, pelo seu caráter observacional, é uma das áreas do conhecimento que pode contribuir neste cenário. A Fundação Planetário da Cidade do Rio de Janeiro possui um telescópio Meade LX-200 (25cm) que, juntamente com as câmeras CCD ST-7E e ST8E, tem sido utilizado em projetos voltados aos estudantes do ensino médio desde o ano 2000. Tais projetos envolvem a condução de um projeto de pesquisa observacional num nível apropriado, e possibilitam o contato com técnicas e novas tecnologias: computador, software para manipulação de dados e gráficos, programas de tratamento e redução de dados, uso de equipamentos óptico-eletrônicos (telescópio e CCD), bem como o processo de aquisição de conhecimento. Dentro da proposta dos anos anteriores, priorizamos projetos de uma noite, ou seja, procuramos trabalhar com fenômenos que apresentem variabilidade com intervalo de recorrência relativamente curto. Em todos os casos, optamos pela fotometria diferencial, que tem se mostrado bastante eficiente para o céu luminoso como o da cidade do Rio de Janeiro. Neste painel, apresentamos alguns dos projetos desenvolvidos no último ano, com 25 estudantes. Apresentamos os resultados da observação da variável pulsante AI Vel (V = 6,6) e da variável cataclísmica FO Aqr (V = 13,5), e do monitoramento do trânsito da lua de Júpiter, Europa, ocorrido em 30 de abril de 2003. As curvas de luz produzidas para as primeiras estão concordantes com as da literatura, assim

  13. Cirurgia de revascularização do miocárdio em pacientes com cardiomiopatia isquêmica e disfunção ventricular acentuada: resultados imediatos e de longo prazo

    Directory of Open Access Journals (Sweden)

    Sérgio F OLIVEIRA

    1997-01-01

    Full Text Available Objetivo: Estudar aspectos ainda não esclarecidos relacionados a parâmetros clínicos pré-operatórios de prognóstico, risco cirúrgico, benefício funcional e sobrevida a longo prazo. Métodos: Foram analisados 71 pacientes com diagnóstico de cardiomiopatia isquêmica, com fração de ejeção ventricular esquerda Purpose: To evaluate the prognosis value of preoperative parameters, surgical risk, functional benefits and long-term survival after myocardial revascularization. Methods: Seventy one patients with coronary artery disease and severe left ventricular dysfunction (left ventricular ejection fraction < 30% and evaluated the myocardial perfusion by Tl-201 scintigraphy were studied before and after myocardial revascularization, during the hospitalar period and 48 months (avarage of late follow up. Results: The early mortality observed was 2,8% and the survival in 5 years 62,8%. The statistical analysis related to the preoperative clinical parameters in all patients were not significant in: a severity of congestive heart failure (CHF or angina; b presence of Q wave (EKG; c presence of ischemia (Tl-201; d left ventricular ejection fraction. The statistical analysis related to survivors and no survivors were significant: a functional class IV of CHF; b presence of left brunch bundle block (LBBB. Conclusion: Our results show that functional class IV of CHF and LBBB were related to bad prognosis and demonstrate the difficulty to establish preoperative clinical parameters of prognosis due to the presence of heterogeneous coronary and myocardial pattern of the ischemic cardiomyopathy. Our surgical results confirm that myocardial revascularization is a safe procedure, increases late survival and improves the quality of life of these patients with coronary artery disease and severe left ventricular dysfunction.

  14. Performance of the Sewage Treatment Plant of S˜ao Jo˜ao de Iracema (Brazil

    Directory of Open Access Journals (Sweden)

    Tsunao Matsumoto

    2016-05-01

    Full Text Available Context: Some of the most important parameters measured in the sewage treatment plant –STP- are: organic matter, solids and faecal organisms. The objective of this work was to diagnose the performance of S˜ao Jo˜ao de Iracema STP for those parameters removal. Method: A batimetric survey of the anaerobic and facultative lagoons; the STP influent and effluent monitoring in three different climate seasons of 3-month long each were conducted by dissolved oxygen, pH, temperature, BOD, filtered BOD, COD, solids and coliforms measuring. Results: Sludge accumulations of 1.3 and 6.5% in the anaerobic and facultative lagoons were registered; average BOD removal was of 73.6%, smaller than the 80% recommended by Brazilian legislation; the average faecal coliform number on final effluent was of 9.55*106/100mL, above the per-missible limit of 1000/100mL. Conclusions: The STP needs to set-up a post treatment system that guarantees additional organic matter removal and fecal coliforms in order to adjust the effluent quality to the environmental legislation standards.

  15. Resposta cronotrópica ao teste anaeróbio máximo de corrida - MART

    Directory of Open Access Journals (Sweden)

    Flávio Areal Lemos

    2013-06-01

    Full Text Available INTRODUÇÃO: A frequência cardíaca (FC no teste anaeróbio máximo de corrida (MART expressa o comportamento autonômico cardíaco em exercício. Ainda não foi investigado se tais respostas cronotrópicas apresentam associação com o desempenho aeróbio e anaeróbio. OBJETIVOS: Descrever a resposta cronotrópica cardíaca durante o MART nos segundos iniciais de estímulo (FC ON e de recuperação (FC OFF e estabelecer a associação entre as variáveis cronotrópicas com o desempenho aeróbio e anaeróbio. MÉTODOS: Foram voluntários 13 homens assintomáticos e fisicamente ativos, com 25,1 ± 4,9 anos, 76,8 ± 12,5 kg, 178,4 ± 9,0 cm e 50,6 ± 4,1 mL×kg‑1×min‑1. Na primeira visita, após a anamnese e medidas antropométricas, foi realizado um teste cardiopulmonar de exercício (TCPE com monitoração direta dos gases expirados. Na segunda visita, foi feita uma familiarização ao MART e na terceira, o teste de MART conduzido até a exaustão. RESULTADOS: A FC de recuperação (58 ± 20 bpm comparada à FC de pico alcançada no primeiro e no último estágio de MART (39 ± 14 bpm apresentou maior inclinação, resultando em maior amplitude de variação ao longo do teste, caracterizando diferenças significativas (P = 0,0017. A FC ON apresentou entre o momento inicial, meio e final do MART diferenças significativas (inicial versus final, p = 0,007. Para FC OFF foram encontradas diferenças significativas do início com o meio (p = 0,035 e do início com o final (p = 0,005 do teste. As correlações entre as variáveis cronotrópicas e de desempenho não apresentaram significância estatística (P < 0,05, assim como com as variáveis de desempenho. CONCLUSÃO: O MART parece ser um modelo de sobrecargas fisiológicas adequado para investigação da modulação autonômica cardíaca. Observou-se atuação do sistema parassimpático mesmo em cargas supramáximas até o final do teste.

  16. Bem-estar dos cordeiros submetidos ao transporte rodoviário e avaliação das carcaças e carnes

    Directory of Open Access Journals (Sweden)

    Fredson V. Silva

    Full Text Available RESUMO: Objetivou-se avaliar o grau de bem-estar dos cordeiros submetidos ao transporte rodoviário e suas carcaças e carnes. Para isto, fez-se a avaliação dos parâmetros comportamentais durante o transporte, dos parâmetros fisiológicos após o desembarque e antes do abate e a caracterização das carcaças e carnes dos cordeiros. Realizaram-se quatro transportes rodoviários com durações crescentes (1h45min, 3h52min, 7h30min e 10h30min, cada transporte continha vinte cordeiros. O peso corporal dos animais foi de 36,64±2,13 kg antes do transporte. Os cordeiros foram abatidos 15 horas após o desembarque. Os cordeiros deitaram por pouco tempo (mediana igual à zero a cada 20min em jornadas menores que 3h52min. O número de eventos potencialmente traumáticos foi baixo (mediana próxima a zero, a cada 20min para quaisquer durações dos transportes. As concentrações de adrenalina e cortisol, bem como os metabólitos que são controlados por eles, foram semelhantes entre os tratamentos. Contudo, a massa das carcaças diminuiu e as concentrações de creatina quinase aumentaram linearmente quando os transportes foram mais longos, o que podem revelar diminuição do bem-estar. A qualidade da carne de cordeiros não sofreu interferências da duração dos transportes.

  17. Estrutura da vegetação de mangue associada ao gradiente de inundação no litoral norte do Espírito Santo, Brasil

    Directory of Open Access Journals (Sweden)

    Vinícius Londe

    2013-08-01

    Full Text Available O manguezal é um ecossistema de grande complexidade que ocorre na interface entre os ambientes marinhos e terrestres, mas que apresenta baixa riqueza de espécies vegetais adaptadas às suas condições diferenciadas. Avaliar a estrutura e distribuição da vegetação no manguezal do rio Piraquê-Açu, ES, associando-as com parâmetros abióticos ao longo de um gradiente, foi o objetivo deste estudo. Em seis parcelas de 100 m² cada, foram registrados 306 indivíduos vivos e um morto, pertencentes às espécies Laguncularia racemosa, Rhizophora mangle, Avicennia schaueriana, Terminalia catappa e outras quatro indeterminadas, sendo L. racemosa de maior densidade, dominância, área basal e IVI. A altura média das árvores foi de 4,2 m (DP±1,9 e a CAP, de 12,4 cm (DP±9,5, estando a maioria dos indivíduos em classes de CAP até 10 cm. O manguezal encontrava-se em estado juvenil e pouco desenvolvido estruturalmente, e houve distinção na distribuição das espécies na área, com espécies associadas ocorrendo na parcela mais elevada e menos úmida. As variáveis abióticas diferiram entre as parcelas, contudo apenas a umidade do substrato apresentou relação significativa com a abundância de indivíduos e circunferência dos troncos.

  18. Forma musical como um processo: do isomorfismo ao heteromorfismo

    Directory of Open Access Journals (Sweden)

    Danilo Rossetti

    2016-05-01

    Full Text Available Este artigo se propõe a analisar a questão da forma musical a partir do momento em que temos, no início do século XX, uma ruptura com sua predeterminação, passando a se configurar como o resultado de diferentes operações ou processos de composição. Neste contexto, abordamos a noção de forma estatística, ligada ao isomorfismo e à continuidade entre as diferentes escalas temporais presentes numa obra musical (MEYER-EPPLER, 2009 [1954]; STOCKHAUSEN 1959; EIMERT, 1959 e ao princípio do grau de mudança (STOCKHAUSEN, 1989b [1958]; KOENIG, 1963, 1965, bem como a noção da forma como uma emergência, ligada ao heteromorfismo e à descontinuidade entre as diversas escalas temporais (VAGGIONE, 1994, 2010. Para tanto, trazemos como fundamentação teórica o método alagmático e o princípio da individuação das formas de Gilbert Simondon (2005, assim como as características morfológicas perceptivas de saliência (saillance e pregnância (prégnance de René Thom (1988, 1990a, além de sua teoria das catástrofes (THOM, 1985. No contexto proposto, a fusão de timbres é pensada como um processo alagmático gerador de novas formas, sendo analisada a partir de diferentes possibilidades tais como por jitter (DUBNOV; TISHBY; COHEN, 1997, síntese granular, permeabilidade (LIGETI, 2010a [1958], micropolifonia (LIGETI, 2010c [1980] e convolução (ERBE, 1997; JAFFE, 1987; ROADS, 1993; VAGGIONE, 1996. Concluímos a respeito dos processos de fusão analisados não apenas considerando-os isoladamente, mas como operações que propiciam o nascimento da forma musical, afirmando o pensamento da forma como um processo e não como algo definido a priori.

  19. Do dispositivo da sexualidade ao dispositivo da biotecnologia

    Directory of Open Access Journals (Sweden)

    Laura Belluzzo de Campos Silva

    2015-12-01

    Full Text Available Resumo No livro “A vontade de saber”, onde definiu o que chamou de dispositivo da sexualidade, Foucault deixou entrever que talvez outro dispositivo já estivesse em vias de se compor. Os avanços recentes no campo da biotecnologia molecular reabrem a discussão sobre as bases biológicas do comportamento, acenando com a possibilidade de novas formas de intervenção e com a de seu uso para fins comerciais. Partindo dessas idéias, este trabalho visa discutir que contribuições o conceito de biopoder pode trazer em relação aos recentes avanços da biotecnologia e cartografar algumas linhas que compõem esse novo dispositivo, que poderíamos chamar de biotecnológico.

  20. Lévi-Strauss nos 90 voltas ao passado

    Directory of Open Access Journals (Sweden)

    Lévi-Strauss Claude

    1998-01-01

    Full Text Available Este artigo responde às críticas formuladas por Christian Delacampagne e Bernard Traimond em "A Polêmica Sartre/Lévi-Strauss Revisitada. Nas Raízes das Ciências Sociais de Hoje", publicado em Les Temps Modernes 596 (novembro-dezembro de 1997. Para fazê-lo, recorda inicialmente o caráter relativo da oposição entre "sociedades frias" e "sociedades quentes". Em seguida, refuta a tese de que Maurice Merleau-Ponty, sob a capa de um elogio, teria dirigido críticas veladas ao autor. Finalmente, reconhecendo o afastamento da antropologia de hoje em face das posições do autor, admite, sem se pronunciar sobre o valor desse movimento, que temas de ar sartriano ressurgem nos antropólogos contemporâneos.

  1. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Cenir Gonçalves Tier; Valéria Lerch Lunardi; Silvana Sidney Costa Santos

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edgar ...

  2. Cuidado ao idoso deprimido e institucionalizado à luz da Complexidade

    OpenAIRE

    Tier, Cenir Gonçalves; Lunardi, Valéria Lerch; Santos, Silvana Sidney Costa

    2008-01-01

    Instituições de Longa Permanência para Idosos (ILPI) são estabelecimentos para atendimento integral, institucionalizando pessoas de 60 anos e mais, dependentes/ou não, que não dispõem de condições para permanecer com a família ou/em seu domicílio. A institucionalização pode desencadear doenças, dentre elas a depressão. Foi objetivo deste artigo de atualização fazer uma reflexão sobre a relação do cuidado ao idoso deprimido e residente em ILPI com três princípios da Complexidade segundo Edg...

  3. Empreendedorismo: do ensino básico ao ensino superior

    OpenAIRE

    Gonçalves, Vitor

    2009-01-01

    A Sociedade da Informação exige cada vez mais indivíduos com capacidade e espírito empreendedor. Embora seja visto como uma resposta ao problema do desemprego através da promoção do auto-emprego, o empreendedorismo deve assumir uma semântica mais abrangente. Não basta correr o risco e criar empresas, é necessário procurar fazê-lo com responsabilidade, competência e excelência. Mas, essa atitude empreendedora não é apenas apanágio dos gestores ou empresários, terá de ser também uma necessi...

  4. MODERNIDADE E LIBERTAÇÃO: DOIS DESAFIOS AO CRISTIANISMO

    Directory of Open Access Journals (Sweden)

    . Editorial

    1987-01-01

    Full Text Available A recente Assembléia Geral da Sociedade de Teologia e Ciências da Religião (SOTER, reunida em Belo Horizonte de 6 a 9 de julho passado, dedicou boa parte de seus trabalhos ao "debate em torno da Modernidade em relação com as preocupações da Teologia da Libertação no Brasil". Está mais uma vez relançada a sempre conflitiva questão da relação entre Cristianismo e Modernidade, só que agora percebida num Continente que não simplesmente goza de algumas luzes da Modernidade, como também sofre efeitos perversos deste processo histórico.

  5. Os ditongos do latim ao português

    Directory of Open Access Journals (Sweden)

    Quednau, Laura Rosane

    2005-01-01

    Full Text Available O presente trabalho trata da evolução dos ditongos já existentes e do surgimento de novos ditongos do latim ao português, analisando a motivação de sua redução quando esta ocorre. Para tanto, apresentamos cada ditongo separadamente, trazendo informações sobre a sua forma em latim clássico, latim vulgar e português. Além disso, tratamos de outros processos de formação de ditongos em português, uma vez que o português possui um número maior de ditongos do que o latim. Por fim, apresentamos um quadro-resumo, sintetizando as informações mais importantes do trbalho: quais ditongos permaneceram, quais foram reduzidos, quais surgiram por outros processos e quais são as causas da formação de ditongos em português

  6. Sophia, Mésseder e um Timor contado aos jovens

    OpenAIRE

    Albuquerque, Pedro; Azevedo, Fernando; Vergopolan, Roseli

    2015-01-01

    Devido a sucessivos e quase ininterruptos períodos bélicos e de ocupação, a fragilidades socioeconómicas e à ausência de um ensino sistematizado numa língua oficial, a produção literária timorense escrita revela-se bastante modesta. Apesar de a literatura timorense ter assistido ao despertar do género romanesco - sendo Luís Cardoso o mais proeminente escritor de Timor -, a invenção literária dedicada a um público mais jovem é praticamente inexistente. Ainda assim, os jovens timorenses, que tê...

  7. HST and Keck AO Images of Vortices on Jupiter

    Science.gov (United States)

    de Pater, Imke; Wong, M.; Luszcz-Cook, S.; Adamkovics, M.; Marcus, P.; Asay-Davis, X.; Conrad, A.; Go, C.

    2009-09-01

    Observations of Jupiter were conducted in April 2006 and May 2008 with both HST (250-890 nm) and the 10-m Keck telescope. On Keck we used the near-infrared camera NIRC2, coupled to the AO system, at 1.2 to 5 micrometers. At 5 um we are sensitive to Jupiter's thermal emission in cloud-free regions of the atmosphere, while at 1.2 um we see reflected sunlight from hazes and clouds in the troposphere-stratosphere. All small ovals (i.e., all except for Oval BA and the GRS) appear to be surrounded by bright rings at 5 mu, with typical brightness temperatures of 225-250 K, and hence probing depths to 2.5-4 bar. We argue that the small vortices are columnar structures, extending down into the water cloud. Air is rising along the center of these vortices, and descending around the outer periphery; the storm systems are likely fueled by the latent heat released from the water cloud. The descending part of the vertical circulation in the larger ovals is within the ovals, likely at the location of the red ring in Oval BA, which may indicate the maximum radial distance where such return flows can take place. On 19 July 2009, amateur observer Anthony Wesley (Australia) reported a dark spot/streak on Jupiter, near a southern latitude of 56 deg, which he attributed to an impact (analogous to the SL9 impact on Jupiter). We are scheduled to observe Jupiter with the Keck AO system on 24 July 2009 UT; if observations are successful, we will report preliminary results.

  8. Comportamento do gramado submetido aos herbicidas clethodim e sethoxydim.

    Directory of Open Access Journals (Sweden)

    Cleber D. de G. Maciel

    2007-06-01

    Full Text Available O principal fator do custo de manutenção de um gramado é o corte na altura adequada. O crescimento vegetativo e reprodutivo do gramado formado com grama-batatais (Paspalum notatum Flügge, submetido às doses de clethodim e sethoxydim foi avaliado em dois experimentos conduzidos no campus urbano da Escola Superior de Agronomia de Paraguaçu Paulista-ESAPP (SP, em gramado já estabelecido. Foi utilizado o delineamento experimental de blocos casualizados com seis tratamentos e quatro repetições, representados por clethodim nas subdoses de 0,0000; 0,0037; 0,0075; 0,0150; 0,0300 e 0,0600 kg i.a. ha-1, assim como pelo sethoxydim a 0,0000; 0,0156; 0,0312; 0,0625; 0,1250 e 0,2500 kg i.a. ha-1. O clethodim e sethoxydim, aos 7 DAA, intoxicaram as plantas a partir das doses de 0,0300 e 0,1250 kg ha-1, respectivamente. Os sintomas de intoxicação, aos 49 DAA, praticamente desapareceram para todos os tratamentos. O teor de clorofila nas folhas não apresentou diferenças significativas entre as subdoses de clethodim e sethoxydim em relação à testemunha, em nenhuma das épocas estudadas. Houve redução progressiva da altura média e no número de inflorescências do gramado em função do incremento das doses de clethodim e sethoxydim. Estes herbicidas apresentam viabilidade na redução vegetativa e reprodutiva da espécie P. notatum, sendo o sethoxydim mais seletivo em relação à preservação das características visuais do gramado

  9. Estilos de Aprendizagem versus Treinamento Vivencial ao Ar Livre

    Directory of Open Access Journals (Sweden)

    Luciano Munck

    2010-04-01

    Full Text Available O objetivo deste estudo foi analisar a relação entre estilos individuais de aprendizagem e o treinamento vivencial ao ar livre. Os treinamentos vivenciais tiveram como técnicas o arvorismo, dinâmicas de grupo e paintball. Para alimentar a análise, foram aplicados dois instrumentos de pesquisa a cento e cinco participantes dos treinamentos: o Learning Style Inventory (LSI e um questionário para identificação da satisfação. A coleta de dados foi realizada nos próprios locais de treinamento, sendo a identificação dos estilos de aprendizagem realizada antes, e a da satisfação, depois dos treinamentos. Os dados evidenciaram que o estilo de aprendizagem predominante entre os participantes da pesquisa foi o estilo acomodador(24,8%. A satisfação foi predominantemente alta, com 100% das respostas variando entre mais ou menos satisfeito e muito satisfeito (arvorismo P=0,006. Os dados da pesquisa demonstraram fraca influência dos estilos individuais de aprendizagem na maior ou menor satisfação para com os treinamentos recebidos. Em suma, concluiu-se que os treinamentos vivenciais ao ar livre possuem características que proporcionam alta satisfação para diferentes habilidades e estilos de aprendizagem. Informação essa que deveria ser levada em consideração por gestores e líderes no momento de planejar e estruturar programas de treinamento e desenvolvimento para seus colaboradores.

