SU-E-T-429: Uncertainties of Cell Surviving Fractions Derived From Tumor-Volume Variation Curves

International Nuclear Information System (INIS)

Chvetsov, A

2014-01-01

Purpose: To evaluate uncertainties of cell surviving fraction reconstructed from tumor-volume variation curves during radiation therapy using sensitivity analysis based on linear perturbation theory. Methods: The time dependent tumor-volume functions V(t) have been calculated using a twolevel cell population model which is based on the separation of entire tumor cell population in two subpopulations: oxygenated viable and lethally damaged cells. The sensitivity function is defined as S(t)=[δV(t)/V(t)]/[δx/x] where δV(t)/V(t) is the time dependent relative variation of the volume V(t) and δx/x is the relative variation of the radiobiological parameter x. The sensitivity analysis was performed using direct perturbation method where the radiobiological parameter x was changed by a certain error and the tumor-volume was recalculated to evaluate the corresponding tumor-volume variation. Tumor volume variation curves and sensitivity functions have been computed for different values of cell surviving fractions from the practically important interval S 2 =0.1-0.7 using the two-level cell population model. Results: The sensitivity functions of tumor-volume to cell surviving fractions achieved a relatively large value of 2.7 for S 2 =0.7 and then approached zero as S 2 is approaching zero Assuming a systematic error of 3-4% we obtain that the relative error in S 2 is less that 20% in the range S2=0.4-0.7. This Resultis important because the large values of S 2 are associated with poor treatment outcome should be measured with relatively small uncertainties. For the very small values of S2<0.3, the relative error can be larger than 20%; however, the absolute error does not increase significantly. Conclusion: Tumor-volume curves measured during radiotherapy can be used for evaluation of cell surviving fractions usually observed in radiation therapy with conventional fractionation

Assessment of the accuracy of ABC/2 variations in traumatic epidural hematoma volume estimation: a retrospective study

Directory of Open Access Journals (Sweden)

Pengfei Yan

2016-04-01

Full Text Available Background. The traumatic epidural hematoma (tEDH volume is often used to assist in tEDH treatment planning and outcome prediction. ABC/2 is a well-accepted volume estimation method that can be used for tEDH volume estimation. Previous studies have proposed different variations of ABC/2; however, it is unclear which variation will provide a higher accuracy. Given the promising clinical contribution of accurate tEDH volume estimations, we sought to assess the accuracy of several ABC/2 variations in tEDH volume estimation. Methods. The study group comprised 53 patients with tEDH who had undergone non-contrast head computed tomography scans. For each patient, the tEDH volume was automatically estimated by eight ABC/2 variations (four traditional and four newly derived with an in-house program, and results were compared to those from manual planimetry. Linear regression, the closest value, percentage deviation, and Bland-Altman plot were adopted to comprehensively assess accuracy. Results. Among all ABC/2 variations assessed, the traditional variations y = 0.5 × A1B1C1 (or A2B2C1 and the newly derived variations y = 0.65 × A1B1C1 (or A2B2C1 achieved higher accuracy than the other variations. No significant differences were observed between the estimated volume values generated by these variations and those of planimetry (p > 0.05. Comparatively, the former performed better than the latter in general, with smaller mean percentage deviations (7.28 ± 5.90% and 6.42 ± 5.74% versus 19.12 ± 6.33% and 21.28 ± 6.80%, respectively and more values closest to planimetry (18/53 and 18/53 versus 2/53 and 0/53, respectively. Besides, deviations of most cases in the former fell within the range of 20% (90.57% and 96.23, respectively. Discussion. In the current study, we adopted an automatic approach to assess the accuracy of several ABC/2 variations for tEDH volume estimation. Our initial results showed that the variations y = 0.5 × A1B1C1 (or A2B2C1

Interobserver variations of target volume delineation and its impact on irradiated volume in accelerated partial breast irradiation with intraoperative interstitial breast implant

Directory of Open Access Journals (Sweden)

Ritu Raj Upreti

2017-02-01

Full Text Available Purpose: To investigate the interobserver variations in delineation of lumpectomy cavity (LC and clinical target volume (CTV, and its impact on irradiated volume in accelerated partial breast irradiation using intraoperative multicatheter brachytherapy. Material and methods : Delineation of LC and CTV was done by five radiation oncologists on planning computed tomography (CT scans of 20 patients with intraoperative interstitial breast implant. Cavity visualization index (CVI, four-point index ranging from (0 = poor to (3 = excellent was created and assigned by observers for each patient. In total, 200 contours for all observers and 100 treatment plans were evaluated. Spatial concordance (conformity index, CI common , and CIgen, average shift in the center of mass (COM, and ratio of maximum and minimum volumes (V max /V min of LC and CTV were quantified among all observers and statistically analyzed. Variation in active dwell positions (0.5 cm step for each catheter, total reference air kerma (TRAK, volume enclosed by prescription isodose (V100% among observers and its spatial concordance were analyzed. Results : The mean ± SD CI common of LC and CTV was 0.54 ± 0.09, and 0.58 ± 0.08, respectively. Conformity index tends to increase, shift in COM and V max /V min decrease significantly (p < 0.05, as CVI increased. Out of total 309 catheters, 29.8% catheters had no change, 29.8% and 17.5% catheters had variations of 1 and 2 dwell positions (0.5 cm and 1 cm, respectively. 9.3% catheters shown variations ≥ 10 dwell positions (5 cm. The mean ± SD CI common of V100% was 0.75 ± 0.11. The mean observed V max /V min of prescription isodose and TRAK was 1.18 (range, 1.03 to 1.56 and 1.11 (range, 1.03 to 1.35, respectively. Conclusions : Interobserver variability in delineation of target volume was found to be significantly related to CVI. Smaller variability was observed with excellent visualization of LC. Interobserver variations showed dosimetric

Dosimetric impact of the variation of the prostate volume and shape between pretreatment planning and treatment procedure

International Nuclear Information System (INIS)

Beaulieu, Luc; Aubin, Sylviane; Taschereau, Richard; Pouliot, Jean; Vigneault, Eric

2002-01-01

Purpose: The goal of this study is to evaluate the dosimetric impact on a pretreatment planning of prostatic volume and shape variations occurring between the moment of the volume study (preplanning) and just before a transperineal permanent seed implant procedure. Such variations could be an obvious source of misplacement of the seeds relative to the prostate gland and organs at risk. Other sources of dosimetric uncertainties, such as misplacement due to the procedure itself or edema, are eliminated by looking at these variations before the implant procedure. Methods and Materials: For 35 clinical cases, prostate contours were taken at preplanning time as well as in the operating room (OR) minutes before the procedure. Comparison of shape and volume between the two sets was made. The impact on V100 was evaluated by placing the seeds in their planned positions in the new volume (clinical situation) and also by performing a new plan with the second set of contours to simulate an intraoperative approach. Results: The volume taken in the OR remained unchanged compared to the pretreatment planning volume in only 37% of the cases. While on average the dose coverage loss from pretreatment planning due to a combination of variations of volume and shape was small at 5.7%, a V100 degradation of up to 20.9% was observed in extreme cases. Even in cases in which no changes in volume were observed, changes in shape occurred and strongly affected implant dosimetry. Conclusions: Variations of volume and shape between pretreatment planning and the implant procedure can have a strong impact on the dosimetry if the planning and the implant procedure are not performed on the same day. This is an argument in favor of performing implant dosimetry in the OR

Variation in Measurements of Transtibial Stump Model Volume A Comparison of Five Methods

NARCIS (Netherlands)

Bolt, A.; de Boer-Wilzing, V. G.; Geertzen, J. H. B.; Emmelot, C. H.; Baars, E. C. T.; Dijkstra, P. U.

Objective: To determine the right moment for fitting the first prosthesis, it is necessary to know when the volume of the stump has stabilized. The aim of this study is to analyze variation in measurements of transtibial stump model volumes using the water immersion method, the Design TT system, the

Cardiac variation of inferior vena cava: new concept in the evaluation of intravascular blood volume.

Science.gov (United States)

Nakamura, Kensuke; Tomida, Makoto; Ando, Takehiro; Sen, Kon; Inokuchi, Ryota; Kobayashi, Etsuko; Nakajima, Susumu; Sakuma, Ichiro; Yahagi, Naoki

2013-07-01

Evaluation of the intravascular blood volume is an important assessment in emergency and critical care medicine. Measurement of the inferior vena cava (IVC) respiratory variation by ultrasound echography is useful, but it entails subjective problems. We have hypothesized that IVC cardiac variation is also correlated with intravascular blood volume and analyzed it automatically using computer software of two kinds, later comparing the results. Snakes, software to track boundaries by curve line continuity, and template matching software were incorporated into a computer with an ultrasound machine to track the short-axis view of IVC automatically and analyze it with approximation by ellipse. Eight healthy volunteers with temporary mild hypovolemia underwent echography before and after passive leg raising and while wearing medical anti-shock trousers. IVC cardiac variation was visually decreased by both leg raising and medical anti-shock trousers. The collapse index (maximum - minimum/maximum) of area during three cardiac beats was decreased showing a good relationship to fluid load simulations; 0.24 ± 0.03 at baseline versus 0.11 ± 0.01 with leg raising and 0.12 ± 0.01 with medical anti-shock trousers. In conclusion, IVC cardiac variation has the potential to provide an evaluation of water volume. It presents some advantages in mechanical analysis over respiratory variation. At the very least, we need to exercise some caution with cardiac variation when evaluating respiratory variation.

Post-traumatic stress and age variation in amygdala volumes among youth exposed to trauma.

Science.gov (United States)

Weems, Carl F; Klabunde, Megan; Russell, Justin D; Reiss, Allan L; Carrión, Victor G

2015-12-01

Theoretically, normal developmental variation in amygdala volumes may be altered under conditions of severe stress. The purpose of this article was to examine whether posttraumatic stress moderates the association between age and amygdala volumes in youth exposed to traumatic events who are experiencing symptoms of post-traumatic stress disorder (PTSD). Volumetric imaging was conducted on two groups of youth aged 9-17 years: 28 with exposure to trauma and PTSD symptoms (boys = 15, girls = 13) and 26 matched (age, IQ) comparison youth (Controls; boys = 12, girls = 14). There was a significant group by age interaction in predicting right amygdala volumes. A positive association between age and right amygdala volumes was observed, but only in PTSD youth. These associations with age remained when controlling for IQ, total brain volumes and sex. Moreover, older youth with PTSD symptoms had relatively larger right amygdala volumes than controls. Findings provide evidence that severe stress may influence age-related variation in amygdala volumes. Results further highlight the importance of utilizing age as an interactive variable in pediatric neuroimaging research, in so far as age may act as an important moderator of group differences. © The Author (2015). Published by Oxford University Press. For Permissions, please email: journals.permissions@oup.com.

Assessment of interpatient heterogeneity in tumor radiosensitivity for nonsmall cell lung cancer using tumor-volume variation data

Energy Technology Data Exchange (ETDEWEB)

Chvetsov, Alexei V., E-mail: chvetsov2@gmail.com; Schwartz, Jeffrey L.; Mayr, Nina [Department of Radiation Oncology, University of Washington, 1959 NE Pacific Street, Seattle, Washington 98195-6043 (United States); Yartsev, Slav [London Regional Cancer Program, London Health Sciences Centre, 790 Commissioners Road East, London, Ontario 46A 4L6 (Canada)

2014-06-15

Purpose: In our previous work, the authors showed that a distribution of cell surviving fractionsS{sub 2} in a heterogeneous group of patients could be derived from tumor-volume variation curves during radiotherapy for head and neck cancer. In this research study, the authors show that this algorithm can be applied to other tumors, specifically in nonsmall cell lung cancer. This new application includes larger patient volumes and includes comparison of data sets obtained at independent institutions. Methods: Our analysis was based on two data sets of tumor-volume variation curves for heterogeneous groups of 17 patients treated for nonsmall cell lung cancer with conventional dose fractionation. The data sets were obtained previously at two independent institutions by using megavoltage computed tomography. Statistical distributions of cell surviving fractionsS{sub 2} and clearance half-lives of lethally damaged cells T{sub 1/2} have been reconstructed in each patient group by using a version of the two-level cell population model of tumor response and a simulated annealing algorithm. The reconstructed statistical distributions of the cell surviving fractions have been compared to the distributions measured using predictive assays in vitro. Results: Nonsmall cell lung cancer presents certain difficulties for modeling surviving fractions using tumor-volume variation curves because of relatively large fractional hypoxic volume, low gradient of tumor-volume response, and possible uncertainties due to breathing motion. Despite these difficulties, cell surviving fractionsS{sub 2} for nonsmall cell lung cancer derived from tumor-volume variation measured at different institutions have similar probability density functions (PDFs) with mean values of 0.30 and 0.43 and standard deviations of 0.13 and 0.18, respectively. The PDFs for cell surviving fractions S{sub 2} reconstructed from tumor volume variation agree with the PDF measured in vitro. Conclusions: The data obtained

Menstrual variation of breast volume and T2 relaxation times in cyclical mastalgia

International Nuclear Information System (INIS)

Hussain, Zainab; Brooks, Jonathan; Percy, Dave

2008-01-01

Purpose: Hormonal activity causes breast volume to change during the menstrual cycle. One possible cause of this volume change is thought to be due to water retention or oedema within the tissues. We used magnetic resonance imaging (MRI) to study the variation in breast volume and 1 H Magnetic Resonance Spectroscopy (MRS) to measure T 2 relaxation times which are known to increase with increasing tissue water content. We hypothesised that an increase in breast volume will elevate T 2 relaxation due to the presence of an increased water content within the breast. T 2 Relaxation time and volume were studied in fifteen control subjects and in a cohort of eight patients with cyclical mastalgia in order to determine whether changes in breast volume and T 2 relaxation times differed in controls and patients during menses, ovulation and premenses. Method: Breast volume was determined by the Cavalieri method in combination with point counting techniques on MR images and T 2 relaxation times of the water and fat in a voxel of breast tissue were obtained using 1 H Magnetic Resonance Spectroscopy (MRS). Results: Statistical analysis (ANOVA) demonstrated highly significant differences in breast volume between the three stages of the cycle (p 2 of fat or water did not depend on stage of cycle. T-tests demonstrated no significant differences in T 2 of water or fat between patient and control groups. The average T 2 relaxation time of water was lowest in the patient and control groups during ovulation and highest in the patient group during premenses. Conclusion: We have performed the first combined volumetric and spectroscopic study of women with cyclical mastalgia and demonstrated that the global changes in volumes and T 2 were not significantly different from normal menstrual variations

Fluid management guided by stroke volume variation failed to decrease the incidence of acute kidney injury, 30-day mortality, and 1-year survival in living donor liver transplant recipients

Directory of Open Access Journals (Sweden)

Shen-Chih Wang

2012-12-01

Conclusion: The outcomes of living donor liver transplant patients who had fluid therapy guided by an SVV less than 10% were similar to those of patients who were given fluids to reach a CVP of 10 mmHg. Our findings suggest that the two measures of vascular filling are similar in liver transplant recipients with demographic characteristics similar to those of our patients.

Hospital variation in 30-day mortality after colorectal cancer surgery in denmark: the contribution of hospital volume and patient characteristics

DEFF Research Database (Denmark)

Osler, Merete; Iversen, Lene Hjerrild; Borglykke, Anders

2011-01-01

This study examines variation between hospitals in 30-day mortality after surgery for colorectal cancer (CRC) in Denmark and explores whether hospital volume and patient characteristics contribute to any variation between hospitals.......This study examines variation between hospitals in 30-day mortality after surgery for colorectal cancer (CRC) in Denmark and explores whether hospital volume and patient characteristics contribute to any variation between hospitals....

Significance of breast boost volume changes during radiotherapy in relation to current clinical interobserver variations

International Nuclear Information System (INIS)

Hurkmans, Coen; Admiraal, Marjan; Sangen, Maurice van der; Dijkmans, Ingrid

2009-01-01

Background and purpose: Nowadays, many departments introduce CT images for breast irradiation techniques, aiming to obtain a better accuracy in the definition of the relevant target volumes. However, the definition of the breast boost volume based on CT images requires further investigation, because it may not only vary between observers, but it may also change during the course of treatment. This study aims to quantify the variability of the CT based visible boost volume (VBV) during the course of treatment in relation to the variability between observers. Materials and methods: Ten patients with stage T1-2 invasive breast cancer treated with breast conservative surgery and post surgical radiotherapy were included in this study. In addition to the regular planning CT which is obtained several days prior to radiotherapy, three additional CT scans were acquired 3, 5 and 7 weeks after the planning CT scan. Four radiation oncologists delineated the VBV in all scans. Conformity of the delineations was analysed both between observers, and between scans taken at different periods of the radiotherapy treatment. Results: The VBV averaged over all patients decreased during the course of the treatment from an initial 40 cm 3 to 28 cm 3 , 27 cm 3 and 25 cm 3 after 3, 5 and 7 weeks, respectively. Assuming the VBV to be spherical, this corresponds to a reduction in diameter of 5-6 mm. More detailed analysis revealed that this reduction was more pronounced when radiotherapy started within 30 days after surgery. These boost volume changes over time were found to be significant (p = 0.02) even in the presence of interobserver variations. Moreover, the conformity index (CI) for the volume changes was of the same magnitude as the conformity index for the interobserver variation (0.25 and 0.31, respectively). Conclusions: Breast boost volume variations during a course of radiotherapy are significant in relation to current clinical interobserver variations. This is an important

Menstrual variation of breast volume and T{sub 2} relaxation times in cyclical mastalgia

Energy Technology Data Exchange (ETDEWEB)

Hussain, Zainab [Department of Medical Imaging, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom); Magnetic Resonance and Image Analysis Research Centre, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom)], E-mail: zay@liverpool.ac.uk; Brooks, Jonathan [Magnetic Resonance and Image Analysis Research Centre, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom); Department of Human Anatomy and Genetics, University of Oxford, Oxford (United Kingdom); Percy, Dave [Centre for Operational Research and Applied Statistics, University of Salford, Salford, Greater Manchester M5 4WT (United Kingdom)

2008-02-15

Purpose: Hormonal activity causes breast volume to change during the menstrual cycle. One possible cause of this volume change is thought to be due to water retention or oedema within the tissues. We used magnetic resonance imaging (MRI) to study the variation in breast volume and {sup 1}H Magnetic Resonance Spectroscopy (MRS) to measure T{sub 2} relaxation times which are known to increase with increasing tissue water content. We hypothesised that an increase in breast volume will elevate T{sub 2} relaxation due to the presence of an increased water content within the breast. T{sub 2} Relaxation time and volume were studied in fifteen control subjects and in a cohort of eight patients with cyclical mastalgia in order to determine whether changes in breast volume and T{sub 2} relaxation times differed in controls and patients during menses, ovulation and premenses. Method: Breast volume was determined by the Cavalieri method in combination with point counting techniques on MR images and T{sub 2} relaxation times of the water and fat in a voxel of breast tissue were obtained using {sup 1}H Magnetic Resonance Spectroscopy (MRS). Results: Statistical analysis (ANOVA) demonstrated highly significant differences in breast volume between the three stages of the cycle (p < 0.0005) with breast volume being greatest premenstrually. Patients did not exhibit an increase in volume premenstrually, significantly above controls. T{sub 2} of fat or water did not depend on stage of cycle. T-tests demonstrated no significant differences in T{sub 2} of water or fat between patient and control groups. The average T{sub 2} relaxation time of water was lowest in the patient and control groups during ovulation and highest in the patient group during premenses. Conclusion: We have performed the first combined volumetric and spectroscopic study of women with cyclical mastalgia and demonstrated that the global changes in volumes and T{sub 2} were not significantly different from normal

Effects of DARPP-32 Genetic Variation on Prefrontal Cortex Volume and Episodic Memory Performance

Directory of Open Access Journals (Sweden)

Ninni Persson

2017-05-01

Full Text Available Despite evidence of a fundamental role of DARPP-32 in integrating dopamine and glutamate signaling, studies examining gene coding for DARPP-32 in relation to neural and behavioral correlates in humans are scarce. Post mortem findings suggest genotype specific expressions of DARPP-32 in the dorsal frontal lobes. Therefore, we investigated the effects of genomic variation in DARPP-32 coding on frontal lobe volumes and episodic memory. Volumetric data from the dorsolateral (DLPFC, and visual cortices (VC were obtained from 61 younger and older adults (♀54%. The major homozygote G, T, or A genotypes in single nucleotide polymorphisms (SNPs: rs879606; rs907094; rs3764352, the two latter in complete linkage disequilibrium, at the DARPP-32 regulating PPP1R1B gene, influenced frontal gray matter volume and episodic memory (EM. Homozygous carriers of allelic variants with lower DARPP-32 expression had an overall larger prefrontal volume in addition to greater EM recall accuracy after accounting for the influence of age. The SNPs did not influence VC volume. The genetic effects on DLPFC were greater in young adults and selective to this group for EM. Our findings suggest that genomic variation maps onto individual differences in frontal brain volumes and cognitive functions. Larger DLPFC volumes were also related to better EM performance, suggesting that gene-related differences in frontal gray matter may contribute to individual differences in EM. These results need further replication from experimental and longitudinal reports to determine directions of causality.

Bladder volume variations of cervical cancer patient in radiation therapy using ultrasonography

Energy Technology Data Exchange (ETDEWEB)

Gong, Jong Ho [Dept. of Radiation Oncology, Pusan National University Hospital, Pusan (Korea, Republic of)

2016-12-15

The bladder volume change was measured using ultrasonography for helping decrease the side effects and other organ variations in the location of radiation therapy for cervical cancer patients. An experiment was performed targeting patients who were treated with radiation therapy at PNUH within the period from September to December 2015. To maintain the bladder volume, each patient was instructed to drink 500 cc water before and after CT simulation, 60 minutes before the dry run. Also, the bladder volume was measured in each patient CT scan, and a 3D conformal therapy plan was designed. The bladder volumes measured before and after the CT simulation, dry run, and radiation treatment planning were compared and analyzed. The average volume and average error of the bladder that were obtained from the measurement based on the CT scan images had the lowest standard deviation in the CT simulation. This means that the values that were obtained before and after the CT simulation were statistically relevant and correlative. Moreover, the bladder volume measured via ultrasonography was larger size, the average volume in the CT scan. But the values that were obtained Dry run and after the CT simulation were not statistically relevant. Drinking a certain amount of water helps a patient maintain his/her bladder volume for a dry run. Even then, it is difficult to maintain the bladder volume for the dry run. Also, whether or not the patients followed the directions for the dry run correctly is important.

Variation of clinical target volume definition in three-dimensional conformal radiation therapy for prostate cancer

International Nuclear Information System (INIS)

Valicenti, Richard K.; Sweet, John W.; Hauck, Walter W.; Hudes, Richard S.; Lee, Tony; Dicker, Adam P.; Waterman, Frank M.; Anne, Pramila R.; Corn, Benjamin W.; Galvin, James M.

1999-01-01

Purpose: Currently, three-dimensional conformal radiation therapy (3D-CRT) planning relies on the interpretation of computed tomography (CT) axial images for defining the clinical target volume (CTV). This study investigates the variation among multiple observers to define the CTV used in 3D-CRT for prostate cancer. Methods and Materials: Seven observers independently delineated the CTVs (prostate ± seminal vesicles [SV]) from the CT simulation data of 10 prostate cancer patients undergoing 3D-CRT. Six patients underwent CT simulation without the use of contrast material and serve as a control group. The other 4 had urethral and bladder opacification with contrast medium. To determine interobserver variation, we evaluated the derived volume, the maximum dimensions, and the isocenter for each examination of CTV. We assessed the reliability in the CTVs among the observers by correlating the variation for each class of measurements. This was estimated by intraclass correlation coefficient (ICC), with 1.00 defining absolute correlation. Results: For the prostate volumes, the ICC was 0.80 (95% confidence interval [CI]: 0.56-0.96). This changed to 0.92 (95% CI: 0.75-0.99) with the use of contrast material. Similarly, the maximal prostatic dimensions were reliable and improved. There was poor agreement in defining the SV. For this structure, the ICC never exceeded 0.28. The reliability of the isocenter was excellent, with the ICC exceeding 0.83 and 0.90 for the prostate ± SV, respectively. Conclusions: In 3D-CRT for prostate cancer, there was excellent agreement among multiple observers to define the prostate target volume but poor agreement to define the SV. The use of urethral and bladder contrast improved the reliability of localizing the prostate. For all CTVs, the isocenter was very reliable and should be used to compare the variation in 3D dosimetry among multiple observers

Variation in Annual Volume at a University Hospital Does Not Predict Mortality for Pancreatic Resections

Directory of Open Access Journals (Sweden)

Rita A. Mukhtar

2008-01-01

Full Text Available Annual volume of pancreatic resections has been shown to affect mortality rates, prompting recommendations to regionalize these procedures to high-volume hospitals. Implementation has been difficult, given the paucity of high-volume centers and the logistical hardships facing patients. Some studies have shown that low-volume hospitals achieve good outcomes as well, suggesting that other factors are involved. We sought to determine whether variations in annual volume affected patient outcomes in 511 patients who underwent pancreatic resections at the University of California, San Francisco between 1990 and 2005. We compared postoperative mortality and complication rates between low, medium, or high volume years, designated by the number of resections performed, adjusting for patient characteristics. Postoperative mortality rates did not differ between high volume years and medium/low volume years. As annual hospital volume of pancreatic resections may not predict outcome, identification of actual predictive factors may allow low-volume centers to achieve excellent outcomes.

Variation in orbitofrontal cortex volume: relation to sex, emotion regulation and affect.

Science.gov (United States)

Welborn, B Locke; Papademetris, Xenophon; Reis, Deidre L; Rajeevan, Nallakkandi; Bloise, Suzanne M; Gray, Jeremy R

2009-12-01

Sex differences in brain structure have been examined extensively but are not completely understood, especially in relation to possible functional correlates. Our two aims in this study were to investigate sex differences in brain structure, and to investigate a possible relation between orbitofrontal cortex subregions and affective individual differences. We used tensor-based morphometry to estimate local brain volume from MPRAGE images in 117 healthy right-handed adults (58 female), age 18-40 years. We entered estimates of local brain volume as the dependent variable in a GLM, controlling for age, intelligence and whole-brain volume. Men had larger left planum temporale. Women had larger ventromedial prefrontal cortex (vmPFC), right lateral orbitofrontal (rlOFC), cerebellum, and bilateral basal ganglia and nearby white matter. vmPFC but not rlOFC volume covaried with self-reported emotion regulation strategies (reappraisal, suppression), expressivity of positive emotions (but not of negative), strength of emotional impulses, and cognitive but not somatic anxiety. vmPFC volume statistically mediated sex differences in emotion suppression. The results confirm prior reports of sex differences in orbitofrontal cortex structure, and are the first to show that normal variation in vmPFC volume is systematically related to emotion regulation and affective individual differences.

Revisiting the returns-volume relationship: Time variation, alternative measures and the financial crisis

Science.gov (United States)

Cook, Steve; Watson, Duncan

2017-03-01

Following its introduction in the seminal study of Osborne (1959), a voluminous literature has emerged examining the returns-volume relationship for financial assets. The present paper revisits this relationship in an examination of the FTSE100 which extends the existing literature in two ways. First, alternative daily measures of the FTSE100 index are used to create differing returns and absolute returns series to employ in an examination of returns-volume causality. Second, rolling regression analysis is utilised to explore potential time variation in the returns-volume relationship. The findings obtained depict a hitherto unconsidered complexity in this relationship with the type of returns series considered and financial crisis found to be significant underlying factors. The implications of the newly derived results for both the understanding of the nature of the returns-volume relationship and the development of theories in connection to it are discussed.

Goal-Directed Fluid Resuscitation Protocol Based on Arterial Waveform Analysis of Major Burn Patients in a Mass Burn Casualty.

Science.gov (United States)

Chiao, Hao-Yu; Chou, Chang-Yi; Tzeng, Yuan-Sheng; Wang, Chih-Hsin; Chen, Shyi-Gen; Dai, Niann-Tzyy

2018-02-01

Adequate fluid titration during the initial resuscitation period of major burn patients is crucial. This study aimed to evaluate the feasibility and efficacy of a goal-directed fluid resuscitation protocol that used hourly urine output plus the arterial waveform analysis FloTrac (Edwards LifeSciences, Irvine, Calif) system for major burns to avoid fluid overload. We conducted a retrospective cohort study of 43 major burn patients at the Tri-Service General Hospital after the Formosa Fun Coast Dust Explosion on June 27, 2015. Because of the limited capacity of intensive care units (ICUs), 23 intubated patients were transferred from the burn wards or emergency department to the ICU within 24 hours. Fluid administration was adjusted to achieve a urine output of 30 to 50 mL/h, cardiac index greater than 2.5 L/min/m, and stroke volume variation (SVV) less than 12%. The hourly crystalloid fluid infusion rate was titrated based on SVV and hourly urine output. Of the 23 critically burned patients admitted to the ICU, 13 patients who followed the goal-directed fluid resuscitation protocol within 12 hours postburn were included in the analysis. The mean age (years) was 21.8, and the mean total body surface area (TBSA) burned (%) was 68.0. The mean Revised Baux score was 106.8. All patients sustained inhalation injury. The fluid volumes administered to patients in the first 24 hours and the second 24 hours (mL/kg/% total body surface area) were 3.62 ± 1.23 and 2.89 ± 0.79, respectively. The urine outputs in the first 24 hours and the second 24 hours (mL/kg/h) were 1.13 ± 0.66 and 1.53 ± 0.87, respectively. All patients achieved the established goals within 32 hours postburn. In-hospital mortality rate was 0%. The SVV-based goal-directed fluid resuscitation protocol leads to less unnecessary fluid administration during the early resuscitation phase. Clinicians can efficaciously manage the dynamic body fluid changes in major burn patients under the guidance of the protocol.

Image-guided radiotherapy of bladder cancer: bladder volume variation and its relation to margins

DEFF Research Database (Denmark)

Muren, Ludvig; Redpath, Anthony Thomas; Lord, Hannah

2007-01-01

: The correlation between the relative bladder volume (RBV, defined as repeat scan volume/planning scan volume) and the margins required to account for internal motion was first studied using a series of 20 bladder cancer patients with weekly repeat CT scanning during treatment. Both conformal RT (CRT) and IGRT......BACKGROUND AND PURPOSE: To control and account for bladder motion is a major challenge in radiotherapy (RT) of bladder cancer. This study investigates the relation between bladder volume variation and margins in conformal and image-guided RT (IGRT) for this disease. MATERIALS AND METHODS...... these patients were given fluid intake restrictions on alternating weeks during treatment. RESULTS: IGRT gave the strongest correlation between the RBV and margin size (R(2)=0.75; p10mm were required in only 1% of the situations when the RBV1, whereas isotropic margins >10...

A Comparative Study of Pituitary Volume Variations in MRI in Acute Onset of Psychiatric Conditions.

Science.gov (United States)

Soni, Brijesh Kumar; Joish, Upendra Kumar; Sahni, Hirdesh; George, Raju A; Sivasankar, Rajeev; Aggarwal, Rohit

2017-02-01

The growing belief that endocrine abnormalities may underlie many mental conditions has led to increased use of imaging and hormonal assays in patients attending to psychiatric OPDs. People who are in an acute phase of a psychiatric disorder show Hypothalamic Pituitary Adrenal (HPA) axis hyperactivity, but the precise underlying central mechanisms are unclear. To assess the pituitary gland volume variations in patients presenting with new onset acute psychiatric illness in comparison with age and gender matched controls by using MRI. The study included 50 patients, with symptoms of acute psychiatric illness presenting within one month of onset of illness and 50 age and gender matched healthy controls. Both patients and controls were made to undergo MRI of the Brain. A 0.9 mm slices of entire brain were obtained by 3 dimensional T1 weighted sequence. Pituitary gland was traced in all sagittal slices. Anterior pituitary and posterior pituitary bright spot were measured separately in each slice. Volume of the pituitary (in cubic centimetre- cm 3 ) was calculated by summing areas. Significance of variations in pituitary gland volumes was compared between the cases and controls using Analysis of Covariance (ANOVA). There were significantly larger pituitary gland volumes in the cases than the controls, irrespective of psychiatric diagnosis (ANOVA, f=15.56; p=0.0002). Pituitary volumes in cases were 15.36% (0.73 cm 3 ) higher than in controls. There is a strong likelihood of HPA axis overactivity during initial phase of all mental disorders along with increased pituitary gland volumes. Further studies including hormonal assays and correlation with imaging are likely to provide further insight into neuroanatomical and pathological basis of psychiatric disorders.

A correlation study on position and volume variation of primary lung cancer during respiration by four-dimensional CT

International Nuclear Information System (INIS)

Zhang Yingjie; Li Jianbin; Tian Shiyu; Li Fengxiang; Fan Tingyong; Shao Qian; Xu Min; Lu Jie

2011-01-01

Objective: To investigate the correlation of position movement of primary tumor with interested organs and skin markers, and to investigate the correlation of volume variation of primary tumors and lungs during different respiration phases for patients with lung cancer at free breath condition scanned by four-dimensional CT (4DCT) simulation. Methods: 16 patients with lung cancer were scanned at free breath condition by simulation 4DCT which connected to a respiration-monitoring system. A coordinate system was created based on image of T 5 phase,gross tumor volume (GTV) and normal tissue structures of 10 phases were contoured. The three dimensional position variation of them were measured and their correlation were analyzed, and the same for the volume variation of GTV and lungs of 10 respiratory phases. Results: Movement range of lung cancer in different lobe differed extinct: 0.8 - 5.0 mm in upper lobe, 5.7 -5.9 mm in middle lobe and 10.2 - 13.7 mm in lower lobe, respectively. Movement range of lung cancer in three dimensional direction was different: z-axis 4.3 mm ± 4.3 mm > y-axis 2.2 mm ± 1.0 mm > x-axis 1.7 mm ± 1.5 mm (χ 2 =16.22, P =0.000), respectively. There was no statistical significant correlation for movement vector of GTV and interested structures (r =-0.50 - -0.01, P =0.058 - -0.961), nor for volume variation of tumor and lung (r =0.23, P =0.520). Conclusions: Based on 4DCT, statistically significant differences of GTV centroid movement are observed at different pulmonary lobes and in three dimensional directions. So individual 4DCT measurement is necessary for definition of internal target volume margin for lung cancer. (authors)

Can a central blood volume deficit be detected by systolic pressure variation during spontaneous breathing?

DEFF Research Database (Denmark)

Dahl, Michael; Hayes, Chris; Steen Rasmussen, Bodil

2016-01-01

BACKGROUND: Whether during spontaneous breathing arterial pressure variations (APV) can detect a volume deficit is not established. We hypothesized that amplification of intra-thoracic pressure oscillations by breathing through resistors would enhance APV to allow identification of a reduced card...

Target volume delineation in external beam partial breast irradiation: less inter-observer variation with preoperative- compared to postoperative delineation

NARCIS (Netherlands)

Leij, F. van der; Elkhuizen, P.H.M.; Janssen, T.M.; Poortmans, P.M.P.; Sangen, M. van der; Scholten, A.N.; Vliet-Vroegindeweij, C. van; Boersma, L.J.

2014-01-01

The challenge of adequate target volume definition in external beam partial breast irradiation (PBI) could be overcome with preoperative irradiation, due to less inter-observer variation. We compared the target volume delineation for external beam PBI on preoperative versus postoperative CT scans of

Amygdala Volume in Offspring from Multiplex for Alcohol Dependence Families: The Moderating Influence of Childhood Environment and 5-HTTLPR Variation.

Science.gov (United States)

Hill, Shirley Y; Wang, Shuhui; Carter, Howard; McDermott, Michael D; Zezza, Nicholas; Stiffler, Scott

2013-12-12

The increased susceptibility for developing alcohol dependence seen in offspring from families with alcohol dependence may be related to structural and functional differences in brain circuits that influence emotional processing. Early childhood environment, genetic variation in the serotonin transporter-linked polymorphic region (5-HTTLPR) of the SLCA4 gene and allelic variation in the Brain Derived Neurotrophic Factor (BDNF) gene have each been reported to be related to volumetric differences in the temporal lobe especially the amygdala. Magnetic resonance imaging was used to obtain amygdala volumes for 129 adolescent/young adult individuals who were either High-Risk (HR) offspring from families with multiple cases of alcohol dependence (N=71) or Low-Risk (LR) controls (N=58). Childhood family environment was measured prospectively using age-appropriate versions of the Family Environment Scale during a longitudinal follow-up study. The subjects were genotyped for Brain-Derived Neurotrophic Factor (BDNF) Val66Met and the serotonin transporter polymorphism (5-HTTLPR). Two family environment scale scores (Cohesion and Conflict), genotypic variation, and their interaction were tested for their association with amygdala volumes. Personal and prenatal exposure to alcohol and drugs were considered in statistical analyses in order to more accurately determine the effects of familial risk group differences. Amygdala volume was reduced in offspring from families with multiple alcohol dependent members in comparison to offspring from control families. High-Risk offspring who were carriers of the S variant of the 5-HTTLPR polymorphism had reduced amygdala volume in comparison to those with an LL genotype. Larger amygdala volume was associated with greater family cohesion but only in Low-Risk control offspring. Familial risk for alcohol dependence is an important predictor of amygdala volume even when removing cases with significant personal exposure and covarying for

Target volume delineation in external beam partial breast irradiation: Less inter-observer variation with preoperative- compared to postoperative delineation

International Nuclear Information System (INIS)

Leij, Femke van der; Elkhuizen, Paula H.M.; Janssen, Tomas M.; Poortmans, Philip; Sangen, Maurice van der; Scholten, Astrid N.; Vliet-Vroegindeweij, Corine van; Boersma, Liesbeth J.

2014-01-01

The challenge of adequate target volume definition in external beam partial breast irradiation (PBI) could be overcome with preoperative irradiation, due to less inter-observer variation. We compared the target volume delineation for external beam PBI on preoperative versus postoperative CT scans of twenty-four breast cancer patients

Variations in CT determination of target volume with active breath co-ordinate in radiotherapy for post-operative gastric cancer.

Science.gov (United States)

Li, Gui-Chao; Zhang, Zhen; Ma, Xue-Jun; Yu, Xiao-Li; Hu, Wei-Gang; Wang, Jia-Zhou; Li, Qi-Wen; Liang, Li-Ping; Shen, Li-Jun; Zhang, Hui; Fan, Ming

2016-01-01

To investigate interobserver and inter-CT variations in using the active breath co-ordinate technique in the determination of clinical tumour volume (CTV) and normal organs in post-operative gastric cancer radiotherapy. Ten gastric cancer patients were enrolled in our study, and four radiation oncologists independently determined the CTVs and organs at risk based on the CT simulation data. To determine interobserver and inter-CT variation, we evaluated the maximum dimensions, derived volume and distance between the centres of mass (CMs) of the CTVs. We assessed the reliability in CTV determination among the observers by conformity index (CI). The average volumes ± standard deviation (cm(3)) of the CTV, liver, left kidney and right kidney were 674 ± 138 (range, 332-969), 1000 ± 138 (range, 714-1320), 149 ± 13 (range, 104-183) and 141 ± 21 (range, 110-186) cm(3), respectively. The average inter-CT distances between the CMs of the CTV, liver, left kidney and right kidney were 0.40, 0.56, 0.65 and 0.6 cm, respectively; the interobserver values were 0.98, 0.53, 0.16 and 0.15 cm, respectively. In the volume size of CTV for post-operative gastric cancer, there were significant variations among multiple observers, whereas there was no variation between different CTs. The slices in which variations more likely occur were the slices of the lower verge of the hilum of the spleen and porta hepatis, then the paraoesophageal lymph nodes region and abdominal aorta, and the inferior vena cava, and the variation in the craniocaudal orientation from the interobserver was more predominant than that from inter-CT. First, this is the first study to evaluate the interobserver and inter-CT variations in the determination of the CTV and normal organs in gastric cancer with the use of the active breath co-ordinate technique. Second, we analysed the region where variations most likely occur. Third, we investigated the influence of interobserver variation on

SU-E-T-427: Cell Surviving Fractions Derived From Tumor-Volume Variation During Radiotherapy for Non-Small Cell Lung Cancer: Comparison with Predictive Assays

Energy Technology Data Exchange (ETDEWEB)

Chvetsov, A; Schwartz, J; Mayr, N [University of Washington, Seattle, WA (United States); Yartsev, S [London Health Sciences Centre, London, Ontario (Canada)

2014-06-01

Purpose: To show that a distribution of cell surviving fractions S{sub 2} in a heterogeneous group of patients can be derived from tumor-volume variation curves during radiotherapy for non-small cell lung cancer. Methods: Our analysis was based on two data sets of tumor-volume variation curves for heterogeneous groups of 17 patients treated for nonsmall cell lung cancer with conventional dose fractionation. The data sets were obtained previously at two independent institutions by using megavoltage (MV) computed tomography (CT). Statistical distributions of cell surviving fractions S{sup 2} and cell clearance half-lives of lethally damaged cells T1/2 have been reconstructed in each patient group by using a version of the two-level cell population tumor response model and a simulated annealing algorithm. The reconstructed statistical distributions of the cell surviving fractions have been compared to the distributions measured using predictive assays in vitro. Results: Non-small cell lung cancer presents certain difficulties for modeling surviving fractions using tumor-volume variation curves because of relatively large fractional hypoxic volume, low gradient of tumor-volume response, and possible uncertainties due to breathing motion. Despite these difficulties, cell surviving fractions S{sub 2} for non-small cell lung cancer derived from tumor-volume variation measured at different institutions have similar probability density functions (PDFs) with mean values of 0.30 and 0.43 and standard deviations of 0.13 and 0.18, respectively. The PDFs for cell surviving fractions S{sup 2} reconstructed from tumor volume variation agree with the PDF measured in vitro. Comparison of the reconstructed cell surviving fractions with patient survival data shows that the patient survival time decreases as the cell surviving fraction increases. Conclusion: The data obtained in this work suggests that the cell surviving fractions S{sub 2} can be reconstructed from the tumor volume

SU-E-T-427: Cell Surviving Fractions Derived From Tumor-Volume Variation During Radiotherapy for Non-Small Cell Lung Cancer: Comparison with Predictive Assays

International Nuclear Information System (INIS)

Chvetsov, A; Schwartz, J; Mayr, N; Yartsev, S

2014-01-01

Purpose: To show that a distribution of cell surviving fractions S 2 in a heterogeneous group of patients can be derived from tumor-volume variation curves during radiotherapy for non-small cell lung cancer. Methods: Our analysis was based on two data sets of tumor-volume variation curves for heterogeneous groups of 17 patients treated for nonsmall cell lung cancer with conventional dose fractionation. The data sets were obtained previously at two independent institutions by using megavoltage (MV) computed tomography (CT). Statistical distributions of cell surviving fractions S 2 and cell clearance half-lives of lethally damaged cells T1/2 have been reconstructed in each patient group by using a version of the two-level cell population tumor response model and a simulated annealing algorithm. The reconstructed statistical distributions of the cell surviving fractions have been compared to the distributions measured using predictive assays in vitro. Results: Non-small cell lung cancer presents certain difficulties for modeling surviving fractions using tumor-volume variation curves because of relatively large fractional hypoxic volume, low gradient of tumor-volume response, and possible uncertainties due to breathing motion. Despite these difficulties, cell surviving fractions S 2 for non-small cell lung cancer derived from tumor-volume variation measured at different institutions have similar probability density functions (PDFs) with mean values of 0.30 and 0.43 and standard deviations of 0.13 and 0.18, respectively. The PDFs for cell surviving fractions S 2 reconstructed from tumor volume variation agree with the PDF measured in vitro. Comparison of the reconstructed cell surviving fractions with patient survival data shows that the patient survival time decreases as the cell surviving fraction increases. Conclusion: The data obtained in this work suggests that the cell surviving fractions S 2 can be reconstructed from the tumor volume variation curves measured

Variation in the Definition of Clinical Target Volumes for Pelvic Nodal Conformal Radiation Therapy for Prostate Cancer

International Nuclear Information System (INIS)

Lawton, Colleen A.F.; Michalski, Jeff; El-Naqa, Issam; Kuban, Deborah; Lee, W. Robert; Rosenthal, Seth A.; Zietman, Anthony; Sandler, Howard; Shipley, William; Ritter, Mark; Valicenti, Richard; Catton, Charles; Roach, Mack; Pisansky, Thomas M.; Seider, Michael

2009-01-01

Purpose: We conducted a comparative study of clinical target volume (CTV) definition of pelvic lymph nodes by multiple genitourinary (GU) radiation oncologists looking at the levels of discrepancies amongst this group. Methods and Materials: Pelvic computed tomography (CT) scans from 2 men were distributed to 14 Radiation Therapy Oncology Group GU radiation oncologists with instructions to define CTVs for the iliac and presacral lymph nodes. The CT data with contours were then returned for analysis. In addition, a questionnaire was completed that described the physicians' method for target volume definition. Results: Significant variation in the definition of the iliac and presacral CTVs was seen among the physicians. The minimum, maximum, mean (SD) iliac volumes (mL) were 81.8, 876.6, 337.6 ± 203 for case 1 and 60.3, 627.7, 251.8 ± 159.3 for case 2. The volume of 100% agreement was 30.6 and 17.4 for case 1 and 2 and the volume of the union of all contours was 1,012.0 and 807.4 for case 1 and 2, respectively. The overall agreement was judged to be moderate in both cases (kappa = 0.53 (p < 0.0001) and kappa = 0.48 (p < 0.0001). There was no volume of 100% agreement for either of the two presacral volumes. These variations were confirmed in the responses to the associated questionnaire. Conclusions: Significant disagreement exists in the definition of the CTV for pelvic nodal radiation therapy among GU radiation oncology specialists. A consensus needs to be developed so as to accurately assess the merit and safety of such treatment.

Genomic regulation of natural variation in cortical and noncortical brain volume

Directory of Open Access Journals (Sweden)

Laughlin Rick E

2006-02-01

Full Text Available Abstract Background The relative growth of the neocortex parallels the emergence of complex cognitive functions across species. To determine the regions of the mammalian genome responsible for natural variations in cortical volume, we conducted a complex trait analysis using 34 strains of recombinant inbred (Rl strains of mice (BXD, as well as their two parental strains (C57BL/6J and DBA/2J. We measured both neocortical volume and total brain volume in 155 coronally sectioned mouse brains that were Nissl stained and embedded in celloidin. After correction for shrinkage, the measured cortical and noncortical brain volumes were entered into a multiple regression analysis, which removed the effects of body size and age from the measurements. Marker regression and interval mapping were computed using WebQTL. Results An ANOVA revealed that more than half of the variance of these regressed phenotypes is genetically determined. We then identified the regions of the genome regulating this heritability. We located genomic regions in which a linkage disequilibrium was present using WebQTL as both a mapping engine and genomic database. For neocortex, we found a genome-wide significant quantitative trait locus (QTL on chromosome 11 (marker D11Mit19, as well as a suggestive QTL on chromosome 16 (marker D16Mit100. In contrast, for noncortex the effect of chromosome 11 was markedly reduced, and a significant QTL appeared on chromosome 19 (D19Mit22. Conclusion This classic pattern of double dissociation argues strongly for different genetic factors regulating relative cortical size, as opposed to brain volume more generally. It is likely, however, that the effects of proximal chromosome 11 extend beyond the neocortex strictly defined. An analysis of single nucleotide polymorphisms in these regions indicated that ciliary neurotrophic factor (Cntf is quite possibly the gene underlying the noncortical QTL. Evidence for a candidate gene modulating neocortical

Reduce in Variation and Improve Efficiency of Target Volume Delineation by a Computer-Assisted System Using a Deformable Image Registration Approach

International Nuclear Information System (INIS)

Chao, K.S. Clifford; Bhide, Shreerang FRCR; Chen, Hansen; Asper, Joshua PAC; Bush, Steven; Franklin, Gregg; Kavadi, Vivek; Liengswangwong, Vichaivood; Gordon, William; Raben, Adam; Strasser, Jon; Koprowski, Christopher; Frank, Steven; Chronowski, Gregory; Ahamad, Anesa; Malyapa, Robert; Zhang Lifei; Dong Lei

2007-01-01

Purpose: To determine whether a computer-assisted target volume delineation (CAT) system using a deformable image registration approach can reduce the variation of target delineation among physicians with different head and neck (HN) IMRT experiences and reduce the time spent on the contouring process. Materials and Methods: We developed a deformable image registration method for mapping contours from a template case to a patient case with a similar tumor manifestation but different body configuration. Eight radiation oncologists with varying levels of clinical experience in HN IMRT performed target delineation on two HN cases, one with base-of-tongue (BOT) cancer and another with nasopharyngeal cancer (NPC), by first contouring from scratch and then by modifying the contours deformed by the CAT system. The gross target volumes were provided. Regions of interest for comparison included the clinical target volumes (CTVs) and normal organs. The volumetric and geometric variation of these regions of interest and the time spent on contouring were analyzed. Results: We found that the variation in delineating CTVs from scratch among the physicians was significant, and that using the CAT system reduced volumetric variation and improved geometric consistency in both BOT and NPC cases. The average timesaving when using the CAT system was 26% to 29% for more experienced physicians and 38% to 47% for the less experienced ones. Conclusions: A computer-assisted target volume delineation approach, using a deformable image-registration method with template contours, was able to reduce the variation among physicians with different experiences in HN IMRT while saving contouring time

Bladder filling variations during concurrent chemotherapy and pelvic radiotherapy in rectal cancer patients: early experience of bladder volume assessment using ultrasound scanner

International Nuclear Information System (INIS)

Chang, Jee Suk; Yoon, Hong In; Cha, Hye Jung; Chang, Yoon Sun; Cho, Yeo Na; Keum, Ki Chang; Koom, Woong Sub

2013-01-01

To describe the early experience of analyzing variations and time trends in bladder volume of the rectal cancer patients who received bladder ultrasound scan. We identified 20 consecutive rectal cancer patients who received whole pelvic radiotherapy (RT) and bladder ultrasound scan between February and April 2012. Before simulation and during the entire course of treatment, patients were scanned with portable automated ultrasonic bladder scanner, 5 times consecutively, and the median value was reported. Then a radiation oncologist contoured the bladder inner wall shown on simulation computed tomography (CT) and calculated its volume. Before simulation, the median bladder volume measured using simulation CT and bladder ultrasound scan was 427 mL (range, 74 to 1,172 mL) and 417 mL (range, 147 to 1,245 mL), respectively. There was strong linear correlation (R = 0.93, p < 0.001) between the two results. During the course of treatment, there were wide variations in the bladder volume and every time, measurements were below the baseline with statistical significance (12/16). At 6 weeks after RT, the median volume was reduced by 59.3% to 175 mL. Compared to the baseline, bladder volume was reduced by 38% or 161 mL on average every week for 6 weeks. To our knowledge, this study is the first to prove that there are bladder volume variations and a reduction in bladder volume in rectal cancer patients. Moreover, our results will serve as the basis for implementation of bladder training to patients receiving RT with full bladder.

Cone Beam CT Imaging Analysis of Interfractional Variations in Bladder Volume and Position During Radiotherapy for Bladder Cancer

International Nuclear Information System (INIS)

Yee, Don; Parliament, Matthew; Rathee, Satyapal; Ghosh, Sunita; Ko, Lawrence; Murray, Brad

2010-01-01

Purpose: To quantify daily bladder size and position variations during bladder cancer radiotherapy. Methods and Materials: Ten bladder cancer patients underwent daily cone beam CT (CBCT) imaging of the bladder during radiotherapy. Bladder and planning target volumes (bladder/PTV) from CBCT and planning CT scans were compared with respect to bladder center-of-mass shifts in the x (lateral), y (anterior-posterior), and z (superior-inferior) coordinates, bladder/PTV size, bladder/PTV margin positions, overlapping areas, and mutually exclusive regions. Results: A total of 262 CBCT images were obtained from 10 bladder cancer patients. Bladder center of mass shifted most in the y coordinate (mean, -0.32 cm). The anterior bladder wall shifted the most (mean, -0.58 cm). Mean ratios of CBCT-derived bladder and PTV volumes to planning CT-derived counterparts were 0.83 and 0.88. The mean CBCT-derived bladder volume (± standard deviation [SD]) outside the planning CT counterpart was 29.24 cm 3 (SD, 29.71 cm 3 ). The mean planning CT-derived bladder volume outside the CBCT counterpart was 47.74 cm 3 (SD, 21.64 cm 3 ). The mean CBCT PTV outside the planning CT-derived PTV was 47.35 cm 3 (SD, 36.51 cm 3 ). The mean planning CT-derived PTV outside the CBCT-derived PTV was 93.16 cm 3 (SD, 50.21). The mean CBCT-derived bladder volume outside the planning PTV was 2.41 cm 3 (SD, 3.97 cm 3 ). CBCT bladder/ PTV volumes significantly differed from planning CT counterparts (p = 0.047). Conclusions: Significant variations in bladder and PTV volume and position occurred in patients in this trial.

Determination of protein and solvent volumes in protein crystals from contrast variation data

Energy Technology Data Exchange (ETDEWEB)

Badger, J. [Brandeis Univ., Waltham, MA (United States)

1994-12-31

By varying the relative values of protein and solvent scattering densities in a crystal, it is possible to obtain information on the shape and dimensions of protein molecular envelopes. Neutron diffraction methods are ideally suited to these contrast variation experiments because H/D exchange leads to large differential changes in the protein and solvent scattering densities and is structurally non-perturbing. Low resolution structure factors have been measured from cubic insulin crystals with differing H/D contents. Structure factors calculated from a simple binary density model, in which uniform scattering densities represent the protein and solvent volumes in the crystals, were compared with these data. The contrast variation differences in the sets of measured structure factors were found to be accurately fitted by this simple model. Trial applications to two problems in crystal structure determination illustrate how this fact may be exploited. (1) A translation function that employs contrast variation data gave a sharp minimum within 1-9{Angstrom} of the correctly positioned insulin molecule and is relatively insensitive to errors in the atomic model. (2) An ab initio phasing method for the contrast variation data, based on analyzing histograms of the density distributions in trial maps, was found to recover the correct molecular envelope.

[Hospital variation in anastomotic leakage after rectal cancer surgery in the Spanish Association of Surgeons project: The contribution of hospital volume].

Science.gov (United States)

Ortiz, Héctor; Biondo, Sebastiano; Codina, Antonio; Ciga, Miguel Á; Enríquez-Navascués, José; Espín, Eloy; García-Granero, Eduardo; Roig, José Vicente

2016-04-01

This multicentre observational study aimed to determine the anastomotic leak rate in the hospitals included in the Rectal Cancer Project of the Spanish Society of Surgeons and examine whether hospital volume may contribute to any variation between hospitals. Hospital variation was quantified using a multilevel approach on prospective data derived from the multicentre database of all adenocarcinomas of the rectum operated by an anterior resection at 84 surgical departments from 2006 to 2013. The following variables were included in the analysis; demographics, American Society of Anaesthesiologists classification, use of defunctioning stoma, tumour location and stage, administration of neoadjuvant treatment, and annual volume of elective surgical procedures. A total of 7231 consecutive patients were included. The rate of anastomotic leak was 10.0%. Stratified by annual surgical volume hospitals varied from 9.9 to 11.3%. In multilevel regression analysis, the risk of anastomotic leak increased in male patients, in patients with tumours located below 12 cm from the anal verge, and advanced tumour stages. However, a defunctioning stoma seemed to prevent this complication. Hospital surgical volume was not associated with anastomotic leak (OR: 0.852, [0.487-1.518]; P=.577). Furthermore, there was a statistically significant variation in anastomotic leak between all departments (MOR: 1.475; [1.321-1.681]; P<0.001). Anastomotic leak varies significantly among hospitals included in the project and this difference cannot be attributed to the annual surgical volume. Copyright © 2015 AEC. Publicado por Elsevier España, S.L.U. All rights reserved.

Variation in Results of Volume Measurements of Stumps of Lower-Limb Amputees : A Comparison of 4 Methods

NARCIS (Netherlands)

de Boer-Wilzing, Vera G.; Bolt, Arjen; Geertzen, Jan H.; Emmelot, Cornelis H.; Baars, Erwin C.; Dijkstra, Pieter U.

de Boer-Wilzing VG, Bolt A, Geertzen JH, Emmelot CH, Baars EC, Dijkstra PU. Variation in results of volume measurements of stumps of lower-limb amputees: a comparison of 4 methods. Arch Phys Med Rehabil 2011;92:941-6. Objective: To analyze the reliability of 4 methods (water immersion,

On optimal control of a sweeping process coupled with an ordinary differential equation

Czech Academy of Sciences Publication Activity Database

Adam, Lukáš; Outrata, Jiří

2014-01-01

Roč. 19, č. 9 (2014), s. 2709-2738 ISSN 1531-3492 R&D Projects: GA ČR(CZ) GAP201/12/0671 Grant - others:GA MŠk(CZ) SVV-2013-267315 Institutional support: RVO:67985556 Keywords : optimal control * variational inequality * variational analysis * coderivative * solution map * queuing theory Subject RIV: BA - General Mathematics Impact factor: 0.768, year: 2014 http://library.utia.cas.cz/separaty/2014/MTR/adam-0434417.pdf

Seneca Valley Virus 3Cpro Substrate Optimization Yields Efficient Substrates for Use in Peptide-Prodrug Therapy.