  10. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the upper extremities of a representative population of children classified according to the PCCF. Patients and methods - We included children and adolescents (0-17 years old) diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at the university hospitals in Bern and Lausanne (Switzerland). Patient charts were retrospectively reviewed and fractures were classified from standard radiographs. Results - Of 2,292 upper extremity fractures in 2,203 children and adolescents, 26% involved the humerus and 74% involved the forearm. In the humerus, 61%, and in the forearm, 80% of single distal fractures involved the metaphysis. In adolescents, single humerus fractures were more often epiphyseal and diaphyseal fractures, and among adolescents radius fractures were more often epiphyseal fractures than in other age groups. 47% of combined forearm fractures were distal metaphyseal fractures. Only 0.7% of fractures could not be classified within 1 of the child-specific fracture patterns. Of the single epiphyseal fractures, 49% were Salter-Harris type-II (SH II) fractures; of these, 94% occurred in schoolchildren and adolescents. Of the metaphyseal fractures, 58% showed an incomplete fracture pattern. 89% of incomplete fractures affected the distal radius. Of the diaphyseal fractures, 32% were greenstick fractures. 24 Monteggia fractures occurred in pre-school children and schoolchildren, and 2 occurred in adolescents. Interpretation - The pattern of pediatric fractures in the upper extremity can be comprehensively described according to the PCCF. Prospective clinical studies are needed to determine its clinical relevance for treatment decisions and

  11. The AO Pediatric Comprehensive Classification of Long Bone Fractures (PCCF).

    Science.gov (United States)

    Joeris, Alexander; Lutz, Nicolas; Blumenthal, Andrea; Slongo, Theddy; Audigé, Laurent

    2017-04-01

    Background and purpose - To achieve a common understanding when dealing with long bone fractures in children, the AO Pediatric Comprehensive Classification of Long Bone Fractures (AO PCCF) was introduced in 2007. As part of its final validation, we present the most relevant fracture patterns in the lower extremities of a representative population of children classified according to the PCCF. Patients and methods - We included patients up to the age of 17 who were diagnosed with 1 or more long bone fractures between January 2009 and December 2011 at either of 2 tertiary care university hospitals in Switzerland. Patient charts were retrospectively reviewed. Results - More lower extremity fractures occurred in boys (62%, n = 341). Of 548 fractured long bones in the lower extremity, 25% involved the femur and 75% the lower leg. The older the patients, the more combined fractures of the tibia and fibula were sustained (adolescents: 50%, 61 of 123). Salter-Harris (SH) fracture patterns represented 66% of single epiphyseal fractures (83 of 126). Overall, 74 of the 83 SH patterns occurred in the distal epiphysis. Of all the metaphyseal fractures, 74 of 79 were classified as incomplete or complete. Complete oblique spiral fractures accounted for 57% of diaphyseal fractures (120 of 211). Of all fractures, 7% (40 of 548) were classified in the category "other", including 29 fractures that were identified as toddler's fractures. 5 combined lower leg fractures were reported in the proximal metaphysis, 40 in the diaphysis, 26 in the distal metaphysis, and 8 in the distal epiphysis. Interpretation - The PCCF allows classification of lower extremity fracture patterns in the clinical setting. Re-introduction of a specific code for toddler's fractures in the PCCF should be considered.

  12. Integração de processos na cadeia de suprimentos e desempenho do serviço ao cliente: um estudo na indústria calçadista de Franca Processes integration in supply chain and customer service performances: a study of a footwear industry in Franca, SP

    Directory of Open Access Journals (Sweden)

    Wilson de Castro Hilsdorf

    2009-06-01

    Full Text Available O processo de globalização e a revolução digital têm trazido novos desafios de competitividade às empresas. Uma dessas novas necessidades é a mudança do foco do escopo gerencial para toda a cadeia de suprimentos. Gerenciar uma cadeia de suprimentos requer, entre outros aspectos, a integração dos "processos-chave" de negócios ao longo dessa cadeia. Nesse sentido, este trabalho teve como objetivo identificar como é a relação entre a integração de processos ao longo da cadeia de suprimentos e o desempenho no serviço prestado ao cliente (customer service. Para tanto, a abordagem exploratória foi utilizada, tendo como objeto de estudo uma cadeia de suprimentos calçadista localizada na cidade de Franca, a qual se constitui em um bom exemplo de cadeia consolidada e já inserida no mercado internacional. Os resultados obtidos permitem concluir que o desempenho do serviço ao cliente na cadeia estudada está relacionado diretamente com a integração dos processos de atendimento de pedidos, gestão da demanda e desenvolvimento de produtos ao longo da cadeia, envolvendo não apenas a integração com clientes, mas também com os fornecedores-chave. Pode-se constatar ainda que esse desempenho está relacionado também com a existência de competências internas nos processos considerados, nas empresas estudadas.The globalization process and the digital revolution have brought new challenges for the companies' competitiveness. One of these new requirements is the change of the managerial scope of the entire supply chain. The management of a supply chain requires, among other aspects, integrating key-business processes along the chain. In this sense, this work has the main purpose of identifying the relationship between processes integration along the supply chain and its customer service performance. In order to achieve this aim, an exploratory research was conducted, focusing on a footwear supply chain located in the city of Franca

  13. Cuidados ao se extrair dimensões de fotografia/filmagem em soldagem Issues before performing measurements from pictures/films in welding

    Directory of Open Access Journals (Sweden)

    Louriel O. Vilarinho

    2009-12-01

    Full Text Available As técnicas de fotografia e filmagem abriram caminhos para estudos em todas as áreas da soldagem e têm sido extensivamente utilizadas para se avaliar características tais como microconstituintes, fases, estruturas, transferência metálica, escoamento de gases, macrografias, deformações e medições geométricas de peças. Embora haja este uso fundamental na soldagem, tem-se notado constantes erros na utilização das técnicas de fotografia e filmagem, como erros de posicionamento, calibração, escolha do sensor, tipo e compactação de imagem. Objetiva-se assim trazer à discussão os critérios e cuidadosos necessários durante medições realizadas a partir de fotografias/filmagens em soldagem. São abordados ao longo do texto os principais detalhes relacionados ao tema de forma prática para que o usuário possa aproveitar todo o potencial de sua fotografia/filmagem. Espera-se a discussão aqui apresentada contribua para o melhor aproveitamento e correto uso das imagens/filmes obtidos em processos de soldagem. Espera-se também que haja comentários sobre o texto no sentido de melhorar e trazer à tona esta importante discussão no âmbito da Revista Soldagem & Inspeção.Photographic and filming techniques have opened different study fields in all welding area and have been extensively employed to assess characteristics such as micro-constituents, phases, structures, metal transfer, gas flow, macro-etches, distortion and geometric measurements in workpieces. Despite this fundamental use in welding, constant mistakes and misuses of these techniques have been noticed, as positioning error, calibration, sensor selection, and type of image. Therefore, it is aimed here to address criteria required during measurements from pictures/films in welding. The main details are discussed in a practical form, so the user can benefit from the full potential of the technique. It is expected that the presented discussion contributes to the better and

  14. Efeito da inclusão de óleo de linhaça sobre a composição lipídica e a concentração de prostaglandina (PGE2 em ossos longos de frangos de corte Effect of linseed oil inclusion on fatty acid profile and prostaglandin (PGE2 concentration in broiler chicken long bones

    Directory of Open Access Journals (Sweden)

    Elis Regina de Moraes Garcia

    2009-07-01

    Full Text Available O objetivo com este trabalho foi avaliar o perfil de ácidos graxos e a concentração de prostaglandina na tíbia de frangos de corte alimentados com rações contendo óleo de linhaça no período de 1 a 42 dias de idade. Nas fases inicial e de crescimento (1 a 21 dias e 22 a 42 dias, respectivamente, foi adotado um delineamento inteiramente casualizado com 4 tratamentos (2,0; 3,5; 5,0 ou 6,5% de óleo de linhaça, 6 repetições e 50 aves/unidade experimental. No período de 1 a 42 dias de idade, o perfil lipídico das rações refletiu sobre o perfil de ácidos graxos dos ossos. O aumento do nível de óleo de linhaça às rações promoveu redução linear da concentração do ácido graxo 20:4n-6 nas células ósseas, porém com menor intensidade ao longo da idade. As concentrações dos ácidos graxos poliinsaturados ômega 3 (EPA ácido eicosapentaenóico, DPA docosapentaenóico e DHA docosahexaenóico nas células ósseas reduziram no decorrer da idade das aves, contudo, esse efeito do óleo de linhaça foi menos intenso para o EPA e DHA. A concentração de prostaglandina determinada no sobrenadante das células ósseas não foi influenciada pelos níveis de óleo de linhaça aos 21 e 42 dias de idade. A adição de 5,17 e 6,5% de óleo de linhaça às rações mostrou-se efetiva em potencializar a incorporação dos ácidos graxos 18:3n-3 e 20:5n-3 nos ossos dos frangos, respectivamente, no período de 1 a 42 dias de idade.The objective of this study was to evaluate the fatty acid profile and PGE2 concentration in tibia of broiler chickens fed on diets with different linseed oil (LO levels from one to 42 days of age. At the initial and growing phases (1 to 21 days and 22 to 42 days of age, respectively a completely randomized design was used with four treatments, six replications and 50 birds per experimental unit. The birds were fed diets with different linseed oil levels (2.0; 3.5; 5.0 and 6.5%. It was observed in the period from 1

  15. Biorreator à membrana em batelada sequencial aplicado ao tratamento de esgoto visando à remoção de nutrientes Membrane sequencing batch reactor for the wastewater treatment aiming the nutrients removal

    Directory of Open Access Journals (Sweden)

    Tiago José Belli

    2012-06-01

    Full Text Available Neste trabalho, avaliou-se o desempenho de um biorreator à membrana em batelada sequencial para a remoção de nutrientes (nitrogênio e fósforo de esgoto sanitário. O reator, construído em escala piloto, foi operado durante 241 dias com tempo total de ciclo de 4 horas, sendo 5 minutos para alimentação, 55 minutos para a fase anóxica e 180 minutos para as fases de aeração e filtração (simultaneamente. Ao longo do monitoramento, foram empregados dois fluxos de filtração: 5,55 e 11,1 L.m-2.h-1, que resultaram nas taxas de troca volumétrica de 5 e 10%, respectivamente. As eficiências médias de remoção de Demanda Química de Oxigênio total, nitrogênio amoniacal e nitrogênio total alcançadas foram de 99, 98 e 96%, respectivamente. Em relação à remoção de fósforo, observou-se inicialmente um baixo rendimento do reator, sendo verificado ao longo do tempo, no entanto, uma tendência de melhora na remoção desse nutriente, atingindo eficiência média de 74% entre os dias 158 e 241. A utilização do fluxo de filtração de 5,55 L.m-2.h-1 proporcionou uma operação estável ao biorreator à membrana em batelada sequencial no que se refere à pressão transmembrana, tendo sido atingido o valor limite de 0,7 bar apenas uma vez em 181 dias de operação, ao passo que, com fluxo de 11,1 L.m-2.h-1, esse limite foi atingido 3 vezes em 55 dias.This study evaluated the performance of a membrane bioreactor sequencing batch, in pilot scale, to remove nutrients (nitrogen and phosphorus from domestic wastewater. The reactor was operated for 241 days with a total cycle time of 4 hours, with 5 minutes for feeding, 55 minutes for the anoxic phase and 180 minutes for the aeration and filtration phases (simultaneously. Throughout the monitoring, two filtration flows were employed: 5.5 and 11.1 (critical flux L.m-2.h-1, which resulted in the volume exchange rates of 5 and 10%, respectively. The removal efficiencies of total Chemical Oxygen

  16. Duas grandes transformações ao mesmo tempo: atitudes em relação à alimentação e ao corpo em gestantes adolescentes

    OpenAIRE

    Carolina Marques Oliboni

    2014-01-01

    Introdução - Adolescência e gestação são caracterizadas por intensas transformações relacionadas ao corpo, e ocorrendo concomitantemente podem potencializar riscos para o surgimento de problemas com a imagem corporal, atitudes alimentares disfuncionais e comportamentos de risco para transtornos alimentares. Objetivo - Avaliar as atitudes em relação à alimentação, ao peso e ao corpo de um grupo de adolescentes grávidas. Métodos - Uma amostra de adolescentes grávidas (n=67) foi avaliada por mei...

  17. A contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle: um estudo sobre duas empresas de grande porte do setor automotivo

    OpenAIRE

    Quintairos, Paulo César Ribeiro; Andrade, Alequexandre Galvez de; Oliveira, Edson Aparecida de Araújo Querido

    2011-01-01

    A contabilidade gerencial é uma importante ferramenta para o planejamento e controle das organizações, pois integra medidas financeiras e não financeiras. O conjunto dessas informações forma um sistema integrado cuja finalidade é avaliar o alinhamento da produção de uma empresa aos seus objetivos estratégicos. Neste trabalho será apresentado um estudo sobre o uso da contabilidade gerencial como ferramenta de apoio ao planejamento e ao controle de duas empresas de grande porte do setor automob...

  18. Correlação de longo alcance em sistemas binários de raios-x usando remoção de flutuações

    Science.gov (United States)

    Pereira, M. G.; Moret, M. A.; Zebende, G. F.; Nogueira, E., Jr.

    2003-08-01

    Neste trabalho é proposta uma metodologia de analise de series temporais de fontes astrofísicas, baseada no método proposto por Peng et al. (1994) e Liu et al. (1999), o qual consiste na idéia de que uma série temporal correlacionada pode ser mapeada por um processo de busca de auto-similaridades em diversas escalas de tempo n. Removendo as eventuais tendências e integrando o sinal observado, é obtida uma medida do desvio médio quadrático das flutuações do sinal integrado F(n)~na, onde a representa o fator de escala associado com a auto-similaridade da correlação de longo alcance do sinal. Baseado nos valores obtidos de a, é possível distinguir entre os casos de sinais não-correlacionados, tipo ruído branco (a = 0,5), sinal anti-persistentes (a 0,5). Usando esta metodologia, foram analisadas 129 curvas de luz de sistemas binários de raios-X, provenientes do banco de dados públicos de observações feitas pelo instrumento All Sky Monitor, a bordo do satélite Rossi X-Ray Timing Explorer (ASM-RXTE). Foram identificadas a presença de a'0,5 em mais de 90% dos sistemas estudados, implicando em dizer que as flutuações de intensidade observadas apresentam correlação de auto-similaridade, sem entretanto, indícios de apresentarem uma escala de tempo característica das flutuações de intensidade. Sistemas onde são observadas erupções (flares), apresentam sistematicamente a > 0,5, característica esta, possivelmente associada com persistência das flutuações de densidade de disco ou taxa de acréscimo de massa. Os sistemas com curvas de luz onde nao são observadas as erupções apresentam uma distribuição normal centrada em a~0,62+/-0,10. Referências ¾ Peng, C.-K., Buldyrev, S.V., Havlin, S., Simons, M., Stanley, H.E., e Goldberg, A.L., Phys. Rev. E, (49), 1685 (1994). ¾ Liu, Y., Gopikrishnan, P., Cizeau, P., Meyer, M., Peng,C.-K., e Stanley, H.E., Phys. Rev. E, (60), 1390 (1999).

  19. Efeitos da terapia multidisciplinar de longo prazo sobre a composição corporal de adolescentes internados com obesidade severa Effects of long-term multidisciplinary inpatient therapy on body composition of severely obese adolescents

    Directory of Open Access Journals (Sweden)

    Wagner Luiz do Prado

    2009-06-01

    Full Text Available OBJETIVO: Descrever os efeitos da terapia multidisciplinar de longo prazo sobre a composição corporal de adolescentes obesos severos internados. MÉTODOS: Um total de 728 adolescentes obesos extremos, incluindo 249 meninos (15,25±1,56 anos e 479 meninas (15,34±1,59 anos, recebeu terapia multidisciplinar durante um período de 3 a 9 meses. A terapia consistiu de redução da ingestão energética, orientação dietética, exercícios físicos e terapia psicológica. A composição corporal foi analisada pela bioimpedância elétrica, e a aptidão física foi avaliada pelo teste em ciclo ergômetro multiestágios. O tipo e duração de cada atividade foram avaliados através de recordatório diário de atividade física. RESULTADOS: Foi verificada redução significante (p OBJECTIVE: To describe the effects of long-term multidisciplinary inpatient therapy on body composition of severely obese adolescents. METHODS: A total of 728 extremely obese adolescents, including 249 boys (aged 15.25±1.56 years and 479 girls (aged 15.34±1.59 years received multidisciplinary therapy during a period of 3 to 9 months. The therapy consisted of reduced energy intake, dietetic education, physical exercises and psychological therapy. Body composition was assessed by bioelectrical impedance analysis, and physical capacity was assessed by the multistage cycle ergometer test. Type and duration of each activity were recorded using a daily controlled activity diary. RESULTS: There was a significant decrease (p < 0.05 in body mass (27.84±12.49 kg for boys and 21.60±9.87 kg for girls, body mass index (9.19±3.88 kg/m² for boys and 7.72±3.98 kg/m² for girls and fat mass. In addition, the percentage of fat free mass increased significantly (p < 0.05 in boys (from 58.8±6.41 to 69.98±7.43% and in girls (from 51.86±4.96 to 60.04±5.65%. CONCLUSION: Long-term multidisciplinary approach allows significant reduction in severe obesity, preserving growth and percentage

  20. Decisões judiciais sobre acesso aos medicamentos em Pernambuco

    Directory of Open Access Journals (Sweden)

    Artur Stamford

    2012-10-01

    Full Text Available OBJETIVO: Analisar as decisões do sistema jurídico sobre acesso da população a medicamentos no Sistema Único de Saúde por via judicial quanto a critérios de decisão e eventuais pressões políticas e econômicas. MÉTODOS: Estudo documental descritivo e retrospectivo de abordagem qualitativa e quantitativa. A coleta de dados foi realizada na Superintendência Estadual de Assistência Farmacêutica de Pernambuco, utilizando-se como fontes de dados 105 ações judiciais e relatórios administrativos de janeiro a junho de 2009. Verificaram-se os medicamentos com pedido ou carta patente no banco de dados do Instituto Nacional de Propriedade Industrial para identificar a frequência das patentes nas ações judiciais. Os dados obtidos foram classificados conforme o Sistema Anatômico Terapêutico Químico. Para análise das decisões judiciais, foi utilizada a teoria dos sistemas sociais autopoiéticos. RESULTADOS: As ações judiciais somaram 134 medicamentos com valor estimado de R$ 4,5 milhões para atender aos tratamentos solicitados; 70,9% dos medicamentos estavam com carta patente ou pedido e se concentraram em três classes terapêuticas: antineoplásicos e moduladores imunológicos, aparelho digestório e metabolismo, órgãos dos sentidos. Foram identificadas seis ideias centrais com os critérios de decisão dos magistrados (Constituição Federal e prescrição médica e as pressões entre os sistemas do direito, da economia e da política quanto ao acesso a medicamentos. CONCLUSÕES: A análise das decisões judiciais fundamentadas na teoria dos sistemas sociais autopoiéticos permitiu identificar as estimulações mútuas (dependências entre o sistema do direito e demais sistemas sociais em relação à questão do acesso dos cidadãos aos medicamentos. Essas dependências foram representadas pela Constituição Federal e pela propriedade intelectual. A Constituição Federal e a prescrição médica foram identificadas como

  1. O uso do TLS (Teste de Lideranca Situacional como instrumento de avaliaçao de gestores de restaurantes / Use of Situational Leadership Test (SLT as a tool for assessment of restaurant managers

    Directory of Open Access Journals (Sweden)

    Francisco Geová Feliciano da Silva

    2012-11-01

    Full Text Available Diversos modelos de liderança foram apresentados ao longo das décadas a fim de se descobrir a existência de um perfil ideal de um líder. A liderança contingencial é mais um modelo que tenta auxiliar neste desafio, considerando que não há um modelo único ideal de liderar, mas suas ações devem ser flexíveis de acordo com a situação. Esse trabalho teve como objetivo principal identificar se a liderança contingencial está presente nos processos de gestão de pessoas em empresa do segmento de restaurantes. Para isso foi aplicado o teste de liderança situacional (TLS desenvolvido por Agostinho Minicucci, em uma empresa de pequeno porte deste setor da cidade de São Paulo. Foi investigado um total de seis líderes, e os resultados apontaram a presença da liderança contingencial nos processos de gestão, no entanto não houve o predomínio. O setor alimentício nos últimos anos tem apresentado um crescimento considerável e pesquisas neste sentido se justificam em função da importância dos líderes neste contexto socioeconômico.

  2. UMA BREVE HISTÓRIA (INDÍGENA DA ERVA-MATE NA REGIÃO PLATINA: DA PROVÍNCIA DO GUAIRÁ AO ANTIGO SUL DE MATO GROSSO

    Directory of Open Access Journals (Sweden)

    Jorge Eremites de Oliveira

    2015-12-01

    Full Text Available Neste artigo, os autores analisam a exploração da erva-mate (Ilex paraguariensis na bacia platina. O estudo se estende desde a Província do Guairá, no período colonial, até a incorporação do antigo sul de Mato Grosso, atual Estado de Mato Grosso do Sul, ao território brasileiro. Esta última situação ocorreu no século XIX, após o fim da guerra entre o Paraguai e a Tríplice Aliança (1864-1870 e com a implantação, na década de 1880, da Companhia Matte Larangeira na região. A empresa explorou durante décadas os ervais nativos, o território e o trabalho de comunidades guarani e kaiowá. Também explorou a mão de obra de trabalhadores não índios de origem paraguaia e brasileira, dentre outros. A economia ervateira é, pois, o fio condutor para uma análise mais ampla sobre um longo processo histórico e sociocultural.

  3. PARÂMETROS DE COR E TURBIDEZ RELACIONADOS AOS USOS DO SOLO E À MORFOMETRIA DA BACIA HIDROGRÁFICA DO RIO TAQUARAL, SÃO MATEUS DO SUL-PR

    Directory of Open Access Journals (Sweden)

    Ângela Marli Ewerling Luíz

    2012-04-01

    Full Text Available O presente artigo teve por objetivo relacionar aspectos morfométricos e de usos do solos com os parâmetros aquáticos de cor e turbidez do Rio Taquaral, São Mateus do Sul. Após a caracterização da área, foram implantados ao longo do rio, dois pontos de observação de dados pluviométricos e de coleta de água. As coletas foram submetidas à análise no laboratório da SANEPAR. Os resultados indicaram que na média, os índices de cor da água se apresentaram acima dos padrões da Resolução CONAMA 357/05. Já os de turbidez estavam dentro dos padrões dessa resolução. Estes se apresentaram mais elevados no alto curso, onde se pratica agricultura temporária e mecanizada.

  4. Do Xá ao Aiatolá: a revolução iraniana através de Veja (1978-1979 = The Shah to the Ayatollah: the iranian revolution through Veja (1978-1979

    Directory of Open Access Journals (Sweden)

    Zanoni, David Anderson

    2014-01-01

    Full Text Available Ao longo da década de 1970, o Irã passava por um momento de instabilidade política e social, o qual, no final dessa década, culminou em um levante popular que decretaria o fim de uma monarquia autocrática e ditatorial do xá Mohammed Reza Pahlavi. Desta forma, iniciava-se no Irã a República Teocrática Islâmica, liderada pelo aiatolá Ruhlloh Khomeini. O processo de queda da monarquia e promulgação de uma República Teocrática Islâmica, o qual, a historiografia denominou Revolução Iraniana, foi mundialmente explorado pelos meios de comunicação de massa, inclusive no Brasil. A partir disto, procuramos analisar como o periódico brasileiro semanal Veja abordou o processo iraniano, a partir de algumas edições que, inclusive, foram capa do semanário. Sendo assim, nossa proposta contempla o estudo da história através da imprensa. Assim, objetivamos analisar a história por meio da imprensa, problematizando os eventos a luz do conteúdo noticiado pelo semanário Veja

  5. Investigação do efeito do tempo de exposição à temperatura ambiente e ao tempo de estocagem de um filme adesivo estrutural de resina epoxídica

    Directory of Open Access Journals (Sweden)

    Ana Carolina Teixeira Neves da Silva

    2016-02-01

    Full Text Available Resumo A exposição de filmes adesivos de resina epoxídica à temperatura ambiente propicia condições que afetam diretamente suas propriedades físicas. Para o adesivo estrutural AF191, de aplicação no setor aeronáutico, isto pode ser confirmado pela súbita perda de pegajosidade (“tack”. Sendo assim, o comportamento do sistema de resina escolhido foi estudado experimentalmente, expondo-se este ao ambiente de laboratório a intervalos pré-determinados de tempo e a diferentes períodos de armazenamento (–18°C. O efeito da exposição foi analisado por meio de ensaios fisico-químicos baseados em normas internacionais complementados por testes empíricos não normatizados que visaram observar alguns comportamentos especificos da resina, como capacidade de fluxo e solubilidade. A partir dos resultados, foi possível observar alterações no comportamento fisico-químico, que afetam as condições de processabilidade do adesivo, como a capacidade de fluxo do adesivo quando aquecido, redução da aderência e da solubilidade em solvente orgânico. Estas alterações sugerem que houve um possível aumento no número de reticulações da matriz polimérica à temperatura ambiente.Porém este fato não foi comprovadopelo método de análise térmica utilizado (calorimetria exploratória diferencial – DSC, onde não foi observado alteração significativa da entalpia de cura ao longo do período de exposição. Isso pode ser atribuído a uma taxa de cura muito baixa da matriz ou apenas pela falta sensibilidade do método. A mudança de comportamento pode estar associada ao processo de plastificação da matriz polímérica causado pela absorção de umidade devido ao caráter higroscópico da matriz epoxídica, que pode ser verificado no aumento progressivo do ensaio de teor de voláteis. O período de estocagem mostrou que não houve alteração significativa das características avaliadas do adesivo.

  6. Macrófitas aquáticas de um lago marginal ao rio Embu-mirim, São Paulo, Brasil Aquatic macrophytes from a marginal pond at Embu-mirim river, S.Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Zuleika Beyruth

    1992-08-01

    Full Text Available Durante os anos de 1984/1985 obtiveram-se amostras sazonais para determinação de parâmetros físicos, químicos e biológicos de um lago marginal ao rio Embu-mirim, em Itapecerica da Serra, na bacia do reservatório de Guarapiranga (São Paulo, Brasil. Além de discutir os resultados obtidos quanto à flora de macrófitas aquáticas e suas relações com os outros parâmetros ambientais, são também analisados os efeitos da variação sazonal. As espécies encontradas estão presentes em diversos corpos d'água marginais, bem como ao longo do rio Embu-mirim, permitindo avaliar seu comportamento em corpos d'água semelhantes, da mesma bacia. A macrófita predominante foi Eichhornia crassipes (Mart. Solms. Os resultados obtidos demostram a tendência de uma eutrofização acelerada e o risco de macrófitas potencialmente problemáticas, como E. crassipes e Salvinia auriculata, formarem camalotes de altas densidades, que podem chegar ao reservatório de Guarapiranga, através do rio Embu-mirim, causando problemas aos diversos usos da água.In the years 1984/1985, limnological surveys were carried out at a marginal pond of the Embu-mirim river belonging to the hydrographic basin of Guarapiranga Reservoir (S. Paulo, Brazil, in order to obtain data for the determination of physical, chemical and biological parameters. Results obtained from the study of the aquatic macrophytes and their relationships with other environmental parameters are analised. Eichhornia crassipes (Mart. Solms, the dominant macrophyte, was observed in several water bodies of that basin, including the river it self, thus favoring an evaluation of its behavior in similar water bodies of the basin.

  7. Características químicas de solo submetido ao tratamento com esterco líquido de suínos e cultivado com gramíneas forrageiras

    Directory of Open Access Journals (Sweden)

    Queiroz Flávia Martins de

    2004-01-01

    Full Text Available Avaliou-se, neste trabalho, o efeito da aplicação intensiva de esterco líquido de suínos (ELS, pelo método do escoamento superficial, nas características químicas de um solo Podzólico Vermelho-Amarelo cultivado com quatro espécies forrageiras: quicuio da Amazônia (Brachiaria humidicola (Rendle Schweick, braquiária (Brachiaria decumbens Stapf, coastcross (Cynodon dactylon (L. Pers. e tifton 85 (Cynodon spp.. O ELS foi aplicado em parcelas de 4m² e com 5% de declividade, durante 4 meses, na taxa média equivalente a 800kg ha-1d-1 de demanda bioquímica de oxigênio (DBO5. Para caracterização química, amostras de solo foram coletadas à profundidade de 0-0,20m, antes de iniciar o experimento e após o término dele. A aplicação de ELS proporcionou acúmulo de P, K, Na e Zn no solo, enquanto as concentrações de Mg e Cu diminuíram e a de Ca se manteve inalterada. Houve aumento na acidez, na soma de bases, na CTC e redução na saturação por bases. Devido ao acúmulo de nutrientes, recomenda-se monitoramento das características químicas do solo, ao longo de seu perfil e das águas subterrâneas para que se avaliem riscos de contaminação ambiental.

  8. Microcefalia e outras manifestações relacionadas ao vírus Zika: impacto nas crianças, nas famílias e nas equipes de saúde

    Directory of Open Access Journals (Sweden)

    Decio Brunoni

    Full Text Available Resumo O presente estudo objetivou apresentar um panorama nacional e internacional atual dos estudos sobre o vírus Zika (ZIKV e, ancorado no avanço deste conhecimento, refletir sobre planos de ação voltados para as crianças, famílias e equipes de saúde envolvidas. Neste sentido, o estudo propôs a implementação de sistemas de seguimento para conhecer, descrever e caracterizar aspectos que devem estar relacionados à exposição pré-natal ao ZIKV, divididos em três eixos de atuação: 1. Avaliação diagnóstica e etiológica e rastreamento de problemas de desenvolvimento nas crianças incluídas como casos confirmados ou suspeitos. 2. Investigação do impacto emocional, da qualidade de vida, das estratégias de enfrentamento e da rede de apoio às famílias das crianças incluídas. 3. Capacitação de equipes multiprofissionais para avaliar e elaborar programas de intervenção ao longo do desenvolvimento das crianças, principalmente nos três primeiros anos de vida. Como conclusão, o presente trabalho ressalta que o sistema de assistência à saúde encontra-se diante de grandes desafios: entender o real significado de um potencial novo teratógeno; desvendar os mecanismos patogênicos do ZIKV, principalmente para o enfrentamento preventivo, e reconhecer o amplo espectro de manifestações clínicas para a elaboração de programas de intervenção.

  9. Oral health studies in the 1982 Pelotas (Brazil birth cohort: methodology and principal results at 15 and 24 years of age Estudo longitudinal de saúde bucal na coorte de nascidos vivos em Pelotas, Rio Grande do Sul, Brasil, 1982: aspectos metodológicos e resultados principais aos 15 e 24 anos de idade

    Directory of Open Access Journals (Sweden)

    Karen Glazer Peres

    2011-08-01

    aos 24 anos foi observado apenas dentre aqueles nunca pobres. Apresentar pelo menos um episódio de pobreza ao longo da vida impactou na saúde bucal na vida adulta.

  10. Robo-AO KP: A new era in robotic adaptive optics

    Science.gov (United States)

    Riddle, Reed L.; Baranec, Christoph; Law, Nicholas M.; Kulkarni, Shrinivas R.; Duev, Dmitry; Ziegler, Carl; Jensen-Clem, Rebecca M.; Atkinson, Dani Eleanor; Tanner, Angelle M.; Zhang, Celia; Ray, Amy

    2016-01-01

    Robo-AO is the first and only fully automated adaptive optics laser guide star AO instrument. It was developed as an instrument for 1-3m robotic telescopes, in order to take advantage of their availability to pursue large survey programs and target of opportunity observations that aren't possible with other AO systems. Robo-AO is currently the most efficient AO system in existence, and it can achieve an observation rate of 20+ science targets per hour. In more than three years of operations at Palomar Observatory, it has been quite successful, producing technology that is being adapted by other AO systems and robotic telescope projects, as well as several high impact scientific publications. Now, Robo-AO has been selected to take over operation of the Kitt Peak National Observatory 2.1m telescope. This will give Robo-AO KP the opportunity to pursue multiple science programs consisting of several thousand targets each during the three years it will be on the telescope. One-sixth of the observing time will be allocated to the US community through the NOAO TAC process. This presentation will discuss the process adapting Robo-AO to the KPNO 2.1m telescope, the plans for integration and initial operations, and the science operations and programs to be pursued.

  11. Adesão de pessoas com diabetes mellitus tipo 2 ao tratamento medicamentoso

    OpenAIRE

    BOAS, Lilian Cristiane Gomes-Villas; Foss-Freitas, Maria Cristina; Pace, Ana Emilia

    2014-01-01

    Estudo seccional de abordagem quantitativa que objetivou avaliar a adesão ao tratamento medicamentoso entre pessoas com diabetes mellitus, e sua relação com variáveis clínicas, de tratamento e controle metabólico. A amostra constituiu-se de 162 pessoas com diabetes mellitus tipo 2 em seguimento ambulatorial. Para a coleta dos dados, foram utilizadas a Medida de Adesão aos Tratamentos e a consulta aos prontuários dos participantes. Obteve-se elevada adesão ao tratamento medicamentoso. Para um ...

  12. COMO ENTENDER E ATENDER AOS DIREITOS DAS MINORIAS?

    Directory of Open Access Journals (Sweden)

    Maria Cristina Alves Delgado de Ávila

    2014-05-01

    Full Text Available No âmbito do Estado Democrático de Direito, um Governo representa a maioria. Conforme os ditames da Constituição Federal de 1988 – CRFB/88 -, a maioria pode organizar-se e decidir sobre os assuntos públicos de um determinado Estado. Dentro da idéia de maioria, tem-se o grupo que, em certo momento, encontra-se no poder com o direito de liderar os demais indivíduos ocupantes de um território. A minoria é o oposto. Para garantir a harmonia social, a maioria não tem o direito de oprimir a minoria e não deve retirar os direitos e as liberdades fundamentais de um grupo minoritário ou mesmo de um indivíduo. Ao contrário, a maioria deve garantir o pluralismo cultural de um povo dentro de um território. Partindo da hermenêutica dos direitos das minorias, pretende-se responder a pergunta como entender e atender a estes direitos.

  13. Subsunção do trabalho imaterial ao capital

    Directory of Open Access Journals (Sweden)

    Eleutério F. S. Prado

    Full Text Available O presente artigo examina a transformação do modo de produção capitalista que acompanha a expansão do trabalho imaterial como fonte de geração de riqueza efetiva. Essa avaliação é feita no interior da teoria do valor-trabalho e da crítica da economia política. Para tanto, interroga, primeiro, o verdadeiro impacto da informatização na natureza capitalista dos processos produtivos atualmente em andamento, principalmente nos países centrais. Compara, depois, as principais características da indústria taylorista com as características marcantes da indústria pós-taylorista. Ao final, conclui que uma transformação importante do sistema capitalista está em curso: a grande indústria, tal como foi caracterizada por Marx em O Capital, não predomina mais nos países do centro do sistema, pois o que aí prevalece agora é a pós-grande indústria.

  14. Touraine, Burawoy, Gramsci: do social ao político

    Directory of Open Access Journals (Sweden)

    Leonardo Mello e Silva

    Full Text Available O ensaio empreende uma discussão da proposta da sociologia pública de Michael Burawoy, nos anos 2000, a partir da confrontação com a intervenção sociológica de Alain Touraine, formulada nos anos 1970. Pontos de contato são detectados no que diz respeito à relação entre pesquisador e pesquisado, como atores sociais. Problemas e limitações, tanto da intervenção sociológica quanto da sociologia pública, são elencados, trazendo-se como apoio exemplos extraídos de trabalho de campo próprio. O texto vale-se também da inspiração de Antonio Gramsci e sua concepção da relação entre senso comum e intelectuais. Ao invés de um juízo conclusivo, propõe-se um diálogo entre os autores, todos preocupados, à sua maneira, com o destino público ou cívico do conhecimento obtido sobre o mundo social.

  15. INTRODUÇAO AOS MODELOS ODE PARTICIPAÇÃO DE MERCADO EM SERVIÇOS DE TRANSPORTES

    Directory of Open Access Journals (Sweden)

    Antonio Galvão Novaes

    2010-04-01

    Full Text Available

    Análises de participação de mercado ("market share" são comuns em estudos na área de "marketing", envolvendo produtos e respectivas marcas, de um lado, o perfil da demanda de outro, e o posicionamento das empresas produtoras que competem nesse mercado, num terceiro bloco. No setor de transportes a literatura registra aplicações em ligações aéreas e em serviços intermunicipais de ônibus. Os modelos de participação de mercado se aplicam normalmente a situações em que os operadores oferecem serviços de transportes similares num determinado mercado, com a competição sendo feita não com base em atributos modais intrínsecos, mas sim apoiada em características diferenciadoras intra-modais mais tênues, tais como conforto, atendimento, promoções tarifárias, "marketing" e propaganda, etc. Neste artigo é feita uma introdução aos modelos de "market share" em transportes, com a apresentação de um exemplo de aplicação ao transporte intermunicipal de passageiros em ônibus, sendo discutidos também aspectos ligados a calibração e tais modelos.

    ABSTRACT

    Market share analysis is common in marketing studies involving products and respective brands, on one hand, the demand profile on the other hand, and the competiting industries on a third set. In the transport sector the literature registers a number of applications to air transport problems and to intercity bus services. Market share models are normally applied to situations in which operators offer, in a specific market, transport services that are similar in nature, with competition based not on intrinsic modal attributes, but rather on more tenous intra-mode differentiating characteristics, such as comfort, attendance, tariff promotions, marketing and advertising efforts, etc (sub-modal configurations. It is presented in this paper an introduction to market share modelling in transport, with an example concerning an intercity bus service in

  16. TRATAMENTO DA CASCA DE QUEIJO CANASTRA COM RESINA E SEUS EFEITOS DURANTE A MATURAÇÃO E NA QUALIDADE COMO FORMA DE MELHORAR O ASPECTO E AGREGAR VALOR AO PRODUTO

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Costa Paiva

    2012-08-01

    Full Text Available O principal objetivo deste trabalho foi testar uma alternativa para melhorar o aspecto de apresentação e a qualidade do queijo Minas artesanal da Canastra sem comprometer as suas características peculiares. Assim, foram comparados queijos Minas artesanais da Canastra ao longo da maturação com aplicação de resina de grau alimentar na casca em relação àqueles sem aplicação, quanto aos aspectos físico-químicos, microbiológicos e sensoriais, durante as quatro estações do ano. Nos ensaios preliminares foram definidas a forma de aplicação (emprego das mãos e a quantidade (5 g de resina pura/unidade de queijo, sem necessidade da adição de sorbato de potássio. Durante o período de maturação estudado (2, 15, 30 e 45 dias não observou-se diferença significativa entre os queijos com e sem aplicação de resina na casca em relação às características físico-químicas como pH, atividade de água, teor de umidade, teor de gordura no extrato seco, extensão e profundidade de proteólise. E aos 15 e 30 dias de maturação, a Análise Descritiva Quantitativa Modificada (ADQM não indicou diferença entre os tratamentos com e sem aplicação de resina quanto aos atributos sensoriais avaliados, exceto para o aspecto global após 15 dias. Os queijos com aplicação de resina na casca tiveram um escore referente ao aspecto global maior em relação àqueles sem aplicação, após 15 dias de maturação, devido ao menor crescimento de mofos durante esse período. A partir dos escores obtidos no teste de aceitação mediante o uso de escala hedônica de 9 pontos, também não houve diferença significativa entre os queijos com e sem aplicação de resina na casca durante as quatro estações do ano. Entretanto, observou-se diferenças significativas nos queijos ao longo do ano, em relação às características físico-químicas pH, teor de gordura no extrato seco e profundidade de proteólise, e em relação aos atributos sensoriais

  17. Da Ruptura ao Acontecimento: Bachelard, Canguilhem e Foucault

    Directory of Open Access Journals (Sweden)

    Gabriela Menezes Jaquet

    2017-02-01

    Full Text Available Este artigo tem por objetivo propor uma problematização da concepção de acontecimento tal como é pensada, em seus contornos gerais, na filosofia francesa contemporânea e, mais especificamente, pela história da ciência. Nosso enfoque será a compreensão das abordagens de Gaston Bachelard, Georges Canguilhem e Michel Foucault principalmente no que tange às noções de ruptura epistemológica e de ideologia científica em sua articulação com as características do acontecimento pensado por Foucault, partimos, portanto, de concepções de história que, apesar das concordâncias, também acabam por se diferenciar: uma, a história descontinuísta das rupturas epistemológicas, outra, a história arqueológica dos acontecimentos. Para explicarmos a diferença deste nível acontecimental, será necessário compreendermos a visada singular de Foucault em relação à ciência, que é questionada (e criticada de forma a atentar para outro nível: o do saber que aqui exploraremos a partir do conceito de limiar. Igualmente quanto ao estatuto de científico, abordaremos o posicionamento crítico de Canguilhem em relação à Bachelard sobre os desdobramentos de uma razão pensada historicamente, através de sua história dos conceitos. Tendo em vista estas considerações poderemos compreender não só a especificidade do trabalho de cada um destes autores, mas visualizar o que a categoria de acontecimento pôde, via Foucault, trazer de novo para a história da ciência.

  18. As hérnias medem-se aos palmos?

    Directory of Open Access Journals (Sweden)

    Cátia Pereira

    2016-06-01

    Full Text Available Apresenta-se o caso de uma doente do sexo feminino com 74 anos, autónoma, com antecedentes patológicos de obesidade, diabetes mellitus tipo 2, hipertensão arterial e doença osteoarticular degenerativa, que recorreu à urgência por infeção respiratória inferior. Negava sintomas gastrointestinais ou antecedentes cirúrgicos. Ao exame objetivo, destacava-se a presença de uma hérnia umbilical volumosa não dolorosa à palpação, mas que condicionava a sua mobilidade, sendo impossível a redução do conteúdo herniário. Após insistência na anamnese, a doente referiu o seu aparecimento na infância, na altura com recusa em efetuar a sua correção cirúrgica, tendo sido perdido o seu seguimento posteriormente. A radiografia e a tomografia computorizada abdominais mostraram um colo herniário de seis centímetros de diâmetro e herniação de praticamente todo o intestino delgado e parte do cólon, sem evidência de encarceramento (Figuras 1 e 2. Apesar de décadas de evolução condicionarem um progressivo e forte impacto nas atividades da vida diária, a doente não procurou os cuidados de saúde por esse motivo, mantendo a sua decisão e sendo encaminhada para a consulta externa. As complicações herniárias abdominais incluem a obstrução intestinal e a temida emergência cirúrgica da hérnia encarcerada, não se desprezando a morbilidade inerente, bem evidente neste caso.1-2

  19. O sindicalismo mineiro frente aos desafios dos anos 90

    Directory of Open Access Journals (Sweden)

    Antônio Carvalho Neto

    2000-12-01

    Full Text Available O que se analisa neste artigo é como os sindicatos dos bancários, metalúrgicos e trabalhadores em telecomunicações têm negociado o (desemprego, a demanda por qualificação e a remuneração variável. Foram tabuladas/analisadas 3.569 cláusulas de acordos coletivos, e realizadas 26 entrevistas com dirigentes sindicais e empresariais em três Estados (RJ, SP e MG. Os resultados indicam que as mudanças organizacionais foram incomparavelmente mais negociadas no setor metalúrgico do ABC. A flexibilização da jornada foi trocada pela redução (da jornada sem redução de salário nos setores metalúrgicos paulistas, mas não em Minas Gerais. No setor bancário, houve poucos resultados nas negociações sobre jornada. As negociações em torno da remuneração variável vinculada às metas das empresas aconteceram nos setores metalúrgicos, e não nos setores de serviços. As entrevistas apontam para um sindicalismo mais propositivo, no sentido de uma intervenção negociada, predisposição que não é correspondida pelos empresários, grosso modo. O Estado, que poderia utilizar seu poder regulador para induzir os empresários a negociarem nessa direção não tem produzido resultados satisfatórios. Conclui-se que não há maturidade empresarial no Brasil que permita ao Estado ausentar-se das relações de trabalho.

  20. Suscetibilidade de Oligonychus yothersi (Acari: Tetranychidae ao fungo Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Oliveira Renato Cassol de

    2002-01-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis é uma importante atividade econômica no Sul do Brasil. Com o aumento de consumo nos anos oitenta, cresceram também as áreas de monocultura, gerando condições favoráveis para o aumento populacional de insetos e ácaros fitófagos, entre eles o ácaro vermelho Oligonychus yothersi. Este estudo avaliou a suscetibilidade do ácaro vermelho O. yothersi a vários isolados do fungo Beauveria bassiana. O experimento foi conduzido em Cascavel, PR. Discos foliares de erva-mate (2,2 cm² foram previamente infestados com 20 fêmeas adultas. Alíquotas de 1 mL de cada suspensão de conídios dos diferentes isolados de B. bassiana, ajustadas na concentração de 1,0x10(8 conídios mL-1 foram pulverizadas, separadamente, sobre um conjunto de 5 discos. Os discos foliares foram mantidos flutuando em água destilada, em caixas plásticas (3 cm de diâmetro, sob condições controladas. Diariamente, os ácaros mortos foram transferidos para câmara úmida, para confirmação de mortalidade causada pelo fungo. A mortalidade total variou entre 77 e 98% (6 dias após a aplicação, não permitindo diferenciar os isolados quanto à virulência (P>0,05. Já a mortalidade confirmada variou entre 19 e 75%, permitindo diferenciá-los (P<0,05. O ácaro vermelho O. yothersi foi suscetível, em diferentes níveis, aos isolados de B. bassiana testados.