Directory of Open Access Journals (Sweden)

Linde A Miles

Full Text Available The oncolytic picornavirus Seneca Valley Virus (SVV-001 demonstrates anti-tumor activity in models of small cell lung cancer (SCLC, but may ultimately need to be combined with cytotoxic therapies to improve responses observed in patients. Combining SVV-001 virotherapy with a peptide prodrug activated by the viral protease 3Cpro is a novel strategy that may increase the therapeutic potential of SVV-001. Using recombinant SVV-001 3Cpro, we measured cleavage kinetics of predicted SVV-001 3Cpro substrates. An efficient substrate, L/VP4 (kcat/KM = 1932 ± 183 M(-1s(-1, was further optimized by a P2' N→P substitution yielding L/VP4.1 (kcat/KM = 17446 ± 2203 M(-1s(-1. We also determined essential substrate amino acids by sequential N-terminal deletion and substitution of amino acids found in other picornavirus genera. A peptide corresponding to the L/VP4.1 substrate was selectively cleaved by SVV-001 3Cpro in vitro and was stable in human plasma. These data define an optimized peptide substrate for SVV-001 3Cpro, with direct implications for anti-cancer therapeutic development.

Polarity-Dependent Misperception of Subjective Visual Vertical during and after Transcranial Direct Current Stimulation (tDCS).

Science.gov (United States)

Santos-Pontelli, Taiza E G; Rimoli, Brunna P; Favoretto, Diandra B; Mazin, Suleimy C; Truong, Dennis Q; Leite, Joao P; Pontes-Neto, Octavio M; Babyar, Suzanne R; Reding, Michael; Bikson, Marom; Edwards, Dylan J

2016-01-01

Pathologic tilt of subjective visual vertical (SVV) frequently has adverse functional consequences for patients with stroke and vestibular disorders. Repetitive transcranial magnetic stimulation (rTMS) of the supramarginal gyrus can produce a transitory tilt on SVV in healthy subjects. However, the effect of transcranial direct current stimulation (tDCS) on SVV has never been systematically studied. We investigated whether bilateral tDCS over the temporal-parietal region could result in both online and offline SVV misperception in healthy subjects. In a randomized, sham-controlled, single-blind crossover pilot study, thirteen healthy subjects performed tests of SVV before, during and after the tDCS applied over the temporal-parietal region in three conditions used on different days: right anode/left cathode; right cathode/left anode; and sham. Subjects were blind to the tDCS conditions. Montage-specific current flow patterns were investigated using computational models. SVV was significantly displaced towards the anode during both active stimulation conditions when compared to sham condition. Immediately after both active conditions, there were rebound effects. Longer lasting after-effects towards the anode occurred only in the right cathode/left anode condition. Current flow models predicted the stimulation of temporal-parietal regions under the electrodes and deep clusters in the posterior limb of the internal capsule. The present findings indicate that tDCS over the temporal-parietal region can significantly alter human SVV perception. This tDCS approach may be a potential clinical tool for the treatment of SVV misperception in neurological patients.

Simian varicella virus infection of rhesus macaques recapitulates essential features of varicella zoster virus infection in humans.

Directory of Open Access Journals (Sweden)

Ilhem Messaoudi

2009-11-01

Full Text Available Simian varicella virus (SVV, the etiologic agent of naturally occurring varicella in primates, is genetically and antigenically closely related to human varicella zoster virus (VZV. Early attempts to develop a model of VZV pathogenesis and latency in nonhuman primates (NHP resulted in persistent infection. More recent models successfully produced latency; however, only a minority of monkeys became viremic and seroconverted. Thus, previous NHP models were not ideally suited to analyze the immune response to SVV during acute infection and the transition to latency. Here, we show for the first time that intrabronchial inoculation of rhesus macaques with SVV closely mimics naturally occurring varicella (chickenpox in humans. Infected monkeys developed varicella and viremia that resolved 21 days after infection. Months later, viral DNA was detected only in ganglia and not in non-ganglionic tissues. Like VZV latency in human ganglia, transcripts corresponding to SVV ORFs 21, 62, 63 and 66, but not ORF 40, were detected by RT-PCR. In addition, as described for VZV, SVV ORF 63 protein was detected in the cytoplasm of neurons in latently infected monkey ganglia by immunohistochemistry. We also present the first in depth analysis of the immune response to SVV. Infected animals produced a strong humoral and cell-mediated immune response to SVV, as assessed by immunohistology, serology and flow cytometry. Intrabronchial inoculation of rhesus macaques with SVV provides a novel model to analyze viral and immunological mechanisms of VZV latency and reactivation.

Seneca Valley Virus Suppresses Host Type I Interferon Production by Targeting Adaptor Proteins MAVS, TRIF, and TANK for Cleavage.

Science.gov (United States)

Qian, Suhong; Fan, Wenchun; Liu, Tingting; Wu, Mengge; Zhang, Huawei; Cui, Xiaofang; Zhou, Yun; Hu, Junjie; Wei, Shaozhong; Chen, Huanchun; Li, Xiangmin; Qian, Ping

2017-08-15

Seneca Valley virus (SVV) is an oncolytic RNA virus belonging to the Picornaviridae family. Its nucleotide sequence is highly similar to those of members of the Cardiovirus genus. SVV is also a neuroendocrine cancer-selective oncolytic picornavirus that can be used for anticancer therapy. However, the interaction between SVV and its host is yet to be fully characterized. In this study, SVV inhibited antiviral type I interferon (IFN) responses by targeting different host adaptors, including mitochondrial antiviral signaling (MAVS), Toll/interleukin 1 (IL-1) receptor domain-containing adaptor inducing IFN-β (TRIF), and TRAF family member-associated NF-κB activator (TANK), via viral 3C protease (3C pro ). SVV 3C pro mediated the cleavage of MAVS, TRIF, and TANK at specific sites, which required its protease activity. The cleaved MAVS, TRIF, and TANK lost the ability to regulate pattern recognition receptor (PRR)-mediated IFN production. The cleavage of TANK also facilitated TRAF6-induced NF-κB activation. SVV was also found to be sensitive to IFN-β. Therefore, SVV suppressed antiviral IFN production to escape host antiviral innate immune responses by cleaving host adaptor molecules. IMPORTANCE Host cells have developed various defenses against microbial pathogen infection. The production of IFN is the first line of defense against microbial infection. However, viruses have evolved many strategies to disrupt this host defense. SVV, a member of the Picornavirus genus, is an oncolytic virus that shows potential functions in anticancer therapy. It has been demonstrated that IFN can be used in anticancer therapy for certain tumors. However, the relationship between oncolytic virus and innate immune response in anticancer therapy is still not well known. In this study, we showed that SVV has evolved as an effective mechanism to inhibit host type I IFN production by using its 3C pro to cleave the molecules MAVS, TRIF, and TANK directly. These molecules are crucial for

Wave energy devices with compressible volumes.

Science.gov (United States)

Kurniawan, Adi; Greaves, Deborah; Chaplin, John

2014-12-08

We present an analysis of wave energy devices with air-filled compressible submerged volumes, where variability of volume is achieved by means of a horizontal surface free to move up and down relative to the body. An analysis of bodies without power take-off (PTO) systems is first presented to demonstrate the positive effects a compressible volume could have on the body response. Subsequently, two compressible device variations are analysed. In the first variation, the compressible volume is connected to a fixed volume via an air turbine for PTO. In the second variation, a water column separates the compressible volume from another volume, which is fitted with an air turbine open to the atmosphere. Both floating and bottom-fixed, axisymmetric, configurations are considered, and linear analysis is employed throughout. Advantages and disadvantages of each device are examined in detail. Some configurations with displaced volumes less than 2000 m 3 and with constant turbine coefficients are shown to be capable of achieving 80% of the theoretical maximum absorbed power over a wave period range of about 4 s.

A pathway in the brainstem for roll-tilt of the subjective visual vertical: evidence from a lesion-behavior mapping study.

Science.gov (United States)

Baier, Bernhard; Thömke, Frank; Wilting, Janine; Heinze, Caroline; Geber, Christian; Dieterich, Marianne

2012-10-24

The perceived subjective visual vertical (SVV) is an important sign of a vestibular otolith tone imbalance in the roll plane. Previous studies suggested that unilateral pontomedullary brainstem lesions cause ipsiversive roll-tilt of SVV, whereas pontomesencephalic lesions cause contraversive roll-tilts of SVV. However, previous data were of limited quality and lacked a statistical approach. We therefore tested roll-tilt of the SVV in 79 human patients with acute unilateral brainstem lesions due to stroke by applying modern statistical lesion-behavior mapping analysis. Roll-tilt of the SVV was verified to be a brainstem sign, and for the first time it was confirmed statistically that lesions of the medial longitudinal fasciculus (MLF) and the medial vestibular nucleus are associated with ipsiversive tilt of the SVV, whereas contraversive tilts are associated with lesions affecting the rostral interstitial nucleus of the MLF, the superior cerebellar peduncle, the oculomotor nucleus, and the interstitial nucleus of Cajal. Thus, these structures constitute the anatomical pathway in the brainstem for verticality perception. Present data indicate that graviceptive otolith signals present a predominant role in the multisensory system of verticality perception.

Variations in Target Volume Definition for Postoperative Radiotherapy in Stage III Non-Small-Cell Lung Cancer: Analysis of an International Contouring Study

International Nuclear Information System (INIS)

Spoelstra, Femke; Senan, Suresh; Le Pechoux, Cecile; Ishikura, Satoshi; Casas, Francesc; Ball, David; Price, Allan; De Ruysscher, Dirk; Soernsen de Koste, John R. van

2010-01-01

Purpose: Postoperative radiotherapy (PORT) in patients with completely resected non-small-cell lung cancer with mediastinal involvement is controversial because of the failure of earlier trials to demonstrate a survival benefit. Improved techniques may reduce toxicity, but the treatment fields used in routine practice have not been well studied. We studied routine target volumes used by international experts and evaluated the impact of a contouring protocol developed for a new prospective study, the Lung Adjuvant Radiotherapy Trial (Lung ART). Methods and Materials: Seventeen thoracic radiation oncologists were invited to contour their routine clinical target volumes (CTV) for 2 representative patients using a validated CD-ROM-based contouring program. Subsequently, the Lung ART study protocol was provided, and both cases were contoured again. Variations in target volumes and their dosimetric impact were analyzed. Results: Routine CTVs were received for each case from 10 clinicians, whereas six provided both routine and protocol CTVs for each case. Routine CTVs varied up to threefold between clinicians, but use of the Lung ART protocol significantly decreased variations. Routine CTVs in a postlobectomy patient resulted in V 20 values ranging from 12.7% to 54.0%, and Lung ART protocol CTVs resulted in values of 20.6% to 29.2%. Similar results were seen for other toxicity parameters and in the postpneumectomy patient. With the exception of upper paratracheal nodes, protocol contouring improved coverage of the required nodal stations. Conclusion: Even among experts, significant interclinician variations are observed in PORT fields. Inasmuch as contouring variations can confound the interpretation of PORT results, mandatory quality assurance procedures have been incorporated into the current Lung ART study.

Variations of radon volume activities in soil and indoor air and their correlation

International Nuclear Information System (INIS)

Mojzes, A.

1998-01-01

Some manual measurements of volume activity of 222 Rn ai soil air and in indoor air of building together with parallel measurements of some meteorological parameters (temperature, humidity and pressure) of both atmospheric and indoor air were carried out. The measurements were performed in the building of Faculty and in its subsoil which consists of slope loams of the base of SW slopes of granitic Male Karpaty Mountains in the area of confluence of the Vidrica Creek with an arm of the Donau river. The monitoring measurements lasted form more than one and a half year, from January 1977 to August 1998, with the frequency of approximately once a week in each object. The soil air was taken from a permanently set up and sealed pipe from the depth of 0.8 m which was placed approximately 10 m from the building at the open air. All measurements of 222 Rn volume activities were performed with a portable fully automatic scintillation detector based on exchangeable Lucas cells. There were also performed the parallel measurements of some meteorological parameters (temperature, humidity and pressure) of air in each object. The geological basement of building is a source of indoor radon. The volume activities of soil 222 Rn range from about 2 kBq/m 3 to about 20 kBq/m 3 with the average of 9.26 kBq/m 3 and the standard deviation of 2.95 kBq/m 3 . The volume activities of indoor air in basement room were form 150 Bq/m 3 to 225 Bq/m 3 and on the third story they were from 125 Bq/m 3 to 175 Bq/m 3 (approximately). The results of monitoring measurements during 20 months period point out the intensity of interaction of geological substrate with building interior through the values of the volume activity of 222 Rn. Therefore a method of building foundation is one of the most important factors which determines the quantity of radon in indoor air. In the light of quality, the fluctuation of radon presence in the bottom part of the buildings is strongly determined by the variations of

THE EFFECT OF VOLUME VARIATION OF SILVER NANOPARTICLE SOLUTION TOWARDS THE POROSITY AND COMPRESSIVE STRENGTH OF MORTAR

Directory of Open Access Journals (Sweden)

W.S.B. Dwandaru

2016-10-01

Full Text Available As the world is growing rapidly, people need better building materials such as mortar. The aim of this research is to determine the effect of adding silver nanoparticle solution towards the porosity and compressive strength of mortar. This research was started by making silver nanoparticle solution from nitrate silver (AgNO3. The solution is then characterized using Uv-Vis spectrophotometer. 5 mM silver nanoparticle is added in the process of mortar production with volume variation of the silver nanoparticle solution. The porosity, compressive strength, and the content of mortar were determined by digital scale, universal testing machine, and X-ray diffraction, respectively. For silver nanoparticle solution volumes of (in mL 0, 5, 10, 15, 20, and 25 the porosity obtained are (in % 20.38, 19.48, 19.42, 18.9, 17.8, and 17.5, respectively. The best increase in compressive strength is obtained for (in MPa 29,068, 29,308, and 31,385, with nanoparticle solution volumes of (in mL 5, 10, and 15   Keywords: mortar, silver nanoparticle, compressive strength

Spatial and temporal variation of residence time and storage volume of subsurface water evaluated by multi-tracers approach in mountainous headwater catchments

Science.gov (United States)

Tsujimura, Maki; Yano, Shinjiro; Abe, Yutaka; Matsumoto, Takehiro; Yoshizawa, Ayumi; Watanabe, Ysuhito; Ikeda, Koichi

2015-04-01

Headwater catchments in mountainous region are the most important recharge area for surface and subsurface waters, additionally time and stock information of the water is principal to understand hydrological processes in the catchments. However, there have been few researches to evaluate variation of residence time and storage volume of subsurface water in time and space at the mountainous headwaters especially with steep slope. We performed an investigation on age dating and estimation of storage volume using simple water budget model in subsurface water with tracing of hydrological flow processes in mountainous catchments underlain by granite, Paleozoic and Tertiary, Yamanashi and Tsukuba, central Japan. We conducted hydrometric measurements and sampling of spring, stream and ground waters in high-flow and low-flow seasons from 2008 through 2012 in the catchments, and CFCs, stable isotopic ratios of oxygen-18 and deuterium, inorganic solute constituent concentrations were determined on all water samples. Residence time of subsurface water ranged from 11 to 60 years in the granite catchments, from 17 to 32 years in the Paleozoic catchments, from 13 to 26 years in the Tertiary catchments, and showed a younger age during the high-flow season, whereas it showed an older age in the low-flow season. Storage volume of subsurface water was estimated to be ranging from 10 ^ 4 to 10 ^ 6 m3 in the granite catchments, from 10 ^ 5 to 10 ^ 7 m3 in the Paleozoic catchments, from 10 ^ 4 to 10 ^ 6 m3 in the Tertiary catchments. In addition, seasonal change of storage volume in the granite catchments was the highest as compared with those of the Paleozoic and the Tertiary catchments. The results suggest that dynamic change of hydrological process seems to cause a larger variation of the residence time and storage volume of subsurface water in time and space in the granite catchments, whereas higher groundwater recharge rate due to frequent fissures or cracks seems to cause larger

Variational Monte Carlo Technique

Indian Academy of Sciences (India)

Home; Journals; Resonance – Journal of Science Education; Volume 19; Issue 8. Variational Monte Carlo Technique: Ground State Energies of Quantum Mechanical Systems. Sukanta Deb. General Article Volume 19 Issue 8 August 2014 pp 713-739 ...

Inter fraction variations in rectum and bladder volumes and dose distributions during high dose rate brachytherapy treatment of the uterine cervix investigated by repetitive CT-examinations

International Nuclear Information System (INIS)

Hellebust, Taran Paulsen; Dale, Einar; Skjoensberg, Ane; Olsen, Dag Rune

2001-01-01

Purpose: To evaluate variation of dose to organs at risk for patients receiving fractionated high dose rate gynaecological brachytherapy by using CT-based 3D treatment planning and dose-volume histograms (DVH). Materials and methods: Fourteen patients with cancer of the uterine cervix underwent three to six CT examinations (mean 4.9) during their course of high-dose-rate brachytherapy using radiographically compatible applicators. The rectal and bladder walls were delineated and DVHs were calculated. Results: Inter fraction variation of the bladder volume (CV mean =44.1%) was significantly larger than the inter fraction variation of the mean dose (CV mean =19.9%, P=0.005) and the maximum dose (CV mean =17.5%, P=0.003) of the bladder wall. The same trend was seen for rectum, although the figures were not significantly different. Performing CT examinations at four of seven brachytherapy fractions reduced the uncertainty to 4 and 7% for the bladder and rectal doses, respectively. A linear regression analysis showed a significant, negative relationship between time after treatment start and the whole bladder volume (P=0.018), whereas no correlation was found for the rectum. For both rectum and bladder a linear regression analysis revealed a significant, negative relationship between the whole volume and median dose (P<0.05). Conclusion: Preferably a CT examination should be provided at every fraction. However, this is logistically unfeasible in most institutions. To obtain reliable DVHs the patients will in the future undergo 3-4 CT examinations during the course of brachytherapy at our institution. Since this study showed an association between large bladder volumes and dose reductions, the patients will be treated with a standardized bladder volume

Goal-directed fluid optimization based on stroke volume variation and cardiac index during one-lung ventilation in patients undergoing thoracoscopy lobectomy operations: a pilot study

Directory of Open Access Journals (Sweden)

Jian Zhang

2013-07-01

Full Text Available OBJECTIVES: This pilot study was designed to utilize stroke volume variation and cardiac index to ensure fluid optimization during one-lung ventilation in patients undergoing thoracoscopic lobectomies. METHODS: Eighty patients undergoing thoracoscopic lobectomy were randomized into either a goal-directed therapy group or a control group. In the goal-directed therapy group, the stroke volume variation was controlled at 10%±1%, and the cardiac index was controlled at a minimum of 2.5 L.min-1.m-2. In the control group, the MAP was maintained at between 65 mm Hg and 90 mm Hg, heart rate was maintained at between 60 BPM and 100 BPM, and urinary output was greater than 0.5 mL/kg-1/h-1. The hemodynamic variables, arterial blood gas analyses, total administered fluid volume and side effects were recorded. RESULTS: The PaO2/FiO2-ratio before the end of one-lung ventilation in the goal-directed therapy group was significantly higher than that of the control group, but there were no differences between the goal-directed therapy group and the control group for the PaO2/FiO2-ratio or other arterial blood gas analysis indices prior to anesthesia. The extubation time was significantly earlier in the goal-directed therapy group, but there was no difference in the length of hospital stay. Patients in the control group had greater urine volumes, and they were given greater colloid and overall fluid volumes. Nausea and vomiting were significantly reduced in the goal-directed therapy group. CONCLUSION: The results of this study demonstrated that an optimization protocol, based on stroke volume variation and cardiac index obtained with a FloTrac/Vigileo device, increased the PaO2/FiO2-ratio and reduced the overall fluid volume, intubation time and postoperative complications (nausea and vomiting in thoracic surgery patients requiring one-lung ventilation.

PPARα L162V underlies variation in serum triglycerides and subcutaneous fat volume in young males

Directory of Open Access Journals (Sweden)

Clarkson Priscilla M

2007-08-01

Full Text Available Abstract Background Of the five sub-phenotypes defining metabolic syndrome, all are known to have strong genetic components (typically 50–80% of population variation. Studies defining genetic predispositions have typically focused on older populations with metabolic syndrome and/or type 2 diabetes. We hypothesized that the study of younger populations would mitigate many confounding variables, and allow us to better define genetic predisposition loci for metabolic syndrome. Methods We studied 610 young adult volunteers (average age 24 yrs for metabolic syndrome markers, and volumetric MRI of upper arm muscle, bone, and fat pre- and post-unilateral resistance training. Results We found the PPARα L162V polymorphism to be a strong determinant of serum triglyceride levels in young White males, where carriers of the V allele showed 78% increase in triglycerides relative to L homozygotes (LL = 116 ± 11 mg/dL, LV = 208 ± 30 mg/dL; p = 0.004. Men with the V allele showed lower HDL (LL = 42 ± 1 mg/dL, LV = 34 ± 2 mg/dL; p = 0.001, but women did not. Subcutaneous fat volume was higher in males carrying the V allele, however, exercise training increased fat volume of the untrained arm in V carriers, while LL genotypes significantly decreased in fat volume (LL = -1,707 ± 21 mm3, LV = 17,617 ± 58 mm3 ; p = 0.002, indicating a systemic effect of the V allele on adiposity after unilateral training. Our study suggests that the primary effect of PPARα L162V is on serum triglycerides, with downstream effects on adiposity and response to training. Conclusion Our results on association of PPARα and triglycerides in males showed a much larger effect of the V allele than previously reported in older and less healthy populations. Specifically, we showed the V allele to increase triglycerides by 78% (p = 0.004, and this single polymorphism accounted for 3.8% of all variation in serum triglycerides in males (p = 0.0037.

High variability of the subjective visual vertical test of vertical perception, in some people with neck pain - Should this be a standard measure of cervical proprioception?

Science.gov (United States)

Treleaven, Julia; Takasaki, Hiroshi

2015-02-01

Subjective visual vertical (SVV) assesses visual dependence for spacial orientation, via vertical perception testing. Using the computerized rod-and-frame test (CRFT), SVV is thought to be an important measure of cervical proprioception and might be greater in those with whiplash associated disorder (WAD), but to date research findings are inconsistent. The aim of this study was to investigate the most sensitive SVV error measurement to detect group differences between no neck pain control, idiopathic neck pain (INP) and WAD subjects. Cross sectional study. Neck Disability Index (NDI), Dizziness Handicap Inventory short form (DHIsf) and the average constant error (CE), absolute error (AE), root mean square error (RMSE), and variable error (VE) of the SVV were obtained from 142 subjects (48 asymptomatic, 36 INP, 42 WAD). The INP group had significantly (p pain or dizziness handicap. These findings are inconsistent with other measures of cervical proprioception in neck pain and more research is required before the SVV can be considered an important measure and utilized clinically. Crown Copyright © 2014. Published by Elsevier Ltd. All rights reserved.

Development of a novel real-time RT-PCR assay to detect Seneca Valley virus-1 associated with emerging cases of vesicular disease in pigs.

Science.gov (United States)

Fowler, Veronica L; Ransburgh, Russell H; Poulsen, Elizabeth G; Wadsworth, Jemma; King, Donald P; Mioulet, Valerie; Knowles, Nick J; Williamson, Susanna; Liu, Xuming; Anderson, Gary A; Fang, Ying; Bai, Jianfa

2017-01-01

Seneca Valley virus 1 (SVV-1) can cause vesicular disease that is clinically indistinguishable from foot-and-mouth disease, vesicular stomatitis and swine vesicular disease. SVV-1-associated disease has been identified in pigs in several countries, namely USA, Canada, Brazil and China. Diagnostic tests are required to reliably detect this emerging virus, and this report describes the development and evaluation of a novel real-time (r) reverse-transcription (RT) PCR assay (rRT-PCR), targeting the viral polymerase gene (3D) of SVV-1. This new assay detected all historical and contemporary SVV-1 isolates examined (n=8), while no cross-reactivity was observed with nucleic acid templates prepared from other vesicular disease viruses or common swine pathogens. The analytical sensitivity of the rRT-PCR was 0.79 TCID 50 /ml and the limit of detection was equivalent using two different rRT-PCR master-mixes. The performance of the test was further evaluated using pig nasal (n=25) and rectal swab samples (n=25), where concordant results compared to virus sequencing were generated for 43/50 samples. The availability of this assay, will enable laboratories to rapidly detect SVV-1 in cases of vesicular disease in pigs, negated for notifiable diseases, and could enable existing knowledge gaps to be investigated surrounding the natural epidemiology of SVV-1. Copyright © 2016 Elsevier B.V. All rights reserved.

Shear Wave Elastography of the Spleen for Monitoring Transjugular Intrahepatic Portosystemic Shunt Function: A Pilot Study.

Science.gov (United States)

Gao, Jing; Zheng, Xiao; Zheng, Yuan-Yi; Zuo, Guo-Qing; Ran, Hai-Tao; Auh, Yong Ho; Waldron, Levi; Chan, Tiffany; Wang, Zhi-Gang

2016-05-01

To assess the feasibility of splenic shear wave elastography in monitoring transjugular intrahepatic portosystemic shunt (TIPS) function. We measured splenic shear wave velocity (SWV), main portal vein velocity (PVV), and splenic vein velocity (SVV) in 33 patients 1 day before and 3 days to 12 months after TIPS placement. We also measured PVV, SVV, and SWV in 10 of 33 patients with TIPS dysfunction 1 day before and 3 to 6 days after TIPS revision. Analyses included differences in portosystemic pressure gradient (PPG), PVV, SVV, and mean SWV before and after TIPS procedures; comparison of median SWV before and after TIPS procedures; differences in PVV, SVV, and SWV before and at different times up to 12 months after TIPS placement; accuracy of PVV, SVV, and SWV in determining TIPS dysfunction; and correlation between PPG and SWV. During 12 months of follow-up, 23 of 33 patients had functioning TIPS, and 10 had TIPS dysfunction. The median SWV was significantly different before and after primary TIPS placement (3.60 versus 3.05 m/s; P = .005), as well as before and after revision (3.73 versus 3.06 m/s; P = .003). The PPG, PVV, and SVV were also significantly different before and after TIPS placement and revision (P function and determining TIPS dysfunction. © 2016 by the American Institute of Ultrasound in Medicine.

Vestibulocerebellar disease impairs the central representation of self-orientation

Directory of Open Access Journals (Sweden)

Alexander A Tarnutzer

2011-02-01

Full Text Available Transformation of head-fixed otolith signals into a space-fixed frame of reference is essential for perception of self-orientation and ocular motor control. In monkeys the nodulus and ventral uvula of the vestibulo-cerebellum facilitate this transformation by computing an internal estimate of direction of gravity. These experimental findings motivated the hypothesis that degeneration of the vestibulo-cerebellum in humans alter perceptual and ocular motor functions that rely on accurate estimates of gravity, such as subjective visual vertical (SVV, static ocular counterroll (OCR, and gravity-dependent modulation of vertical ocular drifts. We assessed the SVV, OCR, and spontaneous vertical ocular drifts in 12 patients with chronic vestibulo-cerebellar disease and in ten controls. Substantially increased variability in estimated SVV was noted in the patients. Furthermore, gravity-dependent modulation of spontaneous vertical ocular drifts along the pitch plane was significantly (p < 0.05 larger in the patients. However, the gain and variability of static OCR and errors in SVV were not significantly different. In conclusion, in chronic vestibulo-cerebellar disease SVV and OCR remain intact except for an abnormal variability in the perception of verticality and impaired stabilization of gaze mediated by the otoliths. These findings suggest that OCR and perceived vertical are relatively independent from the cerebellum unless there is a cerebellar imbalance like an acute unilateral cerebellar stroke. The increased trial-to-trial SVV variability may be a general feature of cerebellar disease since a function of the cerebellum may be to compensate for such. SVV variability might be useful to monitor disease progression and treatment response in patients.

Prostate Contouring Variation: Can It Be Fixed?

International Nuclear Information System (INIS)

Khoo, Eric L.H.; Schick, Karlissa; Plank, Ashley W.; Poulsen, Michael; Wong, Winnie W.G.; Middleton, Mark; Martin, Jarad M.

2012-01-01

Purpose: To assess whether an education program on CT and MRI prostate anatomy would reduce inter- and intraobserver prostate contouring variation among experienced radiation oncologists. Methods and Materials: Three patient CT and MRI datasets were selected. Five radiation oncologists contoured the prostate for each patient on CT first, then MRI, and again between 2 and 4 weeks later. Three education sessions were then conducted. The same contouring process was then repeated with the same datasets and oncologists. The observer variation was assessed according to changes in the ratio of the encompassing volume to intersecting volume (volume ratio [VR]), across sets of target volumes. Results: For interobserver variation, there was a 15% reduction in mean VR with CT, from 2.74 to 2.33, and a 40% reduction in mean VR with MRI, from 2.38 to 1.41 after education. A similar trend was found for intraobserver variation, with a mean VR reduction for CT and MRI of 9% (from 1.51 to 1.38) and 16% (from 1.37 to 1.15), respectively. Conclusion: A well-structured education program has reduced both inter- and intraobserver prostate contouring variations. The impact was greater on MRI than on CT. With the ongoing incorporation of new technologies into routine practice, education programs for target contouring should be incorporated as part of the continuing medical education of radiation oncologists.

Patients with migraine correctly estimate the visual verticality.

Science.gov (United States)

Crevits, Luc; Vanacker, Leen; Verraes, Anouk

2012-05-01

We wanted to study otolith function by measuring the static subjective visual vertical (SVV) in migraine patients and in controls with and without kinetosis (motion sickness). Forty-seven patients with moderately severe migraine and 96 healthy controls were enrolled. Using a questionnaire, persons with kinetosis were identified. The SVV test was performed in a totally dark room. Subjects wore a stiffneck to stabilize the head in an erect position. They were required to adjust an infrared line to the gravitational vertical with a hand-held infrared remote controlled potentiometer. The deviation of SVV in the group of migraine patients was not significantly different from that of controls, regardless of whether an aura was associated. SVV was not significantly influenced by the presence of dizziness/non specific vertigo or kinetosis. Patients with moderately severe migraine under prophylactic medication correctly estimate the visual verticality in the headache-free period. It is suggested that a deviation of SVV in a headache-free migraine patient may not be attributed to his migraine disorder as such regardless whether kinetosis is associated. Copyright © 2011 Elsevier B.V. All rights reserved.

A comparative study of set up variations and bowel volumes in supine versus prone positions of patients treated with external beam radiation for carcinoma rectum.

Science.gov (United States)

Rajeev, K R; Menon, Smrithy S; Beena, K; Holla, Raghavendra; Kumar, R Rajaneesh; Dinesh, M

2014-01-01

A prospective study was undertaken to evaluate the influence of patient positioning on the set up variations to determine the planning target volume (PTV) margins and to evaluate the clinical relevance volume assessment of the small bowel (SB) within the irradiated volume. During the period of months from December 2011 to April 2012, a computed tomography (CT) scan was done either in supine position or in prone position using a belly board (BB) for 20 consecutive patients. All the patients had histologically proven rectal cancer and received either post- or pre-operative pelvic irradiation. Using a three-dimensional planning system, the dose-volume histogram for SB was defined in each axial CT slice. Total dose was 46-50 Gy (2 Gy/fraction), delivered using the 4-field box technique. The set up variation of the study group was assessed from the data received from the electronic portal imaging device in the linear accelerator. The shift along X, Y, and Z directions were noted. Both systematic and random errors were calculated and using both these values the PTV margin was calculated. The systematic errors of patients treated in the supine position were 0.87 (X-mm), 0.66 (Y-mm), 1.6 (Z-mm) and in the prone position were 1.3 (X-mm), 0.59 (Y-mm), 1.17 (Z-mm). The random errors of patients treated in the supine positions were 1.81 (X-mm), 1.73 (Y-mm), 1.83 (Z-mm) and in prone position were 2.02 (X-mm), 1.21 (Y-mm), 3.05 (Z-mm). The calculated PTV margins in the supine position were 3.45 (X-mm), 2.87 (Y-mm), 5.31 (Z-mm) and in the prone position were 4.91 (X-mm), 2.32 (Y-mm), 5.08 (Z-mm). The mean volume of the peritoneal cavity was 648.65 cm 3 in the prone position and 1197.37 cm 3 in the supine position. The prone position using BB device was more effective in reducing irradiated SB volume in rectal cancer patients. There were no significant variations in the daily set up for patients treated in both supine and prone positions.

Variation of Red Blood Cell Distribution Width and Mean Platelet Volume after Moderate Endurance Exercise

Directory of Open Access Journals (Sweden)

Giuseppe Lippi

2014-01-01

Full Text Available Although physical exercise strongly influences several laboratory parameters, data about the hematological changes after medium distance running are scarce. We studied 31 middle-trained athletes (mean training regimen 217±32 min/week who performed a 21.1 km, half-marathon run. Blood samples were collected before the run, at the end, and 3 and 20 hours thereafter. The complete blood count was performed on Advia 2120 and included red blood cell (RBC, reticulocyte, and platelet counts; hemoglobin; mean corpuscular volume (MCV; mean corpuscular hemoglobin (MCH; reticulocyte haemoglobin content (Ret CHR; RBC distribution width (RDW, mean platelet volume (MPV. No significant variations were observed for MCH and Ret CHR. The RBC, reticulocyte, and hemoglobin values modestly decreased after the run. The MCV significantly increased at the end of running but returned to baseline 3 hours thereafter. The RDW constantly increased, reaching a peak 20 hours after the run. The platelet count and MPV both increased after the run and returned to baseline 3 hours thereafter. These results may have implications for definition of reference ranges and antidoping testing, and may also contribute to explaining the relationship between endurance exercise and mortality, since previous studies reported that RDW and MPV may be significantly associated with cardiovascular disease.

Bladder filling variation during conformal radiotherapy for rectal cancer

Science.gov (United States)

Sithamparam, S.; Ahmad, R.; Sabarudin, A.; Othman, Z.; Ismail, M.

2017-05-01

Conformal radiotherapy for rectal cancer is associated with small bowel toxicity mainly diarrhea. Treating patients with a full bladder is one of the practical solutions to reduce small bowel toxicity. Previous studies on prostate and cervix cancer patients revealed that maintaining consistent bladder volume throughout radiotherapy treatment is challenging. The aim of this study was to measure bladder volume variation throughout radiotherapy treatment. This study also measured the association between bladder volume changes and diarrhea. Twenty two rectal cancer patients were recruited prospectively. Patients were planned for treatment with full bladder following departmental bladder filling protocol and the planning bladder volume was measured during CT-simulation. During radiotherapy, the bladder volume was measured weekly using cone-beam computed tomography (CBCT) and compared to planning bladder volume. Incidence and severity of diarrhea were recorded during the weekly patient review. There was a negative time trend for bladder volume throughout five weeks treatment. The mean bladder volume decreased 18 % from 123 mL (SD 54 mL) during CT-simulation to 101 mL (SD 71 mL) on the 5th week of radiotherapy, but the decrease is not statistically significant. However, there was a large variation of bladder volume within each patient during treatment. This study showed an association between changes of bladder volume and diarrhea (P = 0.045). In conclusion bladder volume reduced throughout radiotherapy treatment for conformal radiotherapy for rectal cancer and there was a large variation of bladder volume within patients.

Bladder filling variation during conformal radiotherapy for rectal cancer

International Nuclear Information System (INIS)

Sithamparam, S; Ahmad, R; Sabarudin, A; Othman, Z; Ismail, M

2017-01-01

Conformal radiotherapy for rectal cancer is associated with small bowel toxicity mainly diarrhea. Treating patients with a full bladder is one of the practical solutions to reduce small bowel toxicity. Previous studies on prostate and cervix cancer patients revealed that maintaining consistent bladder volume throughout radiotherapy treatment is challenging. The aim of this study was to measure bladder volume variation throughout radiotherapy treatment. This study also measured the association between bladder volume changes and diarrhea. Twenty two rectal cancer patients were recruited prospectively. Patients were planned for treatment with full bladder following departmental bladder filling protocol and the planning bladder volume was measured during CT-simulation. During radiotherapy, the bladder volume was measured weekly using cone-beam computed tomography (CBCT) and compared to planning bladder volume. Incidence and severity of diarrhea were recorded during the weekly patient review. There was a negative time trend for bladder volume throughout five weeks treatment. The mean bladder volume decreased 18 % from 123 mL (SD 54 mL) during CT-simulation to 101 mL (SD 71 mL) on the 5th week of radiotherapy, but the decrease is not statistically significant. However, there was a large variation of bladder volume within each patient during treatment. This study showed an association between changes of bladder volume and diarrhea (P = 0.045). In conclusion bladder volume reduced throughout radiotherapy treatment for conformal radiotherapy for rectal cancer and there was a large variation of bladder volume within patients. (paper)

Avaliação da vertical visual subjetiva em indivíduos brasileiros normais Subjective visual vertical evaluation in normal Brazilian subjects

Directory of Open Access Journals (Sweden)

Aline M. Kozoroski Kanashiro

2007-06-01

Full Text Available A função otolítica pode ser avaliada pela Vertical Visual Subjetiva (VVS que determina a capacidade de um indivíduo julgar se objetos estão na posição vertical na ausência de outras referências visuais. O objetivo deste estudo foi avaliar a VVS em indivíduos brasileiros normais usando um aparelho portátil. As medidas da VVS foram realizadas em 160 indivíduos (16 a 85 anos. O valor médio da VVS foi obtido após dez ajustes. A VVS teve valores médios entre -2,0º e +2,4º (média=0,18º, e DP=0,77º. Não houve diferença entre as médias da VVS em relação à idade (teste de Kruskal-Wallis; p=0,40, mas as faixas etárias maiores tiveram variância maior (teste de Levene; p=0,016. Os valores da VVS encontrados neste estudo foram semelhantes aos registrados na literatura. Não houve diferença nas médias das inclinações da VVS de acordo com a idade, mas foi encontrada maior variância entre indivíduos mais idosos.Otolith function can be evaluated by subjective visual vertical (SVV that determine the capacity of a subject to judge if the objects are on vertical position with absence of any visual reference. The aim of this study was to evaluate the SVV in a sample of normal Brazilian subjects using a portable device. Measurements of SVV were performed in 160 normal subjects (aged from 16 to 85. SVV mean value was obtained after ten adjustments. SVV mean values ranged from -2.0º to +2.4º (mean=0.18º, and SD=0.77. Considering all age groups, there was no difference of SVV mean values (Kruskal-Wallis test; p=0.40, but older groups had a greater variance (Levene test; p=0.016. SVV values observed in this study are comparable to those described in previous studies. Although there was no difference in mean SVV-inclination according to age, there was a greater variance in older subjects.

The KNICS approach for verification and validation of safety software

International Nuclear Information System (INIS)

Cha, Kyung Ho; Sohn, Han Seong; Lee, Jang Soo; Kim, Jang Yeol; Cheon, Se Woo; Lee, Young Joon; Hwang, In Koo; Kwon, Kee Choon

2003-01-01

This paper presents verification and validation (VV) to be approached for safety software of POSAFE-Q Programmable Logic Controller (PLC) prototype and Plant Protection System (PPS) prototype, which consists of Reactor Protection System (RPS) and Engineered Safety Features-Component Control System (ESF-CCS) in development of Korea Nuclear Instrumentation and Control System (KNICS). The SVV criteria and requirements are selected from IEEE Std. 7-4.3.2, IEEE Std. 1012, IEEE Std. 1028 and BTP-14, and they have been considered for acceptance framework to be provided within SVV procedures. SVV techniques, including Review and Inspection (R and I), Formal Verification and Theorem Proving, and Automated Testing, are applied for safety software and automated SVV tools supports SVV tasks. Software Inspection Support and Requirement Traceability (SIS-RT) supports R and I and traceability analysis, a New Symbolic Model Verifier (NuSMV), Statemate MAGNUM (STM) ModelCertifier, and Prototype Verification System (PVS) are used for formal verification, and McCabe and Cantata++ are utilized for static and dynamic software testing. In addition, dedication of Commercial-Off-The-Shelf (COTS) software and firmware, Software Safety Analysis (SSA) and evaluation of Software Configuration Management (SCM) are being performed for the PPS prototype in the software requirements phase

Effect of Postural Control Demands on Early Visual Evoked Potentials during a Subjective Visual Vertical Perception Task in Adolescents with Idiopathic Scoliosis.

Science.gov (United States)

Chang, Yi-Tzu; Meng, Ling-Fu; Chang, Chun-Ju; Lai, Po-Liang; Lung, Chi-Wen; Chern, Jen-Suh

2017-01-01

Subjective visual vertical (SVV) judgment and standing stability were separately investigated among patients with adolescent idiopathic scoliosis (AIS). Although, one study has investigated the central mechanism of stability control in the AIS population, the relationships between SVV, decreased standing stability, and AIS have never been investigated. Through event-related potentials (ERPs), the present study examined the effect of postural control demands (PDs) on AIS central mechanisms related to SVV judgment and standing stability to elucidate the time-serial stability control process. Thirteen AIS subjects (AIS group) and 13 age-matched adolescents (control group) aged 12-18 years were recruited. Each subject had to complete an SVV task (i.e., the modified rod-and-frame [mRAF] test) as a stimulus, with online electroencephalogram recording being performed in the following three standing postures: feet shoulder-width apart standing, feet together standing, and tandem standing. The behavioral performance in terms of postural stability (center of pressure excursion), SVV (accuracy and reaction time), and mRAF-locked ERPs (mean amplitude and peak latency of the P1, N1, and P2 components) was then compared between the AIS and control groups. In the behavioral domain, the results revealed that only the AIS group demonstrated a significantly accelerated SVV reaction time as the PDs increased. In the cerebral domain, significantly larger P2 mean amplitudes were observed during both feet shoulder-width-apart standing and feet together standing postures compared with during tandem standing. No group differences were noted in the cerebral domain. The results indicated that (1) during the dual-task paradigm, a differential behavioral strategy of accelerated SVV reaction time was observed in the AIS group only when the PDs increased and (2) the decrease in P2 mean amplitudes with the increase in the PD levels might be direct evidence of the competition for central

Effect of Postural Control Demands on Early Visual Evoked Potentials during a Subjective Visual Vertical Perception Task in Adolescents with Idiopathic Scoliosis

Directory of Open Access Journals (Sweden)

Yi-Tzu Chang

2017-06-01

Full Text Available Subjective visual vertical (SVV judgment and standing stability were separately investigated among patients with adolescent idiopathic scoliosis (AIS. Although, one study has investigated the central mechanism of stability control in the AIS population, the relationships between SVV, decreased standing stability, and AIS have never been investigated. Through event-related potentials (ERPs, the present study examined the effect of postural control demands (PDs on AIS central mechanisms related to SVV judgment and standing stability to elucidate the time-serial stability control process. Thirteen AIS subjects (AIS group and 13 age-matched adolescents (control group aged 12–18 years were recruited. Each subject had to complete an SVV task (i.e., the modified rod-and-frame [mRAF] test as a stimulus, with online electroencephalogram recording being performed in the following three standing postures: feet shoulder-width apart standing, feet together standing, and tandem standing. The behavioral performance in terms of postural stability (center of pressure excursion, SVV (accuracy and reaction time, and mRAF-locked ERPs (mean amplitude and peak latency of the P1, N1, and P2 components was then compared between the AIS and control groups. In the behavioral domain, the results revealed that only the AIS group demonstrated a significantly accelerated SVV reaction time as the PDs increased. In the cerebral domain, significantly larger P2 mean amplitudes were observed during both feet shoulder-width-apart standing and feet together standing postures compared with during tandem standing. No group differences were noted in the cerebral domain. The results indicated that (1 during the dual-task paradigm, a differential behavioral strategy of accelerated SVV reaction time was observed in the AIS group only when the PDs increased and (2 the decrease in P2 mean amplitudes with the increase in the PD levels might be direct evidence of the competition for

[The predictive value of dynamic arterial elastance in arterial pressure response after norepinephrine dosage reduction in patients with septic shock].

Science.gov (United States)

Liang, F M; Yang, T; Dong, L; Hui, J J; Yan, J

2017-05-01

Objective: To assess whether dynamic arterial elastance(Ea(dyn))can be used to predict the reduction of arterial pressure after decreasing norepinephrine (NE) dosage in patients with septic shock. Methods: A prospective observational cohort study was conducted. Thirty-two patients with septic shock and mechanical ventilationwere enrolledfrom January 2014 to December 2015 in ICU of Wuxi People's Hospital of Nanjing Medical University. Hemodynamic parameters were recorded by pulse contour cardiac output(PiCCO)monitoring technology before and after decreasing norepinephrine dosage. Ea(dyn) was defined as the ratio of pulse pressure variation (PPV) to stroke volume variation (SVV). Mean arterial pressure(MAP) variation was calculated after decreasing the dose of NE. Response was defined as a ≥15% decrease of MAP. AUC was plotted to assess the value of Ea(dyn) in predicting MAP response. Results: A total of 32 patients were enrolled in our study, with 13 responding to NE dose decrease where as the other 19 did not. Ea(dyn) was lower in responders than in nonresponders (0.77±0.13 vs 1.09±0.31, P blood pressure variation, diastolic blood pressure variation, systemic vascular resistance variation and MAP variation( r =0.621, P =0.000; r =0.735, P =0.000; r =0.756, P =0.000; r =0.568, P =0.000 respectively). However, stoke volume variation, baseline level of systemic vascular resistance and NE baseline dose were not correlated with Ea(dyn) baseline value( r =0.264, P =0.076; r =0.078, P =0.545; r =0.002, P =0.987 respectively). Ea(dyn)≤0.97 predicted a decrease of MAP when decreasing NE dose, with an area under the receiver-operating characteristic curve of 0.85.The sensitivity was 100.0% and specificity was 73.7%. Conclusions: In septic shock patients treated with NE, Ea(dyn) is an index to predict the decrease of arterial pressure in response to NE dose reduction.

Price-volume multifractal analysis and its application in Chinese stock markets

Science.gov (United States)

Yuan, Ying; Zhuang, Xin-tian; Liu, Zhi-ying

2012-06-01

An empirical research on Chinese stock markets is conducted using statistical tools. First, the multifractality of stock price return series, ri(ri=ln(Pt+1)-ln(Pt)) and trading volume variation series, vi(vi=ln(Vt+1)-ln(Vt)) is confirmed using multifractal detrended fluctuation analysis. Furthermore, a multifractal detrended cross-correlation analysis between stock price return and trading volume variation in Chinese stock markets is also conducted. It is shown that the cross relationship between them is also found to be multifractal. Second, the cross-correlation between stock price Pi and trading volume Vi is empirically studied using cross-correlation function and detrended cross-correlation analysis. It is found that both Shanghai stock market and Shenzhen stock market show pronounced long-range cross-correlations between stock price and trading volume. Third, a composite index R based on price and trading volume is introduced. Compared with stock price return series ri and trading volume variation series vi, R variation series not only remain the characteristics of original series but also demonstrate the relative correlation between stock price and trading volume. Finally, we analyze the multifractal characteristics of R variation series before and after three financial events in China (namely, Price Limits, Reform of Non-tradable Shares and financial crisis in 2008) in the whole period of sample to study the changes of stock market fluctuation and financial risk. It is found that the empirical results verified the validity of R.

Physical Therapy Provision in Multiple Sclerosis Across Europe: A Regional Lottery?

Czech Academy of Sciences Publication Activity Database

Řasová, K.; Martinková, Patrícia; Pavlíková, M.; Cattaneo, D.; Jonsdottir, J.; Henze, T.; Baert, I.; Van Asch, P.; Santoyo, C.; Smedal, T.; Beiske, A.G.; Stachowiak, M.; Kovalewski, M.; Nedeljkovic, U.; Bakalidou, D.; Alves-Guerreiro, J.; Nilsagard, Y.; Dimitrova, E.N.; Habek, M.; Armutlu, K.; Donzé, C.; Ross, E.; Ilie, A.M.; Martic, A.; Freeman, J.; Romberg, A.; Feys, P.

2015-01-01

Roč. 51, č. 6 (2015), s. 850-852 ISSN 1973-9087 Grant - others:GA UK(CZ) 260045/SVV/2014; GA UK(CZ) 260168/SVV/2015; Univerzita Karlova(CZ) Prvouk P34 Institutional support: RVO:67985807 Keywords : organisation of physical therapy * multiple sclerosis Subject RIV: FH - Neurology Impact factor: 2.063, year: 2015

Small-Volume Injections: Evaluation of Volume Administration Deviation From Intended Injection Volumes.

Science.gov (United States)

Muffly, Matthew K; Chen, Michael I; Claure, Rebecca E; Drover, David R; Efron, Bradley; Fitch, William L; Hammer, Gregory B

2017-10-01

regression model. Analysis of variance was used to determine whether the absolute log proportional error differed by the intended injection volume. Interindividual and intraindividual deviation from the intended injection volume was also characterized. As the intended injection volumes decreased, the absolute log proportional injection volume error increased (analysis of variance, P standard deviations of the log proportional errors for injection volumes between physicians and pediatric PACU nurses; however, the difference in absolute bias was significantly higher for nurses with a 2-sided significance of P = .03. Clinically significant dose variation occurs when injecting volumes ≤0.5 mL. Administering small volumes of medications may result in unintended medication administration errors.

Impact of electromechanical parameter variations in treatment volume doses and adjacent structures; Impacto da variacao dos parametros eletro-mecanicos nas doses do volume de tratamento e nas estruturas adjacentes

Energy Technology Data Exchange (ETDEWEB)

Morais, M.E.; Campos, A.M. [Instituto Nacional do Cancer (INCa), Rio de Janeiro, RJ (Brazil). Programa de Qualidade em Radioterapia]. E-mails: memorais@yahoo.com.br; amcampos@inca.gov.br; Goncalves, J. F. [Instituto de Oncologia e Radioterapia GV, Governador Valadares, MG (Brazil)]. E-mail: joelfgoncalves@yahoo.com.br; Ferreira, M.L. [Centro Radioterapico Gavea, Rio de Janeiro, RJ (Brazil)]. E-mail: mluciaf@yahoo.com

2003-07-01

ICRU Report 62 recommends that radiotherapy treatment dose should be prescribed in such a way that the dose to the target volume varies no more than 10%. In order to keep this goal, a very important role is played by the quality assurance (QA) of the treatment unit associated to the high level work of the personnel involved in planning and patient treatment. This paper shows the influence of the main electrical and mechanical linear accelerator parameters: field size, source-skin distance, gantry angle and light x radiation field coincidence in tumor volume and adjacent organ doses. We simulated a cubic tumor and a cubic adjacent critical organ in a cubic phantom and used a 3D Prowess system for planning. The treatment has been simulated for a 6 MV linear accelerator. We simulated two treatment planning: one using all the parameters inside their tolerance limits and another doubling these limits. The final results have show that, if the irradiation machine operates out of the tolerance limits, the dose variation in the planning target volume (PTV) can goes till {+-} 5,8% and in the critical adjacent organ till {+-} 7,7%. Therefore we concluded that, according to the complexity of the treatment, it can be necessary to reduce the tolerance levels advised by the IAEA/TECDOC - 1151. (author)

Variations of target volume definition and daily target volume localization in stereotactic body radiotherapy for early-stage non–small cell lung cancer patients under abdominal compression

Energy Technology Data Exchange (ETDEWEB)

Han, Chunhui, E-mail: chan@coh.org; Sampath, Sagus; Schultheisss, Timothy E.; Wong, Jeffrey Y.C.

2017-07-01

We aimed to compare gross tumor volumes (GTV) in 3-dimensional computed tomography (3DCT) simulation and daily cone beam CT (CBCT) with the internal target volume (ITV) in 4-dimensional CT (4DCT) simulation in stereotactic body radiotherapy (SBRT) treatment of patients with early-stage non–small cell lung cancer (NSCLC) under abdominal compression. We retrospectively selected 10 patients with NSCLC who received image-guided SBRT treatments under abdominal compression with daily CBCT imaging. GTVs were contoured as visible gross tumor on the planning 3DCT and daily CBCT, and ITVs were contoured using maximum intensity projection (MIP) images of the planning 4DCT. Daily CBCTs were registered with 3DCT and MIP images by matching of bony landmarks in the thoracic region to evaluate interfractional GTV position variations. Relative to MIP-based ITVs, the average 3DCT-based GTV volume was 66.3 ± 17.1% (range: 37.5% to 92.0%) (p < 0.01 in paired t-test), and the average CBCT-based GTV volume was 90.0 ± 6.7% (daily range: 75.7% to 107.1%) (p = 0.02). Based on bony anatomy matching, the center-of-mass coordinates for CBCT-based GTVs had maximum absolute shift of 2.4 mm (left-right), 7.0 mm (anterior-posterior [AP]), and 5.2 mm (superior-inferior [SI]) relative to the MIP-based ITV. CBCT-based GTVs had average overlapping ratio of 81.3 ± 11.2% (range: 45.1% to 98.9%) with the MIP-based ITV, and 57.7 ± 13.7% (range: 35.1% to 83.2%) with the 3DCT-based GTV. Even with abdominal compression, both 3DCT simulations and daily CBCT scans significantly underestimated the full range of tumor motion. In daily image-guided patient setup corrections, automatic bony anatomy-based image registration could lead to target misalignment. Soft tissue-based image registration should be performed for accurate treatment delivery.

Hemodynamic changes during robotic radical prostatectomy

Directory of Open Access Journals (Sweden)

Vanlal Darlong

2012-01-01

Full Text Available Background: Effect on hemodynamic changes and experience of robot-assisted laparoscopic radical prostatectomy (RALRP in steep Trendelenburg position (45° with high-pressure CO 2 pneumoperitoneum is very limited. Therefore, we planned this prospective clinical trial to study the effect of steep Tredelenburg position with high-pressure CO 2 pneumoperitoneum on hemodynamic parameters in a patient undergoing RALRP using FloTrac/Vigileo™1.10. Methods: After ethical approval and informed consent, 15 patients scheduled for RALRP were included in the study. In the operation room, after attaching standard monitors, the radial artery was cannulated. Anesthesia was induced with fentanyl (2 μg/kg and thiopentone (4-7 mg/kg, and tracheal intubation was facilitated by vecuronium bromide (0.1 mg/kg. The patient′s right internal jugular vein was cannulated and the Pre Sep™ central venous oximetry catheter was connected to it. Anesthesia was maintained with isoflurane in oxygen and nitrous oxide and intermittent boluses of vecuronium. Intermittent positive-pressure ventilation was provided to maintain normocapnea. After CO 2 pneumoperitoneum, position of the patient was gradually changed to 45° Trendelenburg over 5 min. The robot was then docked and the robot-assisted surgery started. Intraoperative monitoring included central venous pressure (CVP, stroke volume (SV, stroke volume variation (SVV, cardiac output (CO, cardiac index (CI and central venous oxygen saturation (ScvO 2 . Results: After induction of anesthesia, heart rate (HR, SV, CO and CI were decreased significantly from the baseline value (P>0.05. SV, CO and CI further decreased significantly after creating pneumoperitoneum (P>0.05. At the 45° Trendelenburg position, HR, SV, CO and CI were significantly decreased compared with baseline. Thereafter, CO and CI were persistently low throughout the 45° Trendelenburg position (P=0.001. HR at 20 min and 1 h, SV and mean arterial blood pressure

Otolith organ function according to subtype of benign paroxysmal positional vertigo.

Science.gov (United States)

Lee, Sun K; Kim, Su J; Park, Moon S; Byun, Jae Y

2014-04-01

The clinical features and treatment outcomes of benign paroxysmal positional vertigo (BPPV) are known to be different depending on the type of and involved canal. This difference could be due to differences in the functional change of the otolith organ. Case series. Forty-nine patients were diagnosed to primary BPPV; 18 were categorized as posterior canal canalolithiasis (PC canalolithiasis), and 31 were categorized as horizontal canal (HC) BPPV with canalolithiasis or cupulolithiasis (HC canalolithiasis or HC cupulolithiasis). Diagnostic interventions to measure vestibular functions were performed such as electronystagmography (ENG), videonystagmography (VNG), and static and dynamic subjective visual vertical (SVV). BPPV was confirmed with nystagmus during positioning/positional test under ENG and VNG. Static SVV was recorded with a light-emitting diode (LED) bar located in front of the patients before eccentric rotation and dynamic SVV was recorded during eccentric rotation with the LED bar. SVV angles were read by the examiner and analyzed. The measured values were compared to those of normal controls and each other. Dynamic SVV toward the lesion side in all subtypes of BPPV were significantly different from those of the controls; HC cupulolithiasis showed significantly lower values than those of PC canalolithiasis and HC canalolithiasis. HC cupulolithiasis shows a lesser degree of utricular dysfunction compared with other subtypes. It could postulate the difference of pathophysiology between canalolithiasis and cupulolithiasis. 4. Copyright © 2013 The American Laryngological, Rhinological and Otological Society, Inc.