  1. Densidade, agregação e frações de carbono de um Argissolo sob pastagem natural submetida a níveis de ofertas de forragem por longo tempo

    Directory of Open Access Journals (Sweden)

    Osmar Conte

    2011-04-01

    Full Text Available O ajuste da quantidade de animais à oferta de forragem é fundamental para a sustentabilidade de pastagens naturais. O manejo da oferta de forragem, além de interferir nas espécies vegetais que compõem a pastagem, também pode se refletir nos atributos do solo, como densidade, agregação e conteúdo de carbono. Neste estudo, avaliaram-se a densidade do solo, o diâmetro médio ponderado de agregados e frações de carbono sob pastagem natural, manejada por 22 anos com diferentes intensidades de pastejo, representadas por níveis de oferta de forragem de 4, 8, 12 e 16 kg de matéria seca para cada 100 kg de peso de animal vivo. Duas áreas excluídas de pastejo foram incluídas como testemunhas. Verificaram-se alterações nos atributos do solo, estando elas relacionadas às intensidades de pastejo. Essas alterações ocorreram, principalmente, na superfície (0-10 cm, observando-se aumento da densidade do solo com a redução na oferta de forragem. O diâmetro médio ponderado de agregados do solo e a massa de raízes na camada de 0 a 10 cm apresentaram comportamento inversamente proporcional ao da oferta de forragem. A labilidade do carbono decresce nos tratamentos conforme diminui a oferta de forragem. O índice de estoque de C indica que na oferta de 12 % aumenta-se o estoque de C no solo em relação à testemunha, enquanto as demais ofertas diminuem. O índice de manejo de carbono demonstra que as maiores ofertas de forragem (12 e 16 % proporcionam melhor qualidade ao sistema em pastagem natural, ao passo que na menor oferta (4 % o sistema está perdendo qualidade e comprometendo a sustentabilidade - demonstrado pela redução substancial desse índice.

  2. Patterns of Impairments in AOS and Mechanisms of Interaction between Phonological and Phonetic Encoding

    Science.gov (United States)

    Laganaro, Marina

    2012-01-01

    Purpose: One reason why the diagnosis of apraxia of speech (AOS) and its underlying impairment are often debated may lie in the fact that most patients do not display pure patterns of AOS. Mixed patterns are clearly acknowledged at other levels of impairment (e.g., lexical-semantic and lexical-phonological), and they have contributed to debate…

  3. SCExAO as a precursor to an ELT exoplanet direct imaging instrument

    Science.gov (United States)

    Jovanovic, Nemanja; Guyon, Olivier; Martinache, Frantz; Clergeon, Christophe; Singh, Garima; Vievard, Sebastien; Kudo, Tomoyuki; Garrel, Vincent; Norris, Barnaby; Tuthill, Peter; Stewart, Paul; Huby, Elsa; Perrin, Guy; Lacour, Sylvestre

    2013-12-01

    The Subaru Coronagraphic Extreme AO (SCExAO) instrument consists of a high performance Phase Induced Amplitude Apodisation (PIAA) coronagraph combined with an extreme Adaptive Optics (AO) system operating in the near-infrared (H band). The extreme AO system driven by the 2000 element deformable mirror will allow for Strehl ratios>90% to be achieved in the H-band when it goes closed loop. This makes the SCExAO instrument a powerful platform for high contrast imaging down to angular separations of the order of 1 lambda/D and an ideal testbed for exploring coronagraphic techniques for ELTs. In this paper we report on the recent progress in regards to the development of the instrument, which includes the addition of a visible bench that makes use of the light at shorter wavelengths not currently utilized by SCExAO and closing the loop on the tip/tilt wavefront sensor. We will also discuss several exciting guest instruments which will expand the capabilities of SCExAO over the next few years; namely CHARIS which is a integral field spectrograph as well as VAMPIRES, a visible aperture masking experiment based on polarimetric analysis of circumstellar disks. In addition we will elucidate the unique role extreme AO systems will play in enabling high precision radial velocity spectroscopy for the detection of small companions.

  4. The nature of ethnic identity among the people of Curaçao

    NARCIS (Netherlands)

    Dijs, N.M. van der

    2011-01-01

    This qualitative research explores the nature of ethnic identity among the people of Curaçao. The questions that are of fundamental interest to this study are: how do the people of Curaçao perceive themselves ethnically, how do they experience their sense of belonging to an ethnic group and what

  5. About the malacological subdivision of Curaçao; a review

    NARCIS (Netherlands)

    Wagenaar Hummelinck, P.

    1990-01-01

    Burrington Baker (1924) states that Curaçao can be divided into three distinct faunal areas. Stock (1977) mentions the occurrence of three subspecies of hadziid amphipods almost exclusively confined to different parts of Curaçao. The results of a study of the distribution on this island of various

  6. Use of AO PSF models for the Study of Resolved Stellar Populations

    NARCIS (Netherlands)

    Deep, A.; Fiorentino, G.; Jolissaint, L.; Tolstoy, E.; Clénet, Y.; Conan, J.-M.; Fusco, Th.; Rousset, G.

    2010-01-01

    The full scientific exploitation of AO images to study resolved stellar populations is still in a nascent stage. This requires pushing to the faint limits and carrying out deep and accurate crowded field photometry and astrometry. The main complexity of AO images is that the correction is never

  7. Data of evolutionary structure change: 1AO5B-1ELCA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1AO5B-1ELCA 1AO5 1ELC B A VVGGFNCEKNSQPWQVAVYYQ----KEHICGGVLLDRNW...TPTWQKPDDLQCVFITLLPNENCAKV--YLQKVTDVMLCAGEMGGGKDTCRDDSGGPLICD----GILQGTTSYGPV-PCGKPGVPAIYTNLIKFNSWIKDTMMKNA TRP CA 491 1ELC A 1ELCA...hain> 1ELC A 1ELCA PLHCLVNGQYAVHG... PRO CA 225 1ELC A 1ELCA

  8. Efeitos do treinamento de força a longo prazo sobre parâmetros hemodinâmicos e concentração de resistina em mulheres na pós-menopausa

    Directory of Open Access Journals (Sweden)

    Cecília Tardivo Marin

    2013-09-01

    Full Text Available Objetivo: Investigar a influência do treinamento de força (TF sobre a concentração sorológica de resistina e pressão arterial de mulheres na pós-menopausa. Métodos: Estudo longitudinal, realizado na Universidade Federal de São Carlos, do qual participaram 23 mulheres sedentárias na pós-menopausa. O TF apresentou duração de 13 meses (dez/2008 a jan/2010, com duas sessões semanais, cada uma consistindo em três séries de 8-12 repetições máximas e um exercício para cada grupo muscular principal. Foi avaliada a força muscular máxima nos seguintes exercícios: supino, leg press 45° e flexão do cotovelo em pé. A concentração sérica de resistina foi determinada pelo método ELISA. No processamento estatístico, utilizou-se o ANOVA (com medidas repetidas para comparar os momentos Pré, 6 meses e 13 meses (p<0,05. Para avaliar as correlações resistina × pressão arterial, resistina × força muscular e força × pressão arterial, utilizou-se o teste de correlação de Pearson. Resultados: As mulheres apresentaram o seguinte perfil antropométrico: 61,33±3,8 anos; estatura de 148,5±32,7 cm; massa corporal de 67,56±10,85 kg. O TF induziu a redução da concentração de resistina (30272,4±8100,1 versus 16350,6±2404,6 pg/mL e pressão arterial sistólica (120,5±11,8 versus 115,8±1,6 mmHg, e o aumento da força muscular no leg press 45o (172,3±27,3 versus 348,6±40,8 kg, supino (31,9±4,1 versus 41,8±5,6 kg e flexão do cotovelo (21,0±2,4 versus 26,5±2,9 kg após os 13 meses (p<0,05. Conclusão: Os resultados deste estudo revelaram que o TF a longo prazo aumenta a força muscular máxima, diminui a pressão arterial sistólica e os níveis séricos da resistina – alterações fisiológicas benéficas para a redução do risco de doenças cardiovasculares em mulheres na pós-menopausa.

  9. Propostas de mudanças ao basquete no sertão cearense: dando voz aos praticantes

    Directory of Open Access Journals (Sweden)

    Bérgson Nogueira de Oliveira

    2017-06-01

    Full Text Available Objetivo: o presente artigo tem como objetivo compreender as percepções de mudanças sociais atribuídas pelos praticantes de basquete em um município do sertão cearense, destacando neste contexto, as suas representações sociais acerca do papel social desta prática esportiva. Método: foram entrevistados cinco sujeitos do sexo masculino que praticam a modalidade há mais de dez anos no contexto do sertão cearense e que estudaram em escolas públicas. Para a construção das informações, utilizamos a entrevista semi-estruturada, seguida por um roteiro composto por temas, que foi adaptado de um estudo realizado por Santos (2004. As análises dos dados se deu a partir da Análise de Conteúdo do tipo Análise Temática, em que foram elaboradas categorias, a partir do material das entrevistas. Resultados: as representações de mudança dos sujeitos indicam o incentivo do basquete nas escolas; criação de projetos sociais; investimento na infraestrutura esportiva; bem como o fomento à criação de competições. Conclusão: conclui-se que a falta de apoio, de forma geral, dificulta a inserção de novos praticantes para essa modalidade. Nesse sentido, entende-se que são necessários mais incentivos ao esporte, pois se trata de um pilar na formação humana e possibilita o seu trabalho, não apenas no alto rendimento, mas também em dimensões de lazer, participação, educação, inclusão social entre outros aspectos.

  10. Sobre a domiciliaçao dos triatomineos

    Directory of Open Access Journals (Sweden)

    Mário B. Aragão

    1981-06-01

    Full Text Available Foram reunidos resultados de testes de precipitina feitos com o conteúdo do tubo digestivo de triatomineos. €ssas informações foram discutidas com base nas proporções de sangue de mamíferos e de ave, encontradas e em diversas observações relativas às espécies de vertebrados a que os triatomíneos estão associados na natureza. O estudo englobou as seguintes espécies: Belminus peruvianus, Panstrongylus geniculatus, Panstrongilus herreri, Panstrongylus megistus, Psammolestes tertius, Rhodnius neglectus, Rhodnius prolixus,Triatoma arthurneivai, Triatoma dimidiata,Triatoma infestans, Triatoma protracta, Triatoma rubrovaria e Triatoma sórdida. As seguintes conclusões puderam ser obtidas: 1 - As espécies que, nos biótopos artificiais, se alimentam principalmente de sangue humano, na natureza, são as mais ecléticas. Sugam mamífero, ave e animais de sangue-frio, mas apresentam marcada preferência por sangue de mamífero. 2 - As espécies que, nos biótopos artificiais, são encontradas com maior freqüência associadas a aves, na natureza ou preferem sangue de ave ou não tem predileção nítida por ave ou mamífero. 3 - As espécies associadas a animais de sangue frio ou restritas a um único grupo de mamíferos, podem colonizar nos domicílios desde que eles sejam previamente colonizados pelo hospedeiro. 4 - Não foram encontrados indícios de que alguma espécie esteja se adaptando aos domicílios. Todos os triatomineos ditos domiciliários já possuíam, na natureza, atributos que permitiam a vida em novos biótopos, habitados ou pelo homem ou por animais domésticos.

  11. Um sopro de Luz e Letra em meio ao caos

    Directory of Open Access Journals (Sweden)

    Marcelo Tomazi

    2009-06-01

    Full Text Available Enquanto compreende avanços científicos, o homem busca compreender a si mesmo. Partindo da citação de Carl Sagan, vemos que a Arte é um dos caminhos para a humanização, e os vínculos entre ciência (tecnologia e arte são cada vez mais estreitos. Um dos artistas que melhor trabalham dentro do nicho conhecido como “arte tecnológica” é Eduardo Kac. Sua trajetória inicial é apresentada aqui, dos “holopoemas” à “arte da telepresença”. Vemos o artista-teórico completo, profundo conhecedor da história da arte eletrônica. O livro Luz & letra: ensaios de arte, literatura e comunicação, sua obra de referência, é apresentado em essência, situando-se sua importância. É uma das poucas obras no Brasil a discutir, pela ótica de quem fez parte, eventos ligados ao advento da arte tecnológica nos anos 1980.In our quest to understand scientific advances, we seek to understand ourselves. Employing Carl Sagan's insight as a departure point, we see that art is one of the paths for humanization and that the links between science (technology and art are increasingly narrow. One of the artists who best works within the realm known as “art and technology” is Eduardo Kac. This essay explores Kac's early artworks, starting with “holopoems” and arriving at “telepresence art”, and especially his texts. We see a complete artist-theorist, with an unrivaled knowledge of electronic art and literature, in part because his theorizing emerges from having actively participated in the creation of the events he refers to. Of special interest is Kac's book Light & letter: essays in art, literature, and communication, which collects his writings of the 1980s. This is a fundamental work and mandatory reference for the study of the experimental art and literature of the period.

  12. Aldehyde oxidase (AO) in the root nodules of Lupinus albus and Medicago truncatula: identification of AO in meristematic and infection zones.

    Science.gov (United States)

    Fedorova, Elena; Redondo, Francisco J; Koshiba, Tomokazu; Pueyo, José J; de Felipe, M Rosario; Lucas, M Mercedes

    2005-05-01

    Phytohormones are involved in the organogenesis of legume root nodules. The source of the auxin indole-3-acetic acid (IAA) in nodules has not been clearly determined. We studied the enzyme aldehyde oxidase (AO; EC 1.2.3.1), that catalyzes the last step of IAA biosynthesis in plants, in the nodules of Lupinus albus and Medicago truncatula. Primordia and young lupin nodules and mature M. truncatula nodules showed AO activity bands after native polyacrylamide gel electrophoresis. Gel activity analyses using indole-3-aldehyde as substrate indicated that the nodules of white lupin and M. truncatula have the capability to synthesize IAA via the indole-3-pyruvic acid pathway. Immunolocalization and in situ hybridization experiments revealed that AO is preferentially expressed in the meristematic and the invasion zones in Medicago nodules and in the lateral meristematic zone of Lupinus nodules. High IAA immunolabeling was also detected in the meristematic and invasion zones. Low expression levels and no AO activity were detected in lupin Fix- nodules that displayed restricted growth and early senescence. We propose that local synthesis of IAA in the root nodule meristem and modulation of AO expression and activity are involved in regulation of nodule development.

  13. O direito fundamental ao conteúdo do próprio trabalho: uma reconstrução normativa do direito ao trabalho

    Directory of Open Access Journals (Sweden)

    Leonardo Vieira Wandelli

    2016-12-01

    Full Text Available Resumo: Pretende-se enfrentar a inefetividade do direito humano e fundamental ao trabalho a partir de um esforço de reconstrução normativa da sua fundamentação, apoiada em um duplo pilar teórico, nas teorias das necessidades e nas teorias do reconhecimento. Com isso, não somente se recupera a importância do vínculo entre trabalho e dignidade humana, como se explicitam aspectos essenciais da centralidade do trabalho para os sujeitos. A partir disso, o direito ao trabalho se desvela não apenas como necessidade radical, tendente à transformação da institucionalidade vigente, mas também como direito positivado em um amplo leque de normas internacionais e nacionais, que contempla diversas dimensões normativas atualmente exigíveis. Propõe-se que, no centro desse direito, está um direito fundamental ao conteúdo do próprio trabalho, que determina juridicamente as condições da atividade e da organização do trabalho. Recente estudo adotado pelo Alto Comissariado em Direitos Humanos da Organização das Nações Unidas (ONU sobre o direito ao trabalho reforça essa compreensão. Palavras-chave: Direitos humanos. Direitos fundamentais. Direito ao trabalho. Psicodinâmica do trabalho. Direito do trabalho.

  14. Agenesia isolada da artéria pulmonar direita ou esquerda: avaliação da evolução natural e a longo prazo, após intervenção corretiva Isolated unilateral pulmonary artery agenesis: evaluation of natural and long term evolution after corrective surgery

    Directory of Open Access Journals (Sweden)

    Edmar Atik

    2006-10-01

    Full Text Available OBJETIVO: Agenesia da artéria pulmonar, direita ou esquerda, rara como anomalia isolada, foi relatada em 119 casos desde 1978. Apresenta-se clinicamente com hipertensão pulmonar (HP na infância e com hemoptise no adulto. Intervenções como reconstrução arterial pulmonar e lobectomia foram realizadas em 17% dos casos. Analisamos quatro destes casos, sendo dois em evolução natural e dois com regressão da HP, após longo tempo da correção operatória. MÉTODOS: Quatro crianças, três do sexo masculino, com 22,10 e 35 meses de idade e uma do sexo feminino com 20 meses, com insuficiência cardíaca direita (ICD e cianose na primeira e ICD na segunda e cansaço aos esforços nas outras duas. Todas tinham sinais de HP, sobrecarga ventricular direita no ECG e cardiomegalia. Cateterismo cardíaco mostrou pressões sistêmicas na artéria pulmonar contralateral na agenesia à direita em três e na agenesia à esquerda em um caso. RESULTADOS: Restabelecimento cirúrgico da continuidade arterial pulmonar foi possível em dois casos, na criança de 22 e na de 10 meses de idade, pela interposição de Goretex de diâmetro de 7 mm entre as artérias pulmonares até o hilo pulmonar contralateral hipoplásico. Houve regressão dos sinais de HP em período imediato e tardio, com 7 e 2,5 anos de idade respectivamente. A relação das pressões entre os ventrículos direito e esquerdo era de 30 e 40%, nos dois casos. A perfusão pulmonar aumentou de 8 para 44% e de 8 para 23%, nos dois casos. O mesmo procedimento foi programado para os outros pacientes. CONCLUSÃO: Esta técnica se torna a operação de escolha para casos similares, raramente descritos na literatura, mesmo em presença de acentuada HP e hipoplasia arterial pulmonar contralateral.OBJECTIVE: Unilateral pulmonary artery agenesis is an uncommon isolated anomaly and since 1978 only 119 cases have been reported. In general the condition presents as pulmonary hypertension (PH in children and

  15. Resposta de cultivares de crisântemo ao manejo de iluminação e ao número de plantas por vaso.

    Directory of Open Access Journals (Sweden)

    Cáudia Prtry

    1999-05-01

    Full Text Available As práticas de manejo permitindo a extensão da produção do crisântemo sobre um período mais longo e a utilização de cultivares adaptadas às condições ambientais locais são, entre outras, as principais metas e objetivos de pequenos produtores desta planta ornamental. Foram avaliados os efeitos da densidade de planta e da duração do crescimento vegetativo sob dia longo (DL: 15 h precedendo as condições de período indutivo curto (DC: 1 O h, sobre a estatura de plantas, massa fresca e seca de parte aérea, massa fresca e seca de raízes, número de botões florais e diâmetro floral de quatro cultivares de crisântemo (Dendranthema grandiflora Tzvelev, produzidos em vaso com fins de comercialização. As densidades de plantas foram de 5 ou 6 plantas por vaso de 1.000 mL de volume. As condições do DL, antes da indução floral, foram impostas a dois tipos de manejo de iluminação: o convencional (42 dias em DL ou por um período mais curto, de 21 dias (precoce. As quatro cultivares de crisântemo usadas foram: Pappilon, Amarelo São Paulo, Red Delano e White Diamond. Foi utilizado um arranjo fatorial com três fatores, num delineamento com quatro blocos completos casualizad os. Os três fatores foram as quatro cultivares de crisântemo, dois manejos de iluminação (precoce e convencional; 21 e 42 dias em DL e as duas densidades de plantas utilizadas por vaso. Os dados foram submetidos à análise da variância e as médias de tratamentos, separadas pelo teste de Tukey (P < 0,05. A densidade de planta por vaso não afetou a altura de plantas no manejo convencional. Comparadas às do manejo convencional, as plantas sob o manejo precoce foram mais baixas e apresentaram menores quantidades de matérias frescas e secas. Não houve efeito do manejo precoce sobre o número de botões florais produzidos por vaso. Comparadas às do manejo convencional, as plantas das cultivares White Diamond, Red Delano e Amarelo São Paulo, apresentaram

  16. Sistema de Informação Ambiental: proposta de adequações ao módulo de fauna para sua utilização como uma ferramenta de apoio à aprendizagem

    Directory of Open Access Journals (Sweden)

    Vania Elisabete Schneider

    2017-12-01

    Full Text Available A sociedade tem se transformado em um ritmo crescente e de forma acelerada, demandando a reinvenção das metodologias e ferramentas de ensino, visando uma aprendizagem mais significativa. Uma tendência que vem sendo utilizada como ferramenta de apoio à educação é a Tecnologia da Informação e Comunicação, permitindo aos alunos que interajam com o professor, apesar de restrições de tempo e local, fornecendo acesso a diferentes fontes de conhecimento a qualquer momento. O Instituto de Saneamento Ambiental da Universidade de Caxias do Sul (ISAM/UCS vem desenvolvendo, ao longo de oito anos, um Sistema de Informação Ambiental (SIA, no qual são armazenadas informações relativas as temáticas: água, fauna, clima e geografia da Bacia Hidrográfica Taquari-Antas, monitorados por empreendimentos hidrelétricos ali instalados. A partir do cruzamento dos dados armazenados no SIA, é possível obter diferentes resultados e avaliações. Nesse contexto, esse trabalho objetiva propor adequações (de interface e de interação para integrar ao SIA, com vistas a utilização do módulo específico de fauna como um Objeto de Aprendizagem (OA, como funcionalidades que permitem algum tipo de interatividade entre o usuário e a informação disponibilizada, tornando-o mais atrativo e eficiente do ponto de vista educacional. As alterações propostas foram baseadas na revisão de sistemas semelhantes e ferramentas educativas visando a inserção de novas funcionalidades no módulo de fauna. Desta forma, foram propostas quatro adequações: abordagem sobre o risco de extinção, compartilhamento de informações entre usuários, desenvolvimento e integração de um jogo educativo e a avaliação de usabilidade do sistema. A partir da implementação das adequações propostas, espera-se que esta ferramenta seja explorada no ambiente escolar, principalmente na região da Bacia Hidrográfica Taquari-Antas, visto que as informações disponibilizadas no

  17. Projeto Ciclo das Rochas: um Exemplo Bem Sucedido do Uso do Patrimônio Geológico como Estímulo ao Aprendizado de Ciências Naturais

    Directory of Open Access Journals (Sweden)

    Soraya Almeida

    2012-01-01

    Full Text Available O projeto de difusão das ciências geológicas “O Ciclo das Rochas em Terras Fluminenses” foi elaborado pelo Departamento de Geociências/UFRuralRJ em parceria com a Secretaria de Estado de Educação do Rio de Janeiro, com o objetivo de promover uma atualização do conhecimento por parte dos docentes do Ensino Médio. Sua estrutura envolve fases de aprendizagens individuais e coletivas sobre os principais tópicos relacionados à ciência geológica. A abordagem do conteúdo é realizada em módulos, oferecidos ao longo de um semestre, por meio de aulas presenciais e acompanhamento on-line. Adicionalmente, os participantes são estimulados a trabalharem, em conjunto com seus alunos, na construção de um acervo contendo dados sobre a geologia de sua região, dos registros da paisagem, coleta e análise de rochas e minerais e pela correlação do meio-ambiente no contexto do ciclo geológico. A composição dos grupos de trabalho fica a critério das próprias escolas e cada projeto é acompanhado por um professor da UFRuralRJ. O material coletado pelos grupos de pesquisa é classificado e discutido em termos de sua origem, alteração, utilização e demais características que se apliquem aos exemplares. Os alunos trabalham com mapas e imagens da região, reconhecendo feições que lhe são familiares. Ao final do curso, as escolas participantes são reunidas em um evento que permite o intercâmbio dos resultados e uma comparação entre as diversidades de seus patrimônios geológicos.