Towards a genetic architecture of cryptic genetic variation

Indian Academy of Sciences (India)

Home; Journals; Journal of Genetics; Volume 84; Issue 3. Towards a genetic architecture of cryptic genetic variation and genetic assimilation: the contribution of K. G. Bateman. Ian Dworkin. Commentary on J. Genet. Classic Volume 84 Issue 3 December 2005 pp 223-226 ...

Variations in cereal volume affect the amount selected and eaten for breakfast

OpenAIRE

Rolls, Barbara J.; Meengs, Jennifer S.; Roe, Liane S.

2014-01-01

Food volume could influence both the portions that people take and the amount that they eat, but these effects have had little investigation. The influence of food volume was tested by systematically reducing the flake size of a breakfast cereal so that the cereal was more compact and the same weight filled a smaller volume. In a crossover design, 41 adults ate cereal for breakfast once a week for four weeks during 2011-2012. The cereal was either standard wheat flakes or th...

Partial Molar Volumes of Aqua Ions from First Principles.

Science.gov (United States)

Wiktor, Julia; Bruneval, Fabien; Pasquarello, Alfredo

2017-08-08

Partial molar volumes of ions in water solution are calculated through pressures obtained from ab initio molecular dynamics simulations. The correct definition of pressure in charged systems subject to periodic boundary conditions requires access to the variation of the electrostatic potential upon a change of volume. We develop a scheme for calculating such a variation in liquid systems by setting up an interface between regions of different density. This also allows us to determine the absolute deformation potentials for the band edges of liquid water. With the properly defined pressures, we obtain partial molar volumes of a series of aqua ions in very good agreement with experimental values.

Variation and Linguistic Theory.

Science.gov (United States)

Bailey, Charles-James N.

This volume presents principles and models for describing language variation, and introduces a time-based, dynamic framework for linguistic description. The book first summarizes some of the problems of grammatical description encountered from Saussure through the present and then outlines possibilities for new descriptions of language which take…

Corylucinine, a new Alkaloid from Corydalis cava (Fumariaceae), and its Cholinesterase Activity

Czech Academy of Sciences Publication Activity Database

Novák, Z.; Chlebek, J.; Opletal, L.; Jiroš, Pavel; Macáková, K.; Kuneš, J.; Cahlíková, L.

2012-01-01

Roč. 7, č. 7 (2012), s. 859-860 ISSN 1934-578X Grant - others:SVV UK(CZ) 265002; SVV UK(CZ) 265001; FRVŠ(CZ) 664/2011; UNCE UK(CZ) 17/2012/ Institutional research plan: CEZ:AV0Z40550506 Keywords : Corydalis cava * corylucinine * 8-trichloromethyl-7,8-dihydropalmatine * acetylcholinesterase * butyrylcholinesterase * Alzheimer's disease Subject RIV: CC - Organic Chemistry Impact factor: 0.956, year: 2012

Inter- and intra-observer variation in soft-tissue sarcoma target definition.

Science.gov (United States)

Roberge, D; Skamene, T; Turcotte, R E; Powell, T; Saran, N; Freeman, C

2011-08-01

To evaluate inter- and intra-observer variability in gross tumor volume definition for adult limb/trunk soft tissue sarcomas. Imaging studies of 15 patients previously treated with preoperative radiation were used in this study. Five physicians (radiation oncologists, orthopedic surgeons and a musculoskeletal radiologist) were asked to contour each of the 15 tumors on T1-weighted, gadolinium-enhanced magnetic resonance images. These contours were drawn twice by each physician. The volume and center of mass coordinates for each gross tumor volume were extracted and a Boolean analysis was performed to measure the degree of volume overlap. The median standard deviation in gross tumor volumes across observers was 6.1% of the average volume (range: 1.8%-24.9%). There was remarkably little variation in the 3D position of the gross tumor volume center of mass. For the 15 patients, the standard deviation of the 3D distance between centers of mass ranged from 0.06 mm to 1.7 mm (median 0.1mm). Boolean analysis demonstrated that 53% to 90% of the gross tumor volume was common to all observers (median overlap: 79%). The standard deviation in gross tumor volumes on repeat contouring was 4.8% (range: 0.1-14.4%) with a standard deviation change in the position of the center of mass of 0.4mm (range: 0mm-2.6mm) and a median overlap of 93% (range: 73%-98%). Although significant inter-observer differences were seen in gross tumor volume definition of adult soft-tissue sarcoma, the center of mass of these volumes was remarkably consistent. Variations in volume definition did not correlate with tumor size. Radiation oncologists should not hesitate to review their contours with a colleague (surgeon, radiologist or fellow radiation oncologist) to ensure that they are not outliers in sarcoma gross tumor volume definition. Protocols should take into account variations in volume definition when considering tighter clinical target volumes. Copyright © 2011 Société française de radioth

Variations in cereal volume affect the amount selected and eaten for breakfast.

Science.gov (United States)

Rolls, Barbara J; Meengs, Jennifer S; Roe, Liane S

2014-09-01

Food volume could influence both the portions that people take and the amount that they eat, but these effects have had little investigation. The influence of food volume was tested by systematically reducing the flake size of a breakfast cereal so that the cereal was more compact and the same weight filled a smaller volume. In a crossover design, 41 adults ate cereal for breakfast once a week for 4 weeks during 2011 and 2012. The cereal was either standard wheat flakes or the same cereal crushed to reduce the volume to 80%, 60%, or 40% of the standard. A constant weight of cereal was provided in an opaque container and participants poured the amount they wanted into a bowl, added fat-free milk and noncalorie sweetener as desired, and consumed as much as they wanted. Results from a mixed linear model showed that as flake size was reduced, subjects poured a smaller volume of cereal, but still took a greater amount by weight and energy content (both P values breakfast energy intake increased from a mean±standard error of the mean of 286±18 kcal to 358±19 kcal, an increase of a mean±standard error of the mean 34%±7% (Pportion served, which in turn affects energy intake. Copyright © 2014 Academy of Nutrition and Dietetics. Published by Elsevier Inc. All rights reserved.

Evolutionary significance of epigenetic variation

NARCIS (Netherlands)

Richards, C.L.; Verhoeven, K.J.F.; Bossdorf, O.; Wendel, J.F.; Greilhuber, J.; Dolezel, J.; Leitch, I.J.

2012-01-01

Several chapters in this volume demonstrate how epigenetic work at the molecular level over the last few decades has revolutionized our understanding of genome function and developmental biology. However, epigenetic processes not only further our understanding of variation and regulation at the

Bladder filling variation during radiation treatment of prostate cancer: Can the use of a bladder ultrasound scanner and biofeedback optimize bladder filling?

International Nuclear Information System (INIS)

Stam, Marcel R.; Lin, Emile N.J. Th. van; Vight, Lisette P. van der; Kaanders, Johannes; Visser, Andries G.

2006-01-01

Purpose: To investigate the use of a bladder ultrasound scanner in achieving a better reproducible bladder filling during irradiation of pelvic tumors, specifically prostate cancer. Methods and Materials: First, the accuracy of the bladder ultrasound scanner relative to computed tomography was validated in a group of 26 patients. Next, daily bladder volume variation was evaluated in a group of 18 patients. Another 16 patients participated in a biofeedback protocol, aiming at a more constant bladder volume. The last objective was to study correlations between prostate motion and bladder filling, by using electronic portal imaging device data on implanted gold markers. Results: A strong correlation between bladder scanner volume and computed tomography volume (r = 0.95) was found. Daily bladder volume variation was very high (1 Sd = 47.2%). Bladder filling and daily variation did not significantly differ between the control and the feedback group (47.2% and 40.1%, respectively). Furthermore, no linear correlations between bladder volume variation and prostate motion were found. Conclusions: This study shows large variations in daily bladder volume. The use of a biofeedback protocol yields little reduction in bladder volume variation. Even so, the bladder scanner is an easy to use and accurate tool to register these variations

Probiotics for Rectal Volume Variation During Radiation Therapy for Prostate Cancer

International Nuclear Information System (INIS)

Ki, Yongkan; Kim, Wontaek; Nam, Jiho; Kim, Donghyun; Lee, Juhye; Park, Dahl; Jeon, Hosang; Ha, Honggu; Kim, Taenam; Kim, Dongwon

2013-01-01

Purpose: To investigate the effect of the probiotic Lactobacillus acidophilus on the percentage volume change of the rectum (PVC R ), a crucial factor of prostate movement. Methods and Materials: Prostate cancer patients managed with tomotherapy as a radical treatment were enrolled in the study to take a probiotic capsule containing 1.0 × 10 8 colony-forming units of L acidophilus or a placebo capsule twice daily. Radiation therapy was performed at a dose of 78 Gy in 39 fractions. The PVC R , defined as the difference in rectal volume between the planning computed tomographic (CT) and daily megavoltage CT images, was analyzed. Results: Forty patients were randomized into 2 groups. The L acidophilus group showed significantly lower median rectal volume and median PVC R values than the placebo group. L acidophilus showed a significant reduction effect on the PVC R (P R . Conclusions: L acidophilus was useful in reducing the PVC R , which is the most important determining factor of prostate position, during radiation therapy for prostate cancer

Anatomic variation of cranial parasympathetic ganglia

Directory of Open Access Journals (Sweden)

Selma Siéssere

2008-06-01

Full Text Available Having broad knowledge of anatomy is essential for practicing dentistry. Certain anatomical structures call for detailed studies due to their anatomical and functional importance. Nevertheless, some structures are difficult to visualize and identify due to their small volume and complicated access. Such is the case of the parasympathetic ganglia located in the cranial part of the autonomic nervous system, which include: the ciliary ganglion (located deeply in the orbit, laterally to the optic nerve, the pterygopalatine ganglion (located in the pterygopalatine fossa, the submandibular ganglion (located laterally to the hyoglossus muscle, below the lingual nerve, and the otic ganglion (located medially to the mandibular nerve, right beneath the oval foramen. The aim of this study was to present these structures in dissected anatomic specimens and perform a comparative analysis regarding location and morphology. The proximity of the ganglia and associated nerves were also analyzed, as well as the number and volume of fibers connected to them. Human heads were dissected by planes, partially removing the adjacent structures to the point we could reach the parasympathetic ganglia. With this study, we concluded that there was no significant variation regarding the location of the studied ganglia. Morphologically, our observations concur with previous classical descriptions of the parasympathetic ganglia, but we observed variations regarding the proximity of the otic ganglion to the mandibular nerve. We also observed that there were variations regarding the number and volume of fiber bundles connected to the submandibular, otic, and pterygopalatine ganglia.

Modeling Per Capita State Health Expenditure Variat...

Data.gov (United States)

U.S. Department of Health & Human Services — Modeling Per Capita State Health Expenditure Variation State-Level Characteristics Matter, published in Volume 3, Issue 4, of the Medicare and Medicaid Research...

Probiotics for Rectal Volume Variation During Radiation Therapy for Prostate Cancer

Energy Technology Data Exchange (ETDEWEB)

Ki, Yongkan [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of); Kim, Wontaek, E-mail: rokwt@hanmail.net [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of); Nam, Jiho; Kim, Donghyun; Lee, Juhye; Park, Dahl; Jeon, Hosang [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of); Ha, Honggu; Kim, Taenam [Department of Urology, Medical Research Institute, Pusan National University Hospital, Pusan National University School of Medicine, Busan (Korea, Republic of); Kim, Dongwon [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of)

2013-11-15

Purpose: To investigate the effect of the probiotic Lactobacillus acidophilus on the percentage volume change of the rectum (PVC{sub R}), a crucial factor of prostate movement. Methods and Materials: Prostate cancer patients managed with tomotherapy as a radical treatment were enrolled in the study to take a probiotic capsule containing 1.0 × 10{sup 8} colony-forming units of L acidophilus or a placebo capsule twice daily. Radiation therapy was performed at a dose of 78 Gy in 39 fractions. The PVC{sub R}, defined as the difference in rectal volume between the planning computed tomographic (CT) and daily megavoltage CT images, was analyzed. Results: Forty patients were randomized into 2 groups. The L acidophilus group showed significantly lower median rectal volume and median PVC{sub R} values than the placebo group. L acidophilus showed a significant reduction effect on the PVC{sub R} (P<.001). However, the radiation therapy fraction number did not significantly influence the PVC{sub R}. Conclusions: L acidophilus was useful in reducing the PVC{sub R}, which is the most important determining factor of prostate position, during radiation therapy for prostate cancer.

Ovarian volume throughout life

DEFF Research Database (Denmark)

Kelsey, Thomas W; Dodwell, Sarah K; Wilkinson, A Graham

2013-01-01

conception to 82 years of age. This model shows that 69% of the variation in ovarian volume is due to age alone. We have shown that in the average case ovarian volume rises from 0.7 mL (95% CI 0.4-1.1 mL) at 2 years of age to a peak of 7.7 mL (95% CI 6.5-9.2 mL) at 20 years of age with a subsequent decline...... to about 2.8 mL (95% CI 2.7-2.9 mL) at the menopause and smaller volumes thereafter. Our model allows us to generate normal values and ranges for ovarian volume throughout life. This is the first validated normative model of ovarian volume from conception to old age; it will be of use in the diagnosis......The measurement of ovarian volume has been shown to be a useful indirect indicator of the ovarian reserve in women of reproductive age, in the diagnosis and management of a number of disorders of puberty and adult reproductive function, and is under investigation as a screening tool for ovarian...

A general methodology for three-dimensional analysis of variation in target volume delineation

NARCIS (Netherlands)

Remeijer, P.; Rasch, C.; Lebesque, J. V.; van Herk, M.

1999-01-01

A generic method for three-dimensional (3-D) evaluation of target volume delineation in multiple imaging modalities is presented. The evaluation includes geometrical and statistical methods to estimate observer differences and variability in defining the Gross Tumor Volume (GTV) in relation to the

Evolution of karyotype, sex chromosomes, and meiosis in mygalomorph spiders (Araneae: Mygalomorphae)

Czech Academy of Sciences Publication Activity Database

Král, J.; Kořínková, T.; Krkavcová, L.; Musilová, J.; Forman, M.; Ávila Herrera, I. M.; Haddad, C. R.; Vítková, Magda; Henriques, S.; Palacios Vargas, J. G.; Hedin, M.

2013-01-01

Roč. 109, č. 2 (2013), s. 377-408 ISSN 0024-4066 Grant - others:AV ČR(CZ) IAA601110808; GA ČR(CZ) GA206/08/0813; Univerzita Karlova v Praze(CZ) SVV-2013-267205; Univerzita Karlova v Praze(CZ) SVV-2012-265202 Institutional support: RVO:60077344 Keywords : achiasmatic * chromosome pairing * deactivation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.535, year: 2013 http://onlinelibrary.wiley.com/doi/10.1111/bij.12056/pdf

A Volume Constrained Variational Problem with Lower-Order Terms

International Nuclear Information System (INIS)

Morini, M.; Rieger, M.O.

2003-01-01

We study a one-dimensional variational problem with two or more level set constraints. The existence of global and local minimizers turns out to be dependent on the regularity of the energy density. A complete characterization of local minimizers and the underlying energy landscape is provided. The Γ -limit when the phases exhaust the whole domain is computed

Incubator weaning in preterm infants and associated practice variation.

Science.gov (United States)

Schneiderman, R; Kirkby, S; Turenne, W; Greenspan, J

2009-08-01

To evaluate the relationship of weight of preterm infants when first placed into an open crib with days to full oral feedings, growth velocity and length of stay (LOS), and to identify unwarranted variation in incubator weaning after adjusting for severity indices. A retrospective study using the ParadigmHealth neonatal database from 2003 to 2006 reviewed incubator weaning to an open crib in appropriate-for-gestational-age (AGA) infants from 22 to weeks gestation. Primary outcome measurements included days to full oral (PO) feeding, weight gain from open crib to discharge and length of stay. Models were severity adjusted. To understand hospital practice variation, we also used a regression model to estimate the weight at open crib for the top 10 volume hospitals. In all 2908 infants met the inclusion criteria for the study. Their mean weight at open crib was 1850 g. On average every additional 100 g an infant weighed at the open crib was associated with increased time to full PO feeding by 0.8 days, decreased weight gained per day by 1 gram and increased LOS by 0.9 days. For the top 10 volume hospitals, severity variables alone accounted for 9% of the variation in weight at open crib, whereas the hospital in which the baby was treated accounted for an additional 19% of the variation. Even after controlling for severity, significant practice variation exists in weaning to an open crib, leading to potential delays in achieving full-volume oral feeds, decreased growth velocity and prolonged LOS.

Postprandial hepatic volume change: spiral CT evaluation in case of liver cirrhosis

International Nuclear Information System (INIS)

Rho, Kwang Suk; Moon, Jang Il; Ko, Myong Kwan; Byun, Joo Nam; Kim, Young Suk; Kim, Young Chol; Oh, Jae Hee

1999-01-01

To investigate the usefulness of evaluating liver cirrhosis through the measurement of liver volume. In a control group(20 normal subjects) and 20 cirrhotic patients, variations in liver volume before and after a meal were obtained. A case-control study was conducted between the two groups. In the control group, the range of increased liver volume after the meal was 67-186ml. Mean increased liver volume was 119.3ml, the range of percentage increase was 6-12.4% and the mean percentage increase was 9.89%. In cirrhotic patients, the range of increased liver volume after the meal was 1-20ml. Mean increase liver volume was 6.9ml, the range of percentage increase was 0-1.9% and the mean percentage increase was 0.65%. Compared with the control group, cirrhotic patients showed a much smaller increase in liver volume(p<0.01). Difference in variation of liver volume between a control group and cirrhotic patients before and after a meal can be used for the evaluation of liver cirrhosis

Cardiothoracic ratio on chest radiograph in pediatric heart disease: How does it correlate with heart volumes at magnetic resonance imaging?

Energy Technology Data Exchange (ETDEWEB)

Grotenhuis, Heynric B. [The University of Toronto, Division of Cardiology, Department of Paediatrics, The Labatt Family Heart Centre, The Hospital for Sick Children, Toronto (Canada); Zhou, Cheng; Isaac, Kathryn V. [The University of Toronto, Department of Diagnostic Imaging, The Hospital for Sick Children, Toronto (Canada); Tomlinson, George [University of Toronto, Department of Medicine, Toronto General Hospital and Mt. Sinai Hospital, Toronto (Canada); Seed, Mike; Grosse-Wortmann, Lars; Yoo, Shi-Joon [The University of Toronto, Division of Cardiology, Department of Paediatrics, The Labatt Family Heart Centre, The Hospital for Sick Children, Toronto (Canada); The University of Toronto, Department of Diagnostic Imaging, The Hospital for Sick Children, Toronto (Canada)

2015-10-15

The cardiothoracic ratio by chest radiograph is widely used as a marker of cardiac size. The purpose of this study is to correlate cardiothoracic ratio and cardiac volumes as measured by cardiovascular magnetic resonance (MR) in common structural and myopathic heart disease with increased cardiac size due to volume overload or hypertrophy. A retrospective single center study was performed in all patients between 2007 and 2013 with repaired tetralogy of Fallot (TOF), aortic regurgitation, isolated left-to-right shunt and hypertrophic cardiomyopathy (HCM) who underwent cardiovascular MR and chest radiograph within 6 months of each other. Cardiothoracic ratios by chest radiograph (frontal and lateral) were compared to cardiac volumes (indexed for body surface area) by cardiovascular MR. One hundred twenty-seven patients (mean age: 11.2 ± 5.5 years) were included in this study (76 with TOF, 23 with isolated left-to-right shunt, 16 with aortic regurgitation and 12 with HCM). Frontal cardiothoracic ratio of all groups correlated with indexed right ventricular (RV) end-diastolic volume (EDVI) (r = 0.40, P < 0.01) and indexed total heart volume (THVI) (r = 0.27, P < 0.01). In TOF patients, frontal cardiothoracic ratio correlated with RVEDVI (r = 0.34, P < 0.01; coefficient of variation = 27.6%), indexed RV end-systolic volume (ESVI) (r = 0.44, P < 0.01; coefficient of variation = 33.3%) and THVI (r = 0.35, P < 0.01; coefficient of variation = 19.6%), although RV volumes and THVI showed widespread variation given the high coefficients of variation. In patients with aortic regurgitation, frontal cardiothoracic ratio correlated with left ventricular (LV) EDVI (r = 0.50, P = 0.047), but not with THVI and aortic regurgitant fraction, and widespread variation for LV EDVI (coefficient of variation = 19.2%), LV ESVI (coefficient of variation = 32.5%) and THVI (coefficient of variation = 13.6%) was also observed. Frontal cardiothoracic ratio was not correlated with cardiac volumes

Subjective visual vertical assessment with mobile virtual reality system

Directory of Open Access Journals (Sweden)

Ingrida Ulozienė

Full Text Available Background and objective: The subjective visual vertical (SVV is a measure of a subject's perceived verticality, and a sensitive test of vestibular dysfunction. Despite this, and consequent upon technical and logistical limitations, SVV has not entered mainstream clinical practice. The aim of the study was to develop a mobile virtual reality based system for SVV test, evaluate the suitability of different controllers and assess the system's usability in practical settings. Materials and methods: In this study, we describe a novel virtual reality based system that has been developed to test SVV using integrated software and hardware, and report normative values across healthy population. Participants wore a mobile virtual reality headset in order to observe a 3D stimulus presented across separate conditions – static, dynamic and an immersive real-world (“boat in the sea” SVV tests. The virtual reality environment was controlled by the tester using a Bluetooth connected controllers. Participants controlled the movement of a vertical arrow using either a gesture control armband or a general-purpose gamepad, to indicate perceived verticality. We wanted to compare 2 different methods for object control in the system, determine normal values and compare them with literature data, to evaluate the developed system with the help of the system usability scale questionnaire and evaluate possible virtually induced dizziness with the help of subjective visual analog scale. Results: There were no statistically significant differences in SVV values during static, dynamic and virtual reality stimulus conditions, obtained using the two different controllers and the results are compared to those previously reported in the literature using alternative methodologies. The SUS scores for the system were high, with a median of 82.5 for the Myo controller and of 95.0 for the Gamepad controller, representing a statistically significant difference between the two

Differential effects of visual feedback on subjective visual vertical accuracy and precision.

Directory of Open Access Journals (Sweden)

Daniel Bjasch

Full Text Available The brain constructs an internal estimate of the gravitational vertical by integrating multiple sensory signals. In darkness, systematic head-roll dependent errors in verticality estimates, as measured by the subjective visual vertical (SVV, occur. We hypothesized that visual feedback after each trial results in increased accuracy, as physiological adjustment errors (A-/E-effect are likely based on central computational mechanisms and investigated whether such improvements were related to adaptational shifts of perceived vertical or to a higher cognitive strategy. We asked 12 healthy human subjects to adjust a luminous arrow to vertical in various head-roll positions (0 to 120deg right-ear down, 15deg steps. After each adjustment visual feedback was provided (lights on, display of previous adjustment and of an earth-vertical cross. Control trials consisted of SVV adjustments without feedback. At head-roll angles with the largest A-effect (90, 105, and 120deg, errors were reduced significantly (p0.05 influenced. In seven subjects an additional session with two consecutive blocks (first with, then without visual feedback was completed at 90, 105 and 120deg head-roll. In these positions the error-reduction by the previous visual feedback block remained significant over the consecutive 18-24 min (post-feedback block, i.e., was still significantly (p<0.002 different from the control trials. Eleven out of 12 subjects reported having consciously added a bias to their perceived vertical based on visual feedback in order to minimize errors. We conclude that improvements of SVV accuracy by visual feedback, which remained effective after removal of feedback for ≥18 min, rather resulted from a cognitive strategy than by adapting the internal estimate of the gravitational vertical. The mechanisms behind the SVV therefore, remained stable, which is also supported by the fact that SVV precision - depending mostly on otolith input - was not affected by visual

Urinary Soluble CD163 in Active Renal Vasculitis.

Science.gov (United States)

O'Reilly, Vincent P; Wong, Limy; Kennedy, Claire; Elliot, Louise A; O'Meachair, Shane; Coughlan, Alice Marie; O'Brien, Eoin C; Ryan, Michelle M; Sandoval, Diego; Connolly, Emma; Dekkema, Gerjan J; Lau, Jiaying; Abdulahad, Wayel H; Sanders, Jan-Stephan F; Heeringa, Peter; Buckley, Colm; O'Brien, Cathal; Finn, Stephen; Cohen, Clemens D; Lindemeyer, Maja T; Hickey, Fionnuala B; O'Hara, Paul V; Feighery, Conleth; Moran, Sarah M; Mellotte, George; Clarkson, Michael R; Dorman, Anthony J; Murray, Patrick T; Little, Mark A

2016-09-01

A specific biomarker that can separate active renal vasculitis from other causes of renal dysfunction is lacking, with a kidney biopsy often being required. Soluble CD163 (sCD163), shed by monocytes and macrophages, has been reported as a potential biomarker in diseases associated with excessive macrophage activation. Thus, we hypothesized that urinary sCD163 shed by crescent macrophages correlates with active glomerular inflammation. We detected sCD163 in rat urine early in the disease course of experimental vasculitis. Moreover, microdissected glomeruli from patients with small vessel vasculitis (SVV) had markedly higher levels of CD163 mRNA than did those from patients with lupus nephritis, diabetic nephropathy, or nephrotic syndrome. Both glomeruli and interstitium of patients with SVV strongly expressed CD163 protein. In 479 individuals, including patients with SVV, disease controls, and healthy controls, serum levels of sCD163 did not differ between the groups. However, in an inception cohort, including 177 patients with SVV, patients with active renal vasculitis had markedly higher urinary sCD163 levels than did patients in remission, disease controls, or healthy controls. Analyses in both internal and external validation cohorts confirmed these results. Setting a derived optimum cutoff for urinary sCD163 of 0.3 ng/mmol creatinine for detection of active renal vasculitis resulted in a sensitivity of 83%, specificity of 96%, and a positive likelihood ratio of 20.8. These data indicate that urinary sCD163 level associates very tightly with active renal vasculitis, and assessing this level may be a noninvasive method for diagnosing renal flare in the setting of a known diagnosis of SVV. Copyright © 2016 by the American Society of Nephrology.

Thermodynamics with pressure and volume under charged particle absorption

Science.gov (United States)

Gwak, Bogeun

2017-11-01

We investigate the variation of the charged anti-de Sitter black hole under charged particle absorption by considering thermodynamic volume. When the energy of the particle is considered to contribute to the internal energy of the black hole, the variation exactly corresponds to the prediction of the first law of thermodynamics. Nevertheless, we find the decrease of the Bekenstein-Hawking entropy for extremal and near-extremal black holes under the absorption, which is an irreversible process. This violation of the second law of thermodynamics is only found when considering thermodynamic volume. We test the weak cosmic censorship conjecture affected by the violation. Fortunately, the conjecture is still valid, but extremal and near-extremal black holes do not change their configurations when any particle enters the black hole. This result is quite different from the case in which thermodynamic volume is not considered.

Seasonal variation in sports participation.

Science.gov (United States)

Schüttoff, Ute; Pawlowski, Tim

2018-02-01

This study explores indicators describing socio-demographics, sports participation characteristics and motives which are associated with variation in sports participation across seasons. Data were drawn from the German Socio-Economic Panel which contains detailed information on the sports behaviour of adults in Germany. Overall, two different measures of seasonal variation are developed and used as dependent variables in our regression models. The first variable measures the coefficient of (seasonal) variation in sport-related energy expenditure per week. The second variable measures whether activity drops below the threshold as defined by the World Health Organization (WHO). Results suggest that the organisational setting, the intensity and number of sports practised, and the motive for participation are strongly correlated with the variation measures used. For example, both, participation in a sports club and a commercial facility, are associated with reduced seasonal variation and a significantly higher probability of participating at a volume above the WHO threshold across all seasons. These findings give some impetus for policymaking and the planning of sports programmes as well as future research directions.

Searching for God: Illness-Related Mortality Threats and Religious Search Volume in Google in 16 Nations.

Science.gov (United States)

Pelham, Brett W; Shimizu, Mitsuru; Arndt, Jamie; Carvallo, Mauricio; Solomon, Sheldon; Greenberg, Jeff

2018-03-01

We tested predictions about religiosity and terror management processes in 16 nations. Specifically, we examined weekly variation in Google search volume in each nation for 12 years (all weeks for which data were available). In all 16 nations, higher than usual weekly Google search volume for life-threatening illnesses (cancer, diabetes, and hypertension) predicted increases in search volume for religious content (e.g., God, Jesus, prayer) in the following week. This effect held up after controlling for (a) recent past and annual variation in religious search volume, (b) increases in search volume associated with religious holidays, and (c) variation in searches for a non-life-threatening illness ("sore throat"). Terror management threat reduction processes appear to occur across the globe. Furthermore, they may occur over much longer periods than those studied in the laboratory. Managing fears of death via religious belief regulation appears to be culturally pervasive.

Surface Freshwater Storage Variations in the Orinoco Floodplains Using Multi-Satellite Observations

Directory of Open Access Journals (Sweden)

Frédéric Frappart

2014-12-01

Full Text Available Variations in surface water extent and storage are poorly characterized from regional to global scales. In this study, a multi-satellite approach is proposed to estimate the water stored in the floodplains of the Orinoco Basin at a monthly time-scale using remotely-sensed observations of surface water from the Global Inundation Extent Multi-Satellite (GIEMS and stages from Envisat radar altimetry. Surface water storage variations over 2003–2007 exhibit large interannual variability and a strong seasonal signal, peaking during summer, and associated with the flood pulse. The volume of surface water storage in the Orinoco Basin was highly correlated with the river discharge at Ciudad Bolivar (R = 0.95, the closest station to the mouth where discharge was estimated, although discharge lagged one month behind storage. The correlation remained high (R = 0.73 after removing seasonal effects. Mean annual variations in surface water volume represented ~170 km3, contributing to ~45% of the Gravity Recovery and Climate Experiment (GRACE-derived total water storage variations and representing ~13% of the total volume of water that flowed out of the Orinoco Basin to the Atlantic Ocean.

TOTAL WOOD VOLUME ESTIMATION OF EUCALYPTUS SPECIES BY IMAGES OF LANDSAT SATELLITE

Directory of Open Access Journals (Sweden)

Elias Fernando Berra

2012-12-01

Full Text Available http://dx.doi.org/10.5902/198050987566Models relating spectral answers with biophysical parameters aim estimate variables, like wood volume, without the necessity of frequent field measurements. The objective was to develop models to estimate wood volume by Landsat 5 TM images, supported by regional forest inventory data. The image was geo-referenced and converted to spectral reflectance. After, the images-index NDVI (Normalized Difference Vegetation Index and SR (Simple Ratio was generated. The reflectance values of the bands (TM1, TM2, TM3 e TM4 and of the indices (NDVI and SR was related with the wood volume. The biggest correlation with volume was with the NDVI and SR indices. The variables selection was made by Stepwise method, which returned three regression models as significant to explain the variation in volume. Finally, the best fitted model was selected (volume = -830,95 + 46,05 (SR + 107,47 (TM2, which was applied on the Landsat image where the pixels had started to represent the estimated volume in m³/ha on the Eucalyptus sp. production units. This model, significant at 95% confidence level, explains 68% of the wood volume variation.

Symptom dimensions are associated with progressive brain volume changes in schizophrenia

NARCIS (Netherlands)

Collin, G.; Derks, E. M.; van Haren, N. E. M.; Schnack, H. G.; Hulshoff Pol, H. E.; Kahn, R. S.; Cahn, W.

2012-01-01

Background: There is considerable variation in progressive brain volume changes in schizophrenia. Whether this is related to the clinical heterogeneity that characterizes the illness remains to be determined. This study examines the relationship between change in brain volume over time and

Respiratory variation in peak aortic velocity accurately predicts fluid responsiveness in children undergoing neurosurgery under general anesthesia.

Science.gov (United States)

Morparia, Kavita G; Reddy, Srijaya K; Olivieri, Laura J; Spaeder, Michael C; Schuette, Jennifer J

2018-04-01

The determination of fluid responsiveness in the critically ill child is of vital importance, more so as fluid overload becomes increasingly associated with worse outcomes. Dynamic markers of volume responsiveness have shown some promise in the pediatric population, but more research is needed before they can be adopted for widespread use. Our aim was to investigate effectiveness of respiratory variation in peak aortic velocity and pulse pressure variation to predict fluid responsiveness, and determine their optimal cutoff values. We performed a prospective, observational study at a single tertiary care pediatric center. Twenty-one children with normal cardiorespiratory status undergoing general anesthesia for neurosurgery were enrolled. Respiratory variation in peak aortic velocity (ΔVpeak ao) was measured both before and after volume expansion using a bedside ultrasound device. Pulse pressure variation (PPV) value was obtained from the bedside monitor. All patients received a 10 ml/kg fluid bolus as volume expansion, and were qualified as responders if stroke volume increased >15% as a result. Utility of ΔVpeak ao and PPV and to predict responsiveness to volume expansion was investigated. A baseline ΔVpeak ao value of greater than or equal to 12.3% best predicted a positive response to volume expansion, with a sensitivity of 77%, specificity of 89% and area under receiver operating characteristic curve of 0.90. PPV failed to demonstrate utility in this patient population. Respiratory variation in peak aortic velocity is a promising marker for optimization of perioperative fluid therapy in the pediatric population and can be accurately measured using bedside ultrasonography. More research is needed to evaluate the lack of effectiveness of pulse pressure variation for this purpose.

Moral values are associated with individual differences in regional brain volume.

Science.gov (United States)

Lewis, Gary J; Kanai, Ryota; Bates, Timothy C; Rees, Geraint

2012-08-01

Moral sentiment has been hypothesized to reflect evolved adaptations to social living. If so, individual differences in moral values may relate to regional variation in brain structure. We tested this hypothesis in a sample of 70 young, healthy adults examining whether differences on two major dimensions of moral values were significantly associated with regional gray matter volume. The two clusters of moral values assessed were "individualizing" (values of harm/care and fairness) and "binding" (deference to authority, in-group loyalty, and purity/sanctity). Individualizing was positively associated with left dorsomedial pFC volume and negatively associated with bilateral precuneus volume. For binding, a significant positive association was found for bilateral subcallosal gyrus and a trend to significance for the left anterior insula volume. These findings demonstrate that variation in moral sentiment reflects individual differences in brain structure and suggest a biological basis for moral sentiment, distributed across multiple brain regions.

Perceived direction of gravity and the body-axis during static whole body roll-tilt in healthy subjects.

Science.gov (United States)

Tamura, Atsushi; Wada, Yoshiro; Inui, Takuo; Shiotani, Akihiro

2017-10-01

We used the subjective visual vertical (SVV) and two different subjective visual body axis (SVBA) methods to quantify roll-tilt perception under gravity, and investigated the characteristics of these methods during static roll-tilt. In addition, we independently developed a compact device to facilitate evaluation of SVBA in different gravitational environments. Ten male volunteers participated in this study. We created a roll-tilt environment using a flight simulator in a dark room. The cockpit of the simulator was tilted leftward or rightward (-30°, -20°, -10°, 0°, 10°, 20° and 30°) in each randomly ordered trial. We quantified roll-tilt perception such that the experiment was conducted under 21 different conditions per participant. We found no significant differences among the SVV error and the two types of SVBA error. The SVV and the SVBA methods may be useful for evaluating subjective roll-tilt perception.

The dependence of prostate postimplant dosimetric quality on CT volume determination

International Nuclear Information System (INIS)

Merrick, Gregory S.; Butler, Wayne M.; Dorsey, Anthony T.; Lief, Jonathan H.

1999-01-01

the ultrasound volume approach. Despite the volume determinations being markedly different, no significant differences between the approaches were appreciated for V100, V150, V200, and D90. Large variations seen in D100 were uncorrelated to any of the other parameters and make D100 unsuitable as a quality indicator. Conclusions: In terms of a logarithmic measure, the variation between volumetric approach for V100, V150, V200, and D90 was less than one-fifth the variation of the CT volumes. These results which indicate relative independence of postimplant CT volume determination and dosimetric quality are only valid for a planning philosophy that includes the prostate with a periprostatic margin as the target volume

Interfractional Dose Variations in Intensity-Modulated Radiotherapy With Breath-Hold for Pancreatic Cancer

Energy Technology Data Exchange (ETDEWEB)

Nakamura, Mitsuhiro [Department of Radiation Oncology and Image-Applied Therapy, Kyoto University Graduate School of Medicine, Kyoto (Japan); Shibuya, Keiko, E-mail: kei@kuhp.kyoto-u.ac.jp [Department of Radiation Oncology and Image-Applied Therapy, Kyoto University Graduate School of Medicine, Kyoto (Japan); Nakamura, Akira [Department of Radiation Oncology and Image-Applied Therapy, Kyoto University Graduate School of Medicine, Kyoto (Japan); Shiinoki, Takehiro [Department of Nuclear Engineering, Kyoto University Graduate School of Engineering, Kyoto (Japan); Matsuo, Yukinori [Department of Radiation Oncology and Image-Applied Therapy, Kyoto University Graduate School of Medicine, Kyoto (Japan); Nakata, Manabu [Clinical Radiology Service Division, Kyoto University Hospital, Kyoto (Japan); Sawada, Akira; Mizowaki, Takashi; Hiraoka, Masahiro [Department of Radiation Oncology and Image-Applied Therapy, Kyoto University Graduate School of Medicine, Kyoto (Japan)

2012-04-01

Purpose: To investigate the interfractional dose variations for intensity-modulated radiotherapy (RT) combined with breath-hold (BH) at end-exhalation (EE) for pancreatic cancer. Methods and Materials: A total of 10 consecutive patients with pancreatic cancer were enrolled. Each patient was fixed in the supine position on an individualized vacuum pillow with both arms raised. Computed tomography (CT) scans were performed before RT, and three additional scans were performed during the course of chemoradiotherapy using a conventional RT technique. The CT data were acquired under EE-BH conditions (BH-CT) using a visual feedback technique. The intensity-modulated RT plan, which used five 15-MV coplanar ports, was designed on the initial BH-CT set with a prescription dose of 39 Gy at 2.6 Gy/fraction. After rigid image registration between the initial and subsequent BH-CT scans, the dose distributions were recalculated on the subsequent BH-CT images under the same conditions as in planning. Changes in the dose-volume metrics of the gross tumor volume (GTV), clinical target volume (CTV = GTV + 5 mm), stomach, and duodenum were evaluated. Results: For the GTV and clinical target volume (CTV), the 95th percentile of the interfractional variations in the maximal dose, mean dose, dose covering 95% volume of the region of structure, and percentage of the volume covered by the 90% isodose line were within {+-}3%. Although the volume covered by the 39 Gy isodose line for the stomach and duodenum did not exceed 0.1 mL at planning, the volume covered by the 39 Gy isodose line for these structures was up to 11.4 cm{sup 3} and 1.8 cm{sup 3}, respectively. Conclusions: Despite variations in the gastrointestinal state and abdominal wall position at EE, the GTV and CTV were mostly ensured at the planned dose, with the exception of 1 patient. Compared with the duodenum, large variations in the stomach volume receiving high-dose radiation were observed, which might be beyond the

Variations in gastric emptying of liquid elicited by acute blood volume changes in awake rats

Directory of Open Access Journals (Sweden)

Gondim F. de-A.A.

1998-01-01

Full Text Available We have observed that acute blood volume expansion increases the gastroduodenal resistance to the flow of liquid in anesthetized dogs, while retraction decreases it (Santos et al. (1991 Acta Physiologica Scandinavica, 143: 261-269. This study evaluates the effect of blood volume expansion and retraction on the gastric emptying of liquid in awake rats using a modification of the technique of Scarpignato (1980 (Archives Internationales de Pharmacodynamie et de Therapie, 246: 286-294. Male Wistar rats (180-200 g were fasted for 16 h with water ad libitum and 1.5 ml of the test meal (0.5 mg/ml phenol red solution in 5% glucose was delivered to the stomach immediately after random submission to one of the following protocols: 1 normovolemic control (N = 22, 2 expansion (N = 72 by intravenous infusion (1 ml/min of Ringer-bicarbonate solution, volumes of 1, 2, 3 or 5% body weight, or 3 retraction (N = 22 by controlled bleeding (1.5 ml/100 g. Gastric emptying of liquid was inhibited by 19-51.2% (P<0.05 after blood volume expansion (volumes of 1, 2, 3 or 5% body weight. Blood volume expansion produced a sustained increase in central venous pressure while mean arterial pressure was transiently increased during expansion (P<0.05. Blood volume retraction increased gastric emptying by 28.5-49.9% (P<0.05 and decreased central venous pressure and mean arterial pressure (P<0.05. Infusion of the shed blood 10 min after bleeding reversed the effect of retraction on gastric emptying. These findings suggest that gastric emptying of liquid is subject to modulation by the blood volume.

Spatial variation in void volume during charged particle bombardment: the effects of injected interstitials

International Nuclear Information System (INIS)

Lee, E.H.; Mansur, L.K.; Yoo, M.H.

1979-01-01

Experimental observations of the void volume at several depths along the range of 4 MeV Ni ions in 316 stainless steel are reported. The specimens were first preconditioned by neutron irradiation at temperatures of 450 and 584 0 C to fluences of approximately 8 x 10 26 n/m -2 . The void volume after ion bombardment to 60 dpa at the peak damage depth is significantly lower at the peak damage depth than in the region between that and the free surface. The ratio of the step height to void volume at the depth of peak energy deposition between regions masked from and exposed to the beam is strongly dependent on bombardment temperature. The reduction of void volume near the peak damage depth is larger for the 584 0 C than for the 450 0 C preconditioned material. These observations are consistent with recent theoretical results which account for the injection of the bombarding ions as self-interstitials. The theory necessary to understand the effect is developed

Distinct roles for the IIId2 sub-domain in pestivirus and picornavirus internal ribosome entry sites.

Science.gov (United States)

Willcocks, Margaret M; Zaini, Salmah; Chamond, Nathalie; Ulryck, Nathalie; Allouche, Delphine; Rajagopalan, Noemie; Davids, Nana A; Fahnøe, Ulrik; Hadsbjerg, Johanne; Rasmussen, Thomas Bruun; Roberts, Lisa O; Sargueil, Bruno; Belsham, Graham J; Locker, Nicolas

2017-12-15

Viral internal ribosomes entry site (IRES) elements coordinate the recruitment of the host translation machinery to direct the initiation of viral protein synthesis. Within hepatitis C virus (HCV)-like IRES elements, the sub-domain IIId(1) is crucial for recruiting the 40S ribosomal subunit. However, some HCV-like IRES elements possess an additional sub-domain, termed IIId2, whose function remains unclear. Herein, we show that IIId2 sub-domains from divergent viruses have different functions. The IIId2 sub-domain present in Seneca valley virus (SVV), a picornavirus, is dispensable for IRES activity, while the IIId2 sub-domains of two pestiviruses, classical swine fever virus (CSFV) and border disease virus (BDV), are required for 80S ribosomes assembly and IRES activity. Unlike in SVV, the deletion of IIId2 from the CSFV and BDV IRES elements impairs initiation of translation by inhibiting the assembly of 80S ribosomes. Consequently, this negatively affects the replication of CSFV and BDV. Finally, we show that the SVV IIId2 sub-domain is required for efficient viral RNA synthesis and growth of SVV, but not for IRES function. This study sheds light on the molecular evolution of viruses by clearly demonstrating that conserved RNA structures, within distantly related RNA viruses, have acquired different roles in the virus life cycles. © The Author(s) 2017. Published by Oxford University Press on behalf of Nucleic Acids Research.

A Nationwide Analysis of Cost Variation for Autologous Free Flap Breast Reconstruction.

Science.gov (United States)

Billig, Jessica I; Lu, Yiwen; Momoh, Adeyiza O; Chung, Kevin C

2017-11-01

Cost variation among hospitals has been demonstrated for surgical procedures. Uncovering these differences has helped guide measures taken to reduce health care spending. To date, the fiscal consequence of hospital variation for autologous free flap breast reconstruction is unknown. To investigate factors that influence cost variation for autologous free flap breast reconstruction. A secondary cross-sectional analysis was performed using the Healthcare Cost and Utilization Project National Inpatient Sample database from 2008 to 2010. The dates of analysis were September 2016 to February 2017. The setting was a stratified sample of all US community hospitals. Participants were female patients who were diagnosed as having breast cancer or were at high risk for breast cancer and underwent autologous free flap breast reconstruction. Variables of interest included demographic data, hospital characteristics, length of stay, complications (surgical and systemic), and inpatient cost. The study used univariate and generalized linear mixed models to examine associations between patient and hospital characteristics and cost. A total of 3302 patients were included in the study, with a median age of 50 years (interquartile range, 44-57 years). The mean cost for autologous free flap breast reconstruction was $22 677 (interquartile range, $14 907-$33 391). Flap reconstructions performed at high-volume hospitals were significantly more costly than those performed at low-volume hospitals ($24 360 vs $18 918, P Logistic regression demonstrated that hospital volume correlated with increased cost (Exp[β], 1.06; 95% CI, 1.02-1.11; P = .003). Fewer surgical complications (16.4% [169 of 1029] vs 23.7% [278 of 1174], P cost variation among patients undergoing autologous free flap breast reconstruction. Experience, as measured by a hospital's volume, provides quality health care with fewer complications but is more costly. Longer length of stay contributed to regional

Pad-weighing test performed with standardized bladder volume

DEFF Research Database (Denmark)

Lose, G; Rosenkilde, P; Gammelgaard, J

1988-01-01

The result of the one-hour pad-weighing test proposed by the International Continence Society has been demonstrated to depend on the urine load during the test. To increase reproducibility of the pad-weighing test by minimizing the influence of variation in urine load the test was done with a sta...... to +/- 24 g between two tests. It is concluded that this setup (i.e., standardized bladder volume) of the one-hour pad-weighing test allows for a more reliable assessment of urinary incontinence for quantitative purposes....... with a standardized bladder volume (50% of the cystometric bladder capacity). Twenty-five female patients with stress or mixed incontinence underwent two separate tests. Test-retest results were highly correlated (r = 0.97, p less than 0.001). Nonetheless, analysis of test-retest differences revealed a variation up...

Seasonal and spatial distribution of Bacterioplankton in a fluvial-lagunar system of a tropical region: density, biomass, cellular volume and morphologic variation

Directory of Open Access Journals (Sweden)

Magnólia Fernandes Florêncio de Araújo

2008-02-01

Full Text Available The temporal and spatial fluctuations of Bacterioplankton in a fluvial-lagunar system of a tropical region (Pitimbu River and Jiqui Lake, RN were studied during the dry and the rainy periods. The bacterial abundance varied from 2.67 to 5.1 Cells10(7mL-1 and did not show a typical temporal variation, presenting only small oscillations between the rainy and the dry periods. The bacterial biomass varied from 123 µgC L-1 to 269 µgC L-1 in the sampling sites and the average cellular volume varied from 0.12 to 0.54µm³, showing a predominance of the rods. The temperature showed a positive correlation with the cellular volume of the rods (R=0.55; p=0.02 and vibrio (R=0.53; p=0.03. Significant spatial differences of biomass (Mann Whitney: p=0.01 and cellular volume of the morphotypes (Mann Whitney: p=0.003 were found between the sampling sites. The strong positive correlations of the water temperature and oxygen with bacterioplankton showed a probable high bacterial activity in this system.A variação temporal e espacial do bacterioplâncton em um sistema fluvial-lagunar de região tropical foi estudada em períodos seco e chuvoso. As médias da abundância bacteriana variaram de 2,67 a 5,1 x 10(7 e não exibiram uma variação temporal marcante, tendo apresentado apenas pequenas oscilações entre os períodos chuvoso e seco. A biomassa bacteriana variou de 123 µg C L-1 a 269 µg C L-1 entre os locais de coleta e o volume celular médio de 0,12µm³ a 0,54µm³, ocorrendo predominância de bacilos. A temperatura mostrou correlação positiva com o volume celular de bacilos (R=0,55; p=0,02 e de vibriões (R=0,53; p=0,03. Foram encontradas diferenças espaciais significativas de biomassa (Mann Whitney: p=0,01 e volume celular dos morfotipos (Mann Whitney: p= 0,003, entre os locais de coleta. As fortes correlações positivas da temperatura da água e do oxigênio, com o bacterioplâncton, são sugestivas de uma provavelmente elevada atividade

Variations in gastric compliance induced by acute blood volume changes in anesthetized rats

Directory of Open Access Journals (Sweden)

Graça J.R.V.

2002-01-01

Full Text Available The impact of acute volume imbalances on gastric volume (GV was studied in anesthetized rats (250-300 g. After cervical and femoral vessel cannulation, a balloon catheter was positioned in the proximal stomach. The opposite end of the catheter was connected to a barostat with an electronic sensor coupled to a plethysmometer. A standard ionic solution was used to fill the balloon (about 3.0 ml and the communicating vessel system, and to raise the reservoir liquid level 4 cm above the animals' xiphoid appendix. Due to constant barostat pressure, GV values were considered to represent the gastric compliance index. All animals were monitored for 90 min. After a basal interval, they were randomly assigned to normovolemic, hypervolemic, hypovolemic or restored protocols. Data were compared by ANOVA followed by Bonferroni's test. Mean arterial pressure (MAP, central venous pressure (CVP and GV values did not change in normovolemic animals (N = 5. Hypervolemic animals (N = 12 were transfused at 0.5 ml/min with a suspension of red blood cells in Ringer-lactate solution with albumin (12.5 ml/kg, which reduced GV values by 11.3% (P0.05. MAP and CVP values increased (P<0.05 after hypervolemia but decreased (P<0.05 with hypovolemia. In conclusion, blood volume level modulates gastric compliance, turning the stomach into an adjustable reservoir, which could be part of the homeostatic process to balance blood volume.

Cell cycle variation in x-ray survival for cells from spheroids measured by volume cell sorting

International Nuclear Information System (INIS)

Freyer, J.P.; Wilder, M.E.; Raju, M.R.

1984-01-01

Considerable work has been done studying the variation in cell survival as a function of cell cycle position for monolayers or single cells exposed to radiation. Little is known about the effects of multicellular growth on the relative radiation sensitivity of cells in different cell cycle stages. The authors have developed a new technique for measuring the response of cells, using volume cell sorting, which is rapid, non-toxic, and does not require cell synchronization. By combining this technique with selective spheroid dissociation,they have measured the age response of cells located at various depths in EMT6 and Colon 26 spheroids. Although cells in the inner region had mostly G1-phase DNA contents, 15-20% had S- and G2-phase DNA contents. Analysis of these cells using BrdU labeling and flow cytometric analysis with a monoclonal antibody to BrdU indicated that the inner region cells were not synthesizing DNA. Thus, the authors were able to measure the radiation response of cells arrested in G1, S and G2 cell cycle phases. Comparison of inner and outer spheroid regions, and monolayer cultures, indicates that it is improper to extrapolate age response data in standard culture conditions to the situation in spheroids

Variations in pore characteristics in high volatile bituminous coals: Implications for coal bed gas content

Science.gov (United States)

Mastalerz, Maria; Drobniak, A.; Strapoc, D.; Solano-Acosta, W.; Rupp, J.

2008-01-01

The Seelyville Coal Member of the Linton Formation (Pennsylvanian) in Indiana was studied to: 1) understand variations in pore characteristics within a coal seam at a single location and compare these variations with changes occurring between the same coal at different locations, 2) elaborate on the influence of mineral-matter and maceral composition on mesopore and micropore characteristics, and 3) discuss implications of these variations for coal bed gas content. The coal is high volatile bituminous rank with R0 ranging from 0.57% to 0.60%. BET specific surface areas (determined by nitrogen adsorption) of the coals samples studied range from 1.8 to 22.9??m2/g, BJH adsorption mesopore volumes from 0.0041 to 0.0339??cm3/g, and micropore volumes (determined by carbon dioxide adsorption) from 0.0315 to 0.0540??cm3/g. The coals that had the largest specific surface areas and largest mesopore volumes occur at the shallowest depths, whereas the smallest values for these two parameters occur in the deepest coals. Micropore volumes, in contrast, are not depth-dependent. In the coal samples examined for this study, mineral-matter content influenced both specific surface area as well as mesopore and micropore volumes. It is especially clear in the case of micropores, where an increase in mineral-matter content parallels the decrease of micropore volume of the coal. No obvious relationships were observed between the total vitrinite content and pore characteristics but, after splitting vitrinite into individual macerals, we see that collotelinite influences both meso- and micropore volume positively, whereas collodetrinite contributes to the reduction of mesopore and micropore volumes. There are large variations in gas content within a single coal at a single location. Because of this variability, the entire thickness of the coal must be desorbed in order to determine gas content reliably and to accurately calculate the level of gas saturation. ?? 2008 Elsevier B.V. All

First impressions: geographic variation in media messages during the first phase of ACA implementation.

Science.gov (United States)

Gollust, Sarah E; Barry, Colleen L; Niederdeppe, Jeff; Baum, Laura; Fowler, Erika Franklin

2014-12-01

Many Americans will learn about the implementation of the Patient Protection and Affordable Care Act (ACA) through the mass media. We examined geographic variation in the volume and content of mass media during the initial two-week rollout of the new health insurance marketplaces in October 2013 across 210 US media markets, using data from the Wesleyan Media Project. We found substantial geographic variation in the volume and tone of insurance product advertisements, political advertisements, and news coverage of the ACA marketplaces. News coverage of the ACA airing in media markets located in states operating federal or partnership marketplaces was more negative than coverage airing in markets located in states running their own marketplaces. Intrastate variation in media volume and content was also substantial and appears distinguishable from the local political climate. Variation in exposure to media messages likely affects public sentiment regarding the ACA and could contribute to geographic differences in insurance enrollment and public perceptions of US health care options. Researchers and policy makers evaluating the implementation of the ACA-and insurance enrollment in the marketplaces in particular-should consider addressing media influences. Copyright © 2014 by Duke University Press.

Intake plenum volume and its influence on the engine performance, cyclic variability and emissions

International Nuclear Information System (INIS)

Ceviz, M.A.

2007-01-01

Intake manifold connects the intake system to the intake valve of the engine and through which air or air-fuel mixture is drawn into the cylinder. Details of the flow in intake manifolds are extremely complex. Recently, most of engine companies are focused on variable intake manifold technology due to their improvement on engine performance. This paper investigates the effects of intake plenum volume variation on engine performance and emissions to constitute a base study for variable intake plenum. Brake and indicated engine performance characteristics, coefficient of variation in indicated mean effective pressure (COV imep ) as an indicator for cyclic variability, pulsating flow pressure in the intake manifold runner, and CO, CO 2 and HC emissions were taken into consideration to evaluate the effects of different plenum volumes. The results of this study showed that the variation in the plenum volume causes an improvement on the engine performance and the pollutant emissions. The brake torque and related performance characteristics improved pronouncedly about between 1700 and 2600 rpm by increasing plenum volume. Additionally, although the increase in the plenum volume caused the mixture leaner due to the increase in the intake runner pressure and lean mixtures inclined to increase the cyclic variability, a decrease was interestingly observed in the COV imep

Hippocampal volume reduction in congenital central hypoventilation syndrome.

Directory of Open Access Journals (Sweden)

Paul M Macey

Full Text Available Children with congenital central hypoventilation syndrome (CCHS, a genetic disorder characterized by diminished drive to breathe during sleep and impaired CO(2 sensitivity, show brain structural and functional changes on magnetic resonance imaging (MRI scans, with impaired responses in specific hippocampal regions, suggesting localized injury.We assessed total volume and regional variation in hippocampal surface morphology to identify areas affected in the syndrome. We studied 18 CCHS (mean age+/-std: 15.1+/-2.2 years; 8 female and 32 healthy control (age 15.2+/-2.4 years; 14 female children, and traced hippocampi on 1 mm(3 resolution T1-weighted scans, collected with a 3.0 Tesla MRI scanner. Regional hippocampal volume variations, adjusted for cranial volume, were compared between groups based on t-tests of surface distances to the structure midline, with correction for multiple comparisons. Significant tissue losses emerged in CCHS patients on the left side, with a trend for loss on the right; however, most areas affected on the left also showed equivalent right-sided volume reductions. Reduced regional volumes appeared in the left rostral hippocampus, bilateral areas in mid and mid-to-caudal regions, and a dorsal-caudal region, adjacent to the fimbria.The volume losses may result from hypoxic exposure following hypoventilation during sleep-disordered breathing, or from developmental or vascular consequences of genetic mutations in the syndrome. The sites of change overlap regions of abnormal functional responses to respiratory and autonomic challenges. Affected hippocampal areas have roles associated with memory, mood, and indirectly, autonomic regulation; impairments in these behavioral and physiological functions appear in CCHS.