  18. Do talento ao alto rendimento: indicadores de acesso à excelência no handebol From talent to a high level of performance: key requirements to access the excellence in handball

    Directory of Open Access Journals (Sweden)

    Luís Massuça

    2010-12-01

    Full Text Available O talento constitui uma das condições fundamentais para acender à excelência no desporto de competição e a sua identificação representa o primeiro passo de um longo processo de especialização que permite selecionar os sujeitos certos. Para conhecer as variáveis que os treinadores julgam mais influentes no sucesso do atleta de handebol (do sexo masculino, foi aplicado um questionário a 71 treinadores de handebol ("Questionário aos Técnicos de Andebol - QTA"; MASSUÇA, 2007. Neste instrumento, solicitava-se aos participantes que avaliassem o grau de importância de cada fator e indicador de rendimento no sucesso em geral (Handebolista, A e, que o fizessem igualmente para cada uma das posições de jogo que caracterizam a modalidade desportiva (Ponta, P; Lateral, L; Central, C; Pivot, Pi; Guarda-redes, GR. Os resultados permitem constatar que não existe um perfil de atleta de handebol, mas vários. Pode assim concluir-se que no jogo de handebol o sucesso pode ser experimentado por atletas com diferentes características. Em complemento, julgamos que o inventário apresentado (das qualidades necessárias ao atleta de handebol de alto rendimento poderá servir de referência para a construção de um modelo de seleção de talentos.Talent is a key requirement to access the excellence in a competitive sport and its identification is the first step of a long process of specialization that allows the correct selection of subjects. To understand what the most influent variables to achieve success are, a questionnaire was administered to 71 handball coaches ("Questionnaire to Handball Coaches - QTA"; MASSUÇA, 2007. The coaches were asked to rate the importance of each factor and performance indicator considering the success of the general male handball player (A and to do exactly the same for each specific playing position (wing, P; backward left/right, L; backward centre, C; pivot, Pi; goalkeeper, GR. Results showed that there is not a

  19. Avaliação da qualidade de vida e vulnerabilidade ao estresse no contexto hospitalar

    Directory of Open Access Journals (Sweden)

    Fernanda Ottati

    2013-05-01

    Full Text Available O conceito de Qualidade de Vida é usado para medir as condições de vida de um ser humano, já a palavra vulnerabilidade refere-se à chance das pessoas estarem expostas ao adoecer. Objetivou-se analisar possíveis relações entre percepção de qualidade de vida e a vulnerabilidade ao estresse no trabalho em enfermeiros, técnicos e auxiliares de enfermagem que atuam na UTI e no setor de emergência de um hospital público. Utilizou-se o instrumento de qualidade de vida da Organização Mundial da Saúde, WHOQOL-Bref e a Escala de Vulnerabilidade ao Estresse no Trabalho. Encontrou-se, em relação ao setor de trabalho, diferença significativa apenas para Qualidade de vida total. Portanto pode-se afirmar que os profissionais que atuam na UTI possuem maior percepção de qualidade de vida quando comparados aos do SUS. Na correlação entre os dois instrumentos, o domínio meio ambiente do WHOQOL-Bref correlacionou-se negativa e significativamente com todos os fatores da EVENT, indicando que a percepção da pessoa em relação aos diversos aspectos do meio em que vive tem relação com a vulnerabilidade ao estresse.

  20. Condições oftalmológicas de pacientes com síndrome da imunodeficiência adquirida com longo tempo de seguimento Ophthalmologic conditions of aids patients with long-term follow-up

    Directory of Open Access Journals (Sweden)

    Márcia Abelin Vargas

    2007-02-01

    Full Text Available OBJETIVO: Avaliar as condições oftalmológicas atuais de pacientes com síndrome da imunodeficiência adquirida (SIDA, previamente avaliados por oftalmologista, levando em consideração algumas características gerais relacionada com essa doença. MÉTODOS: Estudo observacional de 42 pacientes com SIDA, subdivididos em dois grupos: Grupo I: 8 pacientes com SIDA e diagnóstico prévio de retinite por citomegalovírus; Grupo II: 34 pacientes com SIDA sem retinite por citomegalovírus. Os dados gerais relacionados com a SIDA foram obtidos pela análise dos prontuários médicos. RESULTADOS: A maioria dos pacientes apresentou acuidade visual no melhor olho entre logMAR 0,0 (68,3% e 0,1 (26,9%. Prescrição óptica para longe beneficiou 39,4% dos pacientes do Grupo II mas nenhum dos paciente do Grupo I. Presbiopia foi corrigida em 27,3% no Grupo II e 12,5% no Grupo I. Não foram encontradas manifestações oculares atuais relacionadas a SIDA em nenhum dos grupos. As alterações fundoscópicas encontradas em 10 pacientes foram todas alterações cicatriciais de retinite/retinocoroidite, sendo 7 (16,7% pacientes pertencentes ao Grupo I e 3 (7,1% pacientes pertencentes ao Grupo II. CONCLUSÃO: Dez (24,4% pacientes apresentaram alteração visual decorrente do envelhecimento. Com exceção dos pacientes com cicatrizes prévias de retinite ou retinocoroidite, todos os outros participantes estavam em boas condições oftalmológicas e a maioria dos mesmos se encontrava em recuperação imunológica, devido ao uso da terapia anti-retroviral de alta potência.PURPOSE: To evaluate the ophthalmologic conditions of patients with AIDS, with long-term follow-up, previously evaluated by an ophthalmologist, considering general conditions related with AIDS. METHODS: Observational study of 42 patients with AIDS divided into two groups: Group I: 8 patients with previous AIDS-related cytomegalovirus retinitis, Group II: 34 patients with AIDS without cytomegalovirus

  1. Potencialidades e espaços ao empreendedorismo

    Directory of Open Access Journals (Sweden)

    Adriano Lago

    2008-01-01

    Full Text Available A criação de negócios é apontada como uma das causas da prosperidade de um local, região, estado ou de um país. É neste sentido que o empreendedorismo tem recebido destaque nos últimos anos, como promotor de novos negócios. Captar, descrever e analisar o fenômeno do empreendedorismo é, portanto, necessário para o desenho de ações de promoção do desenvolvimento. Assim, o presente estudo aborda o empreendedorismo na piscicultura, tomando como base três casos analisados: uma propriedade com rizipiscicultura, uma com piscicultura de ciclo completo inclusive com frigorífico, e outra onde a piscicultura desenvolve-se através de um pesque-pague, com vistas a proporcionar o turismo rural. Para fins de pesquisa, entrevistaram-se os proprietários de cada estabelecimento na busca dos dados necessários para a construção de uma abordagem consistente da temática proposta, ou seja, identificar a presença do empreendedorismo e suas características particulares em cada propriedade analisada. Verificou-se que determinadas características empreendedoras são comuns aos três casos analisados: habilidade para identificar oportunidades; busca de conhecimento de sua área de atuação; senso de organização; disposição para tomar decisões; capacidade de liderança; talento para empreender; otimismo e tino empresarial; ser estrategista, além do dinamismo. Portanto, foi possível observar que o perfil empreendedor dos proprietários de cada negócio tornou possível a transformação de idéias e problemas em oportunidades reais de negócio.Abstract The business opening is indicated as one of the prosperity causes of a country, state, region or local. It’s in this context that the entrepreneurship has received attention along the last years as new business promoter. This way, to study and promote development actions it’s necessary, firstly, to get, to describe and to analyze the entrepreneurship phenomenon by itself. So, this study

  2. Contribuição ao estudo da Tripanosomiase Americana

    Directory of Open Access Journals (Sweden)

    Bichat de Almeida Rodrigues

    1942-01-01

    ano (época do estío. 6 Em plena mata, n’uma toca de tamanduá (T. tetradactylus foram encontradas larvas, ninfas e adultos de P. geniculatus. A casa situada mais próximo desse foco, foi a que apresentou maior infestação (22 exemplares e exclusiva para essa espécie. Em uma toca de macaco da noite (P. flavus, foi encontrada uma larva de Triatomídeo. Este foco também ficava próximo à casa acima referida. Em toca de P. flavus foi também achado um exemplar adulto de Panstrongylus refotuberculatus. 7 Amostras de S. cruzi isoladas de animais silvestres, mostraram fraco poder infectante. A amostra isolada do cão, embora infectando facilmente os animais de laboratório, pelos estudos biométricos feito por DIAS e FREITAS, afasta-se das amostras humanas típicas. 8 São discutidos os resultados acima referidos e, pelos hábitos dos transmissores, pela predominância de depositários silvestres do parasito, conclue-se pela natureza silvestre da Tripanosomiase Americana no local estudado. Se bem que não tenham sido verificadas infecções humanas, dado o encontro de um cão parasitado – infecção esta que se pode ter verificado pelo meio normal da transmissão da moléstia – admite-se a possibilidade do aparecimento de casos humanos nessa região. Ressalta-se a confirmação que tais resultados parecem trazer á hipótese de CARLOS CHAGAS, que pensava ser esta doença primitivamente silvestre, com posterior adaptação aos animais domésticos e ao homem.1 The epidemiology of Chagas’ disease was studied for the first time in a systematized work, in a district of the region of the Amazon estuary, whose ecological conditions differ from those encountered in other zones where similar researches have been made. 2 At the place chosen for the studies – Aurá – a locality about 10 kms from Belem (State of Pará, no human infection by S. cruzi has been found, either by blood examination or xenodiagnosis, both having been tried on all the inhabitants (117 people

  3. Análise da variabilidade da frequência cardíaca em cordeiros da raça Bergamácia, do nascimento aos 35 dias de idade

    Directory of Open Access Journals (Sweden)

    K. Koether

    2016-08-01

    Full Text Available RESUMO A atividade do sistema nervoso autônomo sobre o coração pode ser verificada pela variabilidade da frequência cardíaca (VFC, método que quantifica e assim infere sobre a modulação autonômica cardíaca, refletindo o funcionamento do sistema nervoso autônomo. Durante o período neonatal, diferenças significativas no que se refere à maturação autonômica são descritas em diversas espécies. Embora a espécie ovina venha sendo utilizada como modelo experimental em diversos protocolos em neonatologia e cardiologia em humanos, estudos descritivos sobre a VFC utilizando animais saudáveis e não sedados são escassos na literatura. O objetivo do estudo foi descrever a VFC em cordeiros da raça Bergamácia durante os primeiros 35 dias de idade. Foram realizados exames eletrocardiográficos em 20 cordeiros da raça Bergamácia a partir do nascimento e semanalmente até o 35° dia de idade. A VFC foi analisada pelo intervalo RR normal (batimentos sinusais, pela frequência cardíaca, pelo índice de tônus vasovagal (iTVV, pela raiz quadrada da média do quadrado das diferenças entre intervalos RR normais adjacentes (RMSSD e pela raiz quadrada da somatória do quadrado das diferenças dos valores individuais em relação ao valor médio, dividido pelo número de iR-R em 90 segundos - VFC global (RMSM. Todos os parâmetros se alteraram ao longo das semanas. A frequência cardíaca média elevou-se entre o nascimento e os primeiros sete dias de idade, com decréscimo nas quatro semanas subsequentes, sendo o menor valor encontrado aos 35 dias de idade (145,63±37,80bpm. Entre 21, 28 e 35 dias de idade, o iTVV elevou-se significativamente, o RMSM a partir do 28º dia, e, aos 35 dias, o RMSSD, reflexo da ativação parassimpática, exibiu diferenças em relação aos momentos subsequentes. O início da predominância parassimpática, refletida nos índices da VFC, particularmente o iTVV, ocorre aos 21 dias de idade. A partir dos 35 dias

  4. CLASSICAL AREAS OF PHENOMENOLOGY: Correcting dynamic residual aberrations of conformal optical systems using AO technology

    Science.gov (United States)

    Li, Yan; Li, Lin; Huang, Yi-Fan; Du, Bao-Lin

    2009-07-01

    This paper analyses the dynamic residual aberrations of a conformal optical system and introduces adaptive optics (AO) correction technology to this system. The image sharpening AO system is chosen as the correction scheme. Communication between MATLAB and Code V is established via ActiveX technique in computer simulation. The SPGD algorithm is operated at seven zoom positions to calculate the optimized surface shape of the deformable mirror. After comparison of performance of the corrected system with the baseline system, AO technology is proved to be a good way of correcting the dynamic residual aberration in conformal optical design.

  5. Lesão de mancha branca associada ao tratamento ortodôntico

    OpenAIRE

    Tambelli, Bianca

    2013-01-01

    Projeto de Pós-Graduação/Dissertação apresentado à Universidade Fernando Pessoa como parte dos requisitos para obtenção do grau de Mestre em Medicina Dentária O desenvolvimento de lesões de mancha branca em indivíduos submetidos ao tratamento ortodôntico com aparatologia fixa constitui um problema clínico importante. A inadequada higiene oral cria condições adicionais propícias ao aumento significativo da placa bacteriana ao redor dos suportes dos aparelhos fixos, fator este responsável pe...

  6. Fósforo num Cambissolo cultivado com cana-de-açúcar por longo tempo: I - fracionamento seqüencial Phosphorus in an Inceptsoil under long-term sugarcane: I - sequential fractionation

    Directory of Open Access Journals (Sweden)

    Jader Galba Busato

    2005-12-01

    Full Text Available A caracterização dos diversos compartimentos de P, além de avaliar frações não monitoradas regularmente pelos métodos de diagnose da fertilidade do solo, pode favorecer o entendimento do ciclo desse nutriente. O objetivo deste trabalho foi avaliar as alterações nos compartimentos de P de um Cambissolo Háplico Ta eutrófico vértico, cultivado com cana-de-açúcar por longo tempo. Em uma das áreas de estudo, não foi realizada a despalha da cana utilizando fogo por ocasião da colheita durante 55 anos. Em outra área, realizou-se a queima do canavial, mas, durante 35 anos, foram aplicados, via irrigação por aspersão, 120 m³ ha-1 ano-1 de vinhaça. Em duas áreas adjacentes a ambos os locais, foram coletadas amostras para efeito de comparação. As amostras foram coletadas em duas camadas (0-0,20 e 0,20-0,40 m e analisadas por meio de um procedimento de extração seqüencial de P. Foram determinados também os teores de P total, P disponível, P orgânico, P inorgânico e P nas substâncias húmicas. Os resultados deste trabalho indicam que o manejo da cana crua possibilitou maior conteúdo de P em todos os compartimentos analisados. A manutenção da palha e a adição de vinhaça alteraram a distribuição das frações de P no solo, com diminuição da participação das formas não-lábeis e conseqüente aumento das formas lábeis. Em todos os manejos observados, o teor de P no ácido húmico foi maior que no ácido fúlvico. O menor teor de P orgânico na cana crua evidenciou a participação desse componente na disponibilidade de P por meio de sua mineralização.The characterization of several soil phosphorus (P pools allowed the evaluation of P components not usually monitored in fertilizer soil tests and can help to understand this nutrient's cycle. The aim of this study was to evaluate the changes in P pools of a Fluventic Eutrochrepts fine clay which had been under long-time sugarcane plantation. In one situation the

  7. Tratamento artroscópico da instabilidade anterior traumática do ombro: resultados a longo prazo e fatores de risco Arthroscopic treatment of traumatic anterior instability of the shoulder: long term results and risk factors

    Directory of Open Access Journals (Sweden)

    Glaydson Gomes Godinho

    2008-05-01

    Full Text Available OBJETIVO: Avaliar os resultados de longo prazo e fatores de risco no tratamento cirúrgico por via artroscópica da instabilidade anterior traumática do ombro. MÉTODOS: Estudo retrospectivo de 302 pacientes (314 ombros. Seguimento de 24 a 140 meses, média de 76,5 meses. Avaliação através de exame físico e radiográfico. Classificação de resultados segundo os critérios da UCLA e Carter-Rowe. Análise estatística através de programa Epi Info e testes t de Student e exato de Fisher. RESULTADOS: Observado índice de recidivas em 8,9% dos ombros. Segundo a UCLA, excelentes/bons resultados observados em 97,6% e, regulares/ruins em 2,4% dos ombros. Segundo Rowe, excelentes/bons resultados em 89,2% e regulares/ruins em 10,8% dos ombros. Observada significância (p = 0,013 entre uso de materiais adequados, curva de aprendizado e índice de recidivas. História de convulsões (p = 0,0039 e prática de esportes de contato (p = 0,004 tiveram forte correlação com recidivas. Não se evidenciou correlação entre lesão de Bankart (p = 0,546, lesão de Hill-Sachs (p = 0,62 e recidivas, considerando-se lesões ósseas menores que 25% da glenóide e cabeça umeral, respectivamente. CONCLUSÕES: 1 Há correlação estatisticamente identificada entre o índice de recidiva da instabilidade anterior traumática do ombro e: a convulsões no pós-operatório; b prática de esportes de contato; c presença das lesões de Bankart com Hill-Sachs caracterizadas por 25% ou mais de lesão óssea da glenóide ou da cabeça umeral, respectivamente. 2 Parece haver correlação entre o não reparo da lesão SLAP e o índice de recidiva da instabilidade anterior traumática do ombro.OBJECTIVE: To evaluate the long term results and risk factors in the surgical arthroscopic treatment of the traumatic anterior instability of the shoulder. METHODS: Retrospective study of 302 patients (314 shoulders 24 to 140 month follow-up, with a mean of 76.5 months. Evaluation

  8. The human body in a microgravity environment: long term adaptations and countermeasures = O corpo humano em ambiente de microgravidade: adaptações à exposição de longo prazo e contramedidas

    Directory of Open Access Journals (Sweden)

    Carvil, Philip

    2013-01-01

    Full Text Available A gravidade tem tido um profundo efeito no desenvolvimento evolucionário humano, moldando sua anatomia e fisiologia. Dessa forma, os sistemas corporais, quando expostos à microgravidade, passam por adaptações consideráveis, como redução da massa osteomuscular e alterações na fisiologia cardiovascular. Proporcionar medidas específicas contra os efeitos da microgravidade é uma prioridade atual, que requer um somatório de ações, como exercícios físicos diários, centrifugação e o uso de trajes especiais. O traje de contramedida por recarga da gravidade (GLCS utiliza uma costura bidirecional que cria uma deformação no material, a qual gera uma carga que se acumula, progressivamente, em direção aos pés. Esses trajes vêm ganhando especial interesse por serem de baixo custo e de fácil utilização, bem como por possuírem uma massa pequena, que facilita seu transporte e armazenamento. Diversos aspectos dos estudos realizados com o GLCS são discutidos neste artigo. Recomendações para pesquisas futuras sobre os efeitos do uso crônico do GLCS na microgravidade e de sua potencial transferência para utilização em condições terrestres também é apresentada

  9. Soil phosphorus fractions in sandy soils amended with cattle manure for long periods Frações de fósforo em solos arenosos adubados com esterco por longos períodos

    Directory of Open Access Journals (Sweden)

    Sandra Regina da Silva Galvão

    2009-06-01

    Full Text Available Phosphorus fractions were determined in soil samples from areas fertilized or not with farmyard cattle manure (FYM and in samples of FYM used in the semi-arid region of Paraiba state, Brazil. Soil samples were taken from the 0-20; 20-40 and 40-60 cm layers of 18 cultivated areas, which, according to interviews with farmers, had been treated with 12 to 20 t ha-1 FYM annually, for the past 2 to 40 years. Soil samples were also collected from four unfertilized pasture areas as controls. Phosphorus in the soil samples was sequentially extracted with water (Pw, resin (Pres, NaHCO3 (Pi bic and Po bic, NaOH (Pi hid and Po hid, H2SO4 (Pacid and, finally, by digestion with H2SO4/H2O2 (Presd. Nine FYM samples were extracted with water, resin, Mehlich-1, H2SO4, NaOH or digestion with H2SO4/H2O2, not sequentially, and the extracts analyzed for P. The sampled areas had homogeneous, sandy and P-deficient soils; increases in total soil P (Pt above the mean value of the control areas (up to 274 mg kg-1 in the 0-20 cm layer of the most P-enriched samples were therefore attributed to FYM applications, which was the only external P input in the region. Regression analysis was used to study the relationship between soil P fractions and Pt. The Pacid fraction, related to Ca-P forms, showed the greatest increases (p Frações de P foram quantificadas em amostras de solo obtidas em áreas não adubadas e adubadas com esterco bovino e em amostras do esterco utilizado na região agreste do estado da Paraíba, Brasil. As amostras de solo foram coletadas nas camadas de 0-20, 20-40 e 40- 60 cm em 18 áreas agrícolas que, pelos históricos levantados junto aos agricultores, vinham recebendo entre 12 e 20 Mg ha-1 de esterco anualmente, por períodos variando entre 2 e 40 anos. Como controle, foram retiradas amostras de solo em quatro áreas sob pastagem sem histórico de adubação. O P nas amostras de solo foi sequencialmente extraído com água (Pw, resina (Pres, NaHCO3

  10. Uso do clorofilômetro no monitoramento nutricional de arroz irrigado com vistas ao manejo da adubação nitrogenada

    Directory of Open Access Journals (Sweden)

    Elisandra Pocojeski

    2015-06-01

    Full Text Available O clorofilômetro pode auxiliar no manejo da adubação nitrogenada em cobertura, não havendo, porém, um valor crítico de leitura que se correlacione com a produtividade de grãos. O objetivo deste trabalho foi monitorar o teor de nitrogênio (N, nas plantas de arroz irrigado dos cultivares IRGA 422CL e IRGA 424, com o uso do clorofilômetro, e associar as leituras com a produção de matérias verde e seca das plantas e com a produtividade de grãos. Foram desenvolvidos dois experimentos, nas safras 2007/08 e 2008/09, com doses N para a 1ª e 2ª adubação de cobertura, sendo, posteriormente, realizadas as leituras SPAD (Soil Plant Analysis Development e determinados a produção de matérias verde e seca, os teores de N no tecido das plantas e de N acumulado e a produtividade de grãos. Houve efeito da 1ª e 2ª aplicação de N nas leituras do clorofilômetro ao longo do ciclo, porém, as leituras SPAD tornaram-se semelhantes para todos os tratamentos com o passar do tempo. A produção de matérias verde e seca e de N acumulado responderam linearmente às doses de N. Não houve efeito de interação para as doses de N e produtividade de grãos, porém, a resposta de produtividade de grãos, em função das doses de N, obedeceu a uma relação quadrática, em ambos os experimentos. A leitura SPAD avalia o estado nutricional das plantas de arroz irrigado, mas não produz uma informação precisa sobre a necessidade de aplicação de N com reflexos na produtividade. Portanto, associá-la a outros parâmetros, como à produção de matérias verde e seca da planta pode auxiliar na interpretação e no ajuste da dose de N a ser aplicada em cobertura

  11. Mecanoreceptores da mucosa palatina de avestruz (Struthio camelus: estudo ao microscópio de luz Mechanoreceptors of the palatine mucosa of ostrich (Struthio camelus: light microscope study

    Directory of Open Access Journals (Sweden)

    Juliana P. Guimarães

    2007-12-01

    Full Text Available Foram estudados corpúsculos de Herbst da mucosa palatina de avestruz em nível de microscopia de luz. Os corpúsculos compõem-se de uma cápsula externa, cápsula interna e axônio central. A cápsula externa apresentou numerosas lamelas, enquanto que a cápsula interna mostrou estrutura de folhas compactas. Os corpúsculos apresentaram formato ovalado ou circular e circundado por espessos feixes de fibras colágenas. Cada lamela estava composta de uma densa rede de fibras espessas. Os axônios terminais estavam situados ao longo do eixo, terminando em um bulbo terminal. As fibras da cápsula externa, coradas por Picrosirius e examinadas no microscópio óptico sob luz polarizada, revelou a presença de fibras colágenas do tipo I em verde e na região periférica observou-se grande quantidade de fibras colágenas do tipo III. Os corpúsculos apresentaram-se envoltos por células planas e envoltos por fibras colágenas.Herbst corpuscles of the palatine mucosa of ostrich were studied by light microscopy. The corpuscles are composed of an outer core, inner core and central nerve terminal. The outer core presents numerous lamellae, while the inner core shows compact structure of cytoplasm sheets. The corpuscles are elongate or oval in shape and are surrounded by bundles of collagen fibers. Each lamella is composed of a dense network of thick fibrils. The terminal axons are located along the axis and form a bulb terminal. The fibers of external core stained by Picrosirius and examined by polarized light microscopy revealed to be green in color like type I collagen fibers, and at the periphery is a large amount of collagen type III. The corpuscles are surrounded by flat cells and dense collagen fibers at the periphery.