Variations of comoving volume and their effects on the star formation rate density

Science.gov (United States)

Kim, Sungeun; Physics and Astronomy, Sejong University, Seoul, Korea (the Republic of).

2018-01-01

To build a comprehensive picture of star formation in the universe, we havedeveloped an application to calculate the comoving volume at a specific redshift and visualize the changes of spaceand time. The application is based on the star formation rates of about a few thousands of galaxies and their redshiftvalues. Three dimensional modeling of these galaxies using the redshift, comoving volume, and star formation ratesas input data allows calculation of the star formation rate density corresponding to the redshift. This work issupported by the National Research Foundation of Korea (NRF) grant funded by the Korea government (MSIP)(no. 2017037333).

A pilot study to assess the feasibility of measurement of adrenal gland volume by magnetic resonance imaging

Energy Technology Data Exchange (ETDEWEB)

Grant, Lee A.; Dixon, Adrian K. (Dept. of Radiology, Cambridge Univ. Teaching Hospitals NHS Foundation Trust, Cambridge (United Kingdom)), e-mail: leegrant100@gmail.com; Napolitano, Antonella; McHugh, Simon M. (GlaxoSmithKline RandD, Clinical Unit Cambridge, Addenbrooke' s Centre for Clinical Investigation, Addenbrooke' s Hospital, Cambridge (United Kingdom)); Miller, Sam (Analysis Applications Research Group, GSK RandD, Harlow, Essex (United Kingdom)); Stephens, Kimberley (Discovery Statistics, GSK RandD, Harlow, Essex (United Kingdom))

2010-01-15

Background: Repeated computed tomography (CT) assessment of the adrenal glands is associated with a significant radiation burden. The increasing capabilities of magnetic resonance (MR) volumetric analysis of the adrenals make this a potentially alternative technique in man. Purpose: To determine whether MR imaging could be used to measure adrenal volume, and to determine the intra- and interobserver variation and repeatability of MR volume imaging of adrenals in healthy human subjects. Material and Methods: This was a single-cohort, sequential design, three-part study involving four MRI examinations per subject following ethical approval and informed consent. Information was collected on four healthy subjects (three male and one female). Two different investigators estimated the area of the adrenal gland for each of the 3-mm contiguous slices (and consequently adrenal volume). In order to estimate inter- and intrareader variability, a repeated-measures mixed model was fitted with adrenal volume as the dependent variable. In order to estimate any bias between readers, Bland-Altman methodology was applied. Results: Intraobserver variation for adrenal gland volume is approximately 5% of a 3-cm3 adrenal gland. Interobserver variation is approximately 9% of a 3-cm3 adrenal gland. Potential variation in measurement for adrenal volume from all sources equates to approximately 14% of a 3-cm3 adrenal gland. Verification of image reading by a second investigator (consensus reading) reduces variability. Conclusion: Analysis of adrenal gland volume using MRI is a potentially reliable technique that could be used to assess a pathological change in adrenal size

Observer variation in target volume delineation of lung cancer related to radiation oncologist-computer interaction: A 'Big Brother' evaluation

International Nuclear Information System (INIS)

Steenbakkers, Roel J.H.M.; Duppen, Joop C.; Fitton, Isabelle; Deurloo, Kirsten E.I.; Zijp, Lambert; Uitterhoeve, Apollonia L.J.; Rodrigus, Patrick T.R.; Kramer, Gijsbert W.P.; Bussink, Johan; Jaeger, Katrien De; Belderbos, Jose S.A.; Hart, Augustinus A.M.; Nowak, Peter J.C.M.; Herk, Marcel van; Rasch, Coen R.N.

2005-01-01

Background and purpose: To evaluate the process of target volume delineation in lung cancer for optimization of imaging, delineation protocol and delineation software. Patients and methods: Eleven radiation oncologists (observers) from five different institutions delineated the Gross Tumor Volume (GTV) including positive lymph nodes of 22 lung cancer patients (stages I-IIIB) on CT only. All radiation oncologist-computer interactions were recorded with a tool called 'Big Brother'. For each radiation oncologist and patient the following issues were analyzed: delineation time, number of delineated points and corrections, zoom levels, level and window (L/W) settings, CT slice changes, use of side windows (coronal and sagittal) and software button use. Results: The mean delineation time per GTV was 16 min (SD 10 min). The mean delineation time for lymph node positive patients was on average 3 min larger (P=0.02) than for lymph node negative patients. Many corrections (55%) were due to L/W change (e.g. delineating in mediastinum L/W and then correcting in lung L/W). For the lymph node region, a relatively large number of corrections was found (3.7 corr/cm 2 ), indicating that it was difficult to delineate lymph nodes. For the tumor-atelectasis region, a relative small number of corrections was found (1.0 corr/cm 2 ), indicating that including or excluding atelectasis into the GTV was a clinical decision. Inappropriate use of L/W settings was frequently found (e.g. 46% of all delineated points in the tumor-lung region were delineated in mediastinum L/W settings). Despite a large observer variation in cranial and caudal direction of 0.72 cm (1 SD), the coronal and sagittal side windows were not used in 45 and 60% of the cases, respectively. For the more difficult cases, observer variation was smaller when the coronal and sagittal side windows were used. Conclusions: With the 'Big Brother' tool a method was developed to trace the delineation process. The differences between

Sensitivity of the amplitude of the single muscle fibre action potential to microscopic volume conduction parameters

NARCIS (Netherlands)

Alberts, B.A.; Rutten, Wim; Wallinga, W.; Boom, H.B.K.

1988-01-01

A microscopic model of volume conduction was applied to examine the sensitivity of the single muscle fibre action potential to variations in parameters of the source and of the volume conductor, such as conduction velocity, intracellular conductivity and intracellular volume fraction. The model

Posterior insular cortex - a site of vestibular-somatosensory interaction?

Science.gov (United States)

Baier, Bernhard; Zu Eulenburg, Peter; Best, Christoph; Geber, Christian; Müller-Forell, Wibke; Birklein, Frank; Dieterich, Marianne

2013-09-01

Background In previous imaging studies the insular cortex (IC) has been identified as an essential part of the processing of a wide spectrum of perception and sensorimotor integration. Yet, there are no systematic lesion studies in a sufficient number of patients examining whether processing of vestibular and the interaction of somatosensory and vestibular signals take place in the IC. Methods We investigated acute stroke patients with lesions affecting the IC in order to fill this gap. In detail, we explored signs of a vestibular tone imbalance such as the deviation of the subjective visual vertical (SVV). We applied voxel-lesion behaviour mapping analysis in 27 patients with acute unilateral stroke. Results Our data demonstrate that patients with lesions of the posterior IC have an abnormal tilt of SVV. Furthermore, re-analysing data of 20 patients from a previous study, we found a positive correlation between thermal perception contralateral to the stroke and the severity of the SVV tilt. Conclusions We conclude that the IC is a sensory brain region where different modalities might interact.

Posterior insular cortex – a site of vestibular–somatosensory interaction?

Science.gov (United States)

Baier, Bernhard; zu Eulenburg, Peter; Best, Christoph; Geber, Christian; Müller-Forell, Wibke; Birklein, Frank; Dieterich, Marianne

2013-01-01

Background In previous imaging studies the insular cortex (IC) has been identified as an essential part of the processing of a wide spectrum of perception and sensorimotor integration. Yet, there are no systematic lesion studies in a sufficient number of patients examining whether processing of vestibular and the interaction of somatosensory and vestibular signals take place in the IC. Methods We investigated acute stroke patients with lesions affecting the IC in order to fill this gap. In detail, we explored signs of a vestibular tone imbalance such as the deviation of the subjective visual vertical (SVV). We applied voxel-lesion behaviour mapping analysis in 27 patients with acute unilateral stroke. Results Our data demonstrate that patients with lesions of the posterior IC have an abnormal tilt of SVV. Furthermore, re-analysing data of 20 patients from a previous study, we found a positive correlation between thermal perception contralateral to the stroke and the severity of the SVV tilt. Conclusions We conclude that the IC is a sensory brain region where different modalities might interact. PMID:24392273

Partial differential equations and calculus of variations

CERN Document Server

Leis, Rolf

1988-01-01

This volume contains 18 invited papers by members and guests of the former Sonderforschungsbereich in Bonn (SFB 72) who, over the years, collaborated on the research group "Solution of PDE's and Calculus of Variations". The emphasis is on existence and regularity results, on special equations of mathematical physics and on scattering theory.

Limitations of the planning organ at risk volume (PRV) concept.

Science.gov (United States)

Stroom, Joep C; Heijmen, Ben J M

2006-09-01

Previously, we determined a planning target volume (PTV) margin recipe for geometrical errors in radiotherapy equal to M(T) = 2 Sigma + 0.7 sigma, with Sigma and sigma standard deviations describing systematic and random errors, respectively. In this paper, we investigated margins for organs at risk (OAR), yielding the so-called planning organ at risk volume (PRV). For critical organs with a maximum dose (D(max)) constraint, we calculated margins such that D(max) in the PRV is equal to the motion averaged D(max) in the (moving) clinical target volume (CTV). We studied margins for the spinal cord in 10 head-and-neck cases and 10 lung cases, each with two different clinical plans. For critical organs with a dose-volume constraint, we also investigated whether a margin recipe was feasible. For the 20 spinal cords considered, the average margin recipe found was: M(R) = 1.6 Sigma + 0.2 sigma with variations for systematic and random errors of 1.2 Sigma to 1.8 Sigma and -0.2 sigma to 0.6 sigma, respectively. The variations were due to differences in shape and position of the dose distributions with respect to the cords. The recipe also depended significantly on the volume definition of D(max). For critical organs with a dose-volume constraint, the PRV concept appears even less useful because a margin around, e.g., the rectum changes the volume in such a manner that dose-volume constraints stop making sense. The concept of PRV for planning of radiotherapy is of limited use. Therefore, alternative ways should be developed to include geometric uncertainties of OARs in radiotherapy planning.

Inter-fraction bladder filling variations and time trends for cervical cancer patients assessed with a portable 3-dimensional ultrasound bladder scanner

International Nuclear Information System (INIS)

Ahmad, Rozilawati; Hoogeman, Mischa S.; Quint, Sandra; Mens, Jan Willem; Pree, Ilse de; Heijmen, Ben J.M.

2008-01-01

Background and Purpose: For cervical cancer patients, bladder filling variations may result in inadequate EBRT target coverage, unless large safety margins are used. For a group of patients who received full bladder instructions, inter-fraction variations and time trends in bladder volume were quantified, and a 3D ultrasound (US) scanner was tested for on-line bladder volume measurements. Methods and materials: For 24 patients, the bladder volume was measured with US at the time of the planning CT scan, and twice weekly during the course of RT. Comparisons of US with planning CT were used to assess the bladder scanner accuracy. Patients were treated in prone on a belly board, EPID images were acquired to correlate set-up errors with bladder filling variations. Results: Measured US and CT bladder volumes were strongly correlated (R = 0.97, slope 1.1 ± 0.1). The population mean bladder volume at planning of 378 ± 209 ml (1 SD) reduced to 109 ± 88 ml (1 SD) in week 6, a reduction by 71% (average reduction 46 ml/week), revealing a large inter-fraction time trend. Intra-patient variation in bladder volume during RT was 168 ml (1 SD) (range 70-266 ml). Rotation around the LR axis was significantly correlated with bladder volume changes. Conclusions: Despite a full bladder instruction, bladder volumes reduced dramatically during treatment, implying large time trends in target position of these patients. The portable US scanner provides a quick and reliable measurement of the bladder volume, which might assist future online treatment adaptation

Variational principles of continuum mechanics. Vol. 1. Fundamentals

Energy Technology Data Exchange (ETDEWEB)

Berdichevsky, Victor L. [Wayne State Univ., Detroit, MI (United States). Dept. of Mechanical Engineering

2009-07-01

The book reviews the two features of the variational approach: its use as a universal tool to describe physical phenomena and as a source for qualitative and quantitative methods of studying particular problems. Berdichevsky's work differs from other books on the subject in focusing mostly on the physical origin of variational principles as well as establishing their interrelations. For example, the Gibbs principles appear as a consequence of the Einstein formula for thermodynamic fluctuations rather than as the first principles of the theory of thermodynamic equilibrium. Mathematical issues are considered as long as they shed light on the physical outcomes and/or provide a useful technique for the direct study of variational problems. In addition, a thorough account of variational principles discovered in various branches of continuum mechanics is given. In this book, the first volume, the author covers the variational principles for systems with a finite number of degrees of freedom; the variational principles of thermodynamics; the basics of continuum mechanics; the variational principles for classical models of continuum mechanics, such as elastic and plastic bodies, and ideal and viscous fluids; and direct methods of calculus of variations. (orig.)

Patient perceptions about illness self-management in ANCA-associated small vessel vasculitis.

Science.gov (United States)

Thorpe, C T; DeVellis, R F; Blalock, S J; Hogan, S L; Lewis, M A; DeVellis, B M

2008-06-01

To characterize patient perceptions, related to eight self-management behaviours relevant for adults with ANCA-associated small vessel vasculitis (ANCA-SVV), and to determine if these perceptions were associated with performance of each behaviour. Adults with ANCA-SVV (n = 202) completed a self-administered questionnaire that assessed eight self-management behaviours (adherence to recommendations for medication, health service use, diet, exercise, infection avoidance and symptom monitoring; prompt reporting of symptoms and side effects; and adjusting activities in response to symptoms), perceptions about these behaviours, socio-demographics, clinical factors and social desirability bias. Descriptive statistics were generated to characterize patients' perceptions about difficulty of, importance of, and specific barriers to performing each behaviour. Regression analyses explored whether these variables were associated with performing each behaviour, controlling for potential confounders. With few exceptions, higher perceived importance and lower perceived difficulty of each behaviour were associated with more frequent performance of the behaviour. For each behaviour, several specific barriers were frequently endorsed by patients and a number of these were associated with lower levels of self-management. This study reveals that patient perceptions about the illness and its treatment influence ANCA-SVV self-management. Perceived barriers to medication, health services, diet and exercise adherence were similar to those in other illnesses. This study also provides insight into barriers experienced by patients in performing behaviours (infection avoidance, symptom monitoring, reporting symptoms and side-effects and adjusting activities) not often previously studied. How the identification of these barriers can help inform future interventions for ANCA-SVV patients is to be discussed.

General volumes in the Orlicz-Brunn-Minkowski theory and a related Minkowski Problem I

OpenAIRE

Gardner, Richard J.; Hug, Daniel; Weil, Wolfgang; Xing, Sudan; Ye, Deping

2018-01-01

The general volume of a star body, a notion that includes the usual volume, the $q$th dual volumes, and many previous types of dual mixed volumes, is introduced. A corresponding new general dual Orlicz curvature measure is defined that specializes to the $(p,q)$-dual curvature measures introduced recently by Lutwak, Yang, and Zhang. General variational formulas are established for the general volume of two types of Orlicz linear combinations. One of these is applied to the Minkowski problem f...

Specification of volume and dose in radiotherapy

International Nuclear Information System (INIS)

Levernes, S.

1997-01-01

As a result of a questionnaire about dose and volume specifications in radiotherapy in the Nordic countries, a group has been set up to propose common recommendations for these countries. The proposal is partly based on ICRU 50, but with major extensions. These extensions fall into three areas: patient geometry, treatment geometry, and dose specifications. For patient geometry and set-up one need alignment markings and anatomical reference points, the latter can be divided into internal and external reference points. These points are necessary to get relationships between coordinate systems related to patient and to treatment unit. For treatment geometry the main volume will be an anatomical target volume which just encompass the clinical target volume with all its variations and movements. This anatomical volume are the most suitable volume for prescription, optimization and reporting dose. A set-up margin should be added to the beam periphery in beams-eye-view to get the minimum size and shape of the beam. For dose specification the most important parameter for homogeneous dose distributions is the arithmetic mean of dose to the anatomical target volume together with its standard deviation. In addition the dose to the ICRU reference point should be reported for intercomparison, together with minimum and maximum doses or dose volume histograms for the anatomical target volume. (author)

Variations in the Contouring of Organs at Risk: Test Case From a Patient With Oropharyngeal Cancer

Energy Technology Data Exchange (ETDEWEB)

Nelms, Benjamin E., E-mail: alpha@canislupusllc.com [Canis Lupus LLC, Merrimac, WI (United States); Tome, Wolfgang A. [Department of Human Oncology, University of Wisconsin, Madison, WI (United States); Robinson, Greg [Radiation Oncology Resources, Goshen, IN (United States); Wheeler, James [Department of Radiation Oncology, Goshen Health System Goshen, IN (United States)

2012-01-01

Purpose: Anatomy contouring is critical in radiation therapy. Inaccuracy and variation in defining critical volumes will affect everything downstream: treatment planning, dose-volume histogram analysis, and contour-based visual guidance used in image-guided radiation therapy. This study quantified: (1) variation in the contouring of organs at risk (OAR) in a clinical test case and (2) corresponding effects on dosimetric metrics of highly conformal plans. Methods and Materials: A common CT data set with predefined targets from a patient with oropharyngeal cancer was provided to a population of clinics, which were asked to (1) contour OARs and (2) design an intensity-modulated radiation therapy plan. Thirty-two acceptable plans were submitted as DICOM RT data sets, each generated by a different clinical team. Using those data sets, we quantified: (1) the OAR contouring variation and (2) the impact this variation has on dosimetric metrics. New technologies were employed, including a software tool to quantify three-dimensional structure comparisons. Results: There was significant interclinician variation in OAR contouring. The degree of variation is organ-dependent. We found substantial dose differences resulting strictly from contouring variation (differences ranging from -289% to 56% for mean OAR dose; -22% to 35% for maximum dose). However, there appears to be a threshold in the OAR comparison metric beyond which the dose differences stabilize. Conclusions: The effects of interclinician variation in contouring organs-at-risk in the head and neck can be large and are organ-specific. Physicians need to be aware of the effect that variation in OAR contouring can play on the final treatment plan and not restrict their focus only to the target volumes.

On the effect of standard PFEM remeshing on volume conservation in free-surface fluid flow problems

Science.gov (United States)

Franci, Alessandro; Cremonesi, Massimiliano

2017-07-01

The aim of this work is to analyze the remeshing procedure used in the particle finite element method (PFEM) and to investigate how this operation may affect the numerical results. The PFEM remeshing algorithm combines the Delaunay triangulation and the Alpha Shape method to guarantee a good quality of the Lagrangian mesh also in large deformation processes. However, this strategy may lead to local variations of the topology that may cause an artificial change of the global volume. The issue of volume conservation is here studied in detail. An accurate description of all the situations that may induce a volume variation during the PFEM regeneration of the mesh is provided. Moreover, the crucial role of the parameter α used in the Alpha Shape method is highlighted and a range of values of α for which the differences between the numerical results are negligible, is found. Furthermore, it is shown that the variation of volume induced by the remeshing reduces by refining the mesh. This check of convergence is of paramount importance for the reliability of the PFEM. The study is carried out for 2D free-surface fluid dynamics problems, however the conclusions can be extended to 3D and to all those problems characterized by significant variations of internal and external boundaries.

Structural covariance of brain region volumes is associated with both structural connectivity and transcriptomic similarity.

Science.gov (United States)

Yee, Yohan; Fernandes, Darren J; French, Leon; Ellegood, Jacob; Cahill, Lindsay S; Vousden, Dulcie A; Spencer Noakes, Leigh; Scholz, Jan; van Eede, Matthijs C; Nieman, Brian J; Sled, John G; Lerch, Jason P

2018-05-18

An organizational pattern seen in the brain, termed structural covariance, is the statistical association of pairs of brain regions in their anatomical properties. These associations, measured across a population as covariances or correlations usually in cortical thickness or volume, are thought to reflect genetic and environmental underpinnings. Here, we examine the biological basis of structural volume covariance in the mouse brain. We first examined large scale associations between brain region volumes using an atlas-based approach that parcellated the entire mouse brain into 318 regions over which correlations in volume were assessed, for volumes obtained from 153 mouse brain images via high-resolution MRI. We then used a seed-based approach and determined, for 108 different seed regions across the brain and using mouse gene expression and connectivity data from the Allen Institute for Brain Science, the variation in structural covariance data that could be explained by distance to seed, transcriptomic similarity to seed, and connectivity to seed. We found that overall, correlations in structure volumes hierarchically clustered into distinct anatomical systems, similar to findings from other studies and similar to other types of networks in the brain, including structural connectivity and transcriptomic similarity networks. Across seeds, this structural covariance was significantly explained by distance (17% of the variation, up to a maximum of 49% for structural covariance to the visceral area of the cortex), transcriptomic similarity (13% of the variation, up to maximum of 28% for structural covariance to the primary visual area) and connectivity (15% of the variation, up to a maximum of 36% for structural covariance to the intermediate reticular nucleus in the medulla) of covarying structures. Together, distance, connectivity, and transcriptomic similarity explained 37% of structural covariance, up to a maximum of 63% for structural covariance to the

Temporal, seasonal and weather effects on cycle volume: an ecological study

Directory of Open Access Journals (Sweden)

Tin Tin Sandar

2012-03-01

Full Text Available Abstract Background Cycling has the potential to provide health, environmental and economic benefits but the level of cycling is very low in New Zealand and many other countries. Adverse weather is often cited as a reason why people do not cycle. This study investigated temporal and seasonal variability in cycle volume and its association with weather in Auckland, New Zealand's largest city. Methods Two datasets were used: automated cycle count data collected on Tamaki Drive in Auckland by using ZELT Inductive Loop Eco-counters and weather data (gust speed, rain, temperature, sunshine duration available online from the National Climate Database. Analyses were undertaken using data collected over one year (1 January to 31 December 2009. Normalised cycle volumes were used in correlation and regression analyses to accommodate differences by hour of the day and day of the week and holiday. Results In 2009, 220,043 bicycles were recorded at the site. There were significant differences in mean hourly cycle volumes by hour of the day, day type and month of the year (p p Conclusions There are temporal and seasonal variations in cycle volume in Auckland and weather significantly influences hour-to-hour and day-to-day variations in cycle volume. Our findings will help inform future cycling promotion activities in Auckland.

Structural Features of the Seneca Valley Virus Internal Ribosome Entry Site (IRES) Element: a Picornavirus with a Pestivirus-Like IRES

DEFF Research Database (Denmark)

Willcocks, Margaret M.; Locker, Nicolas; Gomwalk, Zarmwa

2011-01-01

The RNA genome of Seneca Valley virus (SVV), a recently identified picornavirus, contains an internal ribosome entry site (IRES) element which has structural and functional similarity to that from classical swine fever virus (CSFV) and hepatitis C virus, members of the FLAVIVIRIDAE: The SVV IRES...... has an absolute requirement for the presence of a short region of virus-coding sequence to allow it to function either in cells or in rabbit reticulocyte lysate. The IRES activity does not require the translation initiation factor eIF4A or intact eIF4G. The predicted secondary structure indicates...

Surface area and the seabed area, volume, depth, slope, and topographic variation for the world's seas, oceans, and countries.

Science.gov (United States)

Costello, Mark John; Cheung, Alan; De Hauwere, Nathalie

2010-12-01

Depth and topography directly and indirectly influence most ocean environmental conditions, including light penetration and photosynthesis, sedimentation, current movements and stratification, and thus temperature and oxygen gradients. These parameters are thus likely to influence species distribution patterns and productivity in the oceans. They may be considered the foundation for any standardized classification of ocean ecosystems and important correlates of metrics of biodiversity (e.g., species richness and composition, fisheries). While statistics on ocean depth and topography are often quoted, how they were derived is rarely cited, and unless calculated using the same spatial resolution the resulting statistics will not be strictly comparable. We provide such statistics using the best available resolution (1-min) global bathymetry, and open source digital maps of the world's seas and oceans and countries' Exclusive Economic Zones, using a standardized methodology. We created a terrain map and calculated sea surface and seabed area, volume, and mean, standard deviation, maximum, and minimum, of both depth and slope. All the source data and our database are freely available online. We found that although the ocean is flat, and up to 71% of the area has a ocean volume exceeds 1.3 billion km(3) (or 1.3 sextillion liters), and sea surface and seabed areas over 354 million km(2). We propose the coefficient of variation of slope as an index of topographic heterogeneity. Future studies may improve on this database, for example by using a more detailed bathymetry, and in situ measured data. The database could be used to classify ocean features, such as abyssal plains, ridges, and slopes, and thus provide the basis for a standards based classification of ocean topography.

Urban Run-off Volumes Dependency on Rainfall Measurement Method

DEFF Research Database (Denmark)

Pedersen, L.; Jensen, N. E.; Rasmussen, Michael R.

2005-01-01

Urban run-off is characterized with fast response since the large surface run-off in the catchments responds immediately to variations in the rainfall. Modeling such type of catchments is most often done with the input from very few rain gauges, but the large variation in rainfall over small areas...... resolutions and single gauge rainfall was fed to a MOUSE run-off model. The flow and total volume over the event is evaluated....

Spinning fluids in general relativity: a variational formulation

International Nuclear Information System (INIS)

Oliveira, H.P. de; Salim, J.M.

1990-01-01

In this paper we present a variational formulation for spinning fluids in General Relativity. In our model each volume element of the fluid has rigid microstructure. We deduce a symmetrical energy-moment tensor where there is an explicit contribution of kinetic spin energy to the total energy. (author)

VariVis: a visualisation toolkit for variation databases

Directory of Open Access Journals (Sweden)

Smith Timothy D

2008-04-01

Full Text Available Abstract Background With the completion of the Human Genome Project and recent advancements in mutation detection technologies, the volume of data available on genetic variations has risen considerably. These data are stored in online variation databases and provide important clues to the cause of diseases and potential side effects or resistance to drugs. However, the data presentation techniques employed by most of these databases make them difficult to use and understand. Results Here we present a visualisation toolkit that can be employed by online variation databases to generate graphical models of gene sequence with corresponding variations and their consequences. The VariVis software package can run on any web server capable of executing Perl CGI scripts and can interface with numerous Database Management Systems and "flat-file" data files. VariVis produces two easily understandable graphical depictions of any gene sequence and matches these with variant data. While developed with the goal of improving the utility of human variation databases, the VariVis package can be used in any variation database to enhance utilisation of, and access to, critical information.

All rights reserved Variation in Body Weight, Organ Weight and ...

African Journals Online (AJOL)

ADOWIE PERE

Variation in Body Weight, Organ Weight and Haematological Parameters of Rats Fed ... ABSTRACT: Food insecurity is a major problem of the developing nations. ... Except for the values of haemoglobin and packed cell volume that were ...

Density variation and piezoelectric properties of Ba (Ti1− xSnx) O3 ...

Indian Academy of Sciences (India)

Home; Journals; Bulletin of Materials Science; Volume 35; Issue 5. Density variation and piezoelectric properties of Ba(Ti1−Sn)O3 ceramics prepared from nanocrystalline powders ... The density variation of the ceramics with sintering temperature has been studied by sintering the samples at different temperatures.

Intralesional and metastatic heterogeneity in malignant melanomas demonstrated by stereologic estimates of nuclear volume

DEFF Research Database (Denmark)

Sørensen, Flemming Brandt; Erlandsen, M

1990-01-01

Regional variability of nuclear 3-dimensional size can be estimated objectively using point-sampled intercepts obtained from different, defined zones within individual neoplasms. In the present study, stereologic estimates of the volume-weighted mean nuclear volume, nuclear vv, within peripheral...... on average larger in the peripheral zones of primary melanomas, than nuclear vv in central zones (2p = 6.7 x 10(-4), whereas no zonal differences were demonstrated in metastatic lesions (2p = 0.21). A marked intraindividual variation was demonstrated between primary and corresponding secondary melanomas (2p...... melanomas showed large interindividual variation. This finding emphasizes that unbiased estimates of nuclear vv are robust to regional heterogeneity of nuclear volume and thus suitable for purposes of objective, quantitative malignancy grading of melanomas....

The effect of water volume and mixing time on physical properties of bread made from modified cassava starch-wheat composite flour

Science.gov (United States)

Srirejeki, S.; Manuhara, G. J.; Amanto, B. S.; Atmaka, W.; Laksono, P. W.

2018-03-01

Modification of cassava starch with soaking in the whey (by product on cheese production) resulted in changes of the flour characteristics. Adjustments of processing condition are important to be studied in the making of bread from modified cassava starch and wheat composite flour (30:70). This research aims to determine the effect of water volume and mixing time on the physical properties of the bread. The experimental design of this research was Completely Randomized Factorial Design (CRFD) with two factors which were water volume and mixing time. The variation of water volume significantly affected on bread height, dough volume, dough specific volume, and crust thickness. The variation of mixing time had a significant effect on the increase of dough volume and dough specific volume. The combination of water volume and mixing time had a significant effect on dough height, bread volume, bread specific volume, baking expansion, and weight loss.

Variational analysis and aerospace engineering mathematical challenges for the aerospace of the future

CERN Document Server

Mohammadi, Bijan; Pironneau, Olivier; Cipolla, Vittorio

2016-01-01

This book presents papers surrounding the extensive discussions that took place from the ‘Variational Analysis and Aerospace Engineering’ workshop held at the Ettore Majorana Foundation and Centre for Scientific Culture in 2015. Contributions to this volume focus on advanced mathematical methods in aerospace engineering and industrial engineering such as computational fluid dynamics methods, optimization methods in aerodynamics, optimum controls, dynamic systems, the theory of structures, space missions, flight mechanics, control theory, algebraic geometry for CAD applications, and variational methods and applications. Advanced graduate students, researchers, and professionals in mathematics and engineering will find this volume useful as it illustrates current collaborative research projects in applied mathematics and aerospace engineering.

Novel genetic loci associated with hippocampal volume.

Science.gov (United States)

Hibar, Derrek P; Adams, Hieab H H; Jahanshad, Neda; Chauhan, Ganesh; Stein, Jason L; Hofer, Edith; Renteria, Miguel E; Bis, Joshua C; Arias-Vasquez, Alejandro; Ikram, M Kamran; Desrivières, Sylvane; Vernooij, Meike W; Abramovic, Lucija; Alhusaini, Saud; Amin, Najaf; Andersson, Micael; Arfanakis, Konstantinos; Aribisala, Benjamin S; Armstrong, Nicola J; Athanasiu, Lavinia; Axelsson, Tomas; Beecham, Ashley H; Beiser, Alexa; Bernard, Manon; Blanton, Susan H; Bohlken, Marc M; Boks, Marco P; Bralten, Janita; Brickman, Adam M; Carmichael, Owen; Chakravarty, M Mallar; Chen, Qiang; Ching, Christopher R K; Chouraki, Vincent; Cuellar-Partida, Gabriel; Crivello, Fabrice; Den Braber, Anouk; Doan, Nhat Trung; Ehrlich, Stefan; Giddaluru, Sudheer; Goldman, Aaron L; Gottesman, Rebecca F; Grimm, Oliver; Griswold, Michael E; Guadalupe, Tulio; Gutman, Boris A; Hass, Johanna; Haukvik, Unn K; Hoehn, David; Holmes, Avram J; Hoogman, Martine; Janowitz, Deborah; Jia, Tianye; Jørgensen, Kjetil N; Karbalai, Nazanin; Kasperaviciute, Dalia; Kim, Sungeun; Klein, Marieke; Kraemer, Bernd; Lee, Phil H; Liewald, David C M; Lopez, Lorna M; Luciano, Michelle; Macare, Christine; Marquand, Andre F; Matarin, Mar; Mather, Karen A; Mattheisen, Manuel; McKay, David R; Milaneschi, Yuri; Muñoz Maniega, Susana; Nho, Kwangsik; Nugent, Allison C; Nyquist, Paul; Loohuis, Loes M Olde; Oosterlaan, Jaap; Papmeyer, Martina; Pirpamer, Lukas; Pütz, Benno; Ramasamy, Adaikalavan; Richards, Jennifer S; Risacher, Shannon L; Roiz-Santiañez, Roberto; Rommelse, Nanda; Ropele, Stefan; Rose, Emma J; Royle, Natalie A; Rundek, Tatjana; Sämann, Philipp G; Saremi, Arvin; Satizabal, Claudia L; Schmaal, Lianne; Schork, Andrew J; Shen, Li; Shin, Jean; Shumskaya, Elena; Smith, Albert V; Sprooten, Emma; Strike, Lachlan T; Teumer, Alexander; Tordesillas-Gutierrez, Diana; Toro, Roberto; Trabzuni, Daniah; Trompet, Stella; Vaidya, Dhananjay; Van der Grond, Jeroen; Van der Lee, Sven J; Van der Meer, Dennis; Van Donkelaar, Marjolein M J; Van Eijk, Kristel R; Van Erp, Theo G M; Van Rooij, Daan; Walton, Esther; Westlye, Lars T; Whelan, Christopher D; Windham, Beverly G; Winkler, Anderson M; Wittfeld, Katharina; Woldehawariat, Girma; Wolf, Christiane; Wolfers, Thomas; Yanek, Lisa R; Yang, Jingyun; Zijdenbos, Alex; Zwiers, Marcel P; Agartz, Ingrid; Almasy, Laura; Ames, David; Amouyel, Philippe; Andreassen, Ole A; Arepalli, Sampath; Assareh, Amelia A; Barral, Sandra; Bastin, Mark E; Becker, Diane M; Becker, James T; Bennett, David A; Blangero, John; van Bokhoven, Hans; Boomsma, Dorret I; Brodaty, Henry; Brouwer, Rachel M; Brunner, Han G; Buckner, Randy L; Buitelaar, Jan K; Bulayeva, Kazima B; Cahn, Wiepke; Calhoun, Vince D; Cannon, Dara M; Cavalleri, Gianpiero L; Cheng, Ching-Yu; Cichon, Sven; Cookson, Mark R; Corvin, Aiden; Crespo-Facorro, Benedicto; Curran, Joanne E; Czisch, Michael; Dale, Anders M; Davies, Gareth E; De Craen, Anton J M; De Geus, Eco J C; De Jager, Philip L; De Zubicaray, Greig I; Deary, Ian J; Debette, Stéphanie; DeCarli, Charles; Delanty, Norman; Depondt, Chantal; DeStefano, Anita; Dillman, Allissa; Djurovic, Srdjan; Donohoe, Gary; Drevets, Wayne C; Duggirala, Ravi; Dyer, Thomas D; Enzinger, Christian; Erk, Susanne; Espeseth, Thomas; Fedko, Iryna O; Fernández, Guillén; Ferrucci, Luigi; Fisher, Simon E; Fleischman, Debra A; Ford, Ian; Fornage, Myriam; Foroud, Tatiana M; Fox, Peter T; Francks, Clyde; Fukunaga, Masaki; Gibbs, J Raphael; Glahn, David C; Gollub, Randy L; Göring, Harald H H; Green, Robert C; Gruber, Oliver; Gudnason, Vilmundur; Guelfi, Sebastian; Håberg, Asta K; Hansell, Narelle K; Hardy, John; Hartman, Catharina A; Hashimoto, Ryota; Hegenscheid, Katrin; Heinz, Andreas; Le Hellard, Stephanie; Hernandez, Dena G; Heslenfeld, Dirk J; Ho, Beng-Choon; Hoekstra, Pieter J; Hoffmann, Wolfgang; Hofman, Albert; Holsboer, Florian; Homuth, Georg; Hosten, Norbert; Hottenga, Jouke-Jan; Huentelman, Matthew; Hulshoff Pol, Hilleke E; Ikeda, Masashi; Jack, Clifford R; Jenkinson, Mark; Johnson, Robert; Jönsson, Erik G; Jukema, J Wouter; Kahn, René S; Kanai, Ryota; Kloszewska, Iwona; Knopman, David S; Kochunov, Peter; Kwok, John B; Lawrie, Stephen M; Lemaître, Hervé; Liu, Xinmin; Longo, Dan L; Lopez, Oscar L; Lovestone, Simon; Martinez, Oliver; Martinot, Jean-Luc; Mattay, Venkata S; McDonald, Colm; McIntosh, Andrew M; McMahon, Francis J; McMahon, Katie L; Mecocci, Patrizia; Melle, Ingrid; Meyer-Lindenberg, Andreas; Mohnke, Sebastian; Montgomery, Grant W; Morris, Derek W; Mosley, Thomas H; Mühleisen, Thomas W; Müller-Myhsok, Bertram; Nalls, Michael A; Nauck, Matthias; Nichols, Thomas E; Niessen, Wiro J; Nöthen, Markus M; Nyberg, Lars; Ohi, Kazutaka; Olvera, Rene L; Ophoff, Roel A; Pandolfo, Massimo; Paus, Tomas; Pausova, Zdenka; Penninx, Brenda W J H; Pike, G Bruce; Potkin, Steven G; Psaty, Bruce M; Reppermund, Simone; Rietschel, Marcella; Roffman, Joshua L; Romanczuk-Seiferth, Nina; Rotter, Jerome I; Ryten, Mina; Sacco, Ralph L; Sachdev, Perminder S; Saykin, Andrew J; Schmidt, Reinhold; Schmidt, Helena; Schofield, Peter R; Sigursson, Sigurdur; Simmons, Andrew; Singleton, Andrew; Sisodiya, Sanjay M; Smith, Colin; Smoller, Jordan W; Soininen, Hilkka; Steen, Vidar M; Stott, David J; Sussmann, Jessika E; Thalamuthu, Anbupalam; Toga, Arthur W; Traynor, Bryan J; Troncoso, Juan; Tsolaki, Magda; Tzourio, Christophe; Uitterlinden, Andre G; Hernández, Maria C Valdés; Van der Brug, Marcel; van der Lugt, Aad; van der Wee, Nic J A; Van Haren, Neeltje E M; van 't Ent, Dennis; Van Tol, Marie-Jose; Vardarajan, Badri N; Vellas, Bruno; Veltman, Dick J; Völzke, Henry; Walter, Henrik; Wardlaw, Joanna M; Wassink, Thomas H; Weale, Michael E; Weinberger, Daniel R; Weiner, Michael W; Wen, Wei; Westman, Eric; White, Tonya; Wong, Tien Y; Wright, Clinton B; Zielke, Ronald H; Zonderman, Alan B; Martin, Nicholas G; Van Duijn, Cornelia M; Wright, Margaret J; Longstreth, W T; Schumann, Gunter; Grabe, Hans J; Franke, Barbara; Launer, Lenore J; Medland, Sarah E; Seshadri, Sudha; Thompson, Paul M; Ikram, M Arfan

2017-01-18

The hippocampal formation is a brain structure integrally involved in episodic memory, spatial navigation, cognition and stress responsiveness. Structural abnormalities in hippocampal volume and shape are found in several common neuropsychiatric disorders. To identify the genetic underpinnings of hippocampal structure here we perform a genome-wide association study (GWAS) of 33,536 individuals and discover six independent loci significantly associated with hippocampal volume, four of them novel. Of the novel loci, three lie within genes (ASTN2, DPP4 and MAST4) and one is found 200 kb upstream of SHH. A hippocampal subfield analysis shows that a locus within the MSRB3 gene shows evidence of a localized effect along the dentate gyrus, subiculum, CA1 and fissure. Further, we show that genetic variants associated with decreased hippocampal volume are also associated with increased risk for Alzheimer's disease (r g =-0.155). Our findings suggest novel biological pathways through which human genetic variation influences hippocampal volume and risk for neuropsychiatric illness.

Effect of water volume based on water absorption and mixing time on physical properties of tapioca starch – wheat composite bread

Science.gov (United States)

Prameswari, I. K.; Manuhara, G. J.; Amanto, B. S.; Atmaka, W.

2018-05-01

Tapioca starch application in bread processing change water absorption level by the dough, while sufficient mixing time makes the optimal water absorption. This research aims to determine the effect of variations in water volume and mixing time on physical properties of tapioca starch – wheat composite bread and the best method for the composite bread processing. This research used Complete Randomized Factorial Design (CRFD) with two factors: variations of water volume (111,8 ml, 117,4 ml, 123 ml) and mixing time (16 minutes, 17 minutes 36 seconds, 19 minutes 12 seconds). The result showed that water volume significantly affected on dough volume, bread volume and specific volume, baking expansion, and crust thickness. Mixing time significantly affected on dough volume and specific volume, bread volume and specific volume, baking expansion, bread height, and crust thickness. While the combination of water volume and mixing time significantly affected for all physical properties parameters except crust thickness.

Blood volume measurement with indocyanine green pulse spectrophotometry: dose and site of dye administration

NARCIS (Netherlands)

Germans, Menno R.; de Witt Hamer, Philip C.; van Boven, Leonard J.; Zwinderman, Koos A. H.; Bouma, Gerrit J.

2010-01-01

(1) To determine the optimal administration site and dose of indocyanine green (ICG) for blood volume measurement using pulse spectrophotometry, (2) to assess the variation in repeated blood volume measurements for patients after subarachnoid hemorrhage and (3) to evaluate the safety and efficacy of

Estimating the rates of mass change, ice volume change and snow volume change in Greenland from ICESat and GRACE data

NARCIS (Netherlands)

Slobbe, D.C.; Ditmar, P.G.; Lindenbergh, R.C.

2008-01-01

The focus of this paper is on the quantification of ongoing mass and volume changes over the Greenland ice sheet. For that purpose, we used elevation changes derived from the Ice, Cloud, and land Elevation Satellite (ICESat) laser altimetry mission and monthly variations of the Earth’s gravity field

Interobserver Delineation variation using CT versus combined CT + MRI in intensity- modulated radiotherapy for prostate cancer

International Nuclear Information System (INIS)

Villeirs, G.M.; Verstraete, K.L.; Vaerenbergh, K. van; Vakaet, L.; Bral, S.; Claus, F.; Neve, W.J. de; Meerleer, G.O. de

2005-01-01

Purpose: to quantify interobserver variation of prostate and seminal vesicle delineations using CT only versus CT + MRI in consensus reading with a radiologist. Material and methods: the prostate and seminal vesicles of 13 patients treated with intensity-modulated radiotherapy for prostatic adenocarcinoma were retrospectively delineated by three radiation oncologists on CT only and on CT + MRI in consensus reading with a radiologist. The volumes and margin positions were calculated and intermodality and interobserver variations were assessed for the clinical target volume (CTV), seminal vesicles, prostate and three prostatic subdivisions (apical, middle and basal third). Results: using CT + MRI as compared to CT alone, the mean CTV, prostate and seminal vesicle volumes significantly decreased by 6.54%, 5.21% and 10.47%, respectively. More importantly, their standard deviations significantly decreased by 63.06%, 62.65% and 44.83%, respectively. The highest level of variation was found at the prostatic apex, followed by the prostatic base and seminal vesicles. Conclusion: addition of MRI to CT in consensus reading with a radiologist results in a moderate decrease of the CTV, but an important decrease of the interobserver delineation variation, especially at the prostatic apex. (orig.)

Semiautomatic regional segmentation to measure orbital fat volumes in thyroid-associated ophthalmopathy. A validation study.

Science.gov (United States)

Comerci, M; Elefante, A; Strianese, D; Senese, R; Bonavolontà, P; Alfano, B; Bonavolontà, B; Brunetti, A

2013-08-01

This study was designed to validate a novel semi-automated segmentation method to measure regional intra-orbital fat tissue volume in Graves' ophthalmopathy. Twenty-four orbits from 12 patients with Graves' ophthalmopathy, 24 orbits from 12 controls, ten orbits from five MRI study simulations and two orbits from a digital model were used. Following manual region of interest definition of the orbital volumes performed by two operators with different levels of expertise, an automated procedure calculated intra-orbital fat tissue volumes (global and regional, with automated definition of four quadrants). In patients with Graves' disease, clinical activity score and degree of exophthalmos were measured and correlated with intra-orbital fat volumes. Operator performance was evaluated and statistical analysis of the measurements was performed. Accurate intra-orbital fat volume measurements were obtained with coefficients of variation below 5%. The mean operator difference in total fat volume measurements was 0.56%. Patients had significantly higher intra-orbital fat volumes than controls (p<0.001 using Student's t test). Fat volumes and clinical score were significantly correlated (p<0.001). The semi-automated method described here can provide accurate, reproducible intra-orbital fat measurements with low inter-operator variation and good correlation with clinical data.

Ocular volume measured by CT scans

International Nuclear Information System (INIS)

Hahn, F.J.; Wei-Kom Chu

1984-01-01

Newer CT scans have greatly enhanced oculometric research and made it possible to measure ocular dimensions. With these measurements, ocular volume can be more accurately estimated to understand its relationship with age and sex. One hundred CT orbit scans with presumed normal eyes were used for the data base. The mean values and normal variations of ocular volumes at various ages in both sexes are presented. Rapid growth of the eyeball was noted during the first 24 months of age. It reached its peak between the ages of 18 and 30 years of age, after which there was a reduction. Results may be of help in recognizing eye abnormalities such as microophthalmus and macrophthalmia. (orig.)

Modulation of internal estimates of gravity during and after prolonged roll-tilts.

Directory of Open Access Journals (Sweden)

Alexander A Tarnutzer

Full Text Available Perceived direction of gravity, as assessed by the subjective visual vertical (SVV, shows roll-angle dependent errors that drift over time and a bias upon return to upright. According to Bayesian observer theory, the estimated direction of gravity is derived from the posterior probability distribution by combining sensory input and prior knowledge about earth-vertical in a statistically optimal fashion. Here we aimed to further characterize the stability of SVV during and after prolonged roll-tilts. Specifically we asked whether the post-tilt bias is related to the drift pattern while roll-tilted. Twenty-nine healthy human subjects (23-56 yo repetitively adjusted a luminous arrow to the SVV over periods of 5 min while upright, roll-tilted (± 45°, ± 90°, and immediately after returning to upright. Significant (p<0.05 drifts (median absolute drift-amplitude: 10°/5 min were found in 71% (± 45° and 78% (± 90° of runs. At ± 90° roll-tilt significant increases in absolute adjustment errors were more likely (76%, whereas significant increases (56% and decreases (44% were about equally frequent at ± 45°. When returning to upright, an initial bias towards the previous roll-position followed by significant exponential decay (median time-constant: 71 sec was noted in 47% of all runs (all subjects pooled. No significant correlations were found between the drift pattern during and immediately after prolonged roll-tilt. We conclude that the SVV is not stable during and after prolonged roll-tilt and that the direction and magnitude of drift are individually distinct and roll-angle-dependent. Likely sensory and central adaptation and random-walk processes contribute to drift while roll-tilted. Lack of correlation between the drift and the post-tilt bias suggests that it is not the inaccuracy of the SVV estimate while tilted that determines post-tilt bias, but rather the previous head-roll orientation relative to gravity. We therefore favor central

Striatal volume predicts level of video game skill acquisition.

Science.gov (United States)

Erickson, Kirk I; Boot, Walter R; Basak, Chandramallika; Neider, Mark B; Prakash, Ruchika S; Voss, Michelle W; Graybiel, Ann M; Simons, Daniel J; Fabiani, Monica; Gratton, Gabriele; Kramer, Arthur F

2010-11-01

Video game skills transfer to other tasks, but individual differences in performance and in learning and transfer rates make it difficult to identify the source of transfer benefits. We asked whether variability in initial acquisition and of improvement in performance on a demanding video game, the Space Fortress game, could be predicted by variations in the pretraining volume of either of 2 key brain regions implicated in learning and memory: the striatum, implicated in procedural learning and cognitive flexibility, and the hippocampus, implicated in declarative memory. We found that hippocampal volumes did not predict learning improvement but that striatal volumes did. Moreover, for the striatum, the volumes of the dorsal striatum predicted improvement in performance but the volumes of the ventral striatum did not. Both ventral and dorsal striatal volumes predicted early acquisition rates. Furthermore, this early-stage correlation between striatal volumes and learning held regardless of the cognitive flexibility demands of the game versions, whereas the predictive power of the dorsal striatal volumes held selectively for performance improvements in a game version emphasizing cognitive flexibility. These findings suggest a neuroanatomical basis for the superiority of training strategies that promote cognitive flexibility and transfer to untrained tasks.

Evaluation of axillary dose coverage following whole breast radiotherapy: Variation with the breast volume and shape

International Nuclear Information System (INIS)

Aguiar, Artur; Gomes Pereira, Helena; Azevedo, Isabel; Gomes, Luciano

2015-01-01

Objective: To evaluate the axillary dose coverage in patients treated with tridimensional whole breast radiotherapy (3D-WBRT), according to the breast volume and shape in treatment position. Background: Several studies have demonstrated an insufficient dose contribution to the axillary levels, using 3D-WBRT, remaining unclear whether the breast volume and shape can influence it. Materials and methods: We retrospectively delineated the axillary levels on planning CT-images of 100 patients, treated with 3D-WBRT along 2012 in our institution. To estimate the shape we established an anatomic CT-based interval, defined as the Thoracic Extent (TE). The breast volume matched its CTV. Mean dose levels and V95 (volume receiving at least 95% of the prescribed dose) were evaluated. Results: Mean axillary level I (A1), II (A2) and III (A3) volume was 56.1 cc, 16.5 cc and 18.9 cc, respectively, and mean doses were 43.9 Gy, 38.6 Gy and 19.5 Gy. For breast volumes of <800 cc, 800–999 cc, 1000–1199 cc and >1200 cc, mean A1 V95 was 38%, 51%, 61.2% and 57.2% whereas median A2 V95 was 8.3%, 13.4%, 19.4% and 28% respectively. Regarding shape, where the breast relative position to the TE was categorized in intervals between 31% and 40%, 41% and 50%, 51% and 60%, and 61% and 70%, mean A1 V95 was 38.7%, 43.1%, 51.1% and 77.3% whereas mean A2 V95 was 6.1%, 11.2%, 17.1% and 37% respectively. Conclusions: We observed inadequate dose coverage to all axillary levels, even after applying a sub-analysis accounting for different breast volumes and shapes. Although higher doses were associated with the more voluminous and pendulous breasts, axillary coverage with 3D-WBRT seems to be inefficient, regardless of the breast morphology

Relation of atmogeochemical field variations to radon metronomy

International Nuclear Information System (INIS)

Gruntorad, J.

1996-01-01

Atmogeochemical field variations were monitored through the equivalent volume activity of radon. The interdependences between the various physical variables and the radon activity are presented and discussed, and it is shown that the problem is very complex and a number of factors have to be taken into account. (P.A.). 10 figs., 24 refs

Thermodynamic analysis of a Stirling engine including regenerator dead volume

Energy Technology Data Exchange (ETDEWEB)

Puech, Pascal; Tishkova, Victoria [Universite de Toulouse, UPS, CNRS, CEMES, 29 rue Jeanne Marvig, F-31055 Toulouse (France)

2011-02-15

This paper provides a theoretical investigation on the thermodynamic analysis of a Stirling engine with linear and sinusoidal variations of the volume. The regenerator in a Stirling engine is an internal heat exchanger allowing to reach high efficiency. We used an isothermal model to analyse the net work and the heat stored in the regenerator during a complete cycle. We show that the engine efficiency with perfect regeneration doesn't depend on the regenerator dead volume but this dead volume strongly amplifies the imperfect regeneration effect. An analytical expression to estimate the improvement due to the regenerator has been proposed including the combined effects of dead volume and imperfect regeneration. This could be used at the very preliminary stage of the engine design process. (author)

Poloidal variations in toroidal fusion reactor wall power loadings

International Nuclear Information System (INIS)

Carroll, M.C.; Miley, G.H.

1985-01-01

A geometric formulation is developed by the authors for determining poloidal variations in bremmstrahlung, cyclotron radiation, and neutron wall power loadings in toroidal fusion devices. Assuming toroidal symmetry and utilizing a numerical model which partitions the plasma into small cells, it was generally found that power loadings are highest on the outer surface of the torus, although variations are not as large as some have predicted. Results are presented for various plasma power generation configurations, plasma volume fractions, and toroidal aspect ratios, and include plasma and wall blockage effects

Density variations in a reactor during liquid full dimerization

NARCIS (Netherlands)

Golombok, M.; Bruijn, J.

2000-01-01

In a liquid full plug flow reactor during lower olefin dimerization, the assumption of constant density is not valid—the volume of a plug changes as it proceeds along the reactor. The observed kinetics depend on the density variation in the reactor as the conversion proceeds towards a distribution

Water-vapor pressure control in a volume

Science.gov (United States)

Scialdone, J. J.

1978-01-01

The variation with time of the partial pressure of water in a volume that has openings to the outside environment and includes vapor sources was evaluated as a function of the purging flow and its vapor content. Experimental tests to estimate the diffusion of ambient humidity through openings and to validate calculated results were included. The purging flows required to produce and maintain a certain humidity in shipping containers, storage rooms, and clean rooms can be estimated with the relationship developed here. These purging flows are necessary to prevent the contamination, degradation, and other effects of water vapor on the systems inside these volumes.

Lamb Wave Assessment of Fiber Volume Fraction in Composites

Science.gov (United States)

Seale, Michael D.; Smith, Barry T.; Prosser, W. H.; Zalameda, Joseph N.

1998-01-01

Among the various techniques available, ultrasonic Lamb waves offer a convenient method of examining composite materials. Since the Lamb wave velocity depends on the elastic properties of a material, an effective tool exists to evaluate composites by measuring the velocity of these waves. Lamb waves can propagate over long distances and are sensitive to the desired in-plane elastic properties of the material. This paper discusses a study in which Lamb waves were used to examine fiber volume fraction variations of approximately 0.40-0.70 in composites. The Lamb wave measurements were compared to fiber volume fractions obtained from acid digestion tests. Additionally, a model to predict the fiber volume fraction from Lamb wave velocity values was evaluated.

Changes in superior mesenteric artery Doppler waveform during reduction of cardiac stroke volume and hypotension

DEFF Research Database (Denmark)

Perko, M J; Perko, Grazyna; Just, S

1996-01-01

the hypovolemia. Alterations in pV and pulsatility indices were closely related to changes in stroke volume, and a negative correlation was found between diastolic velocities and stroke volume. regression analysis showed no significant relation between variations in velocity parameters and blood pressure. Results...

Effects of major geometric variations between intracavitary applications on pear-shaped isodose dimension in cancer of the cervix

International Nuclear Information System (INIS)

Kim, R. Y.

1996-01-01

PURPOSE: The basic principal of intracavitary brachytherapy for cancer of the cervix is based on specific loading rules to achieve a pear-shaped isodose distribution centered around the cervix. Recently, ICRU Report 38 recommends a dose reference volume for reporting. Our previous studies have confirmed that there is considerable variations of geometry between applications. This study is to evaluate the effect of major geometric variations on pear-shaped isodose dimension in manual afterloading low-dose-rate system. MATERIAL AND METHODS: One hundred orthogonal films of 50 patients with cancer of the cervix (2 applications/patient) were reviewed for comparative measurements of geometric variations between applications. Major geometric variations were found for 13 patients in lengths of tandem, 7 patients in colpostats separation and 16 patients in vaginal packing. The direct measurement of these geometric variations were compared with the three-dimensional measurement of the pear-shaped isodose enclosed by the point A between the two applications. RESULTS: The geometric variations in the width of colpostats separation and length of tandem were directly related to the width and height of the pear-shaped isodose dimension. The geometric relationship between the colpostats and distal tandem had an important effect on the thickness of the pear-shape. In optimization of poor geometry for rectum or bladder wall, high dose volume centered around the cervix is reduced without changing the overall pear-shaped volume due to changing configuration of the pear-shaped isodose. In our selected patients with two applications, variations in vaginal packing had no direct effect on the width and thickness of the pear-shape due to other variables. CONCLUSION: Major geometric variations between applications greatly affect the dimension of the pear-shaped isodose distribution. Optimization of poor geometry is quite limited without compromising the high-dose volume centered around the

Genetic variations in the serotoninergic system contribute to amygdala volume in humans

Directory of Open Access Journals (Sweden)

Jin eLi

2015-10-01

Full Text Available The amygdala plays a critical role in emotion processing and psychiatric disorders associated with emotion dysfunction. Accumulating evidence suggests that amygdala structure is modulated by serotonin-related genes. However, there is a gap between the small contributions of single loci (less than 1% and the reported 63-65% heritability of amygdala structure. To understand the missing heritability, we systematically explored the contribution of serotonin genes on amygdala structure at the gene set level. The present study of 417 healthy Chinese volunteers examined 129 representative polymorphisms in genes from multiple biological mechanisms in the regulation of serotonin neurotransmission. A system-level approach using multiple regression analyses identified that nine SNPs collectively accounted for approximately 8% of the variance in amygdala volume. Permutation analyses showed that the probability of obtaining these findings by chance was low (p=0.043, permuted for 1000 times. Findings showed that serotonin genes contribute moderately to individual differences in amygdala volume in a healthy Chinese sample. These results indicate that the system-level approach can help us to understand the genetic basis of a complex trait such as amygdala structure.