  12. Percepção do consumidor frente aos riscos associados aos alimentos, sua segurança e rastreabilidade

    Directory of Open Access Journals (Sweden)

    Juliana Cunha de Andrade

    2013-09-01

    mostrou relevante nos três grupos, pois esta deve contribuir para o recolhimento mais eficiente de produtos, caso seja necessário. No entanto, sob a ótica do consumidor, a rastreabilidade leva ao aumento dos preços, embora aumente a confiança em relação à segurança dos alimentos. Muitas das preocupações dos consumidores refletem as informações publicadas em revistas e jornais, como o caso da crença de que hormônios são utilizados na cadeia da carne de frango. Indústria e varejistas devem incrementar a comunicação de informações científicas sobre a segurança dos alimentos, contribuindo, assim, na educação do consumidor.

  13. Reliability and Reproducibility of the OTA/AO Classification for Humeral Shaft Fractures

    NARCIS (Netherlands)

    K.C. Mahabier (Kiran); E.M.M. van Lieshout (Esther); B.C. van der Schaaf (Boyd); G.R. Roukema (Gert); B.J. Punt (Bas); M.H.J. Verhofstad (Michiel); D. den Hartog (Dennis); H.W. Bolhuis (Hugo); P.K. Bos (Koen); M.W.G.A. Bronkhorst (Maarten); M.M.M. Bruijninckx (Milko); P.Th. den Hoed (Pieter); B.J. Dwars (Boudewijn); J.C. Goslings (Carel); R. Haverlag (Robert); M.J. Heetveld (Martin); A.J.H. Kerver (Albert J.H.); K.A. Kolkman (Karel); K. Leenhouts (Kees); R. Onstenk (Ron); H. Poeze; R.W. Poolman (Rudolf); W.H. Roerdink (Herbert); J.B. Sintenie (Jan Bernard); N.M.R. Soesman (Nicolaj); F.H.W.M. van der Heijden (Frank); P. van der Zwaal (Peer); J.P. van Dijk (Johannes); H.P.W. van Jonbergen; E.J.M.M. Verleisdonk (Egbert); J.P.A.M. Vroemen (Jos); M. Waleboer (Marco); W.P. Zuidema (Wietse)

    2017-01-01

    textabstractObjectives: This study aimed to determine interobserver reliability and intraobserver reproducibility of the OTA/AO classification for humeral shaft fractures, and to evaluate differences between fracture types, fracture groups, and surgical specializations. Methods: Thirty observers (25

  14. Additions to the marine algal flora of Curaçao, Netherlands Antilles

    NARCIS (Netherlands)

    Stegenga, H.; Vroman, M.

    1988-01-01

    Nine species of benthic marine algae are reported from the Caribbean island of Curaçao for the first time: Chlorophyta: Derbesia marina and Trichosolen longipedicellata; Phaeophyta: Ectocarpus rhodochortonoides, Feldmannia elachistaeformis, Hecatonema floridanum, Herponema tortugense and Sphacelaria

  15. Tense, But in the Mood: Diachronic Perspectives on the Representation of Time in Ao

    National Research Council Canada - National Science Library

    Coupe, Alexander R

    2013-01-01

    印度東北部的Ao 語呈現一些從類型學的角度來說很有意思的特徵,我們從這些特徵可以看到Ao 語時標誌歷史發展的一些線索。作者認為Ao 語原來有二元的語氣系統:實然 (realis) 和非實然 (irrealis),前者無標誌,後者有標誌。Ao 語把其中兩個名物化標誌的作用延伸到標記時的不同範疇,而原來的無標誌的實然範疇卻...

  16. Ciberespaço cubano: uma forma de resistência ao poder e à censura

    Directory of Open Access Journals (Sweden)

    Lia Hecker Luz

    2011-01-01

    Full Text Available A entrada do corpo e da vida nos cálculos do poder corresponde ao que Foucault chamou de biopolítica. Entretanto, o próprio Foucault intuiu que aquilo mesmo que o poder investia – a vida – era o que doravante ancoraria a resistência a ele. Assim, ao poder sobre a vida deveria responder a potência da vida, capaz de operar uma resistência possível ao sequestro da vida pelo poder. Apoiando-nos no pensamento de Lévy, levantamos a hipótese, a partir da análise do blog Generación Y, de que a blogosfera cubana é uma expressão micropolítica de resistência ao poder, de biopotência da multidão.

  17. Bicolumnar 90–90 plating of AO 13C type fractures

    National Research Council Canada - National Science Library

    Cemal Kural; Ersin Ercin; Mehmet Erkilinc; Evren Karaali; Mustafa Gokhan Bilgili; Suleyman Altun

    2017-01-01

    Objective: The aim of this study was to evaluate functional results and complication rate of patients who underwent medial-dorsolateral plating for intra-articular distal humeral fracture (Müller AO type 13C). Methods...

  18. Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses

    Directory of Open Access Journals (Sweden)

    Restle João

    2001-01-01

    Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.

  19. Attitude toward contraception and abortion among Curaçao women. Ineffective contraception due to limited sexual education?

    NARCIS (Netherlands)

    Brink, M.J.; Boersma, A.A.; Meyboom-deJong, B; Bruijn, de J.G.M.

    2011-01-01

    Background In Curaçao is a high incidence of unintended pregnancies and induced abortions. Most of the induced abortions in Curaçao are on request of the woman and performed by general practitioners. In Curaçao, induced abortion is strictly prohibited, but since 1999 there has been a policy of

  20. Te Ao Kori as Expressive Movement in Aotearoa New Zealand Physical Education Teacher Education (PETE): A Narrative Account

    Science.gov (United States)

    Legge, Maureen

    2011-01-01

    A unique aspect of Aotearoa/New Zealand physical education is the inclusion of Maori culture in the form of te ao kori. Te ao kori translates to mean the world of movement and is represented by the interpretation of indigenous movement, games and pastimes. Participation in te ao kori means the sports-based normative frame of reference for physical…

  1. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): Genotoxicity and sub-chronic studies

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.R.; Krul, C.A.M.; Koeman, J.H.; Speijers, G.J.A.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  2. Safety evaluation of pectin-derived acidic oligosaccharides (pAOS): genotoxicity and sub-chronic studies.

    NARCIS (Netherlands)

    Garthoff, J.A.; Heemskerk, S.; Hempenius, R.A.; Lina, B.A.; Krul, C.A.; Koeman, J.H.; Speijers, G.J.

    2010-01-01

    Pectin-derived acidic oligosaccharides (pAOS) are non-digestible carbohydrates to be used in infant formulae and medical nutrition. To support its safety, the genotoxic potential of pAOS was evaluated. pAOS was not mutagenic in the Ames test. Positive results were obtained in the chromosome

  3. Fatores associados ao baixo peso ao nascimento entre adolescentes no Sudeste do Brasil Factors associated with low birth weight among adolescents in the Brazil Southeast region

    Directory of Open Access Journals (Sweden)

    Fernanda Garanhani Castro Surita

    2011-10-01

    Full Text Available OBJETIVOS: Conhecer a prevalência e alguns fatores associados ao baixo peso ao nascer entre gestantes adolescentes. MÉTODOS: Estudo de corte transversal, realizado entre outubro de 1994 a dezembro de 2009, com os partos ocorridos em uma maternidade de Campinas, utilizando informações coletadas em uma Ficha Obstétrica Informatizada. Foram selecionados os casos de partos entre adolescentes e, posteriormente, separados em dois grupos com e sem baixo peso ao nascer. Foram calculados o risco relativo e o intervalo de confiança (IC de 95% para as variáveis independentes (fatores de risco, e calculou-se o teste do Χ2 para comparação dos resultados perinatais. Assumiu-se nível de significância de 5%. RESULTADOS: No período ocorreram 24.000 partos no Centro de Atenção à Saúde da Mulher (CAISM, com 2.404 em 2.357 adolescentes (10,02%, sendo a frequência de baixo peso ao nascer de 15,1%. A gestação neste grupo foi recorrente em 294 (8,2%. A idade menor que 15 anos, anemia, tabagismo e hipertensão não se associaram ao baixo peso ao nascer. O antecedente de aborto e a associação com lúpus eritematoso sistêmico elevaram o risco de baixo peso ao nascer. A necessidade de cesariana e o Apgar menor que sete também foram mais prevalentes entre as adolescentes com baixo peso ao nascer, e 85% das adolescentes realizaram menos de seis consultas durante o pré-natal. CONCLUSÕES: A prevalência de baixo peso ao nascer é maior entre as adolescentes do que na população geral. Também chamou a atenção o grande número de adolescentes com menos de seis consultas durante o pré-natal. O antecedente de aborto e a presença de lúpus eritematoso sistêmico foram fatores de risco para ocorrência de baixo peso ao nascer em gestantes adolescentes.PURPOSES: To determine the rate of low birth weight and some of the risk factors associated with this event among adolescents. METHODS: A cross-sectional study conducted between October 1994 and

  4. Functional analysis of AoAtg11 in selective autophagy in the filamentous fungus Aspergillus oryzae.

    Science.gov (United States)

    Tadokoro, Takayuki; Kikuma, Takashi; Kitamoto, Katsuhiko

    2015-07-01

    Autophagy is a highly conserved cellular degradation process in eukaryotes and consists of both non-selective and selective types. Selective autophagic processes include pexophagy, mitophagy, and the cytoplasm-to-vacuole targeting (Cvt) pathway of yeast, in which particular vacuolar proteins, such as aminopeptidase I (Ape1), are selectively transported to vacuoles. Although selective autophagy has been mainly studied in the yeasts Saccharomyces cerevisiae and Pichia pastoris, there is evidence for selective autophagy in filamentous fungi; however, the details are poorly understood. In S. cerevisiae, Atg11 is a selective autophagy-specific protein that recognizes and transports substrates to the pre-autophagosomal structure (PAS). Here, we first identified an ATG11 homologue in the filamentous fungus Aspergillus oryzae and analyzed the localization of the corresponding protein, designated AoAtg11, fused to enhanced green fluorescent protein (EGFP). Imaging analysis revealed that AoAtg11-EGFP was localized to PAS-like structures. We next constructed an Aoatg11 disruptant of A. oryzae and showed that AoAtg11 is involved in pexophagy and mitophagy. In addition, AoAtg11 was found to be dispensable for non-selective autophagy and for transporting AoApe1 to vacuoles. Taken together, these results suggest that AoAtg11 is a selective autophagy-specific protein in A. oryzae, and has distinct molecular functions from that of S. cerevisiae Atg11. Copyright © 2015 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  5. History of the AO and its global effect on operative fracture treatment.

    Science.gov (United States)

    Matter, P

    1998-02-01

    In 1958 a group of Swiss general and orthopaedic surgeons established the AO (Arbeitsgemeinschaft für Osteosynthesefragen) or the Association of the Study of Internal Fixation (ASIF) to strive to transform the contemporary treatment of fractures in Switzerland. This association was revolutionary in development of instruments and implants for operative fracture treatment. The first instructional course for teaching the use of these instruments and implants occurred in Davos, Switzerland, in the newly founded Laboratory of Experimental Surgery in 1960. Through a process of internal quality control (AO documentation) the clinical success of these new techniques and implants became evident. Operative fracture treatment gained acceptance throughout Europe and finally worldwide. AO/International (AOI) was founded in 1972 to expand education and the teaching programs for surgeons and operating personnel on an international basis. In 1984, the AO/ASIF Foundation was created with an AO Board of Trustees comprising 90 leading trauma surgeons from throughout the world. Continuous research, implant and instrument development, clinical documentation, and multifaceted educational opportunities are coordinated by the AO/ASIF Foundation to maintain its position as the international authority in the treatment of trauma. The medical community recognizes today the enormous positive global effect that this respected and ever changing organization has had by continually improving operative fracture treatment.

  6. Building a reliable, scalable and affordable RTC for AO instruments on ELTs

    Science.gov (United States)

    Gratadour, Damien; Sevin, Arnaud; Perret, Denis; Brule, Julien

    2013-12-01

    Addressing the unprecedented amount of computing power needed by the ELTs AO instruments real-time controllers (RTC) is one of the key technological developments required for the design of the next generation AO systems. Throughput oriented architectures such as GPUs, providing orders of magnitude greater computational performance than high-end CPUs, have recently appeared as attractive and economically viable candidates since the fast emergence of devices capable of general purpose computing. However, using for real-time applications a I/0 device which cannot be scheduled nor controlled internally by the operating system but is sent commands through a closed source driver comes with a number of challenges. Building on the experience of almost real-time end-to-end simulations using GPUs, and relying on the development of the COMPASS platform, a unified and optimized framework for AO simulations and real-time control, our team has engaged into the development of a scalable, heterogeneous GPU-based prototype for an AO RTC. In this paper, we review the main challenges arising when utilizing GPUs in real-time systems for AO and rank them in terms of impact significance and available solutions. We present our strategy, to mitigate these issues including the general architecture of our prototype, the real-time core and additional dedicated components for data acquisition and distribution. Finally, we discuss the expected performance in terms of latency and jitter on the basis of realistic benchmarks and focusing on the dimensioning of the MICADO AO module RTC.

  7. Aderência das Demonstrações Contábeis dos Fundos de Pensão do Brasil aos Padrões Contábeis Internacionais: Uma Análise Comparativa à Luz da IAS 26

    Directory of Open Access Journals (Sweden)

    Roswelton Anjos de Paula

    2014-08-01

    Full Text Available Apesar de o processo de convergência aos padrões internacionais provocar discussões nos vários ramos da Contabilidade, no Brasil os fundos de pensão devem observar um padrão contábil próprio, respeitando a independência patrimonial de todos os planos de benefícios dos fundos de pensão e identificando, separadamente, os planos previdenciais e assistenciais administrados pelas entidades fechadas de previdência complementar (EFPC. Com o intuito de verificar em que medida a elaboração das demonstrações contábeis das EFPC se encontra aderente aos padrões contábeis internacionais, foi efetuada uma análise comparativa entre os elementos que compõem as estruturas da Demonstração da Mutação do Ativo Líquido (DMAL, da Demonstração do Ativo Líquido (DAL e da Demonstração das Obrigações Atuariais do Plano de Benefícios (DOAP, definidas pelo padrão próprio brasileiro, e os elementos estabelecidos pela IAS 26 - Accounting and Reporting by Retirement Benefit Plans, que se aplica às demonstrações contábeis dos planos de benefícios, relatando e fornecendo informações aos participantes sobre os recursos e os benefícios do plano ao longo do tempo. Trata-se de um estudo de natureza exploratória, com abordagem qualitativa e coleta de dados realizada de forma essencialmente documental. A justificativa para o estudo está na percepção de que o desenvolvimento de um padrão próprio pode comprometer a inserção da Contabilidade dos fundos de pensão do Brasil nas melhores práticas internacionais, e inibir a participação de eventuais investidores na capitalização desses fundos. Os resultados mostram que as estruturas dos elementos que compõem as demonstrações contábeis desses fundos se encontram, em sua maior parte, aderentes ao disposto na IAS 26, sendo observadas, contudo, divergências de caráter formal nas estruturas das demonstrações contábeis e na mensuração a valor justo dos investimentos, pass

  8. Instrumento mensurador de adesao para hipertensos: contribuicao da Teoria da Resposta ao Item

    Directory of Open Access Journals (Sweden)

    Malvina Thais Pacheco Rodrigues

    2013-06-01

    Full Text Available OBJETIVO: Analisar instrumento de medição da adesão ao tratamento da hipertensão por meio da "Teoria da Resposta ao Item". MÉTODOS: Estudo analítico com 406 hipertensos com complicações associadas, atendidos na atenção básica em Fortaleza, CE, 2011, pela "Teoria da Resposta ao Item". As etapas de execução foram: teste de dimensionalidade, calibração dos itens; tratamento dos dados e construção da escala, analisadas com base no modelo de resposta gradual. Estudo da dimensionalidade do instrumento foi feito pela análise da matriz de correlação policórica e análise fatorial de informação completa. Utilizou-se o software Multilog para calibração dos itens e estimação dos escores. RESULTADOS: Os itens referentes ao tratamento medicamentoso foram os mais diretamente relacionados à adesão, enquanto aqueles referentes ao tratamento não medicamentoso precisam ser reformulados, pois possuíram menor quantidade de informação psicométrica e baixa discriminação. A independência dos itens, o reduzido número de níveis da escala e as baixas variâncias explicadas no ajuste dos modelos mostraram as principais fragilidades do instrumento analisado. A "Teoria da Resposta ao Item" mostrou-se relevante para análise, pois avaliou o respondente quanto à adesão ao tratamento da hipertensão, ao nível de dificuldade dos itens e à sua capacidade de discriminação entre indivíduos com diferentes níveis de adesão, o que gerou maior quantidade de informação. CONCLUSÕES: O instrumento analisado é limitado para medir a adesão ao tratamento da hipertensão, mediante análise pela "Teoria da Resposta ao Item", e necessita de ajustes. A adequada formulação dos itens é importante para medir precisamente o traço latente desejado.

  9. CONTROL TEST TO MICRO ACARID Aculops lycopersici (Massee, 1937 (ACARI: ERIOPHYIDAE ATTACKING TOMATO PLANT, USING A NEW ACARID-KILLER ENSAIO DE CONTROLE AO MICROÁCARO DO TOMATEIRO Aculops lycopersici (Massee, 1937 (Acari: Eriophyidae COM UM NOVO ACARICIDA

    Directory of Open Access Journals (Sweden)

    Roberto Magno de Castro e Silva

    2007-09-01

    aos 3, 7, 10, 14 e 21 dias após a aplicação, onde amostrou-se 10 folhas ao acaso, de 10 plantas das duas linhas centrais de cada parcela e contou-se o número de ácaros visando a uma área de 0,7 cm2/folha. Os resultados obtidos mostraram que o produto avermectin foi superior aos outros acaricidas, apresentando uma eficiência de controle de aproximadamente 95%, na menor dosagem, até 21 dias. O cyhexatin e o enxofre foram reduzindo sua eficiência ao longo do desenvolvimento do ensaio.

  10. Compilação de dados atômicos e moleculares do UV ao IV próximo para uso em síntese espectral

    Science.gov (United States)

    Coelho, P.; Barbuy, B.; Melendez, J.; Allen, D. M.; Castilho, B.

    2003-08-01

    Espectros sintéticos são utéis em uma grande variedade de aplicações, desde análise de abundâncias em espectros estelares de alta resolução ao estudo de populações estelares em espectros integrados. A confiabilidade de um espectro sintético depende do modelo de atmosfera adotado, do código de formação de linhas e da qualidade dos dados atômicos e moleculares que são determinantes no cálculo das opacidades da fotosfera. O nosso grupo no departamento de Astronomia no IAG tem utilizado espectros sintéticos há mais de 15 anos, em aplicações voltadas principalmente para a análise de abundâncias de estrelas G, K e M e populações estelares velhas. Ao longo desse tempo, as listas de linhas vieram sendo construídas e atualizadas continuamente, e alguns acréscimos recentes podem ser citados: Castilho (1999, átomos e moléculas no UV), Schiavon (1998, bandas moleculares de TiO) e Melendez (2001, átomos e moléculas no IV próximo). Com o intuito de calcular uma grade de espectros do UV ao IV próximo para uso no estudo de populações estelares velhas, se fazia necessário compilar e homogeneizar as diversas listas em apenas uma lista atômica e uma molecular. Nesse processo, a nova lista compilada foi correlacionada com outras bases de dados (NIST, Kurucz Database, O' Brian et al. 1991) para atualização dos parâmetros que caracterizam a transição atômica (comprimento de onda, log gf e potencial de excitação). Adicionalmente as constantes de interação C6 foram calculadas segundo a teoria de Anstee & O'Mara (1995) e artigos posteriores. As bandas moleculares de CH e CN foram recalculadas com o programa LIFBASE (Luque & Crosley 1999). Nesse poster estão detalhados os procedimentos citados acima, as comparações entre espectros calculados com as novas listas e espectros observados em alta resolução do Sol e de Arcturus, e uma análise do impacto decorrente da utilização de diferentes modelos de atmosfera no espectro sintético. Ao

  11. A exposição pré-natal ao álcool como fator de risco para comportamentos disfuncionais: o papel do pediatra Prenatal alcohol exposure as a risk factor for dysfunctional behaviors: the role of the pediatrician

    Directory of Open Access Journals (Sweden)

    Wakana Momino

    2008-08-01

    Full Text Available OBJETIVO: Ainda que as características clássicas da síndrome fetal alcoólica tenham sido descritas desde 1968, a pesquisa sobre a teratogênese do álcool apenas recentemente demonstrou que o cérebro é o órgão do corpo mais vulnerável aos efeitos da exposição pré-natal ao álcool. No presente artigo, fazemos uma revisão da literatura focalizando principalmente os distúrbios comportamentais relacionados à exposição pré-natal ao álcool. FONTES DOS DADOS: Foi realizada uma pesquisa com base no PubMed sobre a literatura publicada entre 1968 e 2006, com as palavras-chave etanol, gestação e comportamento. Foram estabelecidos limites a estudos em humanos. SÍNTESE DOS DADOS: Os dados apresentados nesta revisão sugerem que jovens com efeitos do espectro do álcool fetal estão sob risco maior de terem comportamento social disruptivo, entre outros problemas neurocomportamentais. CONCLUSÕES: Ainda que seja impossível separar completamente a teratogênese sobre o cérebro decorrente da exposição ao álcool de influências ambientais pós-natais como a causa definitiva desses resultados, o pediatra deve ser estimulado ao diagnóstico precoce de crianças afetadas pela síndrome fetal alcoólica e efeitos do espectro do álcool fetal. Isso permite iniciar o manejo e cuidados apropriados para evitar as conseqüências em longo prazo no comportamento e assegurar uma adaptação social e escolar melhor e mais produtiva.OBJECTIVE: Although the classic features of fetal alcohol syndrome have been recognized since 1968, research on alcohol teratogenesis has only recently demonstrated that the brain is the organ in the body most vulnerable to the effects of prenatal alcohol exposure. In this present article, we reviewed the literature focusing mainly on behavioral disturbances related to prenatal ethanol exposure. SOURCES: We performed a PubMed search on the literature published between 1968 and 2006 using the terms ethanol, pregnancy and

  12. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited].

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-05-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered.

  13. Review of adaptive optics OCT (AO-OCT): principles and applications for retinal imaging [Invited

    Science.gov (United States)

    Pircher, Michael; Zawadzki, Robert J

    2017-01-01

    In vivo imaging of the human retina with a resolution that allows visualization of cellular structures has proven to be essential to broaden our knowledge about the physiology of this precious and very complex neural tissue that enables the first steps in vision. Many pathologic changes originate from functional and structural alterations on a cellular scale, long before any degradation in vision can be noted. Therefore, it is important to investigate these tissues with a sufficient level of detail in order to better understand associated disease development or the effects of therapeutic intervention. Optical retinal imaging modalities rely on the optical elements of the eye itself (mainly the cornea and lens) to produce retinal images and are therefore affected by the specific arrangement of these elements and possible imperfections in curvature. Thus, aberrations are introduced to the imaging light and image quality is degraded. To compensate for these aberrations, adaptive optics (AO), a technology initially developed in astronomy, has been utilized. However, the axial sectioning provided by retinal AO-based fundus cameras and scanning laser ophthalmoscope instruments is limited to tens of micrometers because of the rather small available numerical aperture of the eye. To overcome this limitation and thus achieve much higher axial sectioning in the order of 2-5µm, AO has been combined with optical coherence tomography (OCT) into AO-OCT. This enabled for the first time in vivo volumetric retinal imaging with high isotropic resolution. This article summarizes the technical aspects of AO-OCT and provides an overview on its various implementations and some of its clinical applications. In addition, latest developments in the field, such as computational AO-OCT and wavefront sensor less AO-OCT, are covered. PMID:28663890

  14. A democratização da sociedade internacional e o Brasil: ensaio sobre uma mutação histórica de longo prazo (1815-1997

    Directory of Open Access Journals (Sweden)

    Paulo Roberto de Almeida

    1997-12-01

    Full Text Available Entre o Congresso de Viena, no qual estiveram representados apenas 8 Estados "cristãos", as conferências da paz da Haia e o tratado de Versalhes, que envolveram pouco mais de duas dezenas de países, e o atual sistema onusiano, praticamente universal, a sociedade internacional conheceu uma profunda democratização nos últimos dois séculos, mesmo se os fundamentos do poder não tenham conhecido modificação substancial. Esse fenômeno de ampliação da antiga "democracia censitária" é particularmente visível na elaboração de normas e instituições para o relacionamento econômico internacional, onde as organizações multilaterais de cooperação técnica desempenham relevante papel na construção da interdependência. Este ensaio histórico segue, na longa duração, a evolução do multilateralismo, fundamentalmente em sua vertente econômica, e examina a inserção internacional do Brasil, um dos poucos países da periferia a terem participado ativamente da construção da "ordem econômica internacional" em várias épocas, através de uma ativa participação nas mais diversas conferências multilaterais que presidiram ao nascimentos dessas organizações intergovernamentais de cooperação.From the Congress of Vienna, in which only 8 "Christian" states assisted, through the Hague Peace conferences and the Versailles treaty, mobilizing no more than two dozens countries, to the present UNO system, virtually universal, international society has undergone a deep democratization in the last two centuries, even if the sources of power and its distribution among countries have been substantially preserved. This process of enlargement of the old "feudatory democracy" is mostly evident in the institutional rule making for the international economic relations, where multilateral organizations for technical cooperation have a significat role in reinforcing the interdependence among states. This historical essay follows the evolution of

  15. Panencefalite subaguda esclerosante: transmissão de agente encefalitogênico humano ao macaco rhesus Subacute sclerosing panencephalitis: transmission of a human encephalitogenic agent to Macacus rhezus

    Directory of Open Access Journals (Sweden)

    Alexandre Alencar

    1971-12-01

    ônica" neuronal e espongiose cortical bem como pelo período longo de incubação, deva pertencer ao grupo dos chamados vírus lentos.Suspension of brain fragments obtained from a patient with subacute sclerosing panencephalitis (SSPE were inoculated intracerebrally in two rhesus monkeys. The animals remained apparently well for more than one year after inoculation. Signs of neurological involvement (paralysis of the posterior limbs with apathy and cachexia appeared respectively 21 and 22 months after inoculation. The animals were sacrified. At histological examination of the central nervous system marginal and white matter gliosis, and inflammatory perivascular cuffings were found; there was also proliferation of the perineural satelite glia with satelitosis in the brain stem. A discrete process of chronic myocarditis was observed on visceral examination. In one of these animals an acidophilic intranuclear inclusion was found. From these animals brain fragments were removed aseptically and inoculated intracerebrally in 4 others rhesus monkeys which, 2 to 3 months after inoculation, showed signs of central nervous system involvement similar to those observed in the first passage animals with a shorter incubation period. They were also sacrified. The histological examination showed lesions, similar to those found in the animals of the first passage, increased with cortical spongiosis. The lesions observed in the animals from the first passage and which were also present with more intensity and shorter incubation period in the second group of animals inoculated, seem to be produced by the so-called "slow viruses".

  16. Leptomeningeal dissemination of pilocytic astrocytoma at diagnosis in childhood: two cases report Disseminação leptomeníngea de astrocitoma pilocítico ao diagnóstico: relato de dois casos

    Directory of Open Access Journals (Sweden)

    Eberval Gadelha Figueiredo

    2003-09-01

    Full Text Available Pilocytic astrocytoma (PA is a benign tumor that rarely spread along the neuraxis. At the moment there are no more than five cases of leptomeningeal dissemination (LD from PA at diagnosis described in the literature. Different patterns of presentation or recurrence may be noted: local recurrence, malignant transformation, multicentric disease or metastatic disease. LD and multicentric disease can be distinct pathological entities. We report two cases and analyse literature, emphasizing leptomeningeal spread at presentation. Hydrocephalus, biopsy and parcial ressection are likely to be favorable factors to the occurrence of LD. Otherwise, LD may be part of natural history of PA, as evidenced by its ocurrence in non-treated cases.Astrocitoma pilocítico (AP é tumor benigno que raramente se dissemina ao longo do neuroeixo. Até o momento não há mais que cinco casos de AP que se tenham apresentado com disseminação leptomeníngea (DL descritos na literatura. Diferentes padrões de apresentação ou recorrência podem ser observados: recorrência local, transformação maligna, doença multicêntrica ou doença metastática. DL e doença multicêntrica podem ser entidades diferentes. Relatamos dois casos e analisamos a literatura. Hidrocefalia, biópsia e ressecção parcial são provavelmente fatores predisponentes à DL. Por outro lado, DL pode ser parte da história natural de AP, como pode ser evidenciado pela sua ocorrência em casos não tratados.

  17. Por que as pessoas recorrem ao Judiciário para obter o acesso aos medicamentos? O caso das insulinas análogas na Bahia

    OpenAIRE

    Lisboa, Erick Soares; Souza, Luis Eugenio Portela Fernandes de

    2017-01-01

    Resumo As insulinas análogas são alvo de controvérsias quanto à sua superioridade terapêutica em relação às humanas. Talvez, em parte, devido a isso, são objetos frequentes de ações judicias. A judicialização da saúde tem sido muito estudada, mas pouco se sabe sobre os motivos que levam as pessoas a recorrerem ao Judiciário para obter acesso a medicamentos no SUS. Sendo assim, o presente estudo tem por objetivo analisar os motivos que levaram as pessoas a recorrerem ao Judiciário para obter o...

  18. Dynamic SPECT of the brain using a lipophilic technetium-99m complex, PnAO

    DEFF Research Database (Denmark)

    Holm, S; Andersen, A R; Vorstrup, S

    1985-01-01

    The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-......AO has a high yet incomplete brain extraction yielding a flow dominated initial distribution with limitations mentioned.......The lipophilic 99mTc-labeled oxime propylene amine oxime (PnAO) should, according to recent reports behave like 133Xe in the human brain. This study compares SPECT images of the two tracers in six subjects: four stroke cases, one transitory ischemic attack case and one normal subject. Technetium-99......m PnAO was injected i.v. as a bolus of 15 to 25 mCi. The distribution was followed over 10-sec intervals using a highly sensitive, rapidly rotating SPECT (Tomomatic 64) and compared to 133Xe flow maps. Upon arrival of the PnAO bolus to the brain, a high uptake was found in brain tissue with high...

  19. Production of Alginate Oligosaccharides (AOS as Prebiotic Ingredients through by Alginate lyase enzyme

    Directory of Open Access Journals (Sweden)

    Fahriza Sri Afni

    2017-04-01

    Full Text Available Prebiotics is indigestible foods that can not be digested but can stimulate the growth and activity of bacteria in the digestive tract effecting human health. Alginate oligosaccharides (AOS can be used as a source of prebiotic. That compounds can be produced enzymatically by cutting long chain alginates using alginate lyase. The aim of this study was to produce alginate lyase enzyme then producing Alginate oligosaccharides (AOS as a prebiotic ingredients. The alginate lyase enzyme can be produced from Bacillus megaterium bacteria using a discontinuous fermentor. The enzyme was  optimum temperature of 45°C and an optimum pH of 7.0. Alginate oligosaccharides production was performed with the addition of different enzyme concentrations 25, 50, 75, and 100 U. The result of the addition of enzyme (25, 50,75 U showed that the value of polymerization degrees (DP were between 4-5. However, the addition of enzyme (100 U was in the range of  DP 3-4. Bacterial probiotic growth test results of Bifidobacteria and Lactobacillus showed that 1% added AOS media were able to increase the growth of probiotic bacteria compared to themedia without addition of AOS. The addition Alginate lyase activity of 50 U in AOS production is the best treatment of both probiotic bacteria.

  20. Relationship between winter AO/NAO and temperature in China: intraseasonal and interdecadal variations

    Science.gov (United States)

    Ren, Hong-Li; Zuo, Jinqing; Li, Weijing

    2017-04-01

    In this study, we focus on the intraseasonal and interdecadal variations in the relationship between winter AO/NAO (Arctic Oscillation / North Atlantic Oscillation) and surface air temperature (SAT) in China. On one hand, our results show that there is an intraseasonal contrast in impacts of AO/NAO on SAT in the central-southern China between early and mid-late winter. The linkage between AO and central-southern China SAT strongly depends on the AO-associated changes in Middle-East Jet Stream (MEJS) and the AO-MEJS relationship is significantly different between early and mid-late winter. On the other hand, our results also clearly show that inter-decadal changes have occurred in the relationship between the winter NAO and southern China surface air temperature anomalies in the past decades. A weak in-phase relationship occurred before the early 1970s, but a significant out-of-phase relationship dominated during 1979-1998, though it has been clearly weaker from the late 1990s onwards. Observational evidence shows that such interdecadal variations are mainly related to variations in the spatial pattern and amplitude of the NAO. The eastward shift and amplitude intensification of the NAO favored a north-south Asian dipole structure of circulation anomalies, which tended to produce cold SAT anomalies in central-southern China in the positive NAO phase and warm in the negative NAO phase.

  1. Toward an experimental validation of new AO concepts for future E-ELT instrumentation

    Science.gov (United States)

    El Hadi, K.; Fusco, T.; Le Roux, B.

    2012-07-01

    For the last few years, LAM has been carrying out several R&D activities in Adaptive Optics (AO) instrumentation for Extremely Large Telescopes (ELTs). In the European ELT framework, a multi-purpose AO bench is developed to allow the experimental validation of new instrumental concepts dedicated to the next generation of ELTs. It is based on the use of a Shack-Hartmann wave-front sensor in front of a 140 actuators micro-deformable mirror (Boston Micromachines), dedicated to “low orders” modes, while a Pyramid wave-front sensor (PWFS) will be combined to a Liquid Crystal Spatial Light Modulator for “high orders” correction. Both systems could be merged in a two stages AO concept allowing to study the coupling of a telescope pre-correction using a dedicated large M4 deformable mirror and a post focal high order AO system. Analysis and optimisation of the spatial and temporal splits of the AO correction between the two systems is therefore essential. Finally, we will use the world’s fastest and most sensitive camera system OCAM (developed at LAM) coupled with the pyramid , to demonstrate the concept of a fast and hyper-sensitive PWFS (up to 100x100 sub-pupils) dedicated to the first generation instruments for ELTs.

  2. Fatores sócio-econômicos relacionados ao risco nutricional e sua associação com a freqüência de defeitos do esmalte em crianças da cidade de João Pessoa, Paraíba, Brasil Socioeconomic factors, nutritional risk, and enamel defects in children from João Pessoa, Paraíba State, Brazil

    Directory of Open Access Journals (Sweden)

    Andreza Cristina de Lima Targino Massoni

    2007-12-01

    Full Text Available O objetivo deste estudo foi verificar fatores associados ao risco nutricional ao longo do primeiro ano de vida em crianças de baixo nível sócio-econômico de João Pessoa, Paraíba, Região Nordeste do Brasil. E determinar a freqüência de defeitos do esmalte, associando-a ao risco nutricional. O estudo foi realizado com 117 crianças, 56 com risco nutricional e 61 eutróficas. Em domicílio, realizaram-se avaliação nutricional, exame clínico dos elementos dentais e entrevistas com as mães. Na maternidade, registraram-se informações dos períodos gestacional e de nascimento. Utilizaram-se os testes qui-quadrado, exato de Fisher e modelos de regressão logística. Os defeitos do esmalte estiveram associados ao risco nutricional após o primeiro ano de vida. O risco nutricional esteve associado à renda per capita, condições de peso ao nascimento e índice de crescimento intra-uterino. Conclui-se que na amostra investigada os defeitos do esmalte estiveram associados ao risco nutricional e este às condições sócio-econômicas desfavoráveis durante a gestação e o nascimento, sugerindo que estes são fatores relevantes na programação nutricional do indivíduo e na formação do esmalte dentário.This study focused on factors related to nutritional risk in children over one year of age from low-income families in João Pessoa, Paraíba State, Northeast Brazil, and the frequency of related enamel defects. The study included 117 children, 56 at nutritional risk and 61 with normal growth. Nutritional evaluation, clinical dental examination, and interviews with mothers were conducted at the homes. Gestational and birth records were examined in the maternity hospital. Data were analyzed using the chi-square, Fisher's exact tests, and logistic regression. Enamel defects were associated with nutritional risk after the first year of life. Nutritional risk was associated with per capita family income, birth weight, and intrauterine growth

  3. Cantaria em louvação ao dia do Barroco Mineiro e homenagem ao poeta e ensaísta Affonso Ávila

    Directory of Open Access Journals (Sweden)

    Cristina Ávila

    2013-12-01

    Full Text Available É com profunda comoção que, em nome de minha família, agradeço a prestigiosa homenagem concedida pela Pontifícia Universidade Católica de Minas Gerais – PUCMinas e pela Assembleia Legislativa do Estado de Minas Gerais ao reconhecido e saudoso poeta e ensaísta do Barroco Mineiro, Affonso Ávila. O convite para a participação neste debate acadêmico, feito ao próprio homenageado pela Prof. Dra. Melânia da Silva Aguiar, foi recebido por ele com enorme entusiasmo, mas quis o destino que ele se fosse antes da data prevista. Como historiadora da arte e cultura estou presente apenas para contemplar alguns aspectos de sua obra, especialmente no que se refere aos estudos de Barroco, mas não posso substituir o depoimento do ensaísta que seria, com certeza, bem mais interessante.

  4. Práticas educativas maternas e paternas aos 24 e aos 72 meses de vida da criança

    Directory of Open Access Journals (Sweden)

    Angela Helena Marin

    Full Text Available Este estudo investigou as práticas educativas indutivas, coercitivas e de não interferência maternas e paternas aos 24 e 72 meses de vida da criança. Participaram 24 mães e pais de um único filho/a, que responderam uma entrevista para avaliação dessas práticas. Análises estatísticas revelaram que as mães foram significativamente mais indutivas que os pais aos 24 meses, mas aos 72 meses não houve diferenças. Enfatiza-se que as mães tendem a conversar mais com seus filhos/as, expressar sentimentos, opiniões, estabelecer limites e elogiar comportamentos adequados. As mães também apresentaram médias mais elevadas no total de práticas relatadas, o que pode ser explicado pelo papel predominante que ainda exercem na socialização infantil, embora os pais venham participando mais da educação dos filhos/as.

  5. Propriedades redox de ácidos húmicos isolados de um solo cultivado com cana-de-açúcar por longo tempo Redox properties of humic acids isolated from a soil Under long-term sugarcane cultivation

    Directory of Open Access Journals (Sweden)

    Marihus Altoé Baldotto

    2008-06-01

    Full Text Available A matéria orgânica do solo é o maior reservatório de C nos sistemas naturais. Em tais sistemas a qualidade e a estabilidade do C podem ser estimadas pelo aumento da concentração das frações humificadas que, dentre outros fatores, está condicionada ao balanço entre as perdas e os ganhos que envolvem as reações de oxidação e de redução da matéria orgânica do solo. O objetivo deste estudo foi avaliar a eletroquímica, usando titulações redox iodimétricas, de ácidos húmicos isolados de solos cultivados continuamente com cana-de-açúcar submetida ou não à queima da palha para a colheita ou à adição anual de vinhaça. Os ácidos húmicos apresentaram valores do potencial formal padrão do eletrodo entre 0,760 e 0,779 V a 25 ºC. A capacidade de oxidação dos ácidos húmicos variou de 1,01 a 3,44 mol c kg-1 a pH 5,0 e de 1,64 a 6,44 molc kg-1 a pH 7,0. Observou-se correlação positiva e significativa entre a capacidade de oxidação dos ácidos húmicos e suas concentrações de grupos funcionais fenólicos, quinonas e semiquinonas.Soil organic matter is the largest carbon reservoir in natural systems. In such systems the carbon quality and stability can be estimated based on the increase of humified fractions which, among other factors, is related to the balance between losses and accumulations involving oxidation and reduction reactions of the soil organic matter. The objective of this study was to evaluate the electrochemistry of humic acids isolated from soils cultivated continually with sugar-cane, with or without pre-harvest burning and annual vinasse application using iodimetric redox titrations. The formal electrode potentials of the humic acids had a similar pattern, with values between 0.760 and 0.779 V, at 25 ºC. The oxidation capacity of humic acids varied from 1.01 to 3.44 mol c kg-1 at pH 5.0 and from 1.64 to 6.44 mol c kg-1 at pH 7.0. Positive and significant correlations were observed between the

  6. Intravenous methylprednisolone in HTLV-I associated myelopathy/tropical spastic paraparesis (HAM/TSP Metilprednisolona endovenosa na mielopatia associada ao HTLV-I/Paraparesia Espástica Tropical (MAH/PET

    Directory of Open Access Journals (Sweden)

    Abelardo Q-C Araújo

    1993-09-01

    Full Text Available HTLV-I (Human T-lymphotropic virus type I associated myelopathy/tropical spastic paraparesis (HAM/TSP is an immunomediated myelopathy induced by the HTLV-I. Some patients, specially those from Japan, seem to have a good response to steroid treatment. However, this has not been found in other regions of the world. High dose intravenous methylprednisolone has been used with success in patients with relapses of multiple sclerosis (MS, another autoimmune disease of the central nervous system. To test the effectiveness of methylprednisolone in patients with HAM/TSP, we devised an open trial in 23 patients. We found a very limited benefit of this form of treatment in these patients. Only one patient, who had the shortest disease duration (five months in the whole group, showed a sustained benefit. We speculate that those patients with a shorter history, with presumably less demye-lination and more inflammatory lesions, would show a better response to immunossupressive treatments.A mielopatia associada ao protovírus T-linfotrópico humano (HTLV-I, também conhecida como paraparesia espástica tropical associada ao HTLV-I (MAH/PET, constitui enfermidade imunomediada desencadeada pela infecção pelo HTLV-I. Nesta condição tem sido demonstrada, particularmente em pacientes japoneses, boa resposta clínica à terapêutica com corticosteróides. Este efeito benéfico todavia não foi encontrado em todas as regiões do mundo. Pulsoterapia com metilprednisolona endovenosa tem sido utilizada com sucesso em pacientes com esclerose múltipla, outro exemplo de doença auto-imune do sistema nervoso central, especialmente durante as fases de exacerbação da doença. Objetivando testar a eficácia da pulsoterapia com metilprednisolona em pacientes com MAH/PET, conduzimos estudo aberto em 23 doentes. Não constatamos efeito benéfico significativo desta forma de tratamento na maioria dos enfermos estudados. Apenas um dos pacientes, o qual exibia o menor tempo de

  7. Adesão ao tratamento da dor crônica: estudo de variáveis demográficas, terapêuticas e psicossociais Compliance with chronic pain treatment: study of demographic, therapeutic and psychosocial variables

    Directory of Open Access Journals (Sweden)

    Geana Paula Kurita

    2003-06-01

    Full Text Available Os objetivos deste estudo foram identificar a prevalência da adesão ao tratamento medicamentoso em pacientes com dor crônica, e analisar as relações entre adesão e características do tratamento medicamentoso e fatores psicossociais (crenças frente à dor, locus de controle da saúde e depressão. Trinta indivíduos foram avaliados 5 vezes durante 6 meses. Adesão plena ocorreu entre 43,3% e 56,7% dos pacientes. A adesão parcial e a não adesão foram altas (40,0%-56,7%. Os índices de adesão não variaram ao longo de seis meses. Menor adesão relacionou-se à ocorrência de efeitos colaterais e às crenças de que o controle da saúde dependia de si próprio, de que dor é incapacitante, de que dor indica a presença de dano físico e de que comportamentos de solicitude de outrem quando há manifestação de dor são desejáveis. Conhecer os fatores envolvidos na adesão permite testar intervenções que a otimizem.The aims of this study were to identify the prevalence of compliance with drug therapy in patients with chronic pain and analyze the relationships between compliance and characteristics of drug therapy and psychosocial factors (beliefs regarding pain, health locus of control and depression. Thirty patients were evaluated 5 times over a period of 6 months. Total compliance occurred in 43.3% to 56.7% of the patients. Partial compliance and non-compliance were high (40.0%-56.7%. The index of compliance did not vary over the six months. Low compliance related to occurrence of side effects and beliefs that the control of health depended on the patient, pain is a disability, that pain means the presence of physical injury and solicitous behavior of others is desirable when there is manifestation of pain. Knowing the factors involved in compliance enables us to test interventions that optimize it.