Variation in Nectar Volume and Sugar Concentration of Allium ursinum L. ssp. ucrainicum in Three Habitats

Directory of Open Access Journals (Sweden)

Ágnes Farkas

2012-01-01

Full Text Available Floral nectar volume and concentration of ramson (Allium ursinum L. ssp. ucrainicum were investigated in three different habitats, including two types of sessile oak-hornbeam association on brown forest soil with clay illuviation and a silver lime-flowering ash rock forest association on rendzina. Daily nectar production ranged from 0.1 to 3.8 μL per flower with sugar concentrations of 25 to 50%. Mean nectar volumes and concentrations showed significant differences between freely exposed flowers and covered flowers, which had been isolated from flower visitors 24 h prior to nectar studies. Both the amount and quality of nectar were affected by microclimatic conditions and soil properties and varied between populations at different habitats. In the silver lime-flowering ash rock-forest association mean nectar volumes and concentrations were lower than in a typical sessile oak-hornbeam association on three occasions, the difference being significant in two cases. During full bloom, the date of sampling did not have a profound effect on either nectar volume or concentration.

Variation in Nectar Volume and Sugar Concentration of Allium ursinum L. ssp. ucrainicum in Three Habitats

Science.gov (United States)

Farkas, Ágnes; Molnár, Réka; Morschhauser, Tamás; Hahn, István

2012-01-01

Floral nectar volume and concentration of ramson (Allium ursinum L. ssp. ucrainicum) were investigated in three different habitats, including two types of sessile oak-hornbeam association on brown forest soil with clay illuviation and a silver lime-flowering ash rock forest association on rendzina. Daily nectar production ranged from 0.1 to 3.8 μL per flower with sugar concentrations of 25 to 50%. Mean nectar volumes and concentrations showed significant differences between freely exposed flowers and covered flowers, which had been isolated from flower visitors 24 h prior to nectar studies. Both the amount and quality of nectar were affected by microclimatic conditions and soil properties and varied between populations at different habitats. In the silver lime-flowering ash rock-forest association mean nectar volumes and concentrations were lower than in a typical sessile oak-hornbeam association on three occasions, the difference being significant in two cases. During full bloom, the date of sampling did not have a profound effect on either nectar volume or concentration. PMID:22619588

Volume corrections factors in the measurement of 99mTc and 123I activities in radionuclide calibrators

International Nuclear Information System (INIS)

Correia, Amanda Ribeiro; Rezende, Eduarda Alexandre; Iwahara, Akira; Oliveira, Antonio Eduardo de; Oliveira, Estela Maria de; Tauhata, Luiz; Chaves, Taina Olivieri

2012-01-01

To determine correction factors for the variation in volume of radiopharmaceuticals in containers of different geometries, comparing the influence of such factors on the determination of 99m Tc and 123 I activity with two types of calibrators - one with ionization chamber and another with Geiger-Mueller (G-M) detector -; and to evaluate calibrators performance in the measurement of 99m Tc and 1 '2 3 I activities. Materials and Methods: Eight calibrators, 10R glass vials, 3 and 5 mL plastic syringes and 99m Tc and 123 I solutions were utilized. The correction factors were determined with basis on practical measurements of the variation in the calibrators' response according to the volume of radionuclide solution in the glass vials. The performance was evaluated according to the acceptance criterion of +- 10% accuracy required by the Brazilian standard. Results: The variation of the calibrators' response according to the variation in radionuclide volume was reasonably greater in the calibrator with G-M detector. It was also greater for 123 I than for 99m Tc. Conclusion: The results confirm that the calibrators' response depends on the radionuclide volume contained in the vials. Such dependence is more critical for the calibrators equipped with G-M detector and for 123 I as compared with 99m Tc. (author)

Dosimetric impact of prostate volume change between CT-based HDR brachytherapy fractions

International Nuclear Information System (INIS)

Kim, Yongbok; Hsu, I-C.; Lessard, Etienne; Vujic, Jasmina; Pouliot, Jean

2004-01-01

Purpose: The objective is to evaluate the prostate volume change and its dosimetric consequences after the insertion of catheters for high-dose-rate brachytherapy. Methods and Materials: For 13 consecutive patients, a spiral CT scan was acquired before each of the 2 fractions, separated on average by 20 hours. The coordinates of the catheters were obtained on 3 axial CT slices corresponding to apex, mid portion, and base portion of the prostate. A mathematical expansion model was used to evaluate the change of prostate volumes between the 2 fractions. It is based on the difference in the cube of the average distance between the centroid and catheter positions. The variation of implant dose-volume histograms between fractions was computed for plans produced by either inverse planning based on simulated annealing or geometric optimization. Results: The average magnitude of either increase or reduction in prostate volume was 7.8% (range, 2-17%). This volume change corresponds to an average prostate radius change of only 2.5% (range, 0.7-5.4%). For 5 patients, the prostate volume increased on average by 9% (range, 2-17%), whereas a reduction was observed for 8 patients by an average of 7% (range, 2-13%). More variation was observed at the prostate base than at mid or apex gland. The comparison of implant dose-volume histograms showed a small reduction of V100 receiving the prescription dose, with an average of 3.5% (range, 0.5-12%) and 2.2% (range, 1-6%) for inverse planning based on our simulated annealing and geometric optimization plans, respectively. Conclusion: Small volume change was observed between treatment fractions. This translates into small changes in dose delivered to the prostate volume

Interfractional changes in tumour volume and position during entire radiotherapy courses for lung cancer with respiratory gating and image guidance

DEFF Research Database (Denmark)

Juhler-Nøttrup, Trine; Korreman, Stine Sofia; Pedersen, Anders N

2008-01-01

were contoured on each CT scan to evaluate the variations in volumes and position. The lung tumours and the mediastinal tumours were contoured separately. The positional variations were measured as 3D mobility vectors and correlated to matching of the scans using the two different strategies. RESULTS......-87% when matched using bony landmarks and 70-76% when matched using skin tattoos. The overlap of the mediastinal tumours were 60-65% and 41-47%, respectively. CONCLUSIONS: Despite the use of gating the tumours varied considerably, regarding both position and volume. The variations in position were...

Intralesional and metastatic heterogeneity in malignant melanomas demonstrated by stereologic estimates of nuclear volume

DEFF Research Database (Denmark)

Sørensen, Flemming Brandt; Erlandsen, M

1990-01-01

Regional variability of nuclear 3-dimensional size can be estimated objectively using point-sampled intercepts obtained from different, defined zones within individual neoplasms. In the present study, stereologic estimates of the volume-weighted mean nuclear volume, nuclear vv, within peripheral...... melanomas showed large interindividual variation. This finding emphasizes that unbiased estimates of nuclear vv are robust to regional heterogeneity of nuclear volume and thus suitable for purposes of objective, quantitative malignancy grading of melanomas....

Variation and decomposition of the partial molar volume of small gas molecules in different organic solvents derived from molecular dynamics simulations.

Science.gov (United States)

Klähn, Marco; Martin, Alistair; Cheong, Daniel W; Garland, Marc V

2013-12-28

The partial molar volumes, V(i), of the gas solutes H2, CO, and CO2, solvated in acetone, methanol, heptane, and diethylether are determined computationally in the limit of infinite dilution and standard conditions. Solutions are described with molecular dynamics simulations in combination with the OPLS-aa force field for solvents and customized force field for solutes. V(i) is determined with the direct method, while the composition of V(i) is studied with Kirkwood-Buff integrals (KBIs). Subsequently, the amount of unoccupied space and size of pre-formed cavities in pure solvents is determined. Additionally, the shape of individual solvent cages is analyzed. Calculated V(i) deviate only 3.4 cm(3) mol(-1) (7.1%) from experimental literature values. Experimental V(i) variations across solutions are reproduced qualitatively and also quantitatively in most cases. The KBI analysis identifies differences in solute induced solvent reorganization in the immediate vicinity of H2 (<0.7 nm) and solvent reorganization up to the third solvation shell of CO and CO2 (<1.6 nm) as the origin of V(i) variations. In all solutions, larger V(i) are found in solvents that exhibit weak internal interactions, low cohesive energy density and large compressibility. Weak internal interactions facilitate solvent displacement by thermal solute movement, which enhances the size of solvent cages and thus V(i). Additionally, attractive electrostatic interactions of CO2 and the solvents, which do not depend on internal solvent interactions only, partially reversed the V(i) trends observed in H2 and CO solutions where electrostatic interactions with the solvents are absent. More empty space and larger pre-formed cavities are found in solvents with weak internal interactions, however, no evidence is found that solutes in any considered solvent are accommodated in pre-formed cavities. Individual solvent cages are found to be elongated in the negative direction of solute movement. This wake behind

Variation and decomposition of the partial molar volume of small gas molecules in different organic solvents derived from molecular dynamics simulations

Science.gov (United States)

Klähn, Marco; Martin, Alistair; Cheong, Daniel W.; Garland, Marc V.

2013-12-01

The partial molar volumes, bar V_i, of the gas solutes H2, CO, and CO2, solvated in acetone, methanol, heptane, and diethylether are determined computationally in the limit of infinite dilution and standard conditions. Solutions are described with molecular dynamics simulations in combination with the OPLS-aa force field for solvents and customized force field for solutes. bar V_i is determined with the direct method, while the composition of bar V_i is studied with Kirkwood-Buff integrals (KBIs). Subsequently, the amount of unoccupied space and size of pre-formed cavities in pure solvents is determined. Additionally, the shape of individual solvent cages is analyzed. Calculated bar V_i deviate only 3.4 cm3 mol-1 (7.1%) from experimental literature values. Experimental bar V_i variations across solutions are reproduced qualitatively and also quantitatively in most cases. The KBI analysis identifies differences in solute induced solvent reorganization in the immediate vicinity of H2 (<0.7 nm) and solvent reorganization up to the third solvation shell of CO and CO2 (<1.6 nm) as the origin of bar V_i variations. In all solutions, larger bar V_i are found in solvents that exhibit weak internal interactions, low cohesive energy density and large compressibility. Weak internal interactions facilitate solvent displacement by thermal solute movement, which enhances the size of solvent cages and thus bar V_i. Additionally, attractive electrostatic interactions of CO2 and the solvents, which do not depend on internal solvent interactions only, partially reversed the bar V_i trends observed in H2 and CO solutions where electrostatic interactions with the solvents are absent. More empty space and larger pre-formed cavities are found in solvents with weak internal interactions, however, no evidence is found that solutes in any considered solvent are accommodated in pre-formed cavities. Individual solvent cages are found to be elongated in the negative direction of solute

Free-volume study of ethylene - vinyl alcohol copolymer evaluated through positronium lifetime measurement

International Nuclear Information System (INIS)

Ito, K.; Hong-ling Li; Ujihira, Y.; Nomura, K.; Saito, Y.; Yamamoto, T.; Nishihara, Y.

2003-01-01

The free-volume, of size ranging from 0.2 to 0.4 nm in radius, in an ethylene-vinyl alcohol copolymer was estimated using positronium lifetime measurement to elucidate the dependence of oxygen permeability on the free-volume size and fraction, on the ethylene content and on the crystallinity. The permeability and the free-volume fraction with varying the ethylene content were well related and the relation was interpreted based on the free-volume theory near below and above the glass transition temperature. On the other hand, the crystallinity significantly influenced the fraction of the amorphous region, where the free-volume hole exists, along with a slight change of the free-volume size. The variation of the permeability with the crystalline degree cannot be explained from the averaged free-volume fraction estimated by the whole volume of the polymer, but the permeability correlated with the free-volume size apparently. (author)

Measurement, variation, and scaling of osteocyte lacunae: a case study in birds.

Science.gov (United States)

D'Emic, Michael D; Benson, Roger B J

2013-11-01

Basic issues surrounding osteocyte biology are still poorly understood, including the variability of osteocyte morphology within and among bones, individuals, and species. Several studies have suggested that the volume or shape of osteocytes (or their lacunae) is related to bone and/or organismal growth rate or metabolism, but the nature of this relationship, if any, is unclear. Furthermore, several studies have linked osteocyte lacuna volume with genome size or growth rate and suggested that osteocyte lacuna volume is unrelated to body size. Herein the scaling of osteocyte lacuna volume with body mass, growth and basal metabolic rates, genome size, and red blood cell size is examined using a broad sample of extant birds within a phylogenetic framework. Over 12,000 osteocyte lacuna axes were measured in a variety of bones from 34 avian and four non-avian dinosaur species. Osteocyte lacunae in parallel-fibered bone are scalene ellipsoids; their morphology and volume cannot be reliably estimated from any single thin section, and using a prolate ellipsoid model to estimate osteocyte lacuna volume results in a substantial (ca. 2-7 times) underestimate relative to true lacunar volume. Orthogonal thin sections reveal that in birds, even when only observing parallel-fibered, primary, cortical bone, intra-skeletal variation in osteocyte lacuna volume and shape is very high (volumes vary by a factor of 5.4 among different bones), whereas variation among homologous bones of the same species is low (1.2-44%; mean=12%). Ordinary and phylogenetically informed bivariate and multiple regressions demonstrate that in birds, osteocyte volume scales significantly but weakly with body mass and mass-specific basal metabolic rate and moderately with genome size, but not with erythrocyte size. Avian whole-body growth rate and osteocyte lacuna volume are weakly and inversely related. Finally, we present the first three-dimensionally calculated osteocyte volumes for several non

SU-F-T-378: Evaluation of Dose-Volume Variability and Parameters Between Prostate IMRT and VMAT Plans

Energy Technology Data Exchange (ETDEWEB)

Chow, J [Princess Margaret Cancer Centre, Toronto, ON (Canada); Jiang, R [Grand River Regional Cancer Centre, Kitchener, ON (Canada); Kiciak, A [University of Waterloo, Waterloo, ON (Canada)

2016-06-15

Purpose: This study compared the rectal dose-volume consistency, equivalent uniform dose (EUD) and normal tissue complication probability (NTCP) in prostate intensity modulated radiotherapy (IMRT) and volumetric modulated arc therapy (VMAT). Methods: For forty prostate IMRT and fifty VMAT patients treated using the same dose prescription (78 Gy/39 fraction) and dose-volume criteria in inverse planning optimization, the rectal EUD and NTCP were calculated for each patient. The rectal dose-volume consistency, showing the variability of dose-volume histogram (DVH) among patients, was defined and calculated based on the deviation between the mean and corresponding rectal DVH. Results: From both the prostate IMRT and VMAT plans, the rectal EUD and NTCP were found decreasing with the rectal volume. The decrease rates for the IMRT plans (EUD = 0.47 × 10{sup −3} Gy cm{sup −3} and NTCP = 3.94 × 10{sup −2} % cm{sup −3}) were higher than those for the VMAT (EUD = 0.28 × 10{sup −3} Gy cm{sup −3} and NTCP = 2.61 × 10{sup −2} % cm{sup −3}). In addition, the dependences of the rectal EUD and NTCP on the dose-volume consistency were found very similar between the prostate IMRT and VMAT plans. This shows that both delivery techniques have similar variations of the rectal EUD and NTCP on the dose-volume consistency. Conclusion: Dependences of the dose-volume consistency on the rectal EUD and NTCP were compared between the prostate IMRT and VMAT plans. It is concluded that both rectal EUD and NTCP decreased with an increase of the rectal volume. The variation rates of the rectal EUD and NTCP on the rectal volume were higher for the IMRT plans than VMAT. However, variations of the rectal dose-volume consistency on the rectal EUD and NTCP were found not significant for both delivery techniques.

Convex variational problems linear, nearly linear and anisotropic growth conditions

CERN Document Server

Bildhauer, Michael

2003-01-01

The author emphasizes a non-uniform ellipticity condition as the main approach to regularity theory for solutions of convex variational problems with different types of non-standard growth conditions. This volume first focuses on elliptic variational problems with linear growth conditions. Here the notion of a "solution" is not obvious and the point of view has to be changed several times in order to get some deeper insight. Then the smoothness properties of solutions to convex anisotropic variational problems with superlinear growth are studied. In spite of the fundamental differences, a non-uniform ellipticity condition serves as the main tool towards a unified view of the regularity theory for both kinds of problems.

PENGARUH FRAKSI VOLUME PENGUAT TERHADAP KEKUATAN LENTUR GREEN COMPOSITE UNTUK APLIKASI PADA BODI KENDARAAN

Directory of Open Access Journals (Sweden)

Mastariyanto Perdana

2016-07-01

Full Text Available Composites are one of material be used in engineering field. This is due the composites has light weight and relatively strong properties. The synthesis fiber-based composites reduces to obtain environmental friendly properties. This research use hybrid fiber which consist of calcium carbonate (CaCO3 powder and bagasse fiber. Matrix used is resin polyester. Variation of volume fraction between bagasse and calcium carbonate powder are 10:20, 15:15 and 20:10 respectively. Volume fraction of hybrid fiber and polyester is 30:70. This study aims to determine mechanical properties of hybrid composites for each variation of volume fraction. Test results showed. Bending strength of bagasse-based hybrid composites and powder of calcium carbonate with a variation of volume fraction of 10%: 20%, 15%: 15% and 20%: 10% are 53.77 MPa, 54.90 MPa and 59.76 MPa. Hybrid composites with volume fraction 20% bagasse and 10% calcium carbonate powder has highest of bending strength. Green composite based bagasse and calcium carbonate powder can use on application of vehicle body.Komposit merupakan salah satu material yang banyak digunakan pada bidang keteknikan. Ini dikarenakan komposit memiliki sifat ringan dan relatif kuat. Untuk mendapakatkan sifat yang ramah lingkungan, penggunaan komposit yang berbasis serat sintesis dikurangi penggunaannya. Penelitian ini menggunakan serat hibrid yaitu penggabungan antara serbuk kalsium karbonat (CaCO3 dan serat ampas tebu (bagasse. Matrix yang digunakan adalah resin polyester.Variasi fraksi volume antara bagasse dan serbuk kalsium karbonat masing-masing adalah 10:20, 15:15 dan 20:10. Fraksi volume antara serat hibrid dan resin polyester adalah 30:70. Penelitian ini bertujuan untuk mengetahui sifat mekanik dari komposit hibrid berbasis bagasse dan serbuk kalsium karbonat untuk masing-masing variasi fraksi volume. Hasil pengujian menunjukkan bahwakekuatan bending tertinggi komposit hibrid berbasis bagasse dan serbuk kalsium

A variational principle for the plasma centrifuge

International Nuclear Information System (INIS)

Ludwig, G.O.

1986-09-01

A variational principle is derived which describes the stationary state of the plasma column in a plasma centrifuge. Starting with the fluid equations in a rotating frame the theory is developed using the method of irreversible thermodynamics. This formulation easily leads to an expression for the density distribution of the l-species at sedimentation equilibrium, taking into account the effect of the electric and magnetic forces. Assuming stationary boundary conditions and rigid rotation nonequilibrium states the condition for thermodynamic stability integrated over the volume of the system reduces, under certain restrictions, to the principle of minimum entropy production in the stationary state. This principle yields a variational problem which is equivalent to the original problem posed by the stationary fluid equations. The variational method is useful in achieving approximate solutions that give the electric potential and current distributions in the rotating plasma column consistent with an assumed plasma density profile. (Author) [pt

Interscan variation of semi-automated volumetry of subsolid pulmonary nodules

International Nuclear Information System (INIS)

Scholten, Ernst T.; Jong, Pim A. de; Willemink, Martin J.; Mali, Willem P.T.M.; Gietema, Hester A.; Jacobs, Colin; Riel, Sarah van; Ginneken, Bram van; Vliegenthart, Rozemarijn; Oudkerk, Matthijs; Koning, Harry J. de; Horeweg, Nanda; Prokop, Mathias

2015-01-01

We aimed to test the interscan variation of semi-automatic volumetry of subsolid nodules (SSNs), as growth evaluation is important for SSN management. From a lung cancer screening trial all SSNs that were stable over at least 3 months were included (N = 44). SSNs were quantified on the baseline CT by two observers using semi-automatic volumetry software for effective diameter, volume, and mass. One observer also measured the SSNs on the second CT 3 months later. Interscan variation was evaluated using Bland-Altman plots. Observer agreement was calculated as intraclass correlation coefficient (ICC). Data are presented as mean (± standard deviation) or median and interquartile range (IQR). A Mann-Whitney U test was used for the analysis of the influence of adjustments on the measurements. Semi-automatic measurements were feasible in all 44 SSNs. The interscan limits of agreement ranged from -12.0 % to 9.7 % for diameter, -35.4 % to 28.6 % for volume and -27.6 % to 30.8 % for mass. Agreement between observers was good with intraclass correlation coefficients of 0.978, 0.957, and 0.968 for diameter, volume, and mass, respectively. Our data suggest that when using our software an increase in mass of 30 % can be regarded as significant growth. (orig.)

Interscan variation of semi-automated volumetry of subsolid pulmonary nodules

Energy Technology Data Exchange (ETDEWEB)

Scholten, Ernst T. [University Medical Center, Department of Radiology, Utrecht (Netherlands); Kennemer Gasthuis, Department of Radiology, Haarlem (Netherlands); Jong, Pim A. de; Willemink, Martin J.; Mali, Willem P.T.M.; Gietema, Hester A. [University Medical Center, Department of Radiology, Utrecht (Netherlands); Jacobs, Colin; Riel, Sarah van [Radboud University Medical Center, Diagnostic Image Analysis Group, Nijmegen (Netherlands); Ginneken, Bram van [Radboud University Medical Center, Diagnostic Image Analysis Group, Nijmegen (Netherlands); Fraunhofer MEVIS, Bremen (Germany); Vliegenthart, Rozemarijn [University of Groningen, University Medical Center Groningen, Department of Radiology, Groningen (Netherlands); University of Groningen, University Medical Centre Groningen, Center for Medical Imaging-North East Netherlands, Groningen (Netherlands); Oudkerk, Matthijs [University of Groningen, University Medical Centre Groningen, Center for Medical Imaging-North East Netherlands, Groningen (Netherlands); Koning, Harry J. de [Erasmus Medical Center, Department of Public Health, Rotterdam (Netherlands); Horeweg, Nanda [Erasmus Medical Center, Department of Public Health, Rotterdam (Netherlands); Erasmus Medical Center, Department of Pulmonology, Rotterdam (Netherlands); Prokop, Mathias [Radboud University Medical Center, Department of Radiology, Nijmegen (Netherlands)

2015-04-01

We aimed to test the interscan variation of semi-automatic volumetry of subsolid nodules (SSNs), as growth evaluation is important for SSN management. From a lung cancer screening trial all SSNs that were stable over at least 3 months were included (N = 44). SSNs were quantified on the baseline CT by two observers using semi-automatic volumetry software for effective diameter, volume, and mass. One observer also measured the SSNs on the second CT 3 months later. Interscan variation was evaluated using Bland-Altman plots. Observer agreement was calculated as intraclass correlation coefficient (ICC). Data are presented as mean (± standard deviation) or median and interquartile range (IQR). A Mann-Whitney U test was used for the analysis of the influence of adjustments on the measurements. Semi-automatic measurements were feasible in all 44 SSNs. The interscan limits of agreement ranged from -12.0 % to 9.7 % for diameter, -35.4 % to 28.6 % for volume and -27.6 % to 30.8 % for mass. Agreement between observers was good with intraclass correlation coefficients of 0.978, 0.957, and 0.968 for diameter, volume, and mass, respectively. Our data suggest that when using our software an increase in mass of 30 % can be regarded as significant growth. (orig.)

Strategies to evaluate the impact of rectal volume on prostate motion during three-dimensional conformal radiotherapy for prostate cancer

Energy Technology Data Exchange (ETDEWEB)

Poli, Ana Paula Diniz Fortuna, E-mail: anapaulafortuna@yahoo.com.br [Universidade Estadual de Campinas (CAISM/UNICAMP), Campinas, SP (Brazil). Centro de Atencao Integrada a Saude da Mulher. Divisao de Radioterapia; Dias, Rodrigo Souza; Giordani, Adelmo Jose; Segreto, Helena Regina Comodo; Segreto, Roberto Araujo [Universidade Federal de Sao Paulo (EPM/UNIFESP), Sao Paulo, SP (Brazil). Escola Paulista de Medicina. Divisao de Radioterapia

2016-01-15

Objective: To evaluate the rectal volume influence on prostate motion during three-dimensional conformal radiotherapy (3D-CRT) for prostate cancer. Materials and Methods: Fifty-one patients with prostate cancer underwent a series of three computed tomography scans including an initial planning scan and two subsequent scans during 3D-CRT. The organs of interest were outlined. The prostate contour was compared with the initial CT images considering the anterior, posterior, superior, inferior and lateral edges of the organ. Variations in the anterior limits and volume of the rectum were assessed and correlated with prostate motion in the anteroposterior direction. Results: The maximum range of prostate motion was observed in the superoinferior direction, followed by the anteroposterior direction. A significant correlation was observed between prostate motion and rectal volume variation (p = 0.037). A baseline rectal volume superior to 70 cm{sup 3} had a significant influence on the prostate motion in the anteroposterior direction (p = 0.045). Conclusion: The present study showed a significant interfraction motion of the prostate during 3D-CRT with greatest variations in the superoinferior and anteroposterior directions, and that a large rectal volume influences the prostate motion with a cutoff value of 70 cm{sup 3}. Therefore, the treatment of patients with a rectal volume > 70 cm{sup 3} should be re-planned with appropriate rectal preparation. Keywords: Rectal volume; Prostate cancer; Three-dimensional conformal radiotherapy. (author)

The study of dose variation and change of heart volume using 4D-CT in left breast radiation therapy

International Nuclear Information System (INIS)

Park, Seon Mi; Cheon, Geum Seong; Heo, Gyeong Hun; Shin, Sung Pil; Kim, Kwang Seok; Kim, Chang Uk; Kim, Hoi Nam

2013-01-01

We investigate the results of changed heart volume and heart dose in the left breast cancer patients while considering the movements of respiration. During the months of March and May in 2012, we designated the 10 patients who had tangential irradiation with left breast cancer in the department of radiation Oncology. With acquired images of free breathing pattern through 3D and 4D CT, we had planed enough treatment filed for covered up the whole left breast. It compares the results of the exposed dose and the volume of heart by DVH (Dose Volume histogram). Although total dose was 50.4 Gy (1.8 Gy/28 fraction), reirradiated 9 Gy (1.8 Gy/5 Fraction) with PTV (Planning Target Volume) if necessary. It compares the results of heart volume and heart dose with the free breathing in 3D CT and 4D CT. It represents the maximum difference volume of heart is 40.5%. In addition, it indicated the difference volume of maximum and minimum, average are 8.8% and 27.9%, 37.4% in total absorbed dose of heart. In case of tangential irradiation (opposite beam) in left breast cancer patients, it is necessary to consider the changed heart volume by the respiration of patient and the heartbeat of patient

Effective orbital volume and eyeball position: an MRI study.

Science.gov (United States)

Detorakis, Efstathios T; Drakonaki, Eleni; Papadaki, Efrosini; Pallikaris, Ioannis G; Tsilimbaris, Miltiadis K

2010-10-01

Previous studies have examined factors affecting the position of the eyeball to the orbit. This study examined the role of effective orbital volume (EOV), defined as the difference between orbital and eyeball volume, as a determinant of eyeball position, using MRI scans. Forty-six patients were recruited from the Department of Ophthalmology of the University Hospital of Heraklion, Crete Greece. Patients with a history of orbital disease were excluded. Distances between eyeball poles and orbital landmarks were measured in T1 weighted transverse, sagittal and coronal orbital images. The protrusion of the eyeball in the sagittal and transverse planes was recorded. The volume of the eyeball and bony orbit, the EOV, the volume of the extraocular muscles as well as clinical information (age, gender, Hertel exophthalmometry) were also recorded. EOV was significantly associated with orbital volume but not with eyeball volume. EOV was also significantly associated with transverse and sagittal globe protrusions. Females displayed significantly lower orbital and eyeball volumes as well as EOV than males but higher transverse globe protrusion than males. Variations in EOV are associated with orbital volume rather than with eyeball volume. EOV is associated with globe protrusion and may be taken into account in the planning of various procedures, including orbital decompression, treatment of enophthalmos or the size of orbital implants following enucleation.

Static roll-tilt over 5 minutes locally distorts the internal estimate of direction of gravity.

Science.gov (United States)

Tarnutzer, A A; Bockisch, C J; Straumann, D; Marti, S; Bertolini, G

2014-12-01

The subjective visual vertical (SVV) indicates perceived direction of gravity. Even in healthy human subjects, roll angle-dependent misestimations, roll overcompensation (A-effect, head-roll > 60° and head-roll tilt, SVV estimates when upright are biased toward the preceding roll position, which indicates that perceived vertical (PV) is shifted by the prior tilt (Tarnutzer AA, Bertolini G, Bockisch CJ, Straumann D, Marti S. PLoS One 8: e78079, 2013). Hypothetically, PV in any roll position could be biased toward the previous roll position. We asked whether such a "global" bias occurs or whether the bias is "local". The SVV of healthy human subjects (N = 9) was measured in nine roll positions (-120° to +120°, steps = 30°) after 5 min of roll-tilt in one of two adaptation positions (±90°) and compared with control trials without adaptation. After adapting, adjustments were shifted significantly (P tilted positions (±30°, ±60°) and upright only. We computationally simulated errors based on the sum of a monotonically increasing function (producing roll undercompensation) and a mixture of Gaussian functions (representing roll overcompensation centered around PV). In combination, the pattern of A- and E-effects could be generated. By shifting the function representing local overcompensation toward the adaptation position, the experimental postadaptation data could be fitted successfully. We conclude that prolonged roll-tilt locally distorts PV rather than globally shifting it. Short-term adaptation of roll overcompensation may explain these shifts and could reflect the brain's strategy to optimize SVV estimates around recent roll positions. Thus postural stability can be improved by visually-mediated compensatory responses at any sustained body-roll orientation. Copyright © 2014 the American Physiological Society.

Strategies to evaluate the impact of rectal volume on prostate motion during three-dimensional conformal radiotherapy for prostate cancer

Directory of Open Access Journals (Sweden)

Ana Paula Diniz Fortuna Poli

2016-02-01

Full Text Available Abstract Objective: To evaluate the rectal volume influence on prostate motion during three-dimensional conformal radiotherapy (3D-CRT for prostate cancer. Materials and Methods: Fifty-one patients with prostate cancer underwent a series of three computed tomography scans including an initial planning scan and two subsequent scans during 3D-CRT. The organs of interest were outlined. The prostate contour was compared with the initial CT images considering the anterior, posterior, superior, inferior and lateral edges of the organ. Variations in the anterior limits and volume of the rectum were assessed and correlated with prostate motion in the anteroposterior direction. Results: The maximum range of prostate motion was observed in the superoinferior direction, followed by the anteroposterior direction. A significant correlation was observed between prostate motion and rectal volume variation ( p = 0.037. A baseline rectal volume superior to 70 cm3 had a significant influence on the prostate motion in the anteroposterior direction ( p = 0.045. Conclusion: The present study showed a significant interfraction motion of the prostate during 3D-CRT with greatest variations in the superoinferior and anteroposterior directions, and that a large rectal volume influences the prostate motion with a cutoff value of 70 cm3. Therefore, the treatment of patients with a rectal volume > 70 cm3 should be re-planned with appropriate rectal preparation.

Comparison of respiratory-induced variations in photoplethysmographic signals

International Nuclear Information System (INIS)

Li, Jin; Jin, Jie; Chen, Xiang; Sun, Weixin; Guo, Ping

2010-01-01

Photoplethysmography (PPG) is an optical method for detecting blood volume changes in tissue. Respiratory-induced intensity, frequency and amplitude variations are contained in the PPG signal; thus, an understanding of the relationships between all of these variations and respiration is essential to advancing respiration monitoring based on PPG. This study investigated correlations between respiratory-induced variations extracted from PPG and simultaneous respiratory signals. PPG signals were recorded from 28 healthy subjects under eight different conditions. Six respiratory-induced variations, i.e. the period of the systole, diastole and pulse, the amplitude of the systole and diastole, and the intensity variation, were determined from the PPG signal. The results indicate that, compared with the period of the pulse, the period of the systole and diastole correlates weakly with respiration; the amplitude of the diastole has a stronger correlation with respiration than the amplitude of the systole. For men, when the respiratory rate is less than 10 breaths min −1 , the period of the pulse has the strongest correlation with respiration, whereas up to or above 15 breaths min −1 , the intensity variation becomes strongest in the sitting posture, while the amplitude of the diastole is strongest in the supine posture. For women, compared with the other variations, the period of the pulse has nearly the strongest correlation with respiration, independent of respiratory rate or posture

Controlling thermal deformation by using composite materials having variable fiber volume fraction

International Nuclear Information System (INIS)

Bouremana, M.; Tounsi, A.; Kaci, A.; Mechab, I.

2009-01-01

In application, many thin structural components such as beams, plates and shells experience a through-thickness temperature variation. This temperature variation can produce both an in-plane expansion and an out-of-plane (bending) curvature. Given that these thin components interact with or connect to other components, we often wish to minimize the thermal deformation or match the thermal deformation of another component. This is accomplished by using a composite whose fibers have a negative axial thermal expansion coefficient. By varying the fiber volume fraction within a symmetric laminated beam to create a functionally graded material (FGM), certain thermal deformations can be controlled or tailored. Specifically, a beam can be designed which does not curve under a steady-state through-thickness temperature variation. Continuous gradation of the fiber volume fraction in the FGM layer is modelled in the form of a mth power polynomial of the coordinate axis in thickness direction of the beam. The beam results are independent of the actual temperature values, within the limitations of steady-state heat transfer and constant material properties. The influence of volume fiber fraction distributions are studied to match or eliminate an in-plane expansion coefficient, or to match a desired axial stiffness. Combining two fiber types to create a hybrid FGM can offer desirable increase in axial and bending stiffness while still retaining the useful thermal deformation behavior.

Determination of blood volume by pulse CO-oximetry

International Nuclear Information System (INIS)

Lalande, S; Kelsey, J W; Joyner, M J; Johnson, B D

2012-01-01

The objective of this study was to determine whether changes in carboxyhaemoglobin (COHb) saturation following carbon monoxide (CO) rebreathing can be accurately detected by pulse CO-oximetry in order to determine blood volume. Noninvasive measurements of carboxyhaemoglobin saturation (SpCO) were continuously monitored by pulse CO-oximetry before, during and following 2 min of CO rebreathing. Reproducibility and accuracy of noninvasive blood volume measurements were determined in 16 healthy non-smoking individuals (15 males, age: 28 ± 2 years, body mass index: 25.4 ± 0.6 kg m −2 ) through comparison with blood volume measurements calculated from invasive measurements of COHb saturation. The coefficient of variation for noninvasive blood volume measurements performed on separate days was 15.1% which decreases to 9.1% when measurements were performed on the same day. Changes in COHb saturation and SpCO following CO rebreathing were strongly correlated (r = 0.90, p < 0.01), resulting in a significant correlation between invasive and noninvasive blood volume measurements (r = 0.83, p = 0.02). Changes in SpCO following CO rebreathing can be accurately detected by pulse CO-oximetry, which could potentially provide a simplified, convenient and reproducible method to rapidly determine blood volume in healthy individuals

Kidney volume in type 1 (insulin-dependent) diabetic patients with normal or increased urinary albumin excretion

DEFF Research Database (Denmark)

Feldt-Rasmussen, B; Hegedüs, L; Mathiesen, E R

1991-01-01

Forty-seven patients with type 1 (insulin-dependent) diabetes mellitus and 14 normal subjects had renal volume determined by an ultrasonic technique. Renal volume of 299 +/- 49 ml/1.73 m2 (mean +/- SD) in type 1 diabetic patients with normal urinary albumin excretion exceeded that in the normal...... subjects (245 +/- 53 ml/1.73 m2, p less than 0.05). Compared with diabetic patients with normal urinary albumin excretion, renal volume was significantly higher in patients with microalbuminuria (372 +/- 24 ml/1.73 m2, p less than 0.05) and patients with clinical nephropathy (352 +/- 48 ml/1.73 m2, p less...... than 0.05). In a multiple linear regression with HbA1c, urinary albumin excretion, age, diabetes duration and mean blood pressure as independent variables, variations in HbA1c could account for 33% of the variations in kidney volume (n = 47, r = 0.57, p less than 0.01). The other variables played...

Quantification of Prostate and Seminal Vesicle Interfraction Variation During IMRT

International Nuclear Information System (INIS)

Frank, Steven J.; Dong Lei; Kudchadker, Rajat J.; De Crevoisier, Renaud; Lee, Andrew K.; Cheung, Rex; Choi, Seungtaek; O'Daniel, Jennifer; Tucker, Susan L.; Wang He; Kuban, Deborah A.

2008-01-01

Purpose: To quantify the interfraction variability in prostate and seminal vesicle (SV) positions during a course of intensity-modulated radiotherapy (IMRT) using an integrated computed tomography (CT)-linear accelerator system and to assess the impact of rectal and bladder volume changes. Methods and Materials: We studied 15 patients who had undergone IMRT for prostate carcinoma. Patients had one pretreatment planning CT scan followed by three in-room CT scans per week using a CT-on-rails system. The prostate, bladder, rectum, and pelvic bony anatomy were contoured in 369 CT scans. Using the planning CT scan as a reference, the volumetric and positional changes were analyzed in the subsequent CT scans. Results: For all 15 patients, the mean systematic internal prostate and SV variation was 0.1 ± 4.1 mm and 1.2 ± 7.3 mm in the anteroposterior axis, -0.5 ± 2.9 mm and -0.7 ± 4.5 mm in the superoinferior axis, and 0.2 ± 0.9 mm and -0.9 ± 1.9 mm in the lateral axis, respectively. The mean magnitude of the three-dimensional displacement vector was 4.6 ± 3.5 mm for the prostate and 7.6 ± 4.7 mm for the SVs. The rectal and bladder volume changes during treatment correlated with the anterior and superior displacement of the prostate and SVs. Conclusion: The dominant prostate and SV variations occurred in the anteroposterior and superoinferior directions. The systematic prostate and SV variation between the treatment planning CT and daily therapy as a result of the rectal and bladder volume changes emphasizes the need for daily directed target localization and/or immobilization techniques

Definition of gross tumor volume in lung cancer: inter-observer variability

International Nuclear Information System (INIS)

Van de Steene, Jan; Linthout, Nadine; Mey, Johan de; Vinh-Hung, Vincent; Claassens, Cornelia; Noppen, Marc; Bel, Arjan; Storme, Guy

2002-01-01

Background and purpose: To determine the inter-observer variation in gross tumor volume (GTV) definition in lung cancer, and its clinical relevance. Material and methods: Five clinicians involved in lung cancer were asked to define GTV on the planning CT scan of eight patients. Resulting GTVs were compared on the base of geometric volume, dimensions and extensions. Judgement of invasion of lymph node (LN) regions was evaluated using the ATS/LCSG classification of LN. Clinical relevance of the variation was studied through 3D-dosimetry of standard conformal plans: volume of critical organs (heart, lungs, esophagus, spinal cord) irradiated at toxic doses, 95% isodose volumes of GTVs, normal tissue complication probabilities (NTCP) and tumor control probabilities (TCP) were compared for evaluation of observer variability. Results: Before evaluation of observer variability, critical review of planning CT scan led to up- (two cases) and downstaging (one case) of patients as compared to the respective diagnostic scans. The defined GTVs showed an inter-observer variation with a ratio up to more than 7 between maximum and minimum geometric content. The dimensions of the primary tumor had inter-observer ranges of 4.2 (transversal), 7.9 (cranio-caudal) and 5.4 (antero-posterior) cm. Extreme extensions of the GTVs (left, right, cranial, caudal, anterior and posterior) varied with ranges of 2.8-7.3 cm due to inter-observer variation. After common review, only 63% of involved lymph node regions were delineated by the clinicians (i.e. 37% are false negative). Twenty-two percent of drawn in lymph node regions were accepted to be false positive after review. In the conformal plans, inter-observer ranges of irradiated normal tissue volume were on average 12%, with a maximum of 66%. The probability (in the population of all conformal plans) of irradiating at least 95% of the GTV with at least 95% of the nominal treatment dose decreased from 96 to 88% when swapping the matched GTV

Individual differences in posterior cortical volume correlate with proneness to pride and gratitude.

Science.gov (United States)

Zahn, Roland; Garrido, Griselda; Moll, Jorge; Grafman, Jordan

2014-11-01

Proneness to specific moral sentiments (e.g. pride, gratitude, guilt, indignation) has been linked with individual variations in functional MRI (fMRI) response within anterior brain regions whose lesion leads to inappropriate behaviour. However, the role of structural anatomical differences in rendering individuals prone to particular moral sentiments relative to others is unknown. Here, we investigated grey matter volumes (VBM8) and proneness to specific moral sentiments on a well-controlled experimental task in healthy individuals. Individuals with smaller cuneus, and precuneus volumes were more pride-prone, whereas those with larger right inferior temporal volumes experienced gratitude more readily. Although the primary analysis detected no associations with guilt- or indignation-proneness, subgenual cingulate fMRI responses to guilt were negatively correlated with grey matter volumes in the left superior temporal sulcus and anterior dorsolateral prefrontal cortices (right >left). This shows that individual variations in functional activations within critical areas for moral sentiments were not due to grey matter volume differences in the same areas. Grey matter volume differences between healthy individuals may nevertheless play an important role by affecting posterior cortical brain systems that are non-critical but supportive for the experience of specific moral sentiments. This may be of particular relevance when their experience depends on visuo-spatial elaboration. Published by Oxford University Press 2013. This work is written by US Government employees and is in the public domain in the US.

Single-dose volume regulation algorithm for a gas-compensated intrathecal infusion pump.

Science.gov (United States)

Nam, Kyoung Won; Kim, Kwang Gi; Sung, Mun Hyun; Choi, Seong Wook; Kim, Dae Hyun; Jo, Yung Ho

2011-01-01

The internal pressures of medication reservoirs of gas-compensated intrathecal medication infusion pumps decrease when medication is discharged, and these discharge-induced pressure drops can decrease the volume of medication discharged. To prevent these reductions, the volumes discharged must be adjusted to maintain the required dosage levels. In this study, the authors developed an automatic control algorithm for an intrathecal infusion pump developed by the Korean National Cancer Center that regulates single-dose volumes. The proposed algorithm estimates the amount of medication remaining and adjusts control parameters automatically to maintain single-dose volumes at predetermined levels. Experimental results demonstrated that the proposed algorithm can regulate mean single-dose volumes with a variation of 98%. © 2010, Copyright the Authors. Artificial Organs © 2010, International Center for Artificial Organs and Transplantation and Wiley Periodicals, Inc.

ESTIMATIVA DO VOLUME TOTAL DE MADEIRA EM ESPÉCIES DE EUCALIPTO A PARTIR DE IMAGENS DE SATÉLITE LANDSAT

Directory of Open Access Journals (Sweden)

Elias Fernando Berra

2012-01-01

Full Text Available Models relating spectral answers with biophysical parameters aim estimate variables, such as wood volume, without the necessity of frequent field measurements. The objective was to develop models to estimatewood volume by Landsat 5 TM images, supported by regional forest inventory data. The image was georeferenced and converted to spectral reflectance. After, the images-index NDVI (Normalized Difference Vegetation Index and SR (Simple Ratio was generated. The reflectance values of both spectral bands (TM1, TM2, TM3 e TM4 and indices (NDVI and SR was related with the wood volume. The biggest correlation with volume was with the NDVI and SR indices. The variables selection was made by Stepwise method, which returned three regression models as significant to explain the variation in volume. Finally,the best fitted model was selected (volume = -830,95 + 46,05 × (SR + 107,47 × (TM2, which was applied on the Landsat image where the pixels had started to represent the estimated volume in m³/ha on the Eucalyptus sp. production units. This model, significant at 95 % confidence level, explains 68 % of the wood volume variation.

Variation in rates of breast cancer surgery: A national analysis based on French Hospital Episode Statistics.

Science.gov (United States)

Rococo, E; Mazouni, C; Or, Z; Mobillion, V; Koon Sun Pat, M; Bonastre, J

2016-01-01

Minimum volume thresholds were introduced in France in 2008 to improve the quality of cancer care. We investigated whether/how the quality of treatment decisions in breast cancer surgery had evolved before and after this policy was implemented. We used Hospital Episode Statistics for all women having undergone breast conserving surgery (BCS) or mastectomy in France in 2005 and 2012. Three surgical procedures considered as better treatment options were analyzed: BCS, immediate breast reconstruction (IBR) and sentinel lymph node biopsy (SLNB). We studied the mean rates and variation according to the hospital profile and volume. Between 2005 and 2012, the volume of breast cancer surgery increased by 11% whereas one third of the hospitals no longer performed this type of surgery. In 2012, the mean rate of BCS was 74% and similar in all hospitals whatever the volume. Conversely, IBR and SLNB rates were much higher in cancer centers (CC) and regional teaching hospitals (RTH) [IBR: 19% and 14% versus 8% on average; SLNB: 61% and 47% versus 39% on average]; the greater the hospital volume, the higher the IBR and SLNB rates (p < 0.0001). Overall, whatever the surgical procedure considered, inter-hospital variation in rates declined substantially in CC and RTH. We identified considerable variation in IBR and SLNB rates between French hospitals. Although more complex and less standardized than BCS, most clinical guidelines recommended these procedures. This apparent heterogeneity suggests unequal access to high-quality procedures for women with breast cancer. Copyright © 2015 Elsevier Ltd. All rights reserved.

Target volume shape variation during irradiation of rectal cancer patients in supine position: Comparison with prone position

International Nuclear Information System (INIS)

Nijkamp, Jasper; Jong, Rianne de; Sonke, Jan-Jakob; Vliet, Corine van; Marijnen, Corrie

2009-01-01

Purpose: To quantify the inter-fraction shape variation of the mesorectum for rectal cancer patients treated with 5 x 5 Gy in supine position and compare it to variation in prone position. Methods and materials: For 28 patients a planning CT (pCT) and five daily cone-beam-CT (CBCT) scans were acquired in supine position. The mesorectal part of the CTV (MesoRect) was delineated on all scans. The shape variation was quantified by the distance between the pCT- and the CBCT delineations and stored in surface maps after online setup correction. Data were analyzed for male and female patients separately and compared to prone data. Results: A large range of systematic, 1-8 mm (1SD), and random, 1-5 mm, shape variation was found, comparable to prone patients. Random-shape variation was comparable for male and female patients, while systematic variation was 3 mm larger for female patients. Conclusions: Shape variation of the MesoRect is substantial, heterogeneous and different between male and female patients. Differences between supine and prone orientation, however, are small. Clinical margins should be differentiated in position along the cranio-caudal axis, in anterior-posterior direction and for gender. Margins should also be increased, even when online setup correction is used. Due to the small margin differences between prone and supine treatments, the setup choice should be determined on dose to the organs at risk.

Sasaki-Einstein Manifolds and Volume Minimisation

CERN Document Server

Martelli, D; Yau, S T; Martelli, Dario; Sparks, James; Yau, Shing-Tung

2006-01-01

We study a variational problem whose critical point determines the Reeb vector field for a Sasaki-Einstein manifold. This extends our previous work on Sasakian geometry by lifting the condition that the manifolds are toric. We show that the Einstein-Hilbert action, restricted to a space of Sasakian metrics on a link L in a Calabi-Yau cone M, is the volume functional, which in fact is a function on the space of Reeb vector fields. We relate this function both to the Duistermaat-Heckman formula and also to a limit of a certain equivariant index on M that counts holomorphic functions. Both formulae may be evaluated by localisation. This leads to a general formula for the volume function in terms of topological fixed point data. As a result we prove that the volume of any Sasaki-Einstein manifold, relative to that of the round sphere, is always an algebraic number. In complex dimension n=3 these results provide, via AdS/CFT, the geometric counterpart of a-maximisation in four dimensional superconformal field theo...

Augmented asymmetrical visual field dependence in asymptomatic diabetics: evidence of subclinical asymmetrical bilateral vestibular dysfunction.

Science.gov (United States)

Razzak, Rima Abdul; Bagust, Jeffery; Docherty, Sharon; Hussein, Wiam; Al-Otaibi, Abdullah

2015-01-01

Diabetes negatively affects the vestibular system in many ways, with vestibular dysfunction (VD), a co-morbidity with a high prevalence in diabetics. The ability to perceive subjective visual vertical (SVV), as a sign of vestibular dysfunction, and visual field dependence was measured using a computerized rod and frame test (CRAF). Alignment errors recorded from 47 asymptomatic Type II diabetics (no vertigo or falls, without peripheral neuropathy or retinopathy) were compared to 29 healthy age matched (46-69years) controls. Visual field dependence was significantly larger and more asymmetrical in the diabetics than controls. In the absence of any visual references, or when a vertical reference frame was provided, SVV perception was accurate in both groups, with no significant difference between the controls and diabetics. During tilted frame presentations, the proportion of subjects with either SVV deviations, or an asymmetry index, larger than an upper limit derived from the control data was significantly greater in diabetics than controls. These results suggest that the decreased ability to resolve visuo-vestibular conflict in asymptomatic diabetic patients (free of retinopathy and peripheral neuropathy) compared to controls may be related to diabetic complications affecting vestibular structures and thus causing a decompensation of subclinical vestibular asymmetries. Copyright © 2015 Elsevier Inc. All rights reserved.

FURTHER STUDIES ON THE VARIATION OF SPRAY DEPOSITS IN VINEYARDS WITH AIRFLOW RATE AND VOLUME RATE

Directory of Open Access Journals (Sweden)

Emanuele Cerruto

2007-03-01

Full Text Available The present research, continuing that reported in [2], deals with the spray application subject, so to investigate as volume rate and airflow rate, forward speed being equal, affect the foliar deposition in an espalier vineyard. Experimental trials were carried out by means of an air assisted towed sprayer, equipped with “Albuz ATR” nozzles. To take into account the influence of the development of the trees, the field trials were replicated in two phenological stages with an interval of about one month: “Inflorescences fully developed” (stage 1 and “Beginning of berry touch” (stage 2. A full factorial experiment was carried out for each growth stage, with two airflow rates (3.9 and 7.5 m3/s, three volume rates (103, 216, and 276 L/ha in the first growth stage and 154, 330 and 432 L/ha in the second growth stage, and four replicates, arranged according to a randomised complete block design. Working pressure (1.2 MPa and forward speed (1.4 m/s were kept unchanged for all the trials. The foliar deposition was measured by means of a spectrophotometric technique. The leaves were sampled on two depth layers and two or three heights, according to the trees’ development. The results showed that volume rate did not significantly influence the mean foliar deposition in both the two growth stages, while the highest deposits were obtained with the lowest airflow rate. The airflow rate × volume rate interaction, though not statistically significant, showed that low volume rates together with high airflow rates, result in a noticeable reduction in foliar deposition (29% with respect the grand mean, due to an increase of the spry drift, especially at the first growth stage, when the foliar development is little. These second tests, unlike those described in [2], did not show any positive influence of the airflow rate on the foliar deposition in the inner part of the canopy, so further investigations could be necessary to better understand the

Daily variations in delivered doses in patients treated with radiotherapy for localized prostate cancer

International Nuclear Information System (INIS)

Kupelian, Patrick A.; Langen, Katja M.; Zeidan, Omar A.; Meeks, Sanford L.; Willoughby, Twyla R.; Wagner, Thomas H.; Jeswani, Sam; Ruchala, Kenneth J.; Haimerl, Jason; Olivera, Gustavo H.

2006-01-01

Purpose: The aim of this work was to study the variations in delivered doses to the prostate, rectum, and bladder during a full course of image-guided external beam radiotherapy. Methods and Materials: Ten patients with localized prostate cancer were treated with helical tomotherapy to 78 Gy at 2 Gy per fraction in 39 fractions. Daily target localization was performed using intraprostatic fiducials and daily megavoltage pelvic computed tomography (CT) scans, resulting in a total of 390 CT scans. The prostate, rectum, and bladder were manually contoured on each CT by a single physician. Daily dosimetric analysis was performed with dose recalculation. The study endpoints were D95 (dose to 95% of the prostate), rV2 (absolute rectal volume receiving 2 Gy), and bV2 (absolute bladder volume receiving 2 Gy). Results: For the entire cohort, the average D95 (±SD) was 2.02 ± 0.04 Gy (range, 1.79-2.20 Gy). The average rV2 (±SD) was 7.0 ± 8.1 cc (range, 0.1-67.3 cc). The average bV2 (±SD) was 8.7 ± 6.8 cc (range, 0.3-36.8 cc). Unlike doses for the prostate, there was significant daily variation in rectal and bladder doses, mostly because of variations in volume and shape of these organs. Conclusion: Large variations in delivered doses to the rectum and bladder can be documented with daily megavoltage CT scans. Image guidance for the targeting of the prostate, even with intraprostatic fiducials, does not take into account the variation in actual rectal and bladder doses. The clinical impact of techniques that take into account such dosimetric parameters in daily patient set-ups should be investigated

Changes in atheroma volume estimated from digitized femoral arteriograms

International Nuclear Information System (INIS)

Nilsson, S.; Erikson, U.

1990-01-01

To evaluate the effects of treatment in patients with cardiovascular risk factors, valid and reproducible methods for assessing changes in atheroma volume are required. We postulated that these changes could be accurately estimated by repeat measurement of the lumen volume of the artery to be studied. With a computer-based technique, the lumen volume of a 20 cm segment of the femoral artery was measured in arteriograms from 107 patients with hypercholesterolemia. Films were digitized with use of a high-resolution scanner, cross-sectional areas were calculated with a slice thickness of 150 μm and the lumen volume was obtained by their integration. The validity of the method was demonstrated in model experiments. An automatic algorithm to correct for changes due to patient positioning was developed and validated in a model experiment. With repeat measurment 10 min and 11 to 13 months apart the coefficients of variation were 2.9% (N=107) and 6.1% (N=29), respectively. (orig.)

Measurement of regional extravascular lung density and of pulmonary blood volume with positron emitting isotopes

Energy Technology Data Exchange (ETDEWEB)

Larock, M.P.; Quaglia, L.; Lamotte, D.; De Landsheere, C.; Del Fiore, G.; Chevigne, M.; Peters, J.M.; Rigo, P. (Universite de Liege (Belgium))

1982-01-01

Studies of pulmonary blood volume changes with exercise can be performed after labelling of the blood pool by /sup 11/CO inhalation. Positron transaxial tomography permits the quantitative study of density distribution of the chest and of the pulmonary blood volume. This paper represents our preliminary experience with these techniques on models and control patients. We have first verified the linearity of transmission for density distribution below one. The tomographic examination first records a transmission image, then an emission image on the same section. We next normalize emission and transmission values on a region of unit density corresponding to blood: then we substract the emission from the transmission values to measure the extravascular pulmonary density. With crystal probes we record pulmonary blood volume variations before, during and after exercise. Peripheral hemodynamic variations explain the change recorded at the begining and at the end of exercise. Combination of these two techniques should help us to better study the importance of the acute changes in the ''formation'' of pulmonary oedema and its influence on regional pulmonary blood volume.

Identification of some nonsmooth evolution systems with illustration on adhesive contacts at small strains

Czech Academy of Sciences Publication Activity Database

Adam, Lukáš; Outrata, Jiří; Roubíček, Tomáš

2017-01-01

Roč. 66, č. 12 (2017), s. 2025-2049 ISSN 0233-1934 R&D Projects: GA ČR GA13-25911S; GA ČR GA13-18652S; GA ČR GAP201/10/0357; GA ČR(CZ) GAP201/12/0671 Grant - others:GA UK(CZ) SVV 260225/2015 Institutional support: RVO:67985556 ; RVO:61388998 Keywords : rate-independent systems * optimal control * identification * fractional-step time discretization * quadratic programming * gradient evaluation * variational analysis * implicit programming approach * limiting subdifferential * coderivative * nonsmooth contact mechanics * delamination Subject RIV: BA - General Mathematics; BA - General Mathematics (UT-L) OBOR OECD: Pure mathematics; Pure mathematics (UT-L) Impact factor: 0.943, year: 2016 http://library.utia.cas.cz/separaty/2016/MTR/adam-0453289.pdf

Comparison study of portable bladder scanner versus cone-beam CT scan for measuring bladder volumes in post-prostatectomy patients undergoing radiotherapy.