  8. Exercício físico como fator de prevenção aos processos inflamatórios decorrentes do envelhecimento Physical exercise as a preventive procedures inflammation of aging

    Directory of Open Access Journals (Sweden)

    Ciro José Brito

    2011-09-01

    Full Text Available Ao longo do processo de envelhecimento observa-se complexa remodelagem do sistema imunitário. Estas alterações estão associadas ao desenvolvimento de patologias responsáveis por grande parte da mortalidade em população idosa. Recentemente, a prática regular de atividades físicas tem sido proposta como intervenção não-medicamentosa com amplos benefícios sobre a regulação de processos decorrentes da imunossenescênia. Neste sentido, o presente trabalho revisou e discutiu estudos que abordam a ação de mediadores pró-inflamatórios crônicos e possíveis ações do exercício físico como agente antiinflamatório. Baseado nos resultados de estudos na literatura sugere-se que, em conjunto, a interleucina-6 (IL-6 e o fator de necrose tumoral-α (TNF- α são as principais citocinas associadas à aterosclerose, sarcopenia e déficits cognitivos. Embora os mecanismos não sejam totalmente elucidados, o exercício reduz a atividade de citocinas pró-inflamatórias e aumenta a liberação de substancias anti-inflamatórias.During the aging is observed complex remodeling of immune system. These changes are associated with the development of diseases responsible for much of the mortality in the elderly. Recently, the regular practice of exercise has been proposed as an intervention non-medication with broad benefits on regulation processes arising from Immunosenescence. In sense, this paper reviewed and discussed studies addressing the action of pro-inflammatory mediator's chronic and possible actions of physical exercise as anti-inflammatory agent. Based on the results of studies in the literature suggest that, together, interleukin-6 (IL-6 and tumor necrosis factor-α (TNF-α are the main cytokines associated with atherosclerosis, sarcopenia and cognitive deficits. Though mechanisms are not fully elucidated, the Exercise reduces the activity of pro-inflammatory and increases the release of anti-inflammatory substances.

  9. Up-Regulated Expression of AOS-LOXa and Increased Eicosanoid Synthesis in Response to Coral Wounding

    Science.gov (United States)

    Lõhelaid, Helike; Teder, Tarvi; Tõldsepp, Kadri; Ekins, Merrick; Samel, Nigulas

    2014-01-01

    In octocorals, a catalase–like allene oxide synthase (AOS) and an 8R-lipoxygenase (LOX) gene are fused together encoding for a single AOS-LOX fusion protein. Although the AOS-LOX pathway is central to the arachidonate metabolism in corals, its biological function in coral homeostasis is unclear. Using an acute incision wound model in the soft coral Capnella imbricata, we here test whether LOX pathway, similar to its role in plants, can contribute to the coral damage response and regeneration. Analysis of metabolites formed from exogenous arachidonate before and after fixed time intervals following wounding indicated a significant increase in AOS-LOX activity in response to mechanical injury. Two AOS-LOX isoforms, AOS-LOXa and AOS-LOXb, were cloned and expressed in bacterial expression system as active fusion proteins. Transcription levels of corresponding genes were measured in normal and stressed coral by qPCR. After wounding, AOS-LOXa was markedly up-regulated in both, the tissue adjacent to the incision and distal parts of a coral colony (with the maximum reached at 1 h and 6 h post wounding, respectively), while AOS-LOXb was stable. According to mRNA expression analysis, combined with detection of eicosanoid product formation for the first time, the AOS-LOX was identified as an early stress response gene which is induced by mechanical injury in coral. PMID:24551239

  10. Physical properties of the Algol-type eclipsing binary AO Ser

    Science.gov (United States)

    Chehlaeh, N.; Lampens, P.; Mkrtichian, D.; Van Cauteren, P.; Vermeylen, L.; Komonjinda, S.

    2017-09-01

    We present the results of a combined analysis of photometric time series and spectroscopic observations for the semi-detached eclipsing binary AO Ser aimed to study physical parameters of the system. New CCD photometric light curves in the B and V bands and radial velocities of AO Ser are presented. The Wilson-Devinney technique was used to simultaneously analyze the light and radial velocity curves for determining a new set of the system’s parameters. The solution shows that AO Ser is a semi-detached eclipsing binary system with a mass ratio of 0.183 ± 0.003, an inclination of 89.42 ± 0.04 degrees and a secondary star’s temperature of 4900 K.

  11. A Arqueologia do cuidado: da prática ao discurso

    Directory of Open Access Journals (Sweden)

    Sidi Askofare

    2006-06-01

    Full Text Available A noção de cuidado, assimilada há muito tempo ao tratamento e, então, ao conceito de terapêutica, retorna, logo depois, nos estudos, pesquisas e reflexões nas ciências humanas. Mas, daí em diante, está emancipado de suas aderências e conotações médicas por serem demasiadamente redutoras. O presente artigo propõe uma arqueologia (no sentido foucaultiano do cuidado &– de suas origens animais às suas formas culturalmente e historicamente definidas &– e põe em evidência a subversão que produz no campo do cuidado &– das práticas aos discursos &– a emergência e a dominação do discurso da ciência.

  12. O Ocaso da Utopia Telecomunicacional: regular para quem no tocante ao Direito Fundamental à Privacidade?

    Directory of Open Access Journals (Sweden)

    Conselho Editorial

    2014-05-01

    Full Text Available O presente estudo figura como introdução à Revista de Direito, Estado e Telecomunicações do Grupo de Estudos em Direito das Telecomunicações da Universidade de Brasília, abordando sinteticamente a estrutura, conteúdo e política editorial da revista. Em acréscimo, o texto analisa os principais acontecimentos do setor no Brasil, bem como normas e julgados relativos ao ano de 2013, para registro das principais discussões político-jurídicas do setor de telecomunicações brasileiro referentes ao ano anterior ao da publicação.

  13. ESTUDO DE PROBLEMAS DE ENFERMAGEM REFERENTES AO CABELO E COURO CABELUDO EM PACIENTES HOSPITALIZADOS

    Directory of Open Access Journals (Sweden)

    Maria Romana Friedlander

    Full Text Available A autora procurou identificar os tipos e os problemas de enfermagem referentes ao cabelo e couro cabeludo, apresentados por pacientes internados em clínicas médicas e cirúrgicas gerais de um hospital governamental de ensino. Identificou 4 classes de problemas: estado de limpeza, lesões, infestações e penteação. Cada classe foi subdividida em graus os quais foram denominados tipos de problemas. A proporção de problemas por paciente encontrada foi 0,80 e a proporção de pacientes com problemas foi 58%. Foram também estudadas algumas condições que podem intervir no cuidado ao cabelo e ao couro cabeludo e foram obtidas informações sobre hábitos e costumes apresentados pelos pacientes.

  14. Falência ovariana precoce associada a deleção no braço longo do cromossomo: relato de dois casos e revisão da literatura Premature ovarian failure with a deletion in the long arm of chromosome: report of two cases and review of the literature

    Directory of Open Access Journals (Sweden)

    Mariangela Badalotti

    2006-09-01

    Full Text Available Falência ovariana prematura pode ser idiopática ou estar associada a várias distúrbios auto-imunes ou genéticos, como as deleções do cromossomo X. Relatamos dois novos casos de deleções do braço longo do cromossomo X, em pacientes nuligrávidas apresentando amenorréia secundária e infertilidade. Nenhuma paciente referia história familiar de falência ovariana prematura e relatavam desenvolvimento puberal normal. A avaliação genética mostrou deleção distal no braço longo do cromossomo X, sendo os resultados 46,X,del(Xq22 e 46,X,del(Xq13q28, respectivamente. Após o diagnóstico as pacientes optaram por fertilização in vitro com óvulos doados.Premature ovarian failure may be idiopathic or associated with several autoimmune and genetic disorders as X chromosome deletions. We report two cases of preamture ovarian failure associated with a deletion in the long arm of X chromosome. Both patients were nulligravidas presenting secondary amenorrhea and complaints of infertility, without family history of premature ovarian failure and reporting normal puberal development. Their karyotypes showed deletions of the distal long arm of all X chromosomes and were 46,X, del(Xq22 and 46,X, del(Xq13q28, respectively. After the diagnosis the patients decided to be submitted to an in vitro fertilization with egg donation.

  15. Obtenção de plantas de feijão-caupi resistentes ao Cowpea severe mosaic virus e ao Cowpea aphid-borne mosaic virus

    Directory of Open Access Journals (Sweden)

    Gislanne Brito Barros

    2013-06-01

    Full Text Available Dentre os vírus que infectam o feijão-caupi (Vigna unguiculata L. Walp. destacam-se, respectivamente, pela severidade e ampla ocorrência o Cowpea severe mosaic virus (CPSMV e o Cowpea aphid-borne mosaic virus (CABMV. Portanto, objetivaram-se, no presente trabalho, obter e avaliar plantas de feijão-caupi com resistência ao CPSMV e ao CABMV, visando ao desenvolvimento de cultivares essencialmente derivadas e novas cultivares. Realizaram-se oito cruzamentos seguidos de retrocruzamentos, utilizando a linhagem TE 97-309G-9 e a cultivar Patativa como genitores resistentes, e as cultivares BR3-Tracuateua, BRS-Urubuquara, BRS-Novaera, BRS-Guariba e Pretinho como genitores suscetíveis. As gerações F2 e F2RC1 foram desafiadas quanto à resistência por meio de inoculação mecânica com isolados do CPSMV e do CABMV. Nas gerações F2RC1, além da resistência foram avaliados os caracteres: número de dias para o início da floração, comprimento das vagens, número de grãos. vagem-1, peso de cem grãos e produção de grãos.planta-1. Todos os indivíduos F2 e F2RC1 foram analisados pelo teste χ² e se ajustaram à frequência esperada de 15 plantas suscetíveis 1 planta resistente a ambos os vírus. As médias das plantas F2RC1 resistentes, de cada retrocruzamento, foram comparadas com a média do seu respectivo genitor recorrente pelo teste 't' e as médias dos retrocruzamentos foram comparadas pelo teste de Scott-Knott. Foi detectada variabilidade genética entre os retrocruzamentos para todos os caracteres. Todos os retrocruzamentos foram considerados promissores para produção de cultivares essencialmente derivadas resistentes ao CPSMV e ao CABMV e as plantas selecionadas possuem características que possibilitam a seleção de linhagens com grãos de bom padrão comercial e altamente produtivas.

  16. Fatores associados ao tempo de espera e ao acesso ao transplante renal em Belo Horizonte, Minas Gerais, Brasil Factors associated with waiting time and access to kidney transplants in Belo Horizonte, Minas Gerais State, Brazil'

    Directory of Open Access Journals (Sweden)

    Elaine Leandro Machado

    2012-12-01

    Full Text Available O objetivo deste artigo foi analisar os fatores associados ao acesso ao transplante renal com doador vivo e cadáver em Belo Horizonte, Minas Gerais, Brasil. Foi realizado um estudo de coorte não concorrente com pacientes inscritos na lista de espera por transplante renal, entre 2000 e 2004, os quais foram acompanhados até o transplante, óbito, exclusão ou permanência na fila de espera ao fim do estudo em 31 de dezembro de 2005. Utilizou-se o modelo de Cox para riscos competitivos. Dos 835 pacientes, 22,7% foram transplantados. Apresentaram menor risco de transplante por doador cadáver e vivo os pacientes com maior tempo em diálise e tipo sanguíneo O. Observou-se menor risco de transplante intervivos para residentes em uma área de alto risco à saúde e portadores de diabetes. A maior disparidade de acesso foi para transplante renal intervivos, uma vez que não houve diferenças sociodemográficas significativas para transplante por doador cadáver. Pode-se inferir que o sistema de alocação de órgãos contribuiu para amenizar desigualdades sociodemográficas, sendo as questões clínicas mais relevantes no acesso ao transplante com doador cadáver.The objective of this study was to analyze factors associated with access to kidney transplants from living and cadaver donors in Belo Horizonte, Minas Gerais State, Brazil. The authors conducted a non-concurrent cohort study of patients on the waiting list for kidney transplants from 2000 to 2004 and followed until transplantation, death, exclusion, or continued presence on the line at the end of the study on December 31, 2005. The Cox model was used for competing risks. Of the 835 patients, 22.7% were transplanted. Lower risk of transplantation from living donors and cadavers was observed in patients with more time on dialysis and blood type O. Lower risk of transplantation from living donors was observed in residents in a high health risk area and in recipients with diabetes. The

  17. Facilitadores e barreiras de retorno ao trabalho de trabalhadores acometidos por LER/DORT

    Directory of Open Access Journals (Sweden)

    Jorge Henrique Santos Saldanha

    Full Text Available INTRODUÇÃO: As Lesões por Esforços Repetitivos/Distúrbios Osteomusculares Relacionados ao Trabalho (LER/DORT causam afastamento do trabalho de uma grande parcela de trabalhadores. OBJETIVO: Entender e sistematizar de que forma os fatores relacionados ao retorno ao trabalho (RT de trabalhadores acometidos por LER/DORT são descritos na literatura como facilitadores ou barreiras. MÉTODOS: Revisão crítica de literatura do período de janeiro de 2005 a outubro de 2010 disponível nas bases Lilacs, MedLine e SciELO. As informações foram sistematizadas em três categorias de fatores que influenciam o RT e como facilitadores ou barreiras - de ordem pessoal, de ordem organizacional e relacionadas às características dos serviços, sistemas e políticas. RESULTADOS: Dos 633 artigos inicialmente levantados, 21 atenderam aos critérios de inclusão. Fatores identificados como mais relevantes: de ordem pessoal - dor, fatores psicossociais, afastamento do trabalho; organizacionais - modificações nos postos de trabalho, demanda psicológica do trabalho, apoio organizacional, apoio de colegas e da chefia; relacionados aos serviços, sistemas e políticas - programa de retorno ao trabalho, tempo de afastamento e serviços de apoio. CONCLUSÃO: O estudo evidenciou que o RT é um processo complexo, que demanda políticas intersetoriais, cooperação técnica e pactuação de metas entre os atores envolvidos no processo.

  18. Novel algorithm implementations in DARC: the Durham AO real-time controller

    Science.gov (United States)

    Basden, Alastair; Bitenc, Urban; Jenkins, David

    2016-07-01

    The Durham AO Real-time Controller has been used on-sky with the CANARY AO demonstrator instrument since 2010, and is also used to provide control for several AO test-benches, including DRAGON. Over this period, many new real-time algorithms have been developed, implemented and demonstrated, leading to performance improvements for CANARY. Additionally, the computational performance of this real-time system has continued to improve. Here, we provide details about recent updates and changes made to DARC, and the relevance of these updates, including new algorithms, to forthcoming AO systems. We present the computational performance of DARC when used on different hardware platforms, including hardware accelerators, and determine the relevance and potential for ELT scale systems. Recent updates to DARC have included algorithms to handle elongated laser guide star images, including correlation wavefront sensing, with options to automatically update references during AO loop operation. Additionally, sub-aperture masking options have been developed to increase signal to noise ratio when operating with non-symmetrical wavefront sensor images. The development of end-user tools has progressed with new options for configuration and control of the system. New wavefront sensor camera models and DM models have been integrated with the system, increasing the number of possible hardware configurations available, and a fully open-source AO system is now a reality, including drivers necessary for commercial cameras and DMs. The computational performance of DARC makes it suitable for ELT scale systems when implemented on suitable hardware. We present tests made on different hardware platforms, along with the strategies taken to optimise DARC for these systems.

  19. Deep-water sponges (Porifera) from Bonaire and Klein Curaçao, Southern Caribbean.

    Science.gov (United States)

    Van Soest, Rob W M; Meesters, Erik H W G; Becking, Leontine E

    2014-10-29

    Four submersible dives off the coast of Bonaire (Caribbean Netherlands) and Klein Curaçao (Curaçao) to depths of 99.5-242 m, covering lower mesophotic and upper dysphotic zones, yielded 52 sponge specimens belonging to 31 species. Among these we identified 13 species as new to science. These are Plakinastrella stinapa n. sp., Pachastrella pacoi n. sp., Characella pachastrelloides n. sp., Geodia curacaoensis n. sp., Caminus carmabi n. sp., Discodermia adhaerens n. sp., Clathria (Microciona) acarnoides n. sp., Antho (Acarnia) pellita n. sp., Parahigginsia strongylifera n. sp., Calyx magnoculata n. sp., Neopetrosia dutchi n. sp., Neopetrosia ovata n. sp. and Neopetrosia eurystomata n. sp. We also report an euretid hexactinellid, which belongs to the rare genus Verrucocoeloidea, recently described (2014) as V. liberatorii Reiswig & Dohrmann. The remaining 18 already known species are all illustrated by photos of the habit, either in situ or 'on deck', but only briefly characterized in an annotated table to confirm their occurrence in the Southern Caribbean. The habitat investigated-steep limestone rocks, likely representing Pleistocene fossil reefs--is similar to deep-water fossil reefs at Barbados of which the sponges were sampled and studied by Van Soest and Stentoft (1988). A comparison is made between the two localities, showing a high degree of similarity in sponge composition: 53% of the present Bonaire-Klein Curaçao species were also retrieved at Barbados. At the level of higher taxa (genera, families) Bonaire-Klein Curaçao shared approximately 80% of its lower mesophotic and upper dysphotic sponge fauna with Barbados, despite a distance between them of 1000 km, indicating high faunal homogeneity. We also preliminarily compared the shallow-water (euphotic) sponge fauna of Curaçao with the combined data available for the Barbados, Bonaire and Klein Curaçao mesophotic and upper dysphotic sponges, which resulted in the conclusion that the two faunas show only

  20. Ressalto no canto posteromedial do joelho relacionado ao músculo sartório

    Directory of Open Access Journals (Sweden)

    Marcello Henrique Nogueira-Barbosa

    2011-06-01

    Full Text Available As causas da síndrome de ressalto no joelho relatadas com maior frequência são relacionadas a anormalidades meniscais, ao tendão do músculo bíceps femoral e aos tendões grácil e semitendíneo. Neste trabalho é descrito um caso de ressalto no canto posteromedial relacionado à junção miotendínea do músculo sartório em um paciente do sexo masculino, de 58 anos de idade, com hiperextensão do joelho.

  1. O panorama das Drogas no México: da margem da sociedade ao centro da cultura

    OpenAIRE

    Diana Palaversich

    2013-01-01

    O artigo destaca o percurso das manifestações culturais ligadas ao tráfico de drogas no México, de um lugar marginal, de subcultura, na sociedade mexicana das décadas de 1970 e 1980, expressas principalmente através dos narcocorridos e do narcocine, para um lugar no mainstream cultural mexicano, desde o início do século 21, com destaque especial para a narcoliteratura. O aumento da violência, provocado pela guerra ao narcotráfico, produz uma proliferação da temática nos meios de comunicação e...

  2. The Ashkenazi Jews of Curaçao, a trading minority

    Directory of Open Access Journals (Sweden)

    Eva Abraham-Van der Mark

    2000-07-01

    Full Text Available First describes the early Sephardi presence in Curaçao, the arrival of the Ashkenazi in the 20th c., and the relations between these 2 groups. Author goes on to discuss the Ashkenazis' economic success and the exodus of the 1980s. She asks whether the success and the exodus can be attributed to the characteristics of the group itself or whether conditions and developments in Curaçao account for economic fortune and the departure of the Ashkenazi.

  3. A MEMÕRIA DE JESUS E A MANVFESTAÇAO DO PAI NO QUARTO EVANGELHO

    Directory of Open Access Journals (Sweden)

    Johan Konings

    1988-01-01

    Full Text Available Não somos os primeiros a constatar que as cristologias narrativas pouco se inspiram no Quarto Evangelho (QE, tanto na atual teologia latino-americana como na europeia, de E. Schillebeeckx, por exemplo. Entretanto, as cristologias especulativas usam amplamente pelo menos o prólogo de João como ponto de partida para suas especulações. Será que este tratamento faz jus ao QE, ou repousa num preconceito espiritualista com relação ao evangelho que Clemente de Alexandria chamou de "espiritual"?

  4. [Study on Provenance of Kraak Porcelains from "Nan'ao I" Shipwreck].

    Science.gov (United States)

    Du, Jing-nan; Chen, Yue; Li, Nai-sheng; Ming, Chao-fang; Zhu, Jian; Luo, Wu-gan

    2015-06-01

    The "Kraak Porcelain" was a kind of Blue and White Porcelain which exported from China to Europe in Ming and Qing period. The study of Kraak Porcelain is a focus issue in international field of porcelain research. In 2007, the discovery of "Nan'ao I" Shipwreck of Ming Dynasty and the porcelains loaded in it, provided precious materials for the research on Kraak Porcelain. In this paper, we explored the provenance of 10 Kraak Porcelain samples from Nan'ao I, using both traditional visual method and WDXRF.

  5. Resistência ao Consumo em um Circuito Urbano de Parkour

    Directory of Open Access Journals (Sweden)

    Tatiana Maria Bernardo da Silva

    2011-08-01

    Full Text Available A partir de uma pesquisa alinhada ao método etnográfico, o presente trabalho tem por objetivo investigar os valores e as práticas de resistência ao consumo adotadas pelos membros de um circuito urbano de parkour no Rio de Janeiro. Confiando em uma abordagem indutiva e interpretativa amparada por um estudo empírico de base qualitativa, foram exploradas quatro categorias de análise: (1 a resistência como valor essencial; (2 um percurso de doação; (3 o consumo aprisiona; e (4 mobilização social e resistência.

  6. COMPORTAMENTO ÉTICO E CRÍTICA AO PRECONCEITO BURGUÊS

    OpenAIRE