Science.gov (United States)

Ung, K A; White, R; Mathlum, M; Mak-Hau, V; Lynch, R

2014-01-01

In post-prostatectomy radiotherapy to the prostatic bed, consistent bladder volume is essential to maintain the position of treatment target volume. We assessed the differences between bladder volume readings from a portable bladder scanner (BS-V) and those obtained from planning CT (CT-V) or cone-beam CT (CBCT-V). Interfraction bladder volume variation was also determined. BS-V was recorded before and after planning CT or CBCT. The percentage differences between the readings using the two imaging modalities, standard deviations and 95% confidence intervals were determined. Data were analysed for the whole patient cohort and separately for the older BladderScan™ BVI3000 and newer BVI9400 model. Interfraction bladder volume variation was determined from the percentage difference between the CT-V and CBCT-V. Treatment duration, incorporating the time needed for BS and CBCT, was recorded. Fourteen patients were enrolled, producing 133 data sets for analysis. BS-V was taken using the BVI9400 in four patients (43 data sets). The mean BS-V was 253.2 mL, and the mean CT-V or CBCT-V was 199 cm(3). The mean percentage difference between the two modalities was 19.7% (SD 42.2; 95%CI 12.4 to 26.9). The BVI9400 model produced more consistent readings, with a mean percentage difference of -6.2% (SD 27.8; 95% CI -14.7 to -2.4%). The mean percentage difference between CT-V and CBCT-V was 31.3% (range -48% to 199.4%). Treatment duration from time of first BS reading to CBCT was, on average, 12 min (range 6-27). The BS produces bladder volume readings of an average 19.7% difference from CT-V or CBCT-V and can potentially be used to screen for large interfraction bladder volume variations in radiotherapy to prostatic bed. The observed interfraction bladder volume variation suggests the need to improve bladder volume consistency. Incorporating the BS into practice is feasible. © 2014 The Royal Australian and New Zealand College of Radiologists.

Comparison study of portable bladder scanner versus cone-beam CT scan for measuring bladder volumes in post-prostatectomy patients undergoing radiotherapy

International Nuclear Information System (INIS)

Ung, K.A.; White, R.; Mathlum, M.; Lynch, R.; Mak-Hau, V.

2014-01-01

In post-prostatectomy radiotherapy to the prostatic bed, consistent bladder volume is essential to maintain the position of treatment target volume. We assessed the differences between bladder volume readings from a portable bladder scanner (BS-V) and those obtained from planning CT (CT-V) or cone-beam CT (CBCT-V). Interfraction bladder volume variation was also determined. BS-V was recorded before and after planning CT or CBCT. The percentage differences between the readings using the two imaging modalities, standard deviations and 95% confidence intervals were determined. Data were analysed for the whole patient cohort and separately for the older BladderScan™ BVI3000 and newer BVI9400 model. Interfraction bladder volume variation was determined from the percentage difference between the CT-V and CBCT-V. Treatment duration, incorporating the time needed for BS and CBCT, was recorded. Fourteen patients were enrolled, producing 133 data sets for analysis. BS-V was taken using the BVI9400 in four patients (43 data sets). The mean BS-V was 253.2mL, and the mean CT-V or CBCT-V was 199cm3. The mean percentage difference between the two modalities was 19.7% (SD 42.2; 95%CI 12.4 to 26.9). The BVI9400 model produced more consistent readings, with a mean percentage difference of −6.2% (SD 27.8; 95% CI −14.7 to −2.4%). The mean percentage difference between CT-V and CBCT-V was 31.3% (range −48% to 199.4%). Treatment duration from time of first BS reading to CBCT was, on average, 12min (range 6–27). The BS produces bladder volume readings of an average 19.7% difference from CT-V or CBCT-V and can potentially be used to screen for large interfraction bladder volume variations in radiotherapy to prostatic bed. The observed interfraction bladder volume variation suggests the need to improve bladder volume consistency. Incorporating the BS into practice is feasible.

Volume-based characterization of postocclusion surge.

Science.gov (United States)

Zacharias, Jaime; Zacharias, Sergio

2005-10-01

To propose an alternative method to characterize postocclusion surge using a collapsible artificial anterior chamber to replace the currently used rigid anterior chamber model. Fundación Oftamológica Los Andes, Santiago, Chile. The distal end of a phacoemulsification handpiece was placed inside a compliant artificial anterior chamber. Digital recordings of chamber pressure, chamber volume, inflow, and outflow were performed during occlusion break of the phacoemulsification tip. The occlusion break profile of 2 different consoles was compared. Occlusion break while using a rigid anterior chamber model produced a simultaneous increase of chamber inflow and outflow. In the rigid chamber model, pressure decreased sharply, reaching negative pressure values. Alternatively, with the collapsible chamber model, a delay was observed in the inflow that occurs to compensate the outflow surge. Also, the chamber pressure drop was smaller in magnitude, never undershooting below atmospheric pressure into negative values. Using 500 mm Hg as vacuum limit, the Infiniti System (Alcon) performed better that the Legacy (Alcon), showing an 18% reduction in peak volume variation. The collapsible anterior chamber model provides a more realistic representation of the postocclusion surge events that occur in the real eye during cataract surgery. Peak volume fluctuation (mL), half volume recovery time(s), and volume fluctuation integral value (mL x s) are proposed as realistic indicators to characterize the postocclusion surge performance. These indicators show that the Infiniti System has a better postocclusion surge behavior than the Legacy System.

Variation of densitometry on computed tomography in COPD--influence of different software tools.

Directory of Open Access Journals (Sweden)

Mark O Wielpütz

Full Text Available Quantitative multidetector computed tomography (MDCT as a potential biomarker is increasingly used for severity assessment of emphysema in chronic obstructive pulmonary disease (COPD. Aim of this study was to evaluate the user-independent measurement variability between five different fully-automatic densitometry software tools.MDCT and full-body plethysmography incl. forced expiratory volume in 1s and total lung capacity were available for 49 patients with advanced COPD (age = 64±9 years, forced expiratory volume in 1 s = 31±6% predicted. Measurement variation regarding lung volume, emphysema volume, emphysema index, and mean lung density was evaluated for two scientific and three commercially available lung densitometry software tools designed to analyze MDCT from different scanner types.One scientific tool and one commercial tool failed to process most or all datasets, respectively, and were excluded. One scientific and another commercial tool analyzed 49, the remaining commercial tool 30 datasets. Lung volume, emphysema volume, emphysema index and mean lung density were significantly different amongst these three tools (p<0.001. Limits of agreement for lung volume were [-0.195, -0.052 l], [-0.305, -0.131 l], and [-0.123, -0.052 l] with correlation coefficients of r = 1.00 each. Limits of agreement for emphysema index were [-6.2, 2.9%], [-27.0, 16.9%], and [-25.5, 18.8%], with r = 0.79 to 0.98. Correlation of lung volume with total lung capacity was good to excellent (r = 0.77 to 0.91, p<0.001, but segmented lung volume (6.7±1.3-6.8±1.3 l were significantly lower than total lung capacity (7.7±1.7 l, p<0.001.Technical incompatibilities hindered evaluation of two of five tools. The remaining three showed significant measurement variation for emphysema, hampering quantitative MDCT as a biomarker in COPD. Follow-up studies should currently use identical software, and standardization efforts should encompass software as

Retro-Nasal Aroma Release Is Correlated with Variations in the In-Mouth Air Cavity Volume after Empty Deglutition

Science.gov (United States)

Mishellany-Dutour, Anne; Woda, Alain; Labouré, Hélène; Bourdiol, Pierre; Lachaze, Pauline; Guichard, Elisabeth; Feron, Gilles

2012-01-01

We hypothesized that interindividual differences in motor activities during chewing and/or swallowing were determining factors for the transfer of volatile aroma from the in-mouth air cavity (IMAC) toward the olfactory mucosa. In our first experiment, we looked for changes in IMAC volume after saliva deglutition in 12 healthy subjects. The mean IMAC volume was measured after empty deglutition using an acoustic pharyngometer device. Based on the time course of the IMAC volume after swallowing, we discerned two groups of subjects. The first group displayed a small, constant IMAC volume (2.26 mL ±0.62) that corresponded to a high tongue position. The second group displayed a progressive increase in IMAC (from 6.82 mL ±2.37 to 22.82 mL ±3.04) that corresponded to a progressive lowering of the tongue to its resting position. In our second experiment, we investigated the relationship between IMAC volume changes after deglutition and the level of aroma release at the nostril. For this purpose, the release of menthone was measured at the nostril level in 25 subjects who consumed similar amounts of a mint tablet. The subjects were separated into two groups corresponding to two levels of menthone release: high (H) and low (L). The mean volume of IMAC was measured during and after empty deglutition. Group H displayed a small, constant amplitude of IMAC volume change after deglutition, while Group L displayed a progressive increase in IMAC. It is likely that Group H continuously released the aroma through the veloglossal isthmus as the mint was consumed, while Group L trapped the aroma in the oral cavity and then released it into the nasal cavity upon swallowing. These results show that the in vivo aroma release profile in humans depends closely on the different motor patterns at work during empty deglutition. PMID:22815986

Retro-nasal aroma release is correlated with variations in the in-mouth air cavity volume after empty deglutition.

Directory of Open Access Journals (Sweden)

Anne Mishellany-Dutour

Full Text Available We hypothesized that interindividual differences in motor activities during chewing and/or swallowing were determining factors for the transfer of volatile aroma from the in-mouth air cavity (IMAC toward the olfactory mucosa. In our first experiment, we looked for changes in IMAC volume after saliva deglutition in 12 healthy subjects. The mean IMAC volume was measured after empty deglutition using an acoustic pharyngometer device. Based on the time course of the IMAC volume after swallowing, we discerned two groups of subjects. The first group displayed a small, constant IMAC volume (2.26 mL ±0.62 that corresponded to a high tongue position. The second group displayed a progressive increase in IMAC (from 6.82 mL ±2.37 to 22.82 mL ±3.04 that corresponded to a progressive lowering of the tongue to its resting position. In our second experiment, we investigated the relationship between IMAC volume changes after deglutition and the level of aroma release at the nostril. For this purpose, the release of menthone was measured at the nostril level in 25 subjects who consumed similar amounts of a mint tablet. The subjects were separated into two groups corresponding to two levels of menthone release: high (H and low (L. The mean volume of IMAC was measured during and after empty deglutition. Group H displayed a small, constant amplitude of IMAC volume change after deglutition, while Group L displayed a progressive increase in IMAC. It is likely that Group H continuously released the aroma through the veloglossal isthmus as the mint was consumed, while Group L trapped the aroma in the oral cavity and then released it into the nasal cavity upon swallowing. These results show that the in vivo aroma release profile in humans depends closely on the different motor patterns at work during empty deglutition.

Solid hydrogen and deuterium. I. Ground-state energy calculated by a lowest order constrained-variation method

International Nuclear Information System (INIS)

Pettersen, G.; Oestgaard, E.

1988-01-01

The ground-state energy of solid hydrogen and deuterium is calculated by means of a modified variational lowest order constrained-variation (LOCV) method. Both fcc and hcp H 2 and D 2 are considered, and the calculations are done for five different two-body potentials. For solid H 2 we obtain theoretical results for the ground-state binding energy per particle from -74.9 K at an equilibrium particle density of 0.700 σ -3 or a molar volume of 22.3 cm 3 /mole to -91.3 K at a particle density of 0.725 σ -3 or a molar volume of 21.5 cm 3 /mole, where σ = 2.958 A. The corresponding experimental result is -92.3 K at a particle density of 0.688 σ -3 or a molar volume of 22.7 cm 3 /mole. For solid D 2 we obtain theoretical results for the ground-state binding energy per particle from -125.7 K at an equilibrium particle density of 0.830 σ -3 or a molar volume of 18.8 cm 3 /mole to -140.1 K at a particle density of 0.843 σ -3 or a molar volume of 18.5 cm 3 /mole. The corresponding experimental result is -137.9 K at a particle density of 0.797 σ -3 or a molar volume of 19.6 cm 3 /mole

Changes in circulating blood volume after infusion of hydroxyethyl starch 6% in critically ill patients

DEFF Research Database (Denmark)

Christensen, P; Andersson, J; Rasmussen, S E

2001-01-01

The cardiovascular response to a volume challenge with hydroxyethyl starch (HES) (200/0.5) 6% depends on the relation between the volume of HES 6% infused and the expansion of the blood volume in critically ill patients. However, only relatively limited data exist on the plasma expanding effect...... of infusion of HES 6% in critically ill patients. The purpose of the study was to evaluate the variation in the expansion of the circulating blood volume (CBV) in critically ill patients after infusion of 500 ml of colloid (HES (200/0.5) 6%) using the carbon monoxide method....

Variations of free gas content in water during pressure fluctuations

International Nuclear Information System (INIS)

Keller, A.; Zielke, W.

1977-01-01

In this paper an experimental programme is described in order to determine the influence of the cavitation nuclei distribution on cavitation inception. This programme has been used to measure air bubbles dimensions and number and particularly to determine the influence of quick pressure variations on the size on the number of bubbles in a pipe. An optical device counting scattered light is used as a measuring technique. Gas bubbles go through an optical control volume where they receive a high intensity light beam and scatter the light, then led to a photomultiplier; the signals are sorted and counted according to their size. If the number of nuclei, the dimensions of the control volume and the velocity of the water are known, it is possible to determine bubbles concentrations and the bulk modulus of the water. This measuring technique has been applied to a flow in a 140 mm diameter pipe with quick pressure variations from 2 bar to 0-10 bar. During the variations, the void fraction depends on the Reynolds number of the flow and on the gas content of the water. The bulk modulus has been computed with different conditions. Most results concern pressures slightly over the vapor pressure. Air content has a strong influence on cavitation and on water compressibility after a vapor cavity collapse

Volume ignition of laser driven fusion pellets and double layer effects

International Nuclear Information System (INIS)

Cicchitelli, L.; Eliezer, S.; Goldsworthy, M.P.; Green, F.; Hora, H.; Ray, P.S.; Stening, R.J.; Szichman, H.

1988-01-01

The realization of an ideal volume compression of laser-irradiated fusion pellets opens the possibility for an alternative to spark ignition proposed for many years for inertial confinement fusion. A re-evaluation of the difficulties of the central spark ignition of laser driven pellets is given. The alternative volume compression theory, together with volume burn and volume ignition, have received less attention and are re-evaluated in view of the experimental verification generalized fusion gain formulas, and the variation of optimum temperatures derived at self-ignition. Reactor-level DT fusion with MJ-laser pulses and volume compression to 50 times the solid-state density are estimated. Dynamic electric fields and double layers at the surface and in the interior of plasmas result in new phenomena for the acceleration of thermal electrons to suprathermal electrons. Double layers also cause a surface tension which stabilizes against surface wave effects and Rayleigh-Taylor instabilities. (author)

Do high-volume hospitals and surgeons provide better care in urologic oncology?

Science.gov (United States)

Eastham, James A

2009-01-01

Studies focusing primarily on hospital or surgical volume as a surrogate for surgical experience have found substantial variations in outcomes. Increasing surgical experience has been shown to improve outcomes after multiple procedures, including esophagectomy, pancreatectomy, and primary surgery for colon and breast cancer. More recently, evidence has been presented that surgical volume/experience affects quality of life and cancer control outcomes after urologic oncology procedures. Although most of these data pertain to radical prostatectomy, similar conclusions have been reached for radical cystectomy, retroperitoneal lymph node dissection, and management of renal cell carcinoma. This review highlights data indicating that high-volume surgeons and hospitals provide better care for radical prostatectomy.

Seasonal variations in the volume of the haemolymph and body weight of the horseshoe crab, Tachypleus gigas (Muller)

Digital Repository Service at National Institute of Oceanography (India)

Chatterji, A.; Rathod, V.; Parulekar, A.H.

in sizes between 121-140 mm. An inverse relationship was observed between the volume of haemolymph and salinity of the environment. Maximum volume of haemolymph (57.3 ml) in females was observed when the salinity of the environment was low in October...

Prediction of free-volume-type correlations in glassy chalcogenides from positron annihilation lifetime measurements

International Nuclear Information System (INIS)

Shpotyuk, O.; Ingram, A.; Shpotyuk, M.; Filipecki, J.

2014-01-01

Highlights: • Decisive role of specific chemical environment in free-volume correlations in glass. • Realistic free volumes in As–S/Se glass are defined by newly modified τ 2 -R formula. • Overestimated void sizes in chalcogenide glass as compared with molecular polymers. - Abstract: A newly modified correlation equation between defect-related positron lifetime determined within two-state trapping model and radius of corresponding free-volume-type defects was proposed to describe compositional variations in atomic-deficient structure of covalent-bonded chalcogenides like binary As–S/Se glasses. Specific chemical environment of free-volume voids around neighboring network-forming polyhedrons was shown to play a decisive role in this correlation, leading to systematically enhanced volumes in comparison with typical molecular substrates, such as polymers

Prediction of free-volume-type correlations in glassy chalcogenides from positron annihilation lifetime measurements

Energy Technology Data Exchange (ETDEWEB)

Shpotyuk, O., E-mail: shpotyuk@novas.lviv.ua [Institute of Materials of SRC “Carat”, 212 Stryjska Str., Lviv 79031 (Ukraine); Institute of Physics of Jan Dlugosz University, 13/15 al. Armii Krajowej, Czestcochowa 42200 (Poland); Ingram, A. [Opole University of Technology, 75 Ozimska Str., Opole 45370 (Poland); Shpotyuk, M. [Institute of Materials of SRC “Carat”, 212 Stryjska Str., Lviv 79031 (Ukraine); Lviv Polytechnic National University, 12 Bandery Str., Lviv 79013 (Ukraine); Filipecki, J. [Institute of Physics of Jan Dlugosz University, 13/15 al. Armii Krajowej, Czestcochowa 42200 (Poland)

2014-11-01

Highlights: • Decisive role of specific chemical environment in free-volume correlations in glass. • Realistic free volumes in As–S/Se glass are defined by newly modified τ{sub 2}-R formula. • Overestimated void sizes in chalcogenide glass as compared with molecular polymers. - Abstract: A newly modified correlation equation between defect-related positron lifetime determined within two-state trapping model and radius of corresponding free-volume-type defects was proposed to describe compositional variations in atomic-deficient structure of covalent-bonded chalcogenides like binary As–S/Se glasses. Specific chemical environment of free-volume voids around neighboring network-forming polyhedrons was shown to play a decisive role in this correlation, leading to systematically enhanced volumes in comparison with typical molecular substrates, such as polymers.

Flow measurement at the aortic root

DEFF Research Database (Denmark)

Bertelsen, Litten; Svendsen, Jesper Hastrup; Køber, Lars

2016-01-01

during CMR and aortic stenosis were excluded from the analyses. Stroke volumes were measured volumetrically (SVref) from steady-state free precision short axis images covering the entire left ventricle, excluding the papillary muscles and including the left ventricular outflow tract. Flow sequences......BACKGROUND: Cardiovascular magnetic resonance (CMR) is considered the gold standard of cardiac volumetric measurements. Flow in the aortic root is often measured at the sinotubular junction, even though placing the slice just above valve level may be more precise. It is unknown how much flow...... theoretically be equal to flow measurements, SVV and SVST were compared to SVref. RESULTS: Initially, 152 patients were included. 22 were excluded because of arrhythmias during scans and 9 were excluded for aortic stenosis. Accordingly, data from 121 patients were analysed and of these 63 had visually evident...

Fast in vivo volume dose reconstruction via reference dose perturbation

International Nuclear Information System (INIS)

Lu, Weiguo; Chen, Mingli; Mo, Xiaohu; Parnell, Donald; Olivera, Gustavo; Galmarini, Daniel

2014-01-01

Purpose: Accurate on-line reconstruction of in-vivo volume dose that accounts for both machine and patient discrepancy is not clinically available. We present a simple reference-dose-perturbation algorithm that reconstructs in-vivo volume dose fast and accurately. Methods: We modelled the volume dose as a function of the fluence map and density image. Machine (output variation, jaw/leaf position errors, etc.) and patient (setup error, weight loss, etc.) discrepancies between the plan and delivery were modelled as perturbation of the fluence map and density image, respectively. Delivered dose is modelled as perturbation of the reference dose due to change of the fluence map and density image. We used both simulated and clinical data to validate the algorithm. The planned dose was used as the reference. The reconstruction was perturbed from the reference and accounted for output-variations and the registered daily image. The reconstruction was compared with the ground truth via isodose lines and the Gamma Index. Results: For various plans and geometries, the volume doses were reconstructed in few seconds. The reconstruction generally matched well with the ground truth. For the 3%/3mm criteria, the Gamma pass rates were 98% for simulations and 95% for clinical data. The differences mainly appeared on the surface of the phantom/patient. Conclusions: A novel reference-dose-perturbation dose reconstruction model is presented. The model accounts for machine and patient discrepancy from planning. The algorithm is simple, fast, yet accurate, which makes online in-vivo 3D dose reconstruction clinically feasible.

An association between human hippocampal volume and topographical memory in healthy young adults.

Directory of Open Access Journals (Sweden)

Tom eHartley

2012-12-01

Full Text Available The association between human hippocampal structure and topographical memory was investigated in healthy adults (N=30. Structural MR images were acquired, and voxel-based morphometry (VBM was used to estimate local gray matter volume throughout the brain. A complementary automated mesh-based segmentation approach was used to independently isolate and measure specified structures including the hippocampus. Topographical memory was assessed using a version of the Four Mountains Task, a short test designed to target hippocampal spatial function. Each item requires subjects to briefly study a landscape scene before recognizing the depicted place from a novel viewpoint and under altered non-spatial conditions when presented amongst similar alternative scenes. Positive correlations between topographical memory performance and hippocampal volume were observed in both VBM and segmentation-based analyses. Score on the topographical memory task was also correlated with the volume of some subcortical structures, extra-hippocampal gray matter and total brain volume, with the most robust and extensive covariation seen in circumscribed neocortical regions in the insula and anterior temporal lobes. Taken together with earlier findings, the results suggest that global variations in brain morphology affect the volume of the hippocampus and its specific contribution to topographical memory. We speculate that behavioral variation might arise directly through the impact of resource constraints on spatial representations in the hippocampal formation and its inputs, and perhaps indirectly through an increased reliance on non-allocentric strategies.

Effect of hospital volume on processes of breast cancer care: A National Cancer Data Base study.

Science.gov (United States)

Yen, Tina W F; Pezzin, Liliana E; Li, Jianing; Sparapani, Rodney; Laud, Purushuttom W; Nattinger, Ann B

2017-05-15

The purpose of this study was to examine variations in delivery of several breast cancer processes of care that are correlated with lower mortality and disease recurrence, and to determine the extent to which hospital volume explains this variation. Women who were diagnosed with stage I-III unilateral breast cancer between 2007 and 2011 were identified within the National Cancer Data Base. Multiple logistic regression models were developed to determine whether hospital volume was independently associated with each of 10 individual process of care measures addressing diagnosis and treatment, and 2 composite measures assessing appropriateness of systemic treatment (chemotherapy and hormonal therapy) and locoregional treatment (margin status and radiation therapy). Among 573,571 women treated at 1755 different hospitals, 38%, 51%, and 10% were treated at high-, medium-, and low-volume hospitals, respectively. On multivariate analysis controlling for patient sociodemographic characteristics, treatment year and geographic location, hospital volume was a significant predictor for cancer diagnosis by initial biopsy (medium volume: odds ratio [OR] = 1.15, 95% confidence interval [CI] = 1.05-1.25; high volume: OR = 1.30, 95% CI = 1.14-1.49), negative surgical margins (medium volume: OR = 1.15, 95% CI = 1.06-1.24; high volume: OR = 1.28, 95% CI = 1.13-1.44), and appropriate locoregional treatment (medium volume: OR = 1.12, 95% CI = 1.07-1.17; high volume: OR = 1.16, 95% CI = 1.09-1.24). Diagnosis of breast cancer before initial surgery, negative surgical margins and appropriate use of radiation therapy may partially explain the volume-survival relationship. Dissemination of these processes of care to a broader group of hospitals could potentially improve the overall quality of care and outcomes of breast cancer survivors. Cancer 2017;123:957-66. © 2016 American Cancer Society. © 2016 American Cancer Society.

Variational principle for the Bloch unified reaction theory

International Nuclear Information System (INIS)

MacDonald, W.; Rapheal, R.

1975-01-01

The unified reaction theory formulated by Claude Bloch uses a boundary value operator to write the Schroedinger equation for a scattering state as an inhomogeneous equation over the interaction region. As suggested by Lane and Robson, this equation can be solved by using a matrix representation on any set which is complete over the interaction volume. Lane and Robson have proposed, however, that a variational form of the Bloch equation can be used to obtain a ''best'' value for the S-matrix when a finite subset of this basis is used. The variational principle suggested by Lane and Robson, which gives a many-channel S-matrix different from the matrix solution on a finite basis, is considered first, and it is shown that the difference results from the fact that their variational principle is not, in fact, equivalent to the Bloch equation. Then a variational principle is presented which is fully equivalent to the Bloch form of the Schroedinger equation, and it is shown that the resulting S-matrix is the same as that obtained from the matrix solution of this equation. (U.S.)

Reactive solid surface morphology variation via ionic diffusion.

Science.gov (United States)

Sun, Zhenchao; Zhou, Qiang; Fan, Liang-Shih

2012-08-14

In gas-solid reactions, one of the most important factors that determine the overall reaction rate is the solid morphology, which can be characterized by a combination of smooth, convex and concave structures. Generally, the solid surface structure varies in the course of reactions, which is classically noted as being attributed to one or more of the following three mechanisms: mechanical interaction, molar volume change, and sintering. Here we show that if a gas-solid reaction involves the outward ionic diffusion of a solid-phase reactant then this outward ionic diffusion could eventually smooth the surface with an initial concave and/or convex structure. Specifically, the concave surface is filled via a larger outward diffusing surface pointing to the concave valley, whereas the height of the convex surface decreases via a lower outward diffusion flux in the vertical direction. A quantitative 2-D continuum diffusion model is established to analyze these two morphological variation processes, which shows consistent results with the experiments. This surface morphology variation by solid-phase ionic diffusion serves to provide a fourth mechanism that supplements the traditionally acknowledged solid morphology variation or, in general, porosity variation mechanisms in gas-solid reactions.

Common genetic variation and novel loci associated with volumetric mammographic density.

Science.gov (United States)

Brand, Judith S; Humphreys, Keith; Li, Jingmei; Karlsson, Robert; Hall, Per; Czene, Kamila

2018-04-17

Mammographic density (MD) is a strong and heritable intermediate phenotype of breast cancer, but much of its genetic variation remains unexplained. We conducted a genetic association study of volumetric MD in a Swedish mammography screening cohort (n = 9498) to identify novel MD loci. Associations with volumetric MD phenotypes (percent dense volume, absolute dense volume, and absolute nondense volume) were estimated using linear regression adjusting for age, body mass index, menopausal status, and six principal components. We also estimated the proportion of MD variance explained by additive contributions from single-nucleotide polymorphisms (SNP-based heritability [h 2 SNP ]) in 4948 participants of the cohort. In total, three novel MD loci were identified (at P associated with breast cancer in available meta-analysis data including 122,977 breast cancer cases and 105,974 control subjects (P < 0.05). h 2 SNP (SE) estimates for percent dense, absolute dense, and nondense volume were 0.29 (0.07), 0.31 (0.07), and 0.25 (0.07), respectively. Corresponding ratios of h 2 SNP to previously observed narrow-sense h 2 estimates in the same cohort were 0.46, 0.72, and 0.41, respectively. These findings provide new insights into the genetic basis of MD and biological mechanisms linking MD to breast cancer risk. Apart from identifying three novel loci, we demonstrate that at least 25% of the MD variance is explained by common genetic variation with h 2 SNP /h 2 ratios varying between dense and nondense MD components.

Definition of gross tumor volume in lung cancer: inter-observer variability

NARCIS (Netherlands)

van de Steene, Jan; Linthout, Nadine; de Mey, Johan; Vinh-Hung, Vincent; Claassens, Cornelia; Noppen, Marc; Bel, Arjan; Storme, Guy

2002-01-01

BACKGROUND AND PURPOSE: To determine the inter-observer variation in gross tumor volume (GTV) definition in lung cancer, and its clinical relevance. MATERIALS AND METHODS: Five clinicians involved in lung cancer were asked to define GTV on the planning CT scan of eight patients. Resulting GTVs were

Atlas of total body radionuclide imaging. Volume I and II

International Nuclear Information System (INIS)

Fordham, E.W.; Ali, A.; Turner, D.A.; Charters, J.

1982-01-01

This two-volume work on total body imaging may well be regarded by future historians of nuclear medicine as representing the high points in the art of total body imaging in clinical nuclear medicine. With regard to information content and volume, it is the largest collection of well-interpreted, beautifully reproduced, total body images available to date. The primary goal of this atlas is to demonstrate patterns of abnormality in both typical and less typical variations. This goal is accomplished with many well-described examples of technical artifacts, of normal variants, of common and of rare diseases, and of pitfalls in interpretations. Volume I is entirely dedicated to skeletal imaging with Tc-99m labeled phosphates or phosphonates. The volume is divided into 22 chapters, which include chapters on methodology and instrumentation, chapters on the important bone diseases and other topics such as a treatise on false-negative and false-positive scans, and soft tissue and urinary tract abnormalities recognizable on bone scintigrams

The Effect of Fiber Strength Stochastics and Local Fiber Volume Fraction on Multiscale Progressive Failure of Composites

Science.gov (United States)

Ricks, Trenton M.; Lacy, Jr., Thomas E.; Bednarcyk, Brett A.; Arnold, Steven M.

2013-01-01

Continuous fiber unidirectional polymer matrix composites (PMCs) can exhibit significant local variations in fiber volume fraction as a result of processing conditions that can lead to further local differences in material properties and failure behavior. In this work, the coupled effects of both local variations in fiber volume fraction and the empirically-based statistical distribution of fiber strengths on the predicted longitudinal modulus and local tensile strength of a unidirectional AS4 carbon fiber/ Hercules 3502 epoxy composite were investigated using the special purpose NASA Micromechanics Analysis Code with Generalized Method of Cells (MAC/GMC); local effective composite properties were obtained by homogenizing the material behavior over repeating units cells (RUCs). The predicted effective longitudinal modulus was relatively insensitive to small (8%) variations in local fiber volume fraction. The composite tensile strength, however, was highly dependent on the local distribution in fiber strengths. The RUC-averaged constitutive response can be used to characterize lower length scale material behavior within a multiscale analysis framework that couples the NASA code FEAMAC and the ABAQUS finite element solver. Such an approach can be effectively used to analyze the progressive failure of PMC structures whose failure initiates at the RUC level. Consideration of the effect of local variations in constituent properties and morphologies on progressive failure of PMCs is a central aspect of the application of Integrated Computational Materials Engineering (ICME) principles for composite materials.

Hospital variability in postoperative mortality after rectal cancer surgery in the Spanish Association of Surgeons project: The impact of hospital volume.

Science.gov (United States)

Ortiz, Héctor; Biondo, Sebastiano; Codina, Antonio; Ciga, Miguel Á; Enríquez-Navascués, José M; Espín, Eloy; García-Granero, Eduardo; Roig, José Vicente

2016-01-01

This multicentre observational study examines variation between hospitals in postoperative mortality after elective surgery in the Rectal Cancer Project of the Spanish Society of Surgeons and explores whether hospital volume and patient characteristics contribute to any variation between hospitals. Hospital variation was quantified using a multilevel approach on prospective data derived from the multicentre database of all rectal adenocarcinomas operated by an anterior resection or an abdominoperineal excision at 84 surgical departments from 2006 to 2013. The following variables were included in the analysis; demographics, American Society of Anaesthesiologists classification, tumour location and stage, administration of neoadjuvant treatment, and annual volume of surgical procedures. A total of 9809 consecutive patients were included. The rate of 30-day postoperative mortality was 1.8% Stratified by annual surgical volume hospitals varied from 1.4 to 2.0 in 30-day mortality. In the multilevel regression analysis, male gender (OR 1.623 [1.143; 2.348]; P<.008), increased age (OR: 5.811 [3.479; 10.087]; P<.001), and ASA score (OR 10.046 [3.390; 43.185]; P<.001) were associated with 30-day mortality. However, annual surgical volume was not associated with mortality (OR 1.309 [0.483; 4.238]; P=.619). Besides, there was a statistically significant variation in mortality between all departments (MOR 1.588 [1.293; 2.015]; P<.001). Postoperative mortality varies significantly among hospitals included in the project and this difference cannot be attributed to the annual surgical volume. Copyright © 2015 AEC. Publicado por Elsevier España, S.L.U. All rights reserved.

MRI definition of target volumes using fuzzy logic method for three-dimensional conformal radiation therapy

International Nuclear Information System (INIS)

Caudrelier, Jean-Michel; Vial, Stephane; Gibon, David; Kulik, Carine; Fournier, Charles; Castelain, Bernard; Coche-Dequeant, Bernard; Rousseau, Jean

2003-01-01

Purpose: Three-dimensional (3D) volume determination is one of the most important problems in conformal radiation therapy. Techniques of volume determination from tomographic medical imaging are usually based on two-dimensional (2D) contour definition with the result dependent on the segmentation method used, as well as on the user's manual procedure. The goal of this work is to describe and evaluate a new method that reduces the inaccuracies generally observed in the 2D contour definition and 3D volume reconstruction process. Methods and Materials: This new method has been developed by integrating the fuzziness in the 3D volume definition. It first defines semiautomatically a minimal 2D contour on each slice that definitely contains the volume and a maximal 2D contour that definitely does not contain the volume. The fuzziness region in between is processed using possibility functions in possibility theory. A volume of voxels, including the membership degree to the target volume, is then created on each slice axis, taking into account the slice position and slice profile. A resulting fuzzy volume is obtained after data fusion between multiorientation slices. Different studies have been designed to evaluate and compare this new method of target volume reconstruction and a classical reconstruction method. First, target definition accuracy and robustness were studied on phantom targets. Second, intra- and interobserver variations were studied on radiosurgery clinical cases. Results: The absolute volume errors are less than or equal to 1.5% for phantom volumes calculated by the fuzzy logic method, whereas the values obtained with the classical method are much larger than the actual volumes (absolute volume errors up to 72%). With increasing MRI slice thickness (1 mm to 8 mm), the phantom volumes calculated by the classical method are increasing exponentially with a maximum absolute error up to 300%. In contrast, the absolute volume errors are less than 12% for phantom

A Variational Statistical-Field Theory for Polar Liquid Mixtures

Science.gov (United States)

Zhuang, Bilin; Wang, Zhen-Gang

Using a variational field-theoretic approach, we derive a molecularly-based theory for polar liquid mixtures. The resulting theory consists of simple algebraic expressions for the free energy of mixing and the dielectric constant as functions of mixture composition. Using only the dielectric constants and the molar volumes of the pure liquid constituents, the theory evaluates the mixture dielectric constants in good agreement with the experimental values for a wide range of liquid mixtures, without using adjustable parameters. In addition, the theory predicts that liquids with similar dielectric constants and molar volumes dissolve well in each other, while sufficient disparity in these parameters result in phase separation. The calculated miscibility map on the dielectric constant-molar volume axes agrees well with known experimental observations for a large number of liquid pairs. Thus the theory provides a quantification for the well-known empirical ``like-dissolves-like'' rule. Bz acknowledges the A-STAR fellowship for the financial support.

Scan-based volume animation driven by locally adaptive articulated registrations.

Science.gov (United States)

Rhee, Taehyun; Lewis, J P; Neumann, Ulrich; Nayak, Krishna S

2011-03-01

This paper describes a complete system to create anatomically accurate example-based volume deformation and animation of articulated body regions, starting from multiple in vivo volume scans of a specific individual. In order to solve the correspondence problem across volume scans, a template volume is registered to each sample. The wide range of pose variations is first approximated by volume blend deformation (VBD), providing proper initialization of the articulated subject in different poses. A novel registration method is presented to efficiently reduce the computation cost while avoiding strong local minima inherent in complex articulated body volume registration. The algorithm highly constrains the degrees of freedom and search space involved in the nonlinear optimization, using hierarchical volume structures and locally constrained deformation based on the biharmonic clamped spline. Our registration step establishes a correspondence across scans, allowing a data-driven deformation approach in the volume domain. The results provide an occlusion-free person-specific 3D human body model, asymptotically accurate inner tissue deformations, and realistic volume animation of articulated movements driven by standard joint control estimated from the actual skeleton. Our approach also addresses the practical issues arising in using scans from living subjects. The robustness of our algorithms is tested by their applications on the hand, probably the most complex articulated region in the body, and the knee, a frequent subject area for medical imaging due to injuries. © 2011 IEEE

Technical Note: Stored grain volume measurement using a low density point cloud

Science.gov (United States)

The mass of stored grain is often determined from volume measurements by crop insurers, government auditors, and stored grain managers conducting inventories. Recent increases in bin size have accentuated the difficulty of accounting for irregularities and variations in surface conditions in calcula...

Factors influencing the variations of ejection fraction during exercise in chronic aortic regurgitation

International Nuclear Information System (INIS)

Bassand, J.P.; Faivre, R.; Berthout, P.; Maurat, J.P.; Cardot, J.C.; Verdenet, J.; Bidet, R.

1987-01-01

The influence of left ventricular volume variations and regurgitant fraction variations upon left ventricular ejection fraction during exercise was examined using equilibrium radionuclide angiography in patients suffering from aortic regurgitation. Ejection fraction (EF), regurgitant fraction (RF), end diastolic volume (EDV) and end systolic volume (ESV) variations from rest to peak exercise were determined in 44 patients suffering from chronic aortic regurgitation (AR) and in 8 healthy volunteers (C). In C, EF increased (+0.10±0.03, P<0.01) and ESV decreased significantly (-23%±12%, P<0.01), RF and EDV did not vary significantly. In AR patients, EF, EDV and ESV did not vary significantly because of important scattering of individual values. Changes in EF and ESV were inversely correlated (r=-0.79, P<0.01) and RF decreased significantly (-0.12±0.10, P<0.01). Volumes and EF changes during exercise occurred in three different ways. In a 1st subgroup of 7 patients, EF increased (+0.09±0.03, P<0.05) in conjunction with a reduction of ESV (-24%±12%, P<0.05) without a significant change in EDV. In a 2nd group of 22 patients, EF decreased (-0.04±0.07, P<0.01) in association with an increase in ESV (+17%±16%, P<0.01) and no changes in EDV. In a 3rd subgroup of 15 patients, EF decreased (-0.02±0.06, P<0.01) despite a reduction in ESV (-7%±6%, P<0.01) because of a dramatic EDV decrease (-10%±6%, P<0.05). In this subgroup, changes in EF were inversely correlated with changes in ESV (r=-0.55, P<0.01) and positively related to EDV variations (r=0.42, P=0.02). EDV changes were weakly, but significantly, correlated to RF decrease (r=0.39, P<0.05). We conclude that changes in left ventricular ejection fraction during exercise in patients with chronic aortic regurgitation are significantly related in some patients to changes in ventricular loading conditions as well as contractile state. (orig./MG)

A model to incorporate organ deformation in the evaluation of dose/volume relationship

International Nuclear Information System (INIS)

Yan, D.; Jaffray, D.; Wong, J.; Brabbins, D.; Martinez, A. A.

1997-01-01

Purpose: Measurements of internal organ motion have demonstrated that daily organ deformation exists during the course of radiation treatment. However, a model to evaluate the resultant dose delivered to a daily deformed organ remains a difficult challenge. Current methods which model such organ deformation as rigid body motion in the dose calculation for treatment planning evaluation are incorrect and misleading. In this study, a new model for treatment planning evaluation is introduced which incorporates patient specific information of daily organ deformation and setup variation. The model was also used to retrospectively analyze the actual treatment data measured using daily CT scans for 5 patients with prostate treatment. Methods and Materials: The model assumes that for each patient, the organ of interest can be measured during the first few treatment days. First, the volume of each organ is delineated from each of the daily measurements and cumulated in a 3D bit-map. A tissue occupancy distribution is then constructed with the 50% isodensity representing the mean, or effective, organ volume. During the course of treatment, each voxel in the effective organ volume is assumed to move inside a local 3D neighborhood with a specific distribution function. The neighborhood and the distribution function are deduced from the positions and shapes of the organ in the first few measurements using the biomechanics model of viscoelastic body. For each voxel, the local distribution function is then convolved with the spatial dose distribution. The latter includes also the variation in dose due to daily setup error. As a result, the cumulative dose to the voxel incorporates the effects of daily setup variation and organ deformation. A ''variation adjusted'' dose volume histogram, aDVH, for the effective organ volume can then be constructed for the purpose of treatment evaluation and optimization. Up to 20 daily CT scans and daily portal images for 5 patients with prostate

Dicty_cDB: SFH653 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SIAKDVFGCKSVYLSAQFAIVFYLIGCLSKCYQILPSSTL VSSFPLLFQDSTLKRKKLLTNNSLKYVLLPKNQ Translated Amino Acid sequence (A...ll Frames) Frame A: ---xxxxxxxxxxxxxxxxxxxxxxxxxfxx*xx*fyxnmxkvyl*iinsxin*klsvsi fmmlslknklimlln*stlf*vlqrty...lvarvfisllnlpsffi*svv*anvikychpll wfprflccsktlr*kersy*ptil*smcscqrtn Frame B: ---xxxxxxxxxxxxxxxxxxxxxxx

The unfolding effects on the protein hydration shell and partial molar volume: a computational study.

Science.gov (United States)

Del Galdo, Sara; Amadei, Andrea

2016-10-12

In this paper we apply the computational analysis recently proposed by our group to characterize the solvation properties of a native protein in aqueous solution, and to four model aqueous solutions of globular proteins in their unfolded states thus characterizing the protein unfolded state hydration shell and quantitatively evaluating the protein unfolded state partial molar volumes. Moreover, by using both the native and unfolded protein partial molar volumes, we obtain the corresponding variations (unfolding partial molar volumes) to be compared with the available experimental estimates. We also reconstruct the temperature and pressure dependence of the unfolding partial molar volume of Myoglobin dissecting the structural and hydration effects involved in the process.

Multiple Brain Markers are Linked to Age-Related Variation in Cognition

Science.gov (United States)

Hedden, Trey; Schultz, Aaron P.; Rieckmann, Anna; Mormino, Elizabeth C.; Johnson, Keith A.; Sperling, Reisa A.; Buckner, Randy L.

2016-01-01

Age-related alterations in brain structure and function have been challenging to link to cognition due to potential overlapping influences of multiple neurobiological cascades. We examined multiple brain markers associated with age-related variation in cognition. Clinically normal older humans aged 65–90 from the Harvard Aging Brain Study (N = 186) were characterized on a priori magnetic resonance imaging markers of gray matter thickness and volume, white matter hyperintensities, fractional anisotropy (FA), resting-state functional connectivity, positron emission tomography markers of glucose metabolism and amyloid burden, and cognitive factors of processing speed, executive function, and episodic memory. Partial correlation and mediation analyses estimated age-related variance in cognition shared with individual brain markers and unique to each marker. The largest relationships linked FA and striatum volume to processing speed and executive function, and hippocampal volume to episodic memory. Of the age-related variance in cognition, 70–80% was accounted for by combining all brain markers (but only ∼20% of total variance). Age had significant indirect effects on cognition via brain markers, with significant markers varying across cognitive domains. These results suggest that most age-related variation in cognition is shared among multiple brain markers, but potential specificity between some brain markers and cognitive domains motivates additional study of age-related markers of neural health. PMID:25316342

Millimeter-wave Line Ratios and Sub-beam Volume Density Distributions

Energy Technology Data Exchange (ETDEWEB)

Leroy, Adam K.; Gallagher, Molly [Department of Astronomy, The Ohio State University, 140 West 18th Avenue, Columbus, OH 43210 (United States); Usero, Antonio [Observatorio Astronmico Nacional (IGN), C/Alfonso XII, 3, E-28014 Madrid (Spain); Schruba, Andreas [Max-Planck-Institut für extraterrestrische Physik, Giessenbachstraße 1, D-85748 Garching (Germany); Bigiel, Frank [Institute für theoretische Astrophysik, Zentrum für Astronomie der Universität Heidelberg, Albert-Ueberle Str. 2, D-69120 Heidelberg (Germany); Kruijssen, J. M. Diederik; Schinnerer, Eva [Astronomisches Rechen-Institut, Zentrum für Astronomie der Universität Heidelberg, Mönchhofstraße 12-14, D-69120 Heidelberg (Germany); Kepley, Amanda [National Radio Astronomy Observatory, 520 Edgemont Road, Charlottesville, VA 22903 (United States); Blanc, Guillermo A. [Departamento de Astronomía, Universidad de Chile, Casilla 36-D, Santiago (Chile); Bolatto, Alberto D. [Department of Astronomy, Laboratory for Millimeter-wave Astronomy, and Joint Space Institute, University of Maryland, College Park, MD 20742 (United States); Cormier, Diane; Jiménez-Donaire, Maria J. [Max Planck Institute für Astronomie, Königstuhl 17, D-69117, Heidelberg (Germany); Hughes, Annie [CNRS, IRAP, 9 av. du Colonel Roche, BP 44346, F-31028 Toulouse cedex 4 (France); Rosolowsky, Erik [Department of Physics, University of Alberta, Edmonton, AB (Canada)

2017-02-01

We explore the use of mm-wave emission line ratios to trace molecular gas density when observations integrate over a wide range of volume densities within a single telescope beam. For observations targeting external galaxies, this case is unavoidable. Using a framework similar to that of Krumholz and Thompson, we model emission for a set of common extragalactic lines from lognormal and power law density distributions. We consider the median density of gas that produces emission and the ability to predict density variations from observed line ratios. We emphasize line ratio variations because these do not require us to know the absolute abundance of our tracers. Patterns of line ratio variations have the potential to illuminate the high-end shape of the density distribution, and to capture changes in the dense gas fraction and median volume density. Our results with and without a high-density power law tail differ appreciably; we highlight better knowledge of the probability density function (PDF) shape as an important area. We also show the implications of sub-beam density distributions for isotopologue studies targeting dense gas tracers. Differential excitation often implies a significant correction to the naive case. We provide tabulated versions of many of our results, which can be used to interpret changes in mm-wave line ratios in terms of adjustments to the underlying density distributions.

Sensitivity and Specificity of Clinical and Laboratory Otolith Function Tests.

Science.gov (United States)

Kumar, Lokesh; Thakar, Alok; Thakur, Bhaskar; Sikka, Kapil

2017-10-01

To evaluate clinic based and laboratory tests of otolith function for their sensitivity and specificity in demarcating unilateral compensated complete vestibular deficit from normal. Prospective cross-sectional study. Tertiary care hospital vestibular physiology laboratory. Control group-30 healthy adults, 20-45 years age; Case group-15 subjects post vestibular shwannoma excision or post-labyrinthectomy with compensated unilateral complete audio-vestibular loss. Otolith function evaluation by precise clinical testing (head tilt test-HTT; subjective visual vertical-SVV) and laboratory testing (headroll-eye counterroll-HR-ECR; vesibular evoked myogenic potentials-cVEMP). Sensitivity and specificity of clinical and laboratory tests in differentiating case and control subjects. Measurable test results were universally obtained with clinical otolith tests (SVV; HTT) but not with laboratory tests. The HR-ECR test did not indicate any definitive wave forms in 10% controls and 26% cases. cVEMP responses were absent in 10% controls.HTT test with normative cutoff at 2 degrees deviations from vertical noted as 93.33% sensitive and 100% specific. SVV test with normative cutoff at 1.3 degrees noted as 100% sensitive and 100% specific. Laboratory tests demonstrated poorer specificities owing primarily to significant unresponsiveness in normal controls. Clinical otolith function tests, if conducted with precision, demonstrate greater ability than laboratory testing in discriminating normal controls from cases with unilateral complete compensated vestibular dysfunction.

Associations between volume changes and spatial dose metrics for the urinary bladder during local versus pelvic irradiation for prostate cancer.

Science.gov (United States)

Casares-Magaz, Oscar; Moiseenko, Vitali; Hopper, Austin; Pettersson, Niclas Johan; Thor, Maria; Knopp, Rick; Deasy, Joseph O; Muren, Ludvig Paul; Einck, John

2017-06-01

Inter-fractional variation in urinary bladder volumes during the course of radiotherapy (RT) for prostate cancer causes deviations between planned and delivered doses. This study compared planned versus daily cone-beam CT (CBCT)-based spatial bladder dose distributions, for prostate cancer patients receiving local prostate treatment (local treatment) versus prostate including pelvic lymph node irradiation (pelvic treatment). Twenty-seven patients (N = 15 local treatment; N = 12 pelvic treatment) were treated using daily image-guided RT (1.8 Gy@43-45 fx), adhering to a full bladder/empty rectum protocol. For each patient, 9-10 CBCTs were registered to the planning CT, using the clinically applied translations. The urinary bladder was manually segmented on each CBCT, 3 mm inner shells were generated, and semi and quadrant sectors were created using axial/coronal cuts. Planned and delivered DVH metrics were compared across patients and between the two groups of treatment (t-test, p bladder volume variations and the dose-volume histograms (DVH) of the bladder and its sectors were evaluated (Spearman's rank correlation coefficient, r s ). Bladder volumes varied considerably during RT (coefficient of variation: 16-58%). The population-averaged planned and delivered DVH metrics were not significantly different at any dose level. Larger treatment bladder volumes resulted in increased absolute volume of the posterior/inferior bladder sector receiving intermediate-high doses, in both groups. The superior bladder sector received less dose with larger bladder volumes for local treatments (r s  ± SD: -0.47 ± 0.32), but larger doses for pelvic treatments (r s  ± SD: 0.74 ± 0.24). Substantial bladder volume changes during the treatment course occurred even though patients were treated under a full bladder/daily image-guided protocol. Larger bladder volumes resulted in less bladder wall spared at the posterior-inferior sector, regardless the

Pengaruh besar arus pengelasan dan kecepatan volume alir gas pada proses las GMAW terhadap ketangguhan aluminium 5083

Directory of Open Access Journals (Sweden)

I N Budiarsa

2012-11-01

Full Text Available Level of welding current and flow rate of gas volume are welding parameters, which can influence result of welding process use of GMAW (Gas Metal Arc Welding at material of Aluminium 5083. Testing to be carried out is impact test with nocth type of standart test from A.S.T.M. standart pt.31 Designation E23-82. Specimens to be applied use of standard from DIN 50115 and standart ISO V nocth. Treatments to be given to specimen are variation flow rate of gas volume and level of welding current. By using of factorial experiment method can be showed that level of welding current and flow rate of gas volume and its interaction give a significance effect toward toughness properties of material. The result obtained with level of welding current 250 Ampere at variation of gas volume flow rate (17 l/minute, 18 l/minute, 19l/minute gives result low level toughness properties of material. The lowest level toughness (26,967 at (250 Ampere, 19l/minute

Modeling the imprint of Milankovitch cycles on early Pleistocene ice volume

Science.gov (United States)

Roychowdhury, R.; DeConto, R.; Pollard, D.

2017-12-01

Global climate during Quaternary and Late Pliocene (present-3.1 Ma) is characterized by alternating glacial and interglacial conditions. Several proposed theories associate these cycles with variations in the Earth's orbital configuration. In this study, we attempt to address the anomalously strong obliquity forcing in the Late Pliocene/Early Pleistocene ice volume records (41 kyr world), which stands in sharp contrast to the primary cyclicity of insolation, which is at precessional periods (23 kyr). Model results from GCM simulations show that at low eccentricities (e0.015), precessional response is important, and the insolation metrics vary out-of-phase between the two hemispheres. Using simulations from a GCM-driven ice sheet model, we simulate time continuous ice volume changes from Northern and Southern Hemispheres. Under eccentricities lower than 0.015, ice sheets in both hemispheres respond only to obliquity cycle, and grow and melt together (in-phase). If the ice sheet is simulated with eccentricity higher than 0.015, both hemispheres become more sensitive to precessional variation, and vary out-of-phase with each other, which is consistent with proxy observations from the late Pleistocene glaciations. We use the simulated ice volumes from 2.0 to 1.0 ma to empirically calculate global benthic δ18O variations based on the assumption that relationships between collapse and growth of ice-sheets and sea level is linear and symmetric and that the isotopic signature of the individual ice-sheets has not changed with time. Our modeled global benthic δ18O values are broadly consistent with the paleoclimate proxy records such as the LR04 stack.

Nutrient Deprivation Induces Property Variations in Spider Gluey Silk

Science.gov (United States)

Blamires, Sean J.; Sahni, Vasav; Dhinojwala, Ali; Blackledge, Todd A.; Tso, I-Min

2014-01-01

Understanding the mechanisms facilitating property variability in biological adhesives may promote biomimetic innovations. Spider gluey silks such as the spiral threads in orb webs and the gumfoot threads in cobwebs, both of which comprise of an axial thread coated by glue, are biological adhesives that have variable physical and chemical properties. Studies show that the physical and chemical properties of orb web gluey threads change when spiders are deprived of food. It is, however, unknown whether gumfoot threads undergo similar property variations when under nutritional stress. Here we tested whether protein deprivation induces similar variations in spiral and gumfoot thread morphology and stickiness. We manipulated protein intake for the orb web spider Nephila clavipes and the cobweb spider Latrodectus hesperus and measured the diameter, glue droplet volume, number of droplets per mm, axial thread width, thread stickiness and adhesive energy of their gluey silks. We found that the gluey silks of both species were stickier when the spiders were deprived of protein than when the spiders were fed protein. In N. clavipes a concomitant increase in glue droplet volume was found. Load-extension curves showed that protein deprivation induced glue property variations independent of the axial thread extensions in both species. We predicted that changes in salt composition of the glues were primarily responsible for the changes in stickiness of the silks, although changes in axial thread properties might also contribute. We, additionally, showed that N. clavipes' glue changes color under protein deprivation, probably as a consequence of changes to its biochemical composition. PMID:24523902

Variation in quantitative CT air trapping in heavy smokers on repeat CT examinations

Energy Technology Data Exchange (ETDEWEB)

Mets, Onno M.; Gietema, Hester A.; Jong, Pim A. de [University Medical Center Utrecht, Radiology, Heidelberglaan 100, Postbus 85500, Utrecht (Netherlands); Isgum, Ivana; Mol, Christian P. [University Medical Center Utrecht, Image Sciences Institute, Utrecht (Netherlands); Zanen, Pieter [University Medical Center Utrecht, Pulmonology, Utrecht (Netherlands); Prokop, Mathias [Radboud University Nijmegen Medical Centre, Radiology, Nijmegen (Netherlands); University Medical Center Utrecht, Radiology, Heidelberglaan 100, Postbus 85500, Utrecht (Netherlands)

2012-12-15

To determine the variation in quantitative computed tomography (CT) measures of air trapping in low-dose chest CTs of heavy smokers. We analysed 45 subjects from a lung cancer screening trial, examined by CT twice within 3 months. Inspiratory and expiratory low-dose CT was obtained using breath hold instructions. CT air trapping was defined as the percentage of voxels in expiratory CT with an attenuation below -856 HU (EXP{sub -856}) and the expiratory to inspiratory ratio of mean lung density (E/I-ratio{sub MLD}). Variation was determined using limits of agreement, defined as 1.96 times the standard deviation of the mean difference. The effect of both lung volume correction and breath hold reproducibility was determined. The limits of agreement for uncorrected CT air trapping measurements were -15.0 to 11.7 % (EXP{sub -856}) and -9.8 to 8.0 % (E/I-ratio{sub MLD}). Good breath hold reproducibility significantly narrowed the limits for EXP{sub -856} (-10.7 to 7.5 %, P = 0.002), but not for E/I-ratio{sub MLD} (-9.2 to 7.9 %, P = 0.75). Statistical lung volume correction did not improve the limits for EXP{sub -856} (-12.5 to 8.8 %, P = 0.12) and E/I-ratio{sub MLD} (-7.5 to 5.8 %, P = 0.17). Quantitative air trapping measures on low-dose CT of heavy smokers show considerable variation on repeat CT examinations, regardless of lung volume correction or reproducible breath holds. (orig.)

Dissecting variation in biomass conversion factors across China's forests: implications for biomass and carbon accounting.

Science.gov (United States)

Luo, Yunjian; Zhang, Xiaoquan; Wang, Xiaoke; Ren, Yin

2014-01-01

Biomass conversion factors (BCFs, defined as the ratios of tree components (i.e. stem, branch, foliage and root), as well as aboveground and whole biomass of trees to growing stock volume, Mg m-3) are considered as important parameters in large-scale forest biomass carbon estimation. To date, knowledge of possible sources of the variation in BCFs is still limited at large scales. Using our compiled forest biomass dataset of China, we presented forest type-specific values of BCFs, and examined the variation in BCFs in relation to forest type, stand development and environmental factors (climate and soil fertility). BCFs exhibited remarkable variation across forest types, and also were significantly related to stand development (especially growing stock volume). BCFs (except Stem BCF) had significant relationships with mean annual temperature (MAT) and mean annual precipitation (MAP) (Pforest carbon estimates, we should apply values of BCFs for a specified forest type, and also consider climatic and edaphic effects, especially climatic effect, in developing predictive models of BCFs (except Stem BCF).

Improving volume loss estimates of the northwestern Greenland Ice Sheet 2002-2010

DEFF Research Database (Denmark)

Korsgaard, Niels Jákup; Khan, Shfaqat Abbas; Kjeldsen, Kristian Kjellerup

Studies have been carried out using various methods to estimate the Greenland ice sheet mass balance. Remote sensing techniques used to determine the ice sheet volume includes airborne and satellite radar and laser methods and measurements of ice flow of outlet glaciers use InSAR satellite radar......) does not work on sloping surfaces and is affected by radar penetration into the snow. InSAR estimates require knowledge of outlet glacier thickness. GRACE has limited spatial resolution and is affected by mass variations not just from ice changes, but also from hydrologic and ocean mass variability...... and mass redistribution within the solid Earth. The accuracy of ice mass and ice volume estimates can be assessed by comparing results from different techniques. Here, we focus on volume loss estimates from ICESat, ATM and LVIS data. We estimate catchment-wide ice volume change in northwest Greenland...

Functional changes in CSF volume estimated using measurement of water T2 relaxation

NARCIS (Netherlands)

Piechnik, S.K.; Evans, J.; Bary, L.H.; Wise, R.G.; Jezzard, P.

2009-01-01

Cerebrospinal fluid (CSF) provides hydraulic suspension for the brain. The general concept of bulk CSF production, circulation, and reabsorption is well established, but the mechanisms of momentary CSF volume variation corresponding to vasoreactive changes are far less understood. Nine individuals

[Target volume margins for lung cancer: internal target volume/clinical target volume].

Science.gov (United States)

Jouin, A; Pourel, N

2013-10-01

The aim of this study was to carry out a review of margins that should be used for the delineation of target volumes in lung cancer, with a focus on margins from gross tumour volume (GTV) to clinical target volume (CTV) and internal target volume (ITV) delineation. Our review was based on a PubMed literature search with, as a cornerstone, the 2010 European Organisation for Research and Treatment of Cancer (EORTC) recommandations by De Ruysscher et al. The keywords used for the search were: radiotherapy, lung cancer, clinical target volume, internal target volume. The relevant information was categorized under the following headings: gross tumour volume definition (GTV), CTV-GTV margin (first tumoural CTV then nodal CTV definition), in field versus elective nodal irradiation, metabolic imaging role through the input of the PET scanner for tumour target volume and limitations of PET-CT imaging for nodal target volume definition, postoperative radiotherapy target volume definition, delineation of target volumes after induction chemotherapy; then the internal target volume is specified as well as tumoural mobility for lung cancer and respiratory gating techniques. Finally, a chapter is dedicated to planning target volume definition and another to small cell lung cancer. For each heading, the most relevant and recent clinical trials and publications are mentioned. Copyright © 2013. Published by Elsevier SAS.

Center Variation and the Effect of Center and Provider Characteristics on Clinical Outcomes in Kidney Transplantation: A Systematic Review of the Evidence

Directory of Open Access Journals (Sweden)

Anne Tsampalieros

2017-10-01

Full Text Available Background: Kidney transplantation is the best treatment option for patients with end-stage renal disease. While patient-level factors affecting survival are established, the presence of variation in the management of transplant recipients remains unknown. Objective: The objective of this study was to examine center variation in kidney transplantation and identify center and provider characteristics that may be associated with clinical outcomes. Design: This is a systematic review. Data sources: Ovid Medline, Embase, and Cochrane library from inception to June 2016 were used. Study eligibility: Any study examining the association between center or provider characteristics and graft or patient survival, quality of life, or functional status were included. Results: We identified 6327 records and 24 studies met eligibility. Most studies used data registries. Characteristics evaluated include center volume (n = 17, provider volume (n = 2, provider experience (n = 1, center type (n = 2, and location of follow-up (n = 1. Outcomes assessed included graft survival (n = 24 and patient survival (n = 9. Significant center variation was described in 12 of 15 and 5 of 7 studies for graft and patient survival. There was a significant and positive association between center volume and graft and patient survival in 8 and 2 studies, respectively. Provider experience and volume were significantly associated with less allograft loss and provider volume with lower risk of death. There was no association between graft survival and location of follow-up or center type. Limitations: There was substantial heterogeneity in the variables assessed and methodology used to analyze associations. Conclusion: This systematic review found center variation in kidney transplantation. Future studies in the current era are necessary to better evaluate this important topic.

A new electric method for non-invasive continuous monitoring of stroke volume and ventricular volume-time curves

Directory of Open Access Journals (Sweden)

Konings Maurits K

2012-08-01

Full Text Available Abstract Background In this paper a new non-invasive, operator-free, continuous ventricular stroke volume monitoring device (Hemodynamic Cardiac Profiler, HCP is presented, that measures the average stroke volume (SV for each period of 20 seconds, as well as ventricular volume-time curves for each cardiac cycle, using a new electric method (Ventricular Field Recognition with six independent electrode pairs distributed over the frontal thoracic skin. In contrast to existing non-invasive electric methods, our method does not use the algorithms of impedance or bioreactance cardiography. Instead, our method is based on specific 2D spatial patterns on the thoracic skin, representing the distribution, over the thorax, of changes in the applied current field caused by cardiac volume changes during the cardiac cycle. Since total heart volume variation during the cardiac cycle is a poor indicator for ventricular stroke volume, our HCP separates atrial filling effects from ventricular filling effects, and retrieves the volume changes of only the ventricles. Methods ex-vivo experiments on a post-mortem human heart have been performed to measure the effects of increasing the blood volume inside the ventricles in isolation, leaving the atrial volume invariant (which can not be done in-vivo. These effects have been measured as a specific 2D pattern of voltage changes on the thoracic skin. Furthermore, a working prototype of the HCP has been developed that uses these ex-vivo results in an algorithm to decompose voltage changes, that were measured in-vivo by the HCP on the thoracic skin of a human volunteer, into an atrial component and a ventricular component, in almost real-time (with a delay of maximally 39 seconds. The HCP prototype has been tested in-vivo on 7 human volunteers, using G-suit inflation and deflation to provoke stroke volume changes, and LVot Doppler as a reference technique. Results The ex-vivo measurements showed that ventricular filling

Substantial interobserver variation of thyroid volume and function by visual evaluation of thyroid (99m)Tc scintigraphy

DEFF Research Database (Denmark)

Soelberg, Kerstin; Grupe, Peter; Boel-Jørgensen, Henrik

2014-01-01

(99m)Tc-pertechnetate scintigraphy is much used in the evaluation of patients with nodular goitre. We investigated the ability of experienced observers to estimate the thyroid 24-h (131)I uptake (RAIU) and the thyroid volume by visual evaluation of the scintigram.......(99m)Tc-pertechnetate scintigraphy is much used in the evaluation of patients with nodular goitre. We investigated the ability of experienced observers to estimate the thyroid 24-h (131)I uptake (RAIU) and the thyroid volume by visual evaluation of the scintigram....

Experimental Pressure-Volume diagrams of scroll compressors

OpenAIRE

Picavet, Alain; Ginies, Pierre

2014-01-01

This paper presents the results of tests led with scroll compressors to establish pressure-volume diagrams. Two compressors were thinly instrumented with pressure and displacement sensors so as to follow the whole compression process, from suction to exhaust. A gear coder was set to mark off the closing and opening of gas pockets, and to study the speed variations occurring during a single rotation. These tests help to understand the various phenomena met in a compressor, such as back-flow, o...

Dose, time and volume effects in interstitial radiation therapy

International Nuclear Information System (INIS)

Burgers, J.M.V.

1982-01-01

This study presents the main features and uncertainties of interstitial therapy and was undertaken to examine whether differences could be found in different clinical situations treated by interstitial implants with removable sources, that were not simply related to dose. In chapter 2, dating from 1978, continuous low dose rate irradiation is discussed from the radiobiological point of view together with some points related to variation in dose rate. A benefit of continuous low dose rate irradiation could be surmised in a few situations with special cell-kinetic properties. The problem of dose specification, the sharp dose gradient and other volume characteristics are discussed in chapter 3. Possible adjustments to variations in dose rate are discussed in chapter 4. The clinical material is reviewed in chapter 5, including aspects of dose specification, dose fall-off and variation in dose rate. The general discussion and conclusions are given in chapter 6. (Auth.)

Effects of Artificial Gravity and Bed Rest on Spatial Orientation and Balance Control

Science.gov (United States)

Paloski, William H.; Moore, S. T.; Feiveson, A. H.; Taylor, L. C.

2007-01-01

While the vestibular system should be well-adapted to bed rest (a condition it experiences approximately 8/24 hrs each day), questions remain regarding the degree to which repeated exposures to the unusual gravito-inertial force environment of a short-radius centrifuge might affect central processing of vestibular information used in spatial orientation and balance control. Should these functions be impaired by intermittent AG, its feasibility as a counter-measure would be diminished. We, therefore, examined the effects of AG on spatial orientation and balance control in 15 male volunteers before and after 21 days of 6 HDT bed rest (BR). Eight of the subjects were treated with daily 1hr AG exposures (2.5g at the feet; 1.0g at the heart) aboard a short radius (3m) centrifuge, while the other seven served as controls (C). Spatial orientation was assessed by measures of ocular counter-rolling (OCR; rotation of the eye about the line of sight, an otolith-mediated reflex) and subjective visual vertical (SVV; perception of the spatial upright). Both OCR and SVV measurements were made with the subject upright, lying on their left sides, and lying on their right sides. OCR was measured from binocular eye orientation recordings made while the subjects fixated for 10s on a point target directly in front of the face at a distance of 1 m. SVV was assessed by asking subjects (in the dark) to adjust to upright (using a handheld controller) the orientation of a luminous bar randomly perturbed (15) to either side of the vertical meridian. Balance control performance was assessed using a computerized dynamic posturography (CDP) protocol similar to that currently required for all returning crew members. During each session, the subjects completed a combination of trials of sensory organization test (SOT) 2 (eyes closed, fixed platform) and SOT 5 (eyes closed, sway-referenced platform) with and without static and dynamic pitch plane head movements (plus or minus 20 deg., dynamic

Scintigraphic method for evaluating reductions in local blood volumes in human extremities

DEFF Research Database (Denmark)

Blønd, L; Madsen, Jan Lysgård

2000-01-01

were carried out. No significant differences between results obtained by the use of one or two scintigraphic projections were found. The between-subject coefficient of variation was 14% in the lower limb experiment and 11% in the upper limb experiment. The within-subject coefficient of variation was 6......% in the lower limb experiment and 6% in the upper limb experiment. We found a significant relation (r = 0.42, p = 0.018) between the results obtained by the scintigraphic method and the plethysmographic method. In fractions, a mean reduction in blood volume of 0.49+0.14 (2 SD) was found after 1 min of elevation...... of the lower limb and a mean reduction of 0.45+/-0.10 (2 SD) after half a minute of elevation of the upper limb. We conclude that the method is precise and can be used in investigating physiologic and pathophysiologic mechanisms in relation to blood volumes of limbs not subject to research previously....

Toward Increasing Micropore Volume between Hybrid Layered Perovskites with Silsesquioxane Interlayers.

Science.gov (United States)

Kataoka, Sho; Kamimura, Yoshihiro; Endo, Akira

2018-04-10

Hybrid organic-inorganic layered perovskites are typically nonporous solids. However, the incorporation of silsesquioxanes with a cubic cage structure as interlayer materials creates micropores between the perovskite layers. In this study, we increase in the micropore volume in layered perovskites by replacing a portion of the silsesquioxane interlayers with organic amines. In the proposed method, approximately 20% of the silsesquioxane interlayers can be replaced without changing the layer distance owing to the size of the silsesquioxane. When small amines (e.g., ethylamine) are used in this manner, the micropore volume of the obtained hybrid layered perovskites increases by as much as 44%; when large amines (e.g., phenethylamine) are used, their micropore volume decreases by as much as 43%. Through the variation of amine fraction, the micropore volume can be adjusted in the range. Finally, the magnetic moment measurements reveal that the layered perovskites with mixed interlayers exhibit ferromagnetic ordering at temperature below 20 K, thus indicating that the obtained perovskites maintain their functions as layered perovskites.

A Simple Mercury-Free Laboratory Apparatus to Study the Relationship between Pressure, Volume, and Temperature in a Gas

Science.gov (United States)

McGregor, Donna; Sweeney, William V.; Mills, Pamela

2012-01-01

A simple and inexpensive mercury-free apparatus to measure the change in volume of a gas as a function of pressure at different temperatures is described. The apparatus is simpler than many found in the literature and can be used to study variations in pressure, volume, and temperature. (Contains 1 table and 7 figures.)

[Fluctuations in biophysical measurements as a result of variations in solar activity].

Science.gov (United States)

Peterson, T F

1995-01-01

A theory is proposed to explain variations in the net electrical charge of biological substances at the Earth's surface. These are shown to occur in association with changes in the solar wind and geomagnetic field. It is suggested that a liquid dielectric's net volume charge will imitate pH effects, influence chemical reaction rates, and alter ion transfer mechanisms in biophysical systems. An experiment is described which measures dielectric volume charge, or non-neutrality, to allow correlation of this property with daily, 28-day, and 11-year fluctuation patterns in geophysical and satellite data associated with solar activity and the interplanetary magnetic field.

Volume cross section of auroral radar backscatter and RMS plasma fluctuations inferred from coherent and incoherent scatter data: a response on backscatter volume parameters

Directory of Open Access Journals (Sweden)

M. V. Uspensky

2011-06-01

Full Text Available Norway and Finland STARE radar measurements in the eastward auroral electrojet are combined with EISCAT CP-1 measurements of the electron density and electric field vector in the common scattering volume to investigate the variation of the auroral radar volume cross section (VCS with the flow angle of observations (radar look direction with respect to the E×B electron drift. The data set available consists of ~6000 points for flow angles of 40–85° and electron drifts between 500 and 2000 m s−1. The EISCAT electron density N(h-profile data are used to estimate the effective electron density, aspect angle and thickness of the backscattering layer. It is shown that the flow angle variation of the VCS is rather weak, only ~5 dB within the range of the considered flow angles. The VCS values themselves respond almost linearly to the square of both the electron drift velocity magnitude and the effective electron density. By adopting the inferred shape of the VCS variation with the flow angle and the VCS dependence upon wavelength, the relative amplitude of electrostatic electron density fluctuations over all scales is estimated. Inferred values of 2–4 percent react nearly linearly to the electron drift velocity in the range of 500–1000 m s−1 but the rate of increase slows down at electron drifts >1000 m s−1 and density fluctuations of ~5.5 percent due to, perhaps, progressively growing nonlinear wave losses.

Comparison of polyp size and volume at CT colonography: implications for follow-up CT colonography.

Science.gov (United States)

Bethea, Emily; Nwawka, Ogonna K; Dachman, Abraham H

2009-12-01

The purpose of this study was to evaluate the reliability of polyp measurements at CT colonography and the factors that affect the measurements. Fifty colonoscopically proven cases of polyps 6 mm in diameter or larger were analyzed by two observers who measured each polyp in supine and prone views. Manual measurements of 2D volume by summation of areas, 2D maximum diameter, and 3D maximum diameter and automated measurements of 3D maximum diameter and volume were recorded for each observer and were repeated for one of the observers. Intraobserver and interobserver agreement was calculated. Analysis was performed to determine the measurement parameter that correlated most with summation-of-areas volume. Supine and prone measurements as a surrogate for tracking change in polyp size over time were analyzed to determine the measurement parameter with the least variation. Maximum diameter measured manually on 3D images had the highest correlation with summation-of-areas volume. Manual summation-of-areas volume was found to have the least variation between supine and prone measurements. Linear polyp measurement in the 3D endoluminal view appears to be the most reliable parameter for use in the decision to excise a polyp according to current guidelines. In our study, manual calculation of volume with summation of areas was found to be the most reliable measurement parameter for observing polyp growth over serial examinations. High reliability of polyp measurements is essential for adequate assessment of change in polyp size over serial examinations because many patients with intermediate-size polyps are expected to choose surveillance.

Emergent Chemical Behavior in Variable-Volume Protocells

Directory of Open Access Journals (Sweden)

Ben Shirt-Ediss

2015-01-01

Full Text Available Artificial protocellular compartments and lipid vesicles have been used as model systems to understand the origins and requirements for early cells, as well as to design encapsulated reactors for biotechnology. One prominent feature of vesicles is the semi-permeable nature of their membranes, able to support passive diffusion of individual solute species into/out of the compartment, in addition to an osmotic water flow in the opposite direction to the net solute concentration gradient. Crucially, this water flow affects the internal aqueous volume of the vesicle in response to osmotic imbalances, in particular those created by ongoing reactions within the system. In this theoretical study, we pay attention to this often overlooked aspect and show, via the use of a simple semi-spatial vesicle reactor model, that a changing solvent volume introduces interesting non-linearities into an encapsulated chemistry. Focusing on bistability, we demonstrate how a changing volume compartment can degenerate existing bistable reactions, but also promote emergent bistability from very simple reactions, which are not bistable in bulk conditions. One particularly remarkable effect is that two or more chemically-independent reactions, with mutually exclusive reaction kinetics, are able to couple their dynamics through the variation of solvent volume inside the vesicle. Our results suggest that other chemical innovations should be expected when more realistic and active properties of protocellular compartments are taken into account.

PENGARUH FRAKSI VOLUME PENGUAT TERHADAP KEKUATAN LENTUR GREEN COMPOSITE UNTUK APLIKASI PADA BODI KENDARAAN

OpenAIRE

Perdana, Mastariyanto

2016-01-01

Composites are one of material be used in engineering field. This is due the composites has light weight and relatively strong properties. The synthesis fiber-based composites reduces to obtain environmental friendly properties. This research use hybrid fiber which consist of calcium carbonate (CaCO3) powder and bagasse fiber. Matrix used is resin polyester. Variation of volume fraction between bagasse and calcium carbonate powder are 10:20, 15:15 and 20:10 respectively. Volume fraction of hy...

Longitudinal in vivo reproducibility of cartilage volume and surface in osteoarthritis of the knee

Energy Technology Data Exchange (ETDEWEB)

Brem, M.H. [Harvard Medical School, Brigham and Women' s Hospital, Musculoskeletal Division, Department of Radiology, ASB-1, L-1, Room 003E, Boston, MA (United States); University of Erlangen-Nuremberg, Division of Trauma Surgery and Orthopaedic Surgery, Department of Surgery, Erlangen (Germany); Pauser, J.; Yoshioka, H.; Stratmann, J.; Kikinis, R.; Duryea, J.; Lang, P. [Harvard Medical School, Brigham and Women' s Hospital, Musculoskeletal Division, Department of Radiology, ASB-1, L-1, Room 003E, Boston, MA (United States); Brenning, A. [University of Erlangen-Nuremberg, Department of Medical Informatics, Biometry and Epidemiology, Erlangen (Germany); Hennig, F.F. [University of Erlangen-Nuremberg, Division of Trauma Surgery and Orthopaedic Surgery, Department of Surgery, Erlangen (Germany); Winalski, C.S. [Harvard Medical School, Brigham and Women' s Hospital, Musculoskeletal Division, Department of Radiology, ASB-1, L-1, Room 003E, Boston, MA (United States); Cleveland Clinic Foundation, Division of Radiology, Cleveland, OH (United States)

2007-04-15

The aim of this study was to evaluate the longitudinal reproducibility of cartilage volume and surface area measurements in moderate osteoarthritis (OA) of the knee. We analysed 5 MRI (GE 1.5T, sagittal 3D SPGR) data sets of patients with osteoarthritis (OA) of the knee (Kellgren Lawrence grade I-II). Two scans were performed: one baseline scan and one follow-up scan 3 months later (96 {+-} 10 days). For segmentation, 3D Slicer 2.5 software was used. Two segmentations were performed by two readers independently who were blinded to the scan dates. Tibial and femoral cartilage volume and surface were determined. Longitudinal and cross-sectional precision errors were calculated using the standard deviation (SD) and coefficient of variation (CV%=100 x [SD/mean]) from the repeated measurements in each patient. The in vivo reproducibility was then calculated as the root mean square of these individual reproducibility errors. The cross-sectional root mean squared coefficient of variation (RMSE-CV) was 1.2, 2.2 and 2.4% for surface area measurements (femur, medial and lateral tibia respectively) and 1.4, 1.8 and 1.3% for the corresponding cartilage volumes. Longitudinal RMSE-CV was 3.3, 3.1 and 3.7% for the surface area measurements (femur, medial and lateral tibia respectively) and 2.3, 3.3 and 2.4% for femur, medial and lateral tibia cartilage volumes. The longitudinal in vivo reproducibility of cartilage surface and volume measurements in the knee using this segmentation method is excellent. To the best of our knowledge we measured, for the first time, the longitudinal reproducibility of cartilage volume and surface area in participants with mild to moderate OA. (orig.)

Experimental studies for the development of a new method for stroke volume measuring using X-ray videodensitometry

International Nuclear Information System (INIS)

Odenthal, H.J.

1982-01-01

Quantitative videodensitometry was studied with a view to its possible application as a new, non-invasive method of measuring cardiac stroke volume. To begin with, the accuracy of roentgen volumetric measurements was determined. After this, blood volume variations were measured by densitometry in five animal experiments. The findings were compared with the volumes measured by a flowmeter in the pulmonary artery. The total stroke volume was found to be proportional to the difference between the maximum and mean densitometric volume. A comparison between videodensitometry and other non-invasive methods showed that, in a stable circulatory system, the results of videodensitometry are equally reliable as, or even more reliable than, those of the conventional methods. (orig./MG) [de

Salinity independent volume fraction prediction in water-gas-oil multiphase flows using artificial neural networks

Energy Technology Data Exchange (ETDEWEB)

Salgado, C.M.; Pereira, Claudio M.N.A.; Brandao, Luis E.B., E-mail: otero@ien.gov.b, E-mail: cmnap@ien.gov.b, E-mail: brandao@ien.gov.b [Instituto de Engenharia Nuclear (DIRA/IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Div. de Radiofarmacos

2011-07-01

This work investigates the response of a volume fraction prediction system for water-gas-oil multiphase flows considering variations on water salinity. The approach is based on gamma-ray pulse height distributions pattern recognition by means the artificial neural networks (ANNs). The detection system uses appropriate fan beam geometry, comprised of a dual-energy gamma-ray source and two NaI(Tl) detectors adequately positioned outside the pipe in order measure transmitted and scattered beams. An ideal and static theoretical model for annular flow regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the ANN. More than 500 simulations have been done, in which water salinity have been ranged from 0 to 16% in order to cover a most practical situations. Validation tests have included values of volume fractions and water salinity different from those used in ANN training phase. The results presented here show that the proposed approach may be successfully applied to material volume fraction prediction on watergas- oil multiphase flows considering practical (real) levels of variations in water salinity. (author)

Salinity independent volume fraction prediction in water-gas-oil multiphase flows using artificial neural networks

International Nuclear Information System (INIS)

Salgado, C.M.; Pereira, Claudio M.N.A.; Brandao, Luis E.B.

2011-01-01

This work investigates the response of a volume fraction prediction system for water-gas-oil multiphase flows considering variations on water salinity. The approach is based on gamma-ray pulse height distributions pattern recognition by means the artificial neural networks (ANNs). The detection system uses appropriate fan beam geometry, comprised of a dual-energy gamma-ray source and two NaI(Tl) detectors adequately positioned outside the pipe in order measure transmitted and scattered beams. An ideal and static theoretical model for annular flow regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the ANN. More than 500 simulations have been done, in which water salinity have been ranged from 0 to 16% in order to cover a most practical situations. Validation tests have included values of volume fractions and water salinity different from those used in ANN training phase. The results presented here show that the proposed approach may be successfully applied to material volume fraction prediction on watergas- oil multiphase flows considering practical (real) levels of variations in water salinity. (author)

Actual Dose Variation of Parotid Glands and Spinal Cord for Nasopharyngeal Cancer Patients During Radiotherapy

International Nuclear Information System (INIS)

Han Chunhui; Chen Yijen; Liu An; Schultheiss, Timothy E.; Wong, Jeffrey Y.C.

2008-01-01

Purpose: For intensity-modulated radiotherapy of nasopharyngeal cancer, accurate dose delivery is crucial to the success of treatment. This study aimed to evaluate the significance of daily image-guided patient setup corrections and to quantify the parotid gland volume and dose variations for nasopharyngeal cancer patients using helical tomotherapy megavoltage computed tomography (CT). Methods and Materials: Five nasopharyngeal cancer patients who underwent helical tomotherapy were selected retrospectively. Each patient had received 70 Gy in 35 fractions. Daily megavoltage CT scans were registered with the planning CT images to correct the patient setup errors. Contours of the spinal cord and parotid glands were drawn on the megavoltage CT images at fixed treatment intervals. The actual doses delivered to the critical structures were calculated using the helical tomotherapy Planned Adaptive application. Results: The maximal dose to the spinal cord showed a significant increase and greater variation without daily setup corrections. The significant decrease in the parotid gland volume led to a greater median dose in the later phase of treatment. The average parotid gland volume had decreased from 20.5 to 13.2 cm 3 by the end of treatment. On average, the median dose to the parotid glands was 83 cGy and 145 cGy for the first and the last treatment fractions, respectively. Conclusions: Daily image-guided setup corrections can eliminate significant dose variations to critical structures. Constant monitoring of patient anatomic changes and selective replanning should be used during radiotherapy to avoid critical structure complications

Comparison of Magnetic Resonance Imaging and Computed Tomography for Breast Target Volume Delineation in Prone and Supine Positions

Energy Technology Data Exchange (ETDEWEB)

Pogson, Elise M. [Centre for Medical Radiation Physics, Faculty of Engineering and Information Sciences, University of Wollongong, Wollongong (Australia); Liverpool and Macarthur Cancer Therapy Centres, Liverpool (Australia); Ingham Institute for Applied Medical Research, Liverpool (Australia); Delaney, Geoff P. [Liverpool and Macarthur Cancer Therapy Centres, Liverpool (Australia); Ingham Institute for Applied Medical Research, Liverpool (Australia); South Western Sydney Clinical School, University of New South Wales, Sydney (Australia); School of Medicine, University of Western Sydney, Sydney (Australia); Ahern, Verity [Crown Princess Mary Cancer Care Centre, Westmead Hospital, Westmead (Australia); Boxer, Miriam M. [Liverpool and Macarthur Cancer Therapy Centres, Liverpool (Australia); South Western Sydney Clinical School, University of New South Wales, Sydney (Australia); Chan, Christine [Department of Radiology, Liverpool Hospital, Liverpool (Australia); David, Steven [Peter MacCallum Cancer Centre, Melbourne (Australia); Dimigen, Marion [Department of Radiology, Liverpool Hospital, Liverpool (Australia); Harvey, Jennifer A. [School of Medicine, University of Queensland, Herston (Australia); Princess Alexandra Hospital, Woolloongabba (Australia); Koh, Eng-Siew [Liverpool and Macarthur Cancer Therapy Centres, Liverpool (Australia); Ingham Institute for Applied Medical Research, Liverpool (Australia); South Western Sydney Clinical School, University of New South Wales, Sydney (Australia); Lim, Karen [Liverpool and Macarthur Cancer Therapy Centres, Liverpool (Australia); South Western Sydney Clinical School, University of New South Wales, Sydney (Australia); Papadatos, George [Liverpool and Macarthur Cancer Therapy Centres, Liverpool (Australia); and others

2016-11-15

Purpose: To determine whether T2-weighted MRI improves seroma cavity (SC) and whole breast (WB) interobserver conformity for radiation therapy purposes, compared with the gold standard of CT, both in the prone and supine positions. Methods and Materials: Eleven observers (2 radiologists and 9 radiation oncologists) delineated SC and WB clinical target volumes (CTVs) on T2-weighted MRI and CT supine and prone scans (4 scans per patient) for 33 patient datasets. Individual observer's volumes were compared using the Dice similarity coefficient, volume overlap index, center of mass shift, and Hausdorff distances. An average cavity visualization score was also determined. Results: Imaging modality did not affect interobserver variation for WB CTVs. Prone WB CTVs were larger in volume and more conformal than supine CTVs (on both MRI and CT). Seroma cavity volumes were larger on CT than on MRI. Seroma cavity volumes proved to be comparable in interobserver conformity in both modalities (volume overlap index of 0.57 (95% Confidence Interval (CI) 0.54-0.60) for CT supine and 0.52 (95% CI 0.48-0.56) for MRI supine, 0.56 (95% CI 0.53-0.59) for CT prone and 0.55 (95% CI 0.51-0.59) for MRI prone); however, after registering modalities together the intermodality variation (Dice similarity coefficient of 0.41 (95% CI 0.36-0.46) for supine and 0.38 (0.34-0.42) for prone) was larger than the interobserver variability for SC, despite the location typically remaining constant. Conclusions: Magnetic resonance imaging interobserver variation was comparable to CT for the WB CTV and SC delineation, in both prone and supine positions. Although the cavity visualization score and interobserver concordance was not significantly higher for MRI than for CT, the SCs were smaller on MRI, potentially owing to clearer SC definition, especially on T2-weighted MR images.

Background levels of methane in Mars’ atmosphere show strong seasonal variations

Science.gov (United States)

Webster, Christopher R.; Mahaffy, Paul R.; Atreya, Sushil K.; Moores, John E.; Flesch, Gregory J.; Malespin, Charles; McKay, Christopher P.; Martinez, German; Smith, Christina L.; Martin-Torres, Javier; Gomez-Elvira, Javier; Zorzano, Maria-Paz; Wong, Michael H.; Trainer, Melissa G.; Steele, Andrew; Archer, Doug; Sutter, Brad; Coll, Patrice J.; Freissinet, Caroline; Meslin, Pierre-Yves; Gough, Raina V.; House, Christopher H.; Pavlov, Alexander; Eigenbrode, Jennifer L.; Glavin, Daniel P.; Pearson, John C.; Keymeulen, Didier; Christensen, Lance E.; Schwenzer, Susanne P.; Navarro-Gonzalez, Rafael; Pla-García, Jorge; Rafkin, Scot C. R.; Vicente-Retortillo, Álvaro; Kahanpää, Henrik; Viudez-Moreiras, Daniel; Smith, Michael D.; Harri, Ari-Matti; Genzer, Maria; Hassler, Donald M.; Lemmon, Mark; Crisp, Joy; Sander, Stanley P.; Zurek, Richard W.; Vasavada, Ashwin R.

2018-06-01

Variable levels of methane in the martian atmosphere have eluded explanation partly because the measurements are not repeatable in time or location. We report in situ measurements at Gale crater made over a 5-year period by the Tunable Laser Spectrometer on the Curiosity rover. The background levels of methane have a mean value 0.41 ± 0.16 parts per billion by volume (ppbv) (95% confidence interval) and exhibit a strong, repeatable seasonal variation (0.24 to 0.65 ppbv). This variation is greater than that predicted from either ultraviolet degradation of impact-delivered organics on the surface or from the annual surface pressure cycle. The large seasonal variation in the background and occurrences of higher temporary spikes (~7 ppbv) are consistent with small localized sources of methane released from martian surface or subsurface reservoirs.

Efficacy of lung volume optimization maneuver monitored by optoelectronic pletismography in the management of congenital diaphragmatic hernia

Directory of Open Access Journals (Sweden)

G. Lista

2017-01-01

We report a case of left CDH with severe lung hypoplasia, managed applying open lung strategy in HFOV (pre-surgery period and in Assist-Control with Volume Guarantee (post-surgery period, guided by SpO2 changes, TcPO2 and TcPCO2 monitoring. Opto-electronic plethysmography was used to measure end-expiratory chest wall volume changes (ΔEEcw related to lung volume variations occurring during pressure changes. OEP confirmed the efficacy of using SpO2 and transcutaneous gas monitoring during this recruitment maneuver.

Effect of Glu-B3 Allelic Variation on Sodium Dodecyl Sulfate Sedimentation Volume in Common Wheat (Triticum aestivum L.

Directory of Open Access Journals (Sweden)

Hongqi Si

2013-01-01

Full Text Available Sodium dodecyl sulfate (SDS sedimentation volume has long been used to characterize wheat flours and meals with the aim of predicting processing and end-product qualities. In order to survey the influence of low-molecular-weight glutenin subunits (LMW-GSs at Glu-B3 locus on wheat SDS sedimentation volume, a total of 283 wheat (Triticum aestivum L. varieties including landraces and improved and introduced cultivars were analyzed using 10 allele-specific PCR markers at the Glu-B3 locus. The highest allele frequency observed in the tested varieties was Glu-B3i with 21.9% in all varieties, 21.1% in landraces, 25.5% in improved cultivars, and 12% in introduced cultivars. Glu-B3 locus represented 8.6% of the variance in wheat SDS sedimentation volume, and Glu-B3b, Glu-B3g, and Glu-B3h significantly heightened the SDS sedimentation volume, but Glu-B3a, Glu-B3c, and Glu-B3j significantly lowered the SDS sedimentation volume. For the bread-making quality, the most desirable alleles Glu-B3b and Glu-B3g become more and more popular and the least desirable alleles Glu-B3a and Glu-B3c got less and less in modern improved cultivars, suggesting that wheat grain quality in China has been significantly improved through breeding effort.

Validation of multi-detector computed tomography as a non-invasive method for measuring ovarian volume in macaques (Macaca fascicularis).

Science.gov (United States)

Jones, Jeryl C; Appt, Susan E; Werre, Stephen R; Tan, Joshua C; Kaplan, Jay R

2010-06-01

The purpose of this study was to validate low radiation dose, contrast-enhanced, multi-detector computed tomography (MDCT) as a non-invasive method for measuring ovarian volume in macaques. Computed tomography scans of four known-volume phantoms and nine mature female cynomolgus macaques were acquired using a previously described, low radiation dose scanning protocol, intravenous contrast enhancement, and a 32-slice MDCT scanner. Immediately following MDCT, ovaries were surgically removed and the ovarian weights were measured. The ovarian volumes were determined using water displacement. A veterinary radiologist who was unaware of actual volumes measured ovarian CT volumes three times, using a laptop computer, pen display tablet, hand-traced regions of interest, and free image analysis software. A statistician selected and performed all tests comparing the actual and CT data. Ovaries were successfully located in all MDCT scans. The iliac arteries and veins, uterus, fallopian tubes, cervix, ureters, urinary bladder, rectum, and colon were also consistently visualized. Large antral follicles were detected in six ovaries. Phantom mean CT volume was 0.702+/-SD 0.504 cc and the mean actual volume was 0.743+/-SD 0.526 cc. Ovary mean CT volume was 0.258+/-SD 0.159 cc and mean water displacement volume was 0.257+/-SD 0.145 cc. For phantoms, the mean coefficient of variation for CT volumes was 2.5%. For ovaries, the least squares mean coefficient of variation for CT volumes was 5.4%. The ovarian CT volume was significantly associated with actual ovarian volume (ICC coefficient 0.79, regression coefficient 0.5, P=0.0006) and the actual ovarian weight (ICC coefficient 0.62, regression coefficient 0.6, P=0.015). There was no association between the CT volume accuracy and mean ovarian CT density (degree of intravenous contrast enhancement), and there was no proportional or fixed bias in the CT volume measurements. Findings from this study indicate that MDCT is a valid non

Socialization of prosocial behavior: Gender differences in the mediating role of child brain volume

NARCIS (Netherlands)

R. Kok (Renske); P.J. Prinzie (Peter); M.J. Bakermans-Kranenburg (Marian); F.C. Verhulst (Frank); T.J.H. White (Tonya); H.W. Tiemeier (Henning); M.H. van IJzendoorn (Rien)

2017-01-01

textabstractEvidence has been accumulating for the impact of normal variation in caregiving quality on brain morphology in children, but the question remains whether differences in brain volume related to early caregiving translate to behavioral implications. In this longitudinal population-based

Persistently better treatment planning results of intensity-modulated (IMRT) over conformal radiotherapy (3D-CRT) in prostate cancer patients with significant variation of clinical target volume and/or organs-at-risk

International Nuclear Information System (INIS)

Fenoglietto, Pascal; Laliberte, Benoit; Allaw, Ali; Ailleres, Norbert; Idri, Katia; Hay, Meng Huor; Moscardo, Carmen Llacer; Gourgou, Sophie; Dubois, Jean-Bernard; Azria, David

2008-01-01

Purpose: To compare the dose coverage of planning and clinical target volume (PTV, CTV), and organs-at-risk (OAR) between intensity-modulated (3D-IMRT) and conventional conformal radiotherapy (3D-CRT) before and after internal organ variation in prostate cancer. Methods and materials: We selected 10 patients with clinically significant interfraction volume changes. Patients were treated with 3D-IMRT to 80 Gy (minimum PTV dose of 76 Gy, excluding rectum). Fictitious, equivalent 3D-CRT plans (80 Gy at isocenter, with 95% isodose (76 Gy) coverage of PTV, with rectal blocking above 76 Gy) were generated using the same planning CT data set ('CT planning'). The plans were then also applied to a verification CT scan ('CT verify') obtained at a different moment. PTV, CTV, and OAR dose coverage were compared using non-parametric tests statistics for V95, V90 (% of the volume receiving ≥95 or 90% of the dose) and D50 (dose to 50% of the volume). Results: Mean V95 of the PTV for 'CT planning' was 94.3% (range, 88-99) vs 89.1% (range, 84-94.5) for 3D-IMRT and 3D-CRT (p = 0.005), respectively. Mean V95 of the CTV for 'CT verify' was 97% for both 3D-IMRT and 3D-CRT. Mean D50 of the rectum for 'CT planning' was 26.8 Gy (range, 22-35) vs 43.5 Gy (range, 33.5-50.5) for 3D-IMRT and 3D-CRT (p = 0.0002), respectively. For 'CT verify', this D50 was 31.1 Gy (range, 16.5-44) vs 44.2 Gy (range, 34-55) for 3D-IMRT and 3D-CRT (p = 0.006), respectively. V95 of the rectum was 0% for both plans for 'CT planning', and 2.3% (3D-IMRT) vs 2.1% (3D-CRT) for 'CT verify' (p = non-sig.). Conclusion: Dose coverage of the PTV and OAR was better with 3D-IMRT for each patient and remained so after internal volume changes

Rapid estimate of solid volume in large tuff cores using a gas pycnometer

International Nuclear Information System (INIS)

Thies, C.; Geddis, A.M.; Guzman, A.G.

1996-09-01

A thermally insulated, rigid-volume gas pycnometer system has been developed. The pycnometer chambers have been machined from solid PVC cylinders. Two chambers confine dry high-purity helium at different pressures. A thick-walled design ensures minimal heat exchange with the surrounding environment and a constant volume system, while expansion takes place between the chambers. The internal energy of the gas is assumed constant over the expansion. The ideal gas law is used to estimate the volume of solid material sealed in one of the chambers. Temperature is monitored continuously and incorporated into the calculation of solid volume. Temperature variation between measurements is less than 0.1 degrees C. The data are used to compute grain density for oven-dried Apache Leap tuff core samples. The measured volume of solid and the sample bulk volume are used to estimate porosity and bulk density. Intrinsic permeability was estimated from the porosity and measured pore surface area and is compared to in-situ measurements by the air permeability method. The gas pycnometer accommodates large core samples (0.25 m length x 0.11 m diameter) and can measure solid volume greater than 2.20 cm 3 with less than 1% error

Solid hydrogen and deuterium. II. Pressure and compressibility calculated by a lowest-order constrained-variation method

International Nuclear Information System (INIS)

Pettersen, G.; Ostgaard, E.

1988-01-01

The pressure and the compressibility of solid H 2 and D 2 are obtained from ground-state energies calculated by means of a modified variational lowest order constrained-variation (LOCV) method. Both fcc and hcp structures are considered, but results are given for the fcc structure only. The pressure and the compressibility are calculated or estimated from the dependence of the ground-state energy on density or molar volume, generally in a density region of 0.65σ -3 to 1.3σ -3 , corresponding to a molar volume of 0.65σ -3 to 1.3σ -3 , corresponding to a molar volume of 12-24 cm 3 mole, where σ = 2.958 angstrom, and the calculations are done for five different two-body potentials. Theoretical results for the pressure are 340-460 atm for solid H 2 at a particle density of 0.82σ -3 or a molar volume of 19 cm 3 /mole, and 370-490 atm for solid 4 He at a particle density of 0.92σ -3 or a molar volume of 17 cm 3 /mole. The corresponding experimental results are 650 and 700 atm, respectively. Theoretical results for the compressibility are 210 times 10 -6 to 260 times 10 -6 atm -1 for solid H 2 at a particle density of 0.82σ -3 or a molar volume of 19 cm 3 /mole, and 150 times 10 -6 to 180 times 10 -6 atm -1 for solid D 2 at a particle density of 0.92σ -3 or a molar volume of 17 cm 3 mole. The corresponding experimental results are 180 times 10 -6 and 140 times 10 -6 atm -1 , respectively. The agreement with experimental results is better for higher densities

Developing a stochastic traffic volume prediction model for public-private partnership projects

Science.gov (United States)

Phong, Nguyen Thanh; Likhitruangsilp, Veerasak; Onishi, Masamitsu

2017-11-01

Transportation projects require an enormous amount of capital investment resulting from their tremendous size, complexity, and risk. Due to the limitation of public finances, the private sector is invited to participate in transportation project development. The private sector can entirely or partially invest in transportation projects in the form of Public-Private Partnership (PPP) scheme, which has been an attractive option for several developing countries, including Vietnam. There are many factors affecting the success of PPP projects. The accurate prediction of traffic volume is considered one of the key success factors of PPP transportation projects. However, only few research works investigated how to predict traffic volume over a long period of time. Moreover, conventional traffic volume forecasting methods are usually based on deterministic models which predict a single value of traffic volume but do not consider risk and uncertainty. This knowledge gap makes it difficult for concessionaires to estimate PPP transportation project revenues accurately. The objective of this paper is to develop a probabilistic traffic volume prediction model. First, traffic volumes were estimated following the Geometric Brownian Motion (GBM) process. Monte Carlo technique is then applied to simulate different scenarios. The results show that this stochastic approach can systematically analyze variations in the traffic volume and yield more reliable estimates for PPP projects.

Tracer responses and control of vessels with variable flow and volume

International Nuclear Information System (INIS)

Niemi, A.J.

1990-01-01

Continuous flow vessels which are subject to variation of flow and volume are characterized by time-variable parameters. It is shown that their residence time distributions and weighting functions obtained by tracer testing are made invariant with regard to the integrated flow variables which are introduced. Under variable flow but constant volume, one such integrated variable is sufficient. Under variable volume, two different variables are suggested for the residence time distribution and weighting function, while the appropriate variable of the perfect mixer differs distinctly from that of vessels with a distinct velocity profile. It is shown through a number of example cases, that an agreement with their mathematical models is reached. The approach is extended to include also arbitrary, non-analytic response functions obtained by tracer measurements. Applications of the derived models and their incorporation in automatic control algorithms is discussed. (orig.) [de

Treatment plan evaluation using dose-volume histogram (DVH) and spatial dose-volume histogram (zDVH)

International Nuclear Information System (INIS)

Cheng, C.-W.; Das, Indra J.

1999-01-01

Objective: The dose-volume histogram (DVH) has been accepted as a tool for treatment-plan evaluation. However, DVH lacks spatial information. A new concept, the z-dependent dose-volume histogram (zDVH), is presented as a supplement to the DVH in three-dimensional (3D) treatment planning to provide the spatial variation, as well as the size and magnitude of the different dose regions within a region of interest. Materials and Methods: Three-dimensional dose calculations were carried out with various plans for three disease sites: lung, breast, and prostate. DVHs were calculated for the entire volume. A zDVH is defined as a differential dose-volume histogram with respect to a computed tomographic (CT) slice position. In this study, zDVHs were calculated for each CT slice in the treatment field. DVHs and zDVHs were compared. Results: In the irradiation of lung, DVH calculation indicated that the treatment plan satisfied the dose-volume constraint placed on the lung and zDVH of the lung revealed that a sizable fraction of the lung centered about the central axis (CAX) received a significant dose, a situation that warranted a modification of the treatment plan due to the removal of one lung. In the irradiation of breast with tangential fields, the DVH showed that about 7% of the breast volume received at least 110% of the prescribed dose (PD) and about 11% of the breast received less than 98% PD. However, the zDVHs of the breast volume in each of seven planes showed the existence of high-dose regions of 34% and 15%, respectively, of the volume in the two caudal-most planes and cold spots of about 40% in the two cephalic planes. In the treatment planning of prostate, DVHs showed that about 15% of the bladder and 40% of the rectum received 102% PD, whereas about 30% of the bladder and 50% of the rectum received the full dose. Taking into account the hollow structure of both the bladder and the rectum, the dose-surface histograms (DSH) showed larger hot-spot volume, about

Variation of Quench Propagation Velocities in YBCO Cables

CERN Document Server

Härö, E.; Stenvall, A.; 10.1007/s10948-015-2976-y

2015-01-01

changes during the quench. Due to the large temperature margin between the operation and the current sharing temperatures, the normal zone does not propagate with the temperature front. This means that the temperature will rise in a considerably larger volume when compared to the quenched volume. Thus, the evolution of the temperature distribution below current sharing temperature Tcs after the quench onset affects the normal zone propagation velocity in HTS more than in LTS coils. This can be seen as an acceleration of the quench propagation velocities while the quench evolves when margin to Tcs is high. In this paper we scrutinize quench propagation in a stack of YBCO cables with an in-house finite element method software which solves the heat diffusion equation. We compute the longitudinal and transverse normal zone propagation velocities at various distances from the hot spot to demonstrate the distance-variation...

Impact of irradiation and immunosuppressive agents on immune system homeostasis in rhesus macaques.

Science.gov (United States)

Meyer, C; Walker, J; Dewane, J; Engelmann, F; Laub, W; Pillai, S; Thomas, Charles R; Messaoudi, I

2015-09-01

In this study we examined the effects of non-myeloablative total body irradiation (TBI) in combination with immunosuppressive chemotherapy on immune homeostasis in rhesus macaques. Our results show that the administration of cyclosporin A or tacrolimus without radiotherapy did not result in lymphopenia. The addition of TBI to the regimen resulted in lymphopenia as well as alterations in the memory/naive ratio following reconstitution of lymphocyte populations. Dendritic cell (DC) numbers in whole blood were largely unaffected, while the monocyte population was altered by immunosuppressive treatment. Irradiation also resulted in increased levels of circulating cytokines and chemokines that correlated with T cell proliferative bursts and with the shift towards memory T cells. We also report that anti-thymocyte globulin (ATG) treatment and CD3 immunotoxin administration resulted in a selective and rapid depletion of naive CD4 and CD8 T cells and increased frequency of memory T cells. We also examined the impact of these treatments on reactivation of latent simian varicella virus (SVV) infection as a model of varicella zoster virus (VZV) infection of humans. None of the treatments resulted in overt SVV reactivation; however, select animals had transient increases in SVV-specific T cell responses following immunosuppression, suggestive of subclinical reactivation. Overall, we provide detailed observations into immune modulation by TBI and chemotherapeutic agents in rhesus macaques, an important research model of human disease. © 2015 British Society for Immunology.

Monetary transmission and the financial sector in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Havránek, T.; Horváth, R.; Matějů, Jakub

2012-01-01

Roč. 45, č. 3 (2012), s. 135-155 ISSN 1573-9414 R&D Projects: GA MŠk(CZ) SVV 265801/2012 Institutional support: PRVOUK-P23 Keywords : transmission mechanism * monetary policy * Czech Republic Subject RIV: AH - Economics

Longitudinal in vivo reproducibility of cartilage volume and surface in osteoarthritis of the knee

International Nuclear Information System (INIS)

Brem, M.H.; Pauser, J.; Yoshioka, H.; Stratmann, J.; Kikinis, R.; Duryea, J.; Lang, P.; Brenning, A.; Hennig, F.F.; Winalski, C.S.

2007-01-01

The aim of this study was to evaluate the longitudinal reproducibility of cartilage volume and surface area measurements in moderate osteoarthritis (OA) of the knee. We analysed 5 MRI (GE 1.5T, sagittal 3D SPGR) data sets of patients with osteoarthritis (OA) of the knee (Kellgren Lawrence grade I-II). Two scans were performed: one baseline scan and one follow-up scan 3 months later (96 ± 10 days). For segmentation, 3D Slicer 2.5 software was used. Two segmentations were performed by two readers independently who were blinded to the scan dates. Tibial and femoral cartilage volume and surface were determined. Longitudinal and cross-sectional precision errors were calculated using the standard deviation (SD) and coefficient of variation (CV%=100 x [SD/mean]) from the repeated measurements in each patient. The in vivo reproducibility was then calculated as the root mean square of these individual reproducibility errors. The cross-sectional root mean squared coefficient of variation (RMSE-CV) was 1.2, 2.2 and 2.4% for surface area measurements (femur, medial and lateral tibia respectively) and 1.4, 1.8 and 1.3% for the corresponding cartilage volumes. Longitudinal RMSE-CV was 3.3, 3.1 and 3.7% for the surface area measurements (femur, medial and lateral tibia respectively) and 2.3, 3.3 and 2.4% for femur, medial and lateral tibia cartilage volumes. The longitudinal in vivo reproducibility of cartilage surface and volume measurements in the knee using this segmentation method is excellent. To the best of our knowledge we measured, for the first time, the longitudinal reproducibility of cartilage volume and surface area in participants with mild to moderate OA. (orig.)

The process γγ → νν-bar in a strong magnetic field

International Nuclear Information System (INIS)

Kuznetsov, A.V.; Mikheev, N.V.; Rumyantsev, D.A.

2003-01-01

A general analysis of the three-vertex loop amplitude in a strong magnetic field, based on the asymptotic form of the electron propagator in the field, is performed. In order to investigate the photon-neutrino process γγ → νν-bar, the vertex combinations of the scalar-vector-vector (SVV), pseudoscalar- vector-vector (PVV), 3-vector (VVV), and axial-vector-vector (AVV) types are considered. It is shown that only the SVV amplitude grows linearly with the magnetic-field strength, while in the other amplitudes, PVV, VVV, and AVV, the linearly growing terms are cancelled. The process γγ → νν-bar is investigated in the left-right-symmetric extension of the standard model of electroweak interaction, where the effective scalar ννee coupling could exist. Possible astrophysical manifestations of the considered process are discussed [ru

Beam-induced pressure variations in a TFTR neutral-beam injector

International Nuclear Information System (INIS)

Willis, J.E.; Berkner, K.H.

1981-10-01

In neutral-beam injection systems either all or part of the gas flow into the neutralizer comes from the plasma source. When the beam is switched on, ions from the plasma source, which used to contribute to the gas flow, are converted to an energetic beam and are pumped away: hence reducing the gas input to the neutralizer. The large volume of the neutralizer and its high conductance damp out rapid changes; for example, when the gas to the source is first turned on, there is a 230 msec exponential rise time associated with pressure in the neutralizer. The neutralizer in turn acts as a source of gas to the first chamber and the first chamber to the second and so on. Beam dumps become additional sources of gas in the second chamber and target tank as gas molecules are collisionally desorbed from the surface of the dump. A simple analytical model (the equivalent of an electrical RC circuit) of the volumes and conductances of the system has been used to describe the pressure variations. The use of time dependent sources terms in the model gives an estimate of the desorption rate from the dumps and its time variation during a beam pulse

Investigation of Interfraction Variations of MammoSite Balloon Applicator in High-Dose-Rate Brachytherapy of Partial Breast Irradiation

International Nuclear Information System (INIS)

Kim, Yongbok; Johnson, Mark M.S.; Trombetta, Mark G.; Parda, David S.; Miften, Moyed

2008-01-01

Purpose: To measure the interfraction changes of the MammoSite applicator and evaluate their dosimetric effect on target coverage and sparing of organs at risk. Methods and Materials: A retrospective evaluation of the data from 19 patients who received 10 fractions (34 Gy) of high-dose-rate partial breast irradiation was performed. A computed tomography-based treatment plan was generated for Fraction 1, and a computed tomography scan was acquired just before the delivery of each fraction to ensure a consistent shape of the balloon. The eccentricity, asymmetry, and planning target volume (PTV) for plan evaluation purposes (PTV E VAL), as well as trapped air gaps, were measured for all patients. Furthermore, 169 computed tomography-based treatment plans were retrospectively generated for Fractions 2-10. Interfraction dosimetric variations were evaluated using the %PTV E VAL coverage, target dose homogeneity index, target dose conformal index, and maximum doses to the organs at risks. Results: The average variation of eccentricity and asymmetry from Fraction 1 values of 3.5% and 1.1 mm was -0.4% ± 1.6% and -0.1 ± 0.6 mm. The average trapped air gap volume was dramatically reduced from before treatment (3.7 cm 3 ) to Fraction 1 (0.8 cm 3 ). The PTV E VAL volume change was insignificant. The average variation for the %PTV E VAL, target dose homogeneity, and target dose conformal index from Fraction 1 values of 94.7%, 0.64, and 0.85 was 0.15% ± 2.4%, -0.35 ± 2.4%, and -0.34 ± 4.9%, respectively. The average Fraction 1 maximum skin and ipsilateral lung dose of 3.2 Gy and 2.0 Gy varied by 0.08 ± 0.47 and -0.16 ± 0.29 Gy, respectively. Conclusion: The interfraction variations were patient specific and fraction dependent. Although the average interfraction dose variations for the target and organs at risk were not clinically significant, the maximum variations could be clinically significant

Variational analysis of regular mappings theory and applications

CERN Document Server

Ioffe, Alexander D

2017-01-01

This monograph offers the first systematic account of (metric) regularity theory in variational analysis. It presents new developments alongside classical results and demonstrates the power of the theory through applications to various problems in analysis and optimization theory. The origins of metric regularity theory can be traced back to a series of fundamental ideas and results of nonlinear functional analysis and global analysis centered around problems of existence and stability of solutions of nonlinear equations. In variational analysis, regularity theory goes far beyond the classical setting and is also concerned with non-differentiable and multi-valued operators. The present volume explores all basic aspects of the theory, from the most general problems for mappings between metric spaces to those connected with fairly concrete and important classes of operators acting in Banach and finite dimensional spaces. Written by a leading expert in the field, the book covers new and powerful techniques, whic...

Newton-type methods for optimization and variational problems

CERN Document Server

Izmailov, Alexey F

2014-01-01

This book presents comprehensive state-of-the-art theoretical analysis of the fundamental Newtonian and Newtonian-related approaches to solving optimization and variational problems. A central focus is the relationship between the basic Newton scheme for a given problem and algorithms that also enjoy fast local convergence. The authors develop general perturbed Newtonian frameworks that preserve fast convergence and consider specific algorithms as particular cases within those frameworks, i.e., as perturbations of the associated basic Newton iterations. This approach yields a set of tools for the unified treatment of various algorithms, including some not of the Newton type per se. Among the new subjects addressed is the class of degenerate problems. In particular, the phenomenon of attraction of Newton iterates to critical Lagrange multipliers and its consequences as well as stabilized Newton methods for variational problems and stabilized sequential quadratic programming for optimization. This volume will b...

Variation in the Growth Traits and Wood Properties of Chinese Fir from Six Provinces of Southern China

Directory of Open Access Journals (Sweden)

Hongjing Duan

2016-08-01

Full Text Available To determine the phenotypic variation in 700 ten-year grafted Chinese fir collected from six provinces in southern China, 10 phenotypic traits were investigated: tree height, diameter at breast height, bark thickness, volume of timber, heartwood ratio, density of wood, hygroscopicity, tracheid length, tracheid diameter, and ratio of tracheid length to tracheid diameter. Abundant phenotypic variation was found among the six populations; the phenotypic variation coefficients all exceeded 10%, and the largest was for volume of timber. Significant variation (p < 0.01 or 0.05 in traits was found among the populations, except for diameter at breast height, heartwood ratio, and tracheid diameter, while all traits differed significantly (p < 0.01 within populations. The high value of repeatability (broad-sense heritability suggested moderate genetic control of the traits. The 10 traits were strongly correlated within the entire population; strong positive correlations (p < 0.01 were observed between growth traits, and significant negative correlations (p < 0.01 or 0.05 were found between the density of wood and most other characteristics, except for heartwood ratio and ratio of tracheid length to tracheid diameter. Using diameter at breast height and density of wood as criteria, 98 relatively fast-growing genotypes with relatively high wood basic density were identified.

Variability of Gross Tumor Volume in Nasopharyngeal Carcinoma Using 11C-Choline and 18F-FDG PET/CT.

Directory of Open Access Journals (Sweden)

Jun Jiang

Full Text Available This study was conducted to evaluate the variability of gross tumor volume (GTV using 11C-Choline and 18F-FDG PET/CT images for nasopharyngeal carcinomas boundary definition. Assessment consisted of inter-observer and inter-modality variation analysis. Four radiation oncologists were invited to manually contour GTV by using PET/CT fusion obtained from a cohort of 12 patients with nasopharyngeal carcinoma (NPC and who underwent both 11C-Choline and 18F-FDG scans. Student's paired-sample t-test was performed for analyzing inter-observer and inter-modality variability. Semi-automatic segmentation methods, including thresholding and region growing, were also validated against the manual contouring of the two types of PET images. We observed no significant variation in the results obtained by different oncologists in terms of the same type of PET/CT volumes. Choline fusion volumes were significantly larger than the FDG volumes (p < 0.0001, mean ± SD = 18.21 ± 8.19. While significantly consistent results were obtained between the oncologists and the standard references in Choline volumes compared with those in FDG volumes (p = 0.0025. Simple semi-automatic delineation methods indicated that 11C-Choline PET images could provide better results than FDG volumes (p = 0.076, CI = [-0.29, 0.025]. 11C-Choline PET/CT may be more advantageous in GTV delineation for the radiotherapy of NPC than 18F-FDG. Phantom simulations and clinical trials should be conducted to prove the possible improvement of the treatment outcome.

Structural Variation within the Amygdala and Ventromedial Prefrontal Cortex Predict Memory for Impressions in Older Adults

Directory of Open Access Journals (Sweden)

Brittany Shane Cassidy

2012-08-01

Full Text Available Research has shown that lesions to regions involved in social and emotional cognition disrupt socioemotional processing and memory. We investigated how structural variation of regions involved in socioemotional memory (ventromedial prefrontal cortex [vmPFC], amygdala, as opposed to a region implicated in explicit memory (hippocampus, affected memory for impressions in young and older adults. Anatomical MRI scans for fifteen young and fifteen older adults were obtained and reconstructed to gather information about cortical thickness and subcortical volume. Young adults had greater amygdala and hippocampus volumes than old, and thicker left vmPFC than old, although right vmPFC thickness did not differ across the age groups. Participants formed behavior-based impressions and responded to interpersonally meaningful, social but interpersonally irrelevant, or non-social prompts, and completed a memory test. Results showed that greater left amygdala volume predicted enhanced overall memory for impressions in older but not younger adults. Increased right vmPFC thickness in older, but not younger, adults correlated with enhanced memory for impressions formed in the interpersonally meaningful context. Hippocampal volume was not predictive of social memory in young or older adults. These findings demonstrate the importance of structural variation in regions linked to socioemotional processing in the retention of impressions with age, and suggest that the amygdala and vmPFC play an integral role when encoding and retrieving social information.

Early developmental gene enhancers affect subcortical volumes in the adult human brain.

Science.gov (United States)

Becker, Martin; Guadalupe, Tulio; Franke, Barbara; Hibar, Derrek P; Renteria, Miguel E; Stein, Jason L; Thompson, Paul M; Francks, Clyde; Vernes, Sonja C; Fisher, Simon E

2016-05-01

Genome-wide association screens aim to identify common genetic variants contributing to the phenotypic variability of complex traits, such as human height or brain morphology. The identified genetic variants are mostly within noncoding genomic regions and the biology of the genotype-phenotype association typically remains unclear. In this article, we propose a complementary targeted strategy to reveal the genetic underpinnings of variability in subcortical brain volumes, by specifically selecting genomic loci that are experimentally validated forebrain enhancers, active in early embryonic development. We hypothesized that genetic variation within these enhancers may affect the development and ultimately the structure of subcortical brain regions in adults. We tested whether variants in forebrain enhancer regions showed an overall enrichment of association with volumetric variation in subcortical structures of >13,000 healthy adults. We observed significant enrichment of genomic loci that affect the volume of the hippocampus within forebrain enhancers (empirical P = 0.0015), a finding which robustly passed the adjusted threshold for testing of multiple brain phenotypes (cutoff of P < 0.0083 at an alpha of 0.05). In analyses of individual single nucleotide polymorphisms (SNPs), we identified an association upstream of the ID2 gene with rs7588305 and variation in hippocampal volume. This SNP-based association survived multiple-testing correction for the number of SNPs analyzed but not for the number of subcortical structures. Targeting known regulatory regions offers a way to understand the underlying biology that connects genotypes to phenotypes, particularly in the context of neuroimaging genetics. This biology-driven approach generates testable hypotheses regarding the functional biology of identified associations. Hum Brain Mapp 37:1788-1800, 2016. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

Sampling soils for 137Cs using various field-sampling volumes

International Nuclear Information System (INIS)

Nyhan, J.W.; Schofield, T.G.; White, G.C.; Trujillo, G.

1981-10-01

The sediments from a liquid effluent receiving area at the Los Alamos National Laboratory and soils from intensive study area in the fallout pathway of Trinity were sampled for 137 Cs using 25-, 500-, 2500-, and 12 500-cm 3 field sampling volumes. A highly replicated sampling program was used to determine mean concentrations and inventories of 137 Cs at each site, as well as estimates of spatial, aliquoting, and counting variance components of the radionuclide data. The sampling methods were also analyzed as a function of soil size fractions collected in each field sampling volume and of the total cost of the program for a given variation in the radionuclide survey results. Coefficients of variation (CV) of 137 Cs inventory estimates ranged from 0.063 to 0.14 for Mortandad Canyon sediments, where CV values for Trinity soils were observed from 0.38 to 0.57. Spatial variance components of 137 Cs concentration data were usually found to be larger than either the aliquoting or counting variance estimates and were inversely related to field sampling volume at the Trinity intensive site. Subsequent optimization studies of the sampling schemes demonstrated that each aliquot should be counted once, and that only 2 to 4 aliquots out of an many as 30 collected need be assayed for 137 Cs. The optimization studies showed that as sample costs increased to 45 man-hours of labor per sample, the variance of the mean 137 Cs concentration decreased dramatically, but decreased very little with additional labor

Forest anisotropy assessment by means of spatial variations analysis of PolSAR backscattering

Directory of Open Access Journals (Sweden)

A. V. Dmitriev

2017-06-01

Full Text Available The possibility to synthesize polarization response from earth covers at any desired combination of transmit and receive antenna polarizations is the significant advantage of polarimetric radar. It permits better identification of dominant scattering mechanisms especially when analyzing polarization signatures. These signatures depict more details of physical information from target backscattering in various polarization bases. However, polarization signatures cannot reveal spatial variations of the radar backscattering caused by volume heterogeneity of a target. This paper proposes a new approach for estimating volume target heterogeneity from polarimetric synthetic aperture radar (PolSAR images. The approach is based on the analysis of a novel type of polarization signature, which we call fractal polarization signature (FPS. This signature is a result of polarization synthesis of initial fully polarimetric data and subsequent fractal analysis of synthesized images. It is displayed as a 3D plot and can be produced for each point in an image. It is shown that FPS describes backscattering variations or image roughness at different states of polarization. Fully polarimetric data of SIR-C and ALOS PALSAR at ascending/descending orbits were used for testing the proposed approach. The azimuthal dependence of the radar backscattering variations is discovered when analyzing backscattering from a pine forest. It correlates with the results of a field survey of trees branch distribution.

Geometrical considerations in dose volume analysis in intracavitary treatment

International Nuclear Information System (INIS)

Deshpande, D.D.; Shrivastava, S.K.; Pradhan, A.S.; Viswanathan, P.S.; Dinshaw, K.A.

1996-01-01

The present work was aimed at to study the relationship between the volume enclosed by reference iodose surface and various geometrical parameters of the intracavitary applicator in treatment of carcinoma of cervix. Pearshape volume of the reference isodose derived from the Total Reference Air Kerma (TRAK) and the product of its dimensions, height H, width W and thickness T which is dependent on the applicator geometry, were estimated for 100 intracavitary applications treated by Selectron LDR machine. Orthogonal radiographs taken for each patient were used for measurement of actual geometric dimensions of the applicator and carrying out the dosimetry on TP-11 treatment planning system. The dimensions H, W and T of reference isodose surface (60 Gy) were also noted. Ratio of the product HWT and the pearshape volume was found mainly to be a function of colpostat separation and not of other geometrical parameters like maximum vertical and anterio-posterior dimension of the applicator. The ratio remained almost constant for a particular combination of uterine tandem and colpostat. Variation in the ratios were attributed to the non-standard geometry. The ratio of the volume of reference isodose surface to the product of its dimensions in the applicator depends upon the colpostat separation. (orig./MG) [de

Variational principles for locally variational forms

International Nuclear Information System (INIS)

Brajercik, J.; Krupka, D.

2005-01-01

We present the theory of higher order local variational principles in fibered manifolds, in which the fundamental global concept is a locally variational dynamical form. Any two Lepage forms, defining a local variational principle for this form, differ on intersection of their domains, by a variationally trivial form. In this sense, but in a different geometric setting, the local variational principles satisfy analogous properties as the variational functionals of the Chern-Simons type. The resulting theory of extremals and symmetries extends the first order theories of the Lagrange-Souriau form, presented by Grigore and Popp, and closed equivalents of the first order Euler-Lagrange forms of Hakova and Krupkova. Conceptually, our approach differs from Prieto, who uses the Poincare-Cartan forms, which do not have higher order global analogues

Normal variation in early parental sensitivity predicts child structural brain development.

Science.gov (United States)

Kok, Rianne; Thijssen, Sandra; Bakermans-Kranenburg, Marian J; Jaddoe, Vincent W V; Verhulst, Frank C; White, Tonya; van IJzendoorn, Marinus H; Tiemeier, Henning

2015-10-01

Early caregiving can have an impact on brain structure and function in children. The influence of extreme caregiving experiences has been demonstrated, but studies on the influence of normal variation in parenting quality are scarce. Moreover, no studies to date have included the role of both maternal and paternal sensitivity in child brain maturation. This study examined the prospective relation between mothers' and fathers' sensitive caregiving in early childhood and brain structure later in childhood. Participants were enrolled in a population-based prenatal cohort. For 191 families, maternal and paternal sensitivity was repeatedly observed when the child was between 1 year and 4 years of age. Head circumference was assessed at 6 weeks, and brain structure was assessed using magnetic resonance imaging (MRI) measurements at 8 years of age. Higher levels of parental sensitivity in early childhood were associated with larger total brain volume (adjusted β = 0.15, p = .01) and gray matter volume (adjusted β = 0.16, p = .01) at 8 years, controlling for infant head size. Higher levels of maternal sensitivity in early childhood were associated with a larger gray matter volume (adjusted β = 0.13, p = .04) at 8 years, independent of infant head circumference. Associations with maternal versus paternal sensitivity were not significantly different. Normal variation in caregiving quality is related to markers of more optimal brain development in children. The results illustrate the important role of both mothers and fathers in child brain development. Copyright © 2015 American Academy of Child and Adolescent Psychiatry. Published by Elsevier Inc. All rights reserved.

High Level of Tregs Is a Positive Prognostic Marker in Patients with HPV-Positive Oral and Oropharyngeal Squamous Cell Carcinomas

Czech Academy of Sciences Publication Activity Database

Lukešová, E.; Bouček, J.; Rotnáglová, E.; Salaková, M.; Koslabová, E.; Grega, M.; Eckschlager, T.; Říhová, Blanka; Procházka, B.; Klozar, J.; Tachezy, R.

2014-01-01

Roč. 2, č. 303929 (2014), 1-4 ISSN 2314-6141 R&D Projects: GA MZd(CZ) NT11542 Grant - others:GA UK(CZ) SVV 266513 Institutional support: RVO:61388971 Keywords : HPV positivity * Tregs * Infection Subject RIV: EE - Microbiology, Virology

Medication and volume delivery by gravity-driven micro-drip intravenous infusion: potential variations during "wide-open" flow.

Science.gov (United States)

Pierce, Eric T; Kumar, Vikram; Zheng, Hui; Peterfreund, Robert A

2013-03-01

Gravity-driven micro-drip infusion sets allow control of medication dose delivery by adjusting drops per minute. When the roller clamp is fully open, flow in the drip chamber can be a continuous fluid column rather than discrete, countable, drops. We hypothesized that during this "wide-open" state, drug delivery becomes dependent on factors extrinsic to the micro-drip set and is therefore difficult to predict. We conducted laboratory experiments to characterize volume delivery under various clinically relevant conditions of wide-open flow in an in vitro laboratory model. A micro-drip infusion set, plugged into a bag of normal saline, was connected to a high-flow stopcock at the distal end. Vertically oriented IV catheters (gauges 14-22) were connected to the stopcock. The fluid meniscus height in the bag was fixed (60-120 cm) above the outflow point. The roller clamp on the infusion set was in fully open position for all experiments resulting in a continuous column of fluid in the drip chamber. Fluid volume delivered in 1 minute was measured 4 times with each condition. To model resistive effects of carrier flow, volumetric infusion pumps were used to deliver various flow rates of normal saline through a carrier IV set into which a micro-drip infusion was "piggybacked." We also compared delivery by micro-drip infusion sets from 3 manufacturers. The volume of fluid delivered by gravity-driven infusion under wide-open conditions (continuous fluid column in drip chamber) varied 2.9-fold (95% confidence interval, 2.84-2.96) depending on catheter size and fluid column height. Total model resistance of the micro-drip with stopcock and catheter varied with flow rate. Volume delivered by the piggybacked micro-drip decreased up to 29.7% ± 0.8% (mean ± SE) as the carrier flow increased from 0 to 1998 mL/min. Delivery characteristics of the micro-drip infusion sets from 3 different manufacturers were similar. Laboratory simulation of clinical situations with gravity

Evaluation of the accuracy of volume determination on the orbit and eyeball using MRI

International Nuclear Information System (INIS)

Chau, Anson; Fung, Karl; Yap, Maurice

2005-01-01

Purpose: This study reports a calibration carried out on phantoms simulating the orbit and eyeball to evaluate the accuracy of volumetric determination using MRI DICOM (Digital Imaging and Communication in Medicine) images. Methods: Ten tailor-made spherical silicon balls ranging in size from 5 to 14 cm 3 and 10 silicon moulds of orbits from 10 human dried skulls were used to simulate the eyes and orbits, respectively. The CISS (Constructive interference in steady state, TR/TE = 16/8 ms) T2-weighted sequence was taken using a Siemens MRI scanner. The volume of each phantom was computed and compared with the known physical volumes. Results: The computed and physical volumes were highly correlated for both eyeball (r = 0.997) and the orbit (r = 0.992) phantoms. Coefficients of variation of the computed and physical volumes were low. Consequently, it is possible to apply a calibration value to the computed volume to derive the physical volume with a high level of confidence. Conclusion: We conclude that with appropriate calibration, it is viable to use MRI DICOM images to derive the volume of the eyeball and the orbit

Evaluation of the accuracy of volume determination on the orbit and eyeball using MRI

Energy Technology Data Exchange (ETDEWEB)

Chau, Anson [Department of Optometry and Radiography, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China); Fung, Karl [Department of Optometry and Radiography, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China)]. E-mail: orkarl@polyu.edu.hk; Yap, Maurice [Department of Optometry and Radiography, Hong Kong Polytechnic University, Hung Hom, Kowloon, Hong Kong (China)

2005-02-01

Purpose: This study reports a calibration carried out on phantoms simulating the orbit and eyeball to evaluate the accuracy of volumetric determination using MRI DICOM (Digital Imaging and Communication in Medicine) images. Methods: Ten tailor-made spherical silicon balls ranging in size from 5 to 14 cm{sup 3} and 10 silicon moulds of orbits from 10 human dried skulls were used to simulate the eyes and orbits, respectively. The CISS (Constructive interference in steady state, TR/TE = 16/8 ms) T2-weighted sequence was taken using a Siemens MRI scanner. The volume of each phantom was computed and compared with the known physical volumes. Results: The computed and physical volumes were highly correlated for both eyeball (r = 0.997) and the orbit (r = 0.992) phantoms. Coefficients of variation of the computed and physical volumes were low. Consequently, it is possible to apply a calibration value to the computed volume to derive the physical volume with a high level of confidence. Conclusion: We conclude that with appropriate calibration, it is viable to use MRI DICOM images to derive the volume of the eyeball and the orbit.

Volume measurement variability in three-dimensional high-frequency ultrasound images of murine liver metastases

International Nuclear Information System (INIS)

Wirtzfeld, L A; Graham, K C; Groom, A C; MacDonald, I C; Chambers, A F; Fenster, A; Lacefield, J C

2006-01-01

The identification and quantification of tumour volume measurement variability is imperative for proper study design of longitudinal non-invasive imaging of pre-clinical mouse models of cancer. Measurement variability will dictate the minimum detectable volume change, which in turn influences the scheduling of imaging sessions and the interpretation of observed changes in tumour volume. In this paper, variability is quantified for tumour volume measurements from 3D high-frequency ultrasound images of murine liver metastases. Experimental B16F1 liver metastases were analysed in different size ranges including less than 1 mm 3 , 1-4 mm 3 , 4-8 mm 3 and 8-70 mm 3 . The intra- and inter-observer repeatability was high over a large range of tumour volumes, but the coefficients of variation (COV) varied over the volume ranges. The minimum and maximum intra-observer COV were 4% and 14% for the 1-4 mm 3 and 3 tumours, respectively. For tumour volumes measured by segmenting parallel planes, the maximum inter-slice distance that maintained acceptable measurement variability increased from 100 to 600 μm as tumour volume increased. Comparison of free breathing versus ventilated animals demonstrated that respiratory motion did not significantly change the measured volume. These results enable design of more efficient imaging studies by using the measured variability to estimate the time required to observe a significant change in tumour volume

Rapid estimate of solid volume in large tuff cores using a gas pycnometer

Energy Technology Data Exchange (ETDEWEB)

Thies, C. [ed.; Geddis, A.M.; Guzman, A.G. [and others

1996-09-01

A thermally insulated, rigid-volume gas pycnometer system has been developed. The pycnometer chambers have been machined from solid PVC cylinders. Two chambers confine dry high-purity helium at different pressures. A thick-walled design ensures minimal heat exchange with the surrounding environment and a constant volume system, while expansion takes place between the chambers. The internal energy of the gas is assumed constant over the expansion. The ideal gas law is used to estimate the volume of solid material sealed in one of the chambers. Temperature is monitored continuously and incorporated into the calculation of solid volume. Temperature variation between measurements is less than 0.1{degrees}C. The data are used to compute grain density for oven-dried Apache Leap tuff core samples. The measured volume of solid and the sample bulk volume are used to estimate porosity and bulk density. Intrinsic permeability was estimated from the porosity and measured pore surface area and is compared to in-situ measurements by the air permeability method. The gas pycnometer accommodates large core samples (0.25 m length x 0.11 m diameter) and can measure solid volume greater than 2.20 cm{sup 3} with less than 1% error.

Elemental Spatiotemporal Variations of Total Suspended Particles in Jeddah City

OpenAIRE

Kadi, Mohammad W.

2014-01-01

Elements associated with total suspended particulate matter (TSP) in Jeddah city were determined. Using high-volume samplers, TSP samples were simultaneously collected over a one-year period from seven sampling sites. Samples were analyzed for Al, Ba, Ca, Cu, Mg, Fe, Mn, Zn, Ti, V, Cr, Co, Ni, As, and Sr. Results revealed great dependence of element contents on spatial and temporal variations. Two sites characterized by busy roads, workshops, heavy population, and heavy trucking have high lev...

A low-volume cavity ring-down spectrometer for sample-limited applications

Science.gov (United States)

Stowasser, C.; Farinas, A. D.; Ware, J.; Wistisen, D. W.; Rella, C.; Wahl, E.; Crosson, E.; Blunier, T.

2014-08-01

In atmospheric and environmental sciences, optical spectrometers are used for the measurements of greenhouse gas mole fractions and the isotopic composition of water vapor or greenhouse gases. The large sample cell volumes (tens of milliliters to several liters) in commercially available spectrometers constrain the usefulness of such instruments for applications that are limited in sample size and/or need to track fast variations in the sample stream. In an effort to make spectrometers more suitable for sample-limited applications, we developed a low-volume analyzer capable of measuring mole fractions of methane and carbon monoxide based on a commercial cavity ring-down spectrometer. The instrument has a small sample cell (9.6 ml) and can selectively be operated at a sample cell pressure of 140, 45, or 20 Torr (effective internal volume of 1.8, 0.57, and 0.25 ml). We present the new sample cell design and the flow path configuration, which are optimized for small sample sizes. To quantify the spectrometer's usefulness for sample-limited applications, we determine the renewal rate of sample molecules within the low-volume spectrometer. Furthermore, we show that the performance of the low-volume spectrometer matches the performance of the standard commercial analyzers by investigating linearity, precision, and instrumental drift.

Testing the Sensory Drive Hypothesis: Geographic variation in echolocation frequencies of Geoffroy's horseshoe bat (Rhinolophidae: Rhinolophus clivosus).

Science.gov (United States)

Jacobs, David S; Catto, Sarah; Mutumi, Gregory L; Finger, Nikita; Webala, Paul W

2017-01-01

Geographic variation in sensory traits is usually influenced by adaptive processes because these traits are involved in crucial life-history aspects including orientation, communication, lineage recognition and mate choice. Studying this variation can therefore provide insights into lineage diversification. According to the Sensory Drive Hypothesis, lineage diversification may be driven by adaptation of sensory systems to local environments. It predicts that acoustic signals vary in association with local climatic conditions so that atmospheric attenuation is minimized and transmission of the signals maximized. To test this prediction, we investigated the influence of climatic factors (specifically relative humidity and temperature) on geographic variation in the resting frequencies of the echolocation pulses of Geoffroy's horseshoe bat, Rhinolophus clivosus. If the evolution of phenotypic variation in this lineage tracks climate variation, human induced climate change may lead to decreases in detection volumes and a reduction in foraging efficiency. A complex non-linear interaction between relative humidity and temperature affects atmospheric attenuation of sound and principal components composed of these correlated variables were, therefore, used in a linear mixed effects model to assess their contribution to observed variation in resting frequencies. A principal component composed predominantly of mean annual temperature (factor loading of -0.8455) significantly explained a proportion of the variation in resting frequency across sites (P < 0.05). Specifically, at higher relative humidity (around 60%) prevalent across the distribution of R. clivosus, increasing temperature had a strong negative effect on resting frequency. Climatic factors thus strongly influence acoustic signal divergence in this lineage, supporting the prediction of the Sensory Drive Hypothesis. The predicted future increase in temperature due to climate change is likely to decrease the

Testing the Sensory Drive Hypothesis: Geographic variation in echolocation frequencies of Geoffroy's horseshoe bat (Rhinolophidae: Rhinolophus clivosus.

Directory of Open Access Journals (Sweden)

David S Jacobs

Full Text Available Geographic variation in sensory traits is usually influenced by adaptive processes because these traits are involved in crucial life-history aspects including orientation, communication, lineage recognition and mate choice. Studying this variation can therefore provide insights into lineage diversification. According to the Sensory Drive Hypothesis, lineage diversification may be driven by adaptation of sensory systems to local environments. It predicts that acoustic signals vary in association with local climatic conditions so that atmospheric attenuation is minimized and transmission of the signals maximized. To test this prediction, we investigated the influence of climatic factors (specifically relative humidity and temperature on geographic variation in the resting frequencies of the echolocation pulses of Geoffroy's horseshoe bat, Rhinolophus clivosus. If the evolution of phenotypic variation in this lineage tracks climate variation, human induced climate change may lead to decreases in detection volumes and a reduction in foraging efficiency. A complex non-linear interaction between relative humidity and temperature affects atmospheric attenuation of sound and principal components composed of these correlated variables were, therefore, used in a linear mixed effects model to assess their contribution to observed variation in resting frequencies. A principal component composed predominantly of mean annual temperature (factor loading of -0.8455 significantly explained a proportion of the variation in resting frequency across sites (P < 0.05. Specifically, at higher relative humidity (around 60% prevalent across the distribution of R. clivosus, increasing temperature had a strong negative effect on resting frequency. Climatic factors thus strongly influence acoustic signal divergence in this lineage, supporting the prediction of the Sensory Drive Hypothesis. The predicted future increase in temperature due to climate change is likely to

Variational 3D-PIV with sparse descriptors

Science.gov (United States)

Lasinger, Katrin; Vogel, Christoph; Pock, Thomas; Schindler, Konrad

2018-06-01

3D particle imaging velocimetry (3D-PIV) aims to recover the flow field in a volume of fluid, which has been seeded with tracer particles and observed from multiple camera viewpoints. The first step of 3D-PIV is to reconstruct the 3D locations of the tracer particles from synchronous views of the volume. We propose a new method for iterative particle reconstruction, in which the locations and intensities of all particles are inferred in one joint energy minimization. The energy function is designed to penalize deviations between the reconstructed 3D particles and the image evidence, while at the same time aiming for a sparse set of particles. We find that the new method, without any post-processing, achieves significantly cleaner particle volumes than a conventional, tomographic MART reconstruction, and can handle a wide range of particle densities. The second step of 3D-PIV is to then recover the dense motion field from two consecutive particle reconstructions. We propose a variational model, which makes it possible to directly include physical properties, such as incompressibility and viscosity, in the estimation of the motion field. To further exploit the sparse nature of the input data, we propose a novel, compact descriptor of the local particle layout. Hence, we avoid the memory-intensive storage of high-resolution intensity volumes. Our framework is generic and allows for a variety of different data costs (correlation measures) and regularizers. We quantitatively evaluate it with both the sum of squared differences and the normalized cross-correlation, respectively with both a hard and a soft version of the incompressibility constraint.

To what extent do long-duration high-volume dam releases influence river-aquifer interactions? A case study in New South Wales, Australia

Science.gov (United States)

Graham, P. W.; Andersen, M. S.; McCabe, M. F.; Ajami, H.; Baker, A.; Acworth, I.

2015-03-01

Long-duration high-volume dam releases are unique anthropogenic events with no naturally occurring equivalents. The impact from such dam releases on a downstream Quaternary alluvial aquifer in New South Wales, Australia, is assessed. It is observed that long-duration (>26 days), high-volume dam releases (>8,000 ML/day average) result in significant variations in river-aquifer interactions. These variations include a flux from the river to the aquifer up to 6.3 m3/day per metre of bank (at distances of up to 330 m from the river bank), increased extent and volume of recharge/bank storage, and a long-term (>100 days) reversal of river-aquifer fluxes. In contrast, during lower-volume events (bank. A groundwater-head prediction model was constructed and river-aquifer fluxes were calculated; however, predicted fluxes from this method showed poor correlation to fluxes calculated using actual groundwater heads. Long-duration high-volume dam releases have the potential to skew estimates of long-term aquifer resources and detrimentally alter the chemical and physical properties of phreatic aquifers flanking the river. The findings have ramifications for improved integrated management of dam systems and downstream aquifers.

Delay in the Diagnosis and Treatment of Pulmonary Tuberculosis in Uzbekistan: A Cross-Sectional Study

Czech Academy of Sciences Publication Activity Database

Belkina, T.V.; Khojiev, D.S.; Tillyashaykhov, M.N.; Tigay, Z.N.; Kudenov, M.U.; Duintjer Tebbens, Jurjen; Vlček, J.

2014-01-01

Roč. 14, November (2014), article 624 ISSN 1471-2334 Grant - others:SVV UK(CZ) 260 066 Institutional support: RVO:67985807 Keywords : cross-sectional study * pulmonary tuberculosis * self-medication * Uzbekistan Subject RIV: FR - Pharmacology ; Medidal Chemistry Impact factor: 2.613, year: 2014

Incorporating Allelic Dropout

Czech Academy of Sciences Publication Activity Database

Slovák, Dalibor

2014-01-01

Roč. 2, č. 1 (2014), s. 31-33 ISSN 1805-8698 Grant - others:SVV(CZ) 260034 Institutional support: RVO:67985807 Keywords : drop-out * peak height * DNA interpretation Subject RIV: IN - Informatics, Computer Science http://www.ijbh.org/ijbh2014-1.pdf

How are inflation targets set?

Czech Academy of Sciences Publication Activity Database

Horváth, R.; Matějů, Jakub

-, č. 426 (2010), s. 1-35 ISSN 1211-3298 Grant - others:MŠk(CZ) SVV-2010-261801 Institutional research plan: CEZ:MSM0021620846 Keywords : inflation targeting * central bank * credibility Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp426.pdf

Analyzing structural variations along strike in a deep-water thrust belt

Science.gov (United States)

Totake, Yukitsugu; Butler, Robert W. H.; Bond, Clare E.; Aziz, Aznan

2018-03-01

We characterize a deep-water fold-thrust arrays imaged by a high-resolution 3D seismic dataset in the offshore NW Borneo, Malaysia, to understand the kinematics behind spatial arrangement of structural variations throughout the fold-thrust system. The seismic volume used covers two sub-parallel fold trains associated with a series of fore-thrusts and back-thrusts. We measured fault heave, shortening value, fold geometries (forelimb dip, interlimb angle and crest depth) along strike in individual fold trains. Heave plot on strike projection allows to identify individual thrust segments showing semi-elliptical to triangular to bimodal patterns, and linkages of these segments. The linkage sites are marked by local minima in cumulative heave. These local heave minima are compensated by additional structures, such as small imbricate thrusts and tight folds indicated by large forelimb dip and small interlimb angle. Complementary profiles of the shortening amount for the two fold trains result in smoother gradient of total shortening across the structures. We interpret this reflects kinematic interaction between two fold-thrust trains. This type of along-strike variation analysis provides comprehensive understanding of a fold-thrust system and may provide an interpretative strategy for inferring the presence of complex multiple faults in less well-imaged parts of seismic volumes.

Variation of Shrinkage Strain within the Depth of Concrete Beams

Directory of Open Access Journals (Sweden)

Jong-Hyun Jeong

2015-11-01

Full Text Available The variation of shrinkage strain within beam depth was examined through four series of time-dependent laboratory experiments on unreinforced concrete beam specimens. Two types of beam specimens, horizontally cast and vertically cast, were tested; shrinkage variation was observed in the horizontally cast specimens. This indicated that the shrinkage variation within the beam depth was due to water bleeding and tamping during the placement of the fresh concrete. Shrinkage strains were measured within the beam depth by two types of strain gages, surface-attached and embedded. The shrinkage strain distribution within the beam depth showed a consistent tendency for the two types of gages. The test beams were cut into four sections after completion of the test, and the cutting planes were divided into four equal sub-areas to measure the aggregate concentration for each sub-area of the cutting plane. The aggregate concentration increased towards the bottom of the beam. The shrinkage strain distribution was estimated by Hobbs’ equation, which accounts for the change of aggregate volume concentration.

Process γγ → νν-bar in a strong magnetic field

International Nuclear Information System (INIS)

Kuznetsov, A.V.; Mikheev, N.V.; Rumyantsev, D.A.

2003-01-01

The three-vertex loop amplitude in a strong magnetic field are analyzed in a general form by using the asymptotic behavior of the electron propagator in an external field. The process γγ → νν-bar is studied in terms of the scalar-vector-vector (SVV), pseudoscalar-vector-vector (PVV), vector-vector-vector (VVV), and axial-vector-vector-vector (AVV) combinations of couplings. It is shown that only in the case of the SVV combination does the amplitude grow linearly with increasing magnetic-field strength, the amplitudes evaluated with the other combinations of couplings (PVV, VVV, and AVV) featuring no linearly increasing terms. The process γγ → νν-bar is also studied within the left-right model, which is an extension of the Standard Model of electroweak interactions and which may involve an effective scalar ννee coupling. Possible astrophysical manifestations of this process are discussed

SU-C-210-06: Quantitative Evaluation of Dosimetric Effects Resulting From Positional Variations of Pancreatic Tumor Volumes

Energy Technology Data Exchange (ETDEWEB)

Yu, S; Sehgal, V; Wei, R; Lawrenson, L; Kuo, J; Hanna, N; Ramsinghani, N; Daroui, P; Al-Ghazi, M [University of California, Orange, CA (United States)

2015-06-15

Purpose: The aim of this study is to quantify dosimetric effects resulting from variation in pancreatic tumor position assessed by bony anatomy and implanted fiducial markers Methods: Twelve pancreatic cancer patients were retrospectively analyzed for this study. All patients received modulated arc therapy (VMAT) treatment using fiducial-based Image Guided Radiation Therapy (IGRT) to the intact pancreas. Using daily orthogonal kV and/or Cone beam CT images, the shift needed to co-register the daily pre-treatment images to reference CT from fiducial to bone (Fid-Bone) were recorded as Left-Right (LR), Anterior-Posterior (AP) and Superior-Inferior (SI). The original VMAT plan iso-center was shifted based on KV bone matching positions at 5 evenly spaced fractions. Dose coverage of the planning target volumes (PTVs) (V100%), mean dose to liver, kidney and stomach/duodenum were assessed in the modified plans. Results: A total of 306 fractions were analyzed. The absolute fiducial-bone positional shifts were greatest in the SI direction, (AP = 2.7 ± 3.0, LR = 2.8 ± 2.8, and SI 6.3 ± 7.9 mm, mean ± SD). The V100% was significantly reduced by 13.5%, (Fid-Bone = 95.3 ± 2.0 vs. 82.3 ± 11.8%, p=0.02). This varied widely among patients (Fid-Bone V100% Range = 2–60%), where 33% of patients had a reduction in V100% of more than 10%. The impact on OARs was greatest to the liver (Fid-Bone= 14.6 vs. 16.1 Gy, 10%), and stomach, (Fid-Bone = 23.9 vx. 25.5 Gy, 7%), however was not statistically significant (p=0.10 both). Conclusion: Compared to matching by fiducial markers, matching by bony anatomy would have substantially reduced the PTV coverage by 13.5%. This reinforces the importance of online position verification based on fiducial markers. Hence, implantation of fiducial markers is strongly recommended for pancreatic cancer patients undergoing intensity modulated radiation therapy treatments.

Effects of the molecular level dispersion of graphene oxide on the free volume characteristics of poly(vinyl alcohol) and its impact on the thermal and mechanical properties of their nanocomposites.

Science.gov (United States)

Sharma, S K; Prakash, J; Pujari, P K

2015-11-21

Poly(vinyl alcohol), PVA, reinforced with carbon nanofillers has shown drastic variations in thermal as well as mechanical properties. In order to establish structure-property correlations, these variations have been correlated with modifications in the hydrogen bonding structure as well as the crystallinity of the PVA matrix without paying much attention to molecular packing in the amorphous region of this semicrystalline polymer. In order to investigate the molecular packing in PVA-graphene oxide (GO) nanocomposites, free volume characterization of PVA-GO nanocomposites has been carried out using ortho-positronium (o-Ps) probe. The variations in free volume size, density and size distribution have been determined through o-Ps lifetime and the corresponding intensity as well as its lifetime distribution. The variation in hydrogen bonding and its effect on crystallinity has been determined by Fourier Transform Infra Red (FTIR) and X-ray diffraction (XRD) measurements. The variation in the thermal (glass transition temperature) and mechanical (Young's modulus, tensile strength and percentage strain at break) properties of the nanocomposites is explained in view of the free volume structure and crystallinity of the PVA matrix which are severely modified due to the molecular-level dispersion of GO sheets in the PVA matrix.

Volume-dependent hemodynamic effects of blood collection in canine donors - evaluation of 13% and 15% of total blood volume depletion

Directory of Open Access Journals (Sweden)

RUI R.F. FERREIRA

2015-03-01

Full Text Available Background: There is no consensus regarding the blood volume that could be safely donated by dogs, ranging from 11 to 25% of its total blood volume (TBV. No previous studies evaluated sedated donors.Aim: To evaluate the hemodynamic effects of blood collection from sedated and non-sedated dogs and to understand if such effects were volume-dependent.Materials and Methods: Fifty three donations of 13% of TBV and 20 donations of 15% TBV were performed in dogs sedated with diazepam and ketamine. Additionally, a total of 30 collections of 13% TBV and 20 collections of 15% TBV were performed in non-sedated dogs. Non-invasive arterial blood pressures and pulse rates were registered before and 15 min after donation. Results: Post-donation pulse rates increased significantly in both sedated groups, with higher differences in the 15% TBV collections. Systolic arterial pressures decreased significantly in these groups, while diastolic pressures increased significantly in 13% TBV donations. Non-sedated groups revealed a slight, but significant, SBP decrease. No clinical signs related to donations were registered.Conclusion: These results suggest that the collection of 15% TBV in sedated donors induces hemodynamic variations that may compromise the harmlessness of the procedure, while it seems to be a safe procedure in non-sedated dogs.

Application of variational principles and adjoint integrating factors for constructing numerical GFD models

Science.gov (United States)

Penenko, Vladimir; Tsvetova, Elena; Penenko, Alexey

2015-04-01

The proposed method is considered on an example of hydrothermodynamics and atmospheric chemistry models [1,2]. In the development of the existing methods for constructing numerical schemes possessing the properties of total approximation for operators of multiscale process models, we have developed a new variational technique, which uses the concept of adjoint integrating factors. The technique is as follows. First, a basic functional of the variational principle (the integral identity that unites the model equations, initial and boundary conditions) is transformed using Lagrange's identity and the second Green's formula. As a result, the action of the operators of main problem in the space of state functions is transferred to the adjoint operators defined in the space of sufficiently smooth adjoint functions. By the choice of adjoint functions the order of the derivatives becomes lower by one than those in the original equations. We obtain a set of new balance relationships that take into account the sources and boundary conditions. Next, we introduce the decomposition of the model domain into a set of finite volumes. For multi-dimensional non-stationary problems, this technique is applied in the framework of the variational principle and schemes of decomposition and splitting on the set of physical processes for each coordinate directions successively at each time step. For each direction within the finite volume, the analytical solutions of one-dimensional homogeneous adjoint equations are constructed. In this case, the solutions of adjoint equations serve as integrating factors. The results are the hybrid discrete-analytical schemes. They have the properties of stability, approximation and unconditional monotony for convection-diffusion operators. These schemes are discrete in time and analytic in the spatial variables. They are exact in case of piecewise-constant coefficients within the finite volume and along the coordinate lines of the grid area in each

Determination of Partial Molar Volumes of EPA and DHA Ethyl Esters in Supercritical Carbon Dioxide

Institute of Scientific and Technical Information of China (English)

无

2002-01-01

The use of supercritical-fluid chromatography for determining partial molar volumes of ethyl esters of cis-5,8,11,14,17-eicosapentaenoic acid (EPA) and cis -4,7,10,13,16,19- docosa-hexaenoic acid (DHA) in supercritical carbon dioxide is presented and discussed. Partial molar volumes of EPA and DHA esters are obtained from the variation of the retention properties with the density of mobile phase at 313.15 K, 323.15 K, 333.15 K and in the pressure range from 9 MPa to 21 MPa.

Deptermination of Partial Molar Volumes of EPA and DHA Ethyl Esters in Supercritical Carbon Dioxide

Institute of Scientific and Technical Information of China (English)

MeiHUANG; XianDaWANG; 等

2002-01-01

The use of supercritical-fluid shromatogrphy for determining partial molar volumes of ethyl esters of cis-5,8,11,14,17-eicosapentaenoic acid (EPA) and cis-4,7,10,13,16,19-docosa-hexaenoic acid(DHA) in supercritical carbon dioxide is presented and discussed. Partial molar volumes of EPA and DHA esters are obtained from the variation of the retention properties with the density of mobile phase at 313.15K,323.15K,333.15K and in the pressure range from 9 MPa to 21 MPa.

SU-E-T-578: On Definition of Minimum and Maximum Dose for Target Volume

Energy Technology Data Exchange (ETDEWEB)

Gong, Y; Yu, J; Xiao, Y [Thomas Jefferson University Hospital, Philadelphia, PA (United States)

2015-06-15

Purpose: This study aims to investigate the impact of different minimum and maximum dose definitions in radiotherapy treatment plan quality evaluation criteria by using tumor control probability (TCP) models. Methods: Dosimetric criteria used in RTOG 1308 protocol are used in the investigation. RTOG 1308 is a phase III randomized trial comparing overall survival after photon versus proton chemoradiotherapy for inoperable stage II-IIIB NSCLC. The prescription dose for planning target volume (PTV) is 70Gy. Maximum dose (Dmax) should not exceed 84Gy and minimum dose (Dmin) should not go below 59.5Gy in order for the plan to be “per protocol” (satisfactory).A mathematical model that simulates the characteristics of PTV dose volume histogram (DVH) curve with normalized volume is built. The Dmax and Dmin are noted as percentage volumes Dη% and D(100-δ)%, with η and d ranging from 0 to 3.5. The model includes three straight line sections and goes through four points: D95%= 70Gy, Dη%= 84Gy, D(100-δ)%= 59.5 Gy, and D100%= 0Gy. For each set of η and δ, the TCP value is calculated using the inhomogeneously irradiated tumor logistic model with D50= 74.5Gy and γ50=3.52. Results: TCP varies within 0.9% with η; and δ values between 0 and 1. With η and η varies between 0 and 2, TCP change was up to 2.4%. With η and δ variations from 0 to 3.5, maximum of 8.3% TCP difference is seen. Conclusion: When defined maximum and minimum volume varied more than 2%, significant TCP variations were seen. It is recommended less than 2% volume used in definition of Dmax or Dmin for target dosimetric evaluation criteria. This project was supported by NIH grants U10CA180868, U10CA180822, U24CA180803, U24CA12014 and PA CURE Grant.

SU-E-T-578: On Definition of Minimum and Maximum Dose for Target Volume

International Nuclear Information System (INIS)

Gong, Y; Yu, J; Xiao, Y

2015-01-01

Purpose: This study aims to investigate the impact of different minimum and maximum dose definitions in radiotherapy treatment plan quality evaluation criteria by using tumor control probability (TCP) models. Methods: Dosimetric criteria used in RTOG 1308 protocol are used in the investigation. RTOG 1308 is a phase III randomized trial comparing overall survival after photon versus proton chemoradiotherapy for inoperable stage II-IIIB NSCLC. The prescription dose for planning target volume (PTV) is 70Gy. Maximum dose (Dmax) should not exceed 84Gy and minimum dose (Dmin) should not go below 59.5Gy in order for the plan to be “per protocol” (satisfactory).A mathematical model that simulates the characteristics of PTV dose volume histogram (DVH) curve with normalized volume is built. The Dmax and Dmin are noted as percentage volumes Dη% and D(100-δ)%, with η and d ranging from 0 to 3.5. The model includes three straight line sections and goes through four points: D95%= 70Gy, Dη%= 84Gy, D(100-δ)%= 59.5 Gy, and D100%= 0Gy. For each set of η and δ, the TCP value is calculated using the inhomogeneously irradiated tumor logistic model with D50= 74.5Gy and γ50=3.52. Results: TCP varies within 0.9% with η; and δ values between 0 and 1. With η and η varies between 0 and 2, TCP change was up to 2.4%. With η and δ variations from 0 to 3.5, maximum of 8.3% TCP difference is seen. Conclusion: When defined maximum and minimum volume varied more than 2%, significant TCP variations were seen. It is recommended less than 2% volume used in definition of Dmax or Dmin for target dosimetric evaluation criteria. This project was supported by NIH grants U10CA180868, U10CA180822, U24CA180803, U24CA12014 and PA CURE Grant

Psychopathic traits are associated with cortical and subcortical volume alterations in healthy individuals.

Science.gov (United States)

Vieira, Joana B; Ferreira-Santos, Fernando; Almeida, Pedro R; Barbosa, Fernando; Marques-Teixeira, João; Marsh, Abigail A

2015-12-01

Research suggests psychopathy is associated with structural brain alterations that may contribute to the affective and interpersonal deficits frequently observed in individuals with high psychopathic traits. However, the regional alterations related to different components of psychopathy are still unclear. We used voxel-based morphometry to characterize the structural correlates of psychopathy in a sample of 35 healthy adults assessed with the Triarchic Psychopathy Measure. Furthermore, we examined the regional grey matter alterations associated with the components described by the triarchic model. Our results showed that, after accounting for variation in total intracranial volume, age and IQ, overall psychopathy was negatively associated with grey matter volume in the left putamen and amygdala. Additional regression analysis with anatomical regions of interests revealed total triPM score was also associated with increased lateral orbitofrontal cortex (OFC) and caudate volume. Boldness was positively associated with volume in the right insula. Meanness was positively associated with lateral OFC and striatum volume, and negatively associated with amygdala volume. Finally, disinhibition was negatively associated with amygdala volume. Results highlight the contribution of both subcortical and cortical brain alterations for subclinical psychopathy and are discussed in light of prior research and theoretical accounts about the neurobiological bases of psychopathic traits. © The Author (2015). Published by Oxford University Press. For Permissions, please email: journals.permissions@oup.com.

Leading indicators of crisis incidence: evidence from developed countries

Czech Academy of Sciences Publication Activity Database

Babecký, J.; Havránek, T.; Matějů, Jakub; Rusnák, M.; Šmídková, K.; Vašíček, B.

2013-01-01

Roč. 35, June (2013), s. 1-19 ISSN 0261-5606 R&D Projects: GA MŠk(CZ) SVV 267801/2013 Institutional support: PRVOUK-P23 Keywords : early warning indicators * Bayesian model averaging * economic crises Subject RIV: AH - Economics Impact factor: 1.090, year: 2013

How are inflation targets set?

Czech Academy of Sciences Publication Activity Database

Horváth, R.; Matějů, Jakub

2011-01-01

Roč. 14, č. 2 (2011), s. 265-300 ISSN 1367-0271 R&D Projects: GA MŠk SVV 263801/2011 Institutional research plan: CEZ:MSM0021620846 Keywords : central bank independence * imperfect credibility * macroeconomic policy Subject RIV: AH - Economics Impact factor: 0.500, year: 2011

Les variations diasystématiques et leurs interdépendances dans les langues romanes

DEFF Research Database (Denmark)

Le présent volume contient un choix des actes du Colloque DIA II sur la variation linguistique dans les langues romanes. Ce colloque organisé par l'Université de Copenhague en collaboration avec l’Académie Royale des Sciences et Belles-lettres du Danemark du 19 au 21 novembre 2012 était consacré ...

Volume adjustment of lung density by computed tomography scans in patients with emphysema

DEFF Research Database (Denmark)

Shaker, S B; Dirksen, A; Laursen, Lars Christian

2004-01-01

of pulmonary emphysema derived from CT scans. These parameters are markedly influenced by changes in the level of inspiration. The variability of lung density due to within-subject variation in TLV was explored by plotting TLV against PD and RA. RESULTS: The coefficients for volume adjustment for PD were...... relatively stable over a wide range from the 10th to the 80th percentile, whereas for RA the coefficients showed large variability especially in the lower range, which is the most relevant for quantitation of pulmonary emphysema. CONCLUSION: Volume adjustment is mandatory in repeated CT densitometry......PURPOSE: To determine how to adjust lung density measurements for the volume of the lung calculated from computed tomography (CT) scans in patients with emphysema. MATERIAL AND METHODS: Fifty patients with emphysema underwent 3 CT scans at 2-week intervals. The scans were analyzed with a software...

Are urine flow-volume nomograms developed on Caucasian men optimally applicable for Indian men? Need for appraisal of flow-volume relations in local population

Directory of Open Access Journals (Sweden)

Mayank M Agarwal

2010-01-01

Full Text Available Introduction : Flow-volume nomograms and volume-corrected flow-rates (cQ are tools to correct uroflow rates (Q with varied voided volumes (VV of urine. We investigated the applicability of the available nomograms in our local population. Materials and Methods : Raw data of our previous study on variation in Q with voiding position (standing, sitting, and squatting in healthy adult men was reanalyzed. Additionally, the departmental urodynamic database of the last four years was searched for uroflow data of men with voiding symptoms (International Prostatic Symptom Score (IPSS > 7 and global quality of life score >2. These results were projected on the Liverpool and Siroky nomograms for men. The Q-VV relations were statistically analyzed using curve-estimation regression method to examine the current definition of corrected maximum flow rate (Qmax. Results : We found a cubic relation between Q and VV; based on this we developed novel equation for cQ [cQ=Q/(VV 1/3 ] and novel confidence-limit flow-volume nomograms. The imaginary 16 th percentile line of Liverpool nomogram, -1 standard-deviation line of Siroky nomogram and lower 68% confidence-limit line of our nomogram had sensitivity of 96.2%, 100% and 89.3%, and specificity of 75.3% 69.3% and 86.0%, respectively for Qmax-VV relations. Corresponding values for average flow rate (Qave-volume relations were 96.2%, 100% and 94.6%, and 75.2%, 50.4% and 86.0%, respectively. The area under curve of the receiver operating characteristics (ROC curve for cQmax and cQave was 0.954 and 0.965, respectively, suggesting significantly higher discriminatory power than chance (P = 0.0001. Conclusion : Flow-volume nomograms developed on Caucasian population may not be optimally applicable to the Indian population. We introduce flow-volume nomograms and cQ, which have high sensitivity and specificity.

Economic impacts from energy efficiency programs - Variations in multiplier effects by program type and region. Volume 1

International Nuclear Information System (INIS)

Gardner, John; Skumatz, Lisa

2007-01-01

Research indicates that the value of omitted program effects - specifically non-energy benefits (NEBs) - represent a significant share of overall program impacts. One of the largest components of societal benefits is the direct and indirect economic and job creation effects stimulated by the investment in conservation on behalf of the program. The literature has indicated that the valuations assigned to this category of these categories can be large, but much of the literature overstates the impact of economic NEBs. We conducted extensive research to develop reliable and defensible estimates of these benefits categories. This study used input-output analysis to update the economic multipliers for NEBs in several ways. Net: Developed 'net' estimates of the multipliers (rather than 'gross' factors)Variations by Region: Estimated multipliers for multiple states and for the entire US; Variations by Program Type: Developed estimates based on different types or categories of programs (e.g weatherization vs. new construction vs. appliance programs, etc.), Variations in Baseline Assumptions: Different assumptions about where the expenditures are transferred 'from' for the net analysis (e.g. from 'generation', from a mixed market basket, etc.); and Variations over Time: Used data from multiple time periods to examine changes in the size of multipliers over time. We examined the results by state, by program type, and over time and found dramatic differences in the economic impacts by program type and territory under consideration. The results provide estimates of the economic impacts derived from the program; however, for communities or utilities with economic development goals, the results can be used to help select between program alternatives. The results are new, and the revised figures have been used to compute more reliable and tailored estimates of economic non-energy benefits that can be applied in regulatory tests

30th International School of Mathematics "G Stampacchia" : Equilibrium Problems and Variational Models "Ettore Majorana"

CERN Document Server

Giannessi, Franco; Maugeri, Antonino; Equilibrium Problems and Variational Models

2000-01-01

The volume, devoted to variational analysis and its applications, collects selected and refereed contributions, which provide an outline of the field. The meeting of the title "Equilibrium Problems and Variational Models", which was held in Erice (Sicily) in the period June 23 - July 2 2000, was the occasion of the presentation of some of these papers; other results are a consequence of a fruitful and constructive atmosphere created during the meeting. New results, which enlarge the field of application of variational analysis, are presented in the book; they deal with the vectorial analysis, time dependent variational analysis, exact penalization, high order deriva­ tives, geometric aspects, distance functions and log-quadratic proximal methodology. The new theoretical results allow one to improve in a remarkable way the study of significant problems arising from the applied sciences, as continuum model of transportation, unilateral problems, multicriteria spatial price models, network equilibrium...

Inter fractional dose variation during intensity-modulated radiation therapy for cervical cancer assessed by weekly CT evaluation

International Nuclear Information System (INIS)

Han, Youngyih; Shin, Eun Hyuk; Huh, Seung Jae; Lee, Jung Eun; Park, Won

2006-01-01

Purpose: To investigate the inter fractional dose variation of a small-bowel displacement system (SBDS)-assisted intensity-modulated radiation therapy (IMRT) for the treatment of cervical cancer. Methods: Four computed tomography (CT) scans were carried out in 10 patients who received radiotherapy for uterine cervical cancer. The initial CT was taken by use of the SBDS, before the beginning of radiotherapy, and 3 additional CT scans with the SBDS were done in subsequent weeks. IMRT was planned by use of the initial CT, and the subsequent images were fused with the initial CT set. Dose-volume histogram (DVH) changes of the targets (planning target volume [PTV] = clinical target volume [CTV] + 1.5 cm) and of the critical organs were evaluated after obtaining the volumes of each organ on 4 CT sets. Results: No significant differences were found in PTV volumes. Changes on the DVH of the CTVs were not significant, whereas DVH changes of the PTVs at 40% to 100% of the prescription dose level were significant (V 90% ; 2nd week: p = 0.0091, 3rd week: p = 0.0029, 4th week: p = 0.0050). The changes in the small-bowel volume included in the treatment field were significant. These were 119.5 cm 3 (range, 26.9-251.0 cm 3 ), 126 cm 3 (range, 38.3-336 cm 3 ), 161.9 cm 3 (range, 37.7-294.6 cm 3 ), and 149.1 cm 3 (range, 38.6-277.8 cm 3 ) at the 1st, 2nd, 3rd, and 4th weeks, respectively, and were significantly correlated with the DVH change in the small bowel, which were significant at the 3rd (V 80% ; p = 0.0230) and 4th (V 80% ; p = 0.0263) weeks. The bladder-volume change correlated to the large volume change (>20%) of the small-bowel volume. Conclusions: Significant DVH differences for the small bowel can result because of interfractional position variations, whereas the DVH differences of the CTV were not significant. Strict bladder-filling control and an accurate margin for the PTV, as well as image-guided position verification, are important to achieve the goal of IMRT

Volume fraction dependence of transient absorption signal and nonlinearities in metal nanocolloids

International Nuclear Information System (INIS)

Jayabalan, J; Singh, Asha; Khan, Salahuddin; Chari, Rama

2013-01-01

Electron–lattice thermalization dynamics in metal nanoparticles or in bulk metal is usually estimated by measuring the decay time of the change in transmission following an optical excitation. Such measurements can be performed in transient absorption geometry using a femtosecond laser. We find that for silver nanoplatelet/water colloids, the decay time of the transient absorption depends on the volume fraction of silver in water. By estimating the volume fraction dependence of nonlinearities in the same samples, we show that the variation in the measured decay time is due to pump-depletion effects present in the sample. The correct correction factor for taking into account pump-depletion effects in fifth- and higher-order nonlinearities is also presented. (paper)

Vasodilation increases pulse pressure variation, mimicking hypovolemic status in rabbits

Directory of Open Access Journals (Sweden)

Glauco A Westphal

2010-01-01

Full Text Available OBJECTIVE: To test the hypothesis that pulse pressure respiratory variation (PPV amplification, observed in hypovolemia, can also be observed during sodium nitroprusside (SNP-induced vasodilation. INTRODUCTION: PPV is largely used for early identification of cardiac responsiveness, especially when hypovolemia is suspected. PPV results from respiratory variation in transpulmonary blood flow and reflects the left ventricular preload variations during respiratory cycles. Any factor that decreases left ventricular preload can be associated with PPV amplification, as seen in hypovolemia. METHODS: Ten anesthetized and mechanically ventilated rabbits underwent progressive hypotension by either controlled hemorrhage (Group 1 or intravenous SNP infusion (Group 2. Animals in Group 1 (n = 5 had graded hemorrhage induced at 10% steps until 50% of the total volume was bled. Mean arterial pressure (MAP steps were registered and assumed as pressure targets to be reached in Group 2. Group 2 (n = 5 was subjected to a progressive SNP infusion to reach similar pressure targets as those defined in Group 1. Heart rate (HR, systolic pressure variation (SPV and PPV were measured at each MAP step, and the values were compared between the groups. RESULTS: SPV and PPV were similar between the experimental models in all steps (p > 0.16. SPV increased earlier in Group 2. CONCLUSION: Both pharmacologic vasodilation and graded hemorrhage induced PPV amplification similar to that observed in hypovolemia, reinforcing the idea that amplified arterial pressure variation does not necessarily represent hypovolemic status but rather potential cardiovascular responsiveness to fluid infusion.

[The assessment of ultrasonic measurement of superior vena cava blood flow for the volume responsiveness of patients with mechanical ventilation].

Science.gov (United States)

Guo, Zhe; He, Wei; Hou, Jing; Li, Tong; Zhou, Hua; Xu, Yuan; Xi, Xiuming

2014-09-01

To approach the evaluative effect of respiratory variation of superior vena cava peak flow velocity measured using transthoracic echocardiography (TTE) on fluid responsiveness in patients with mechanical ventilation. A prospective cohort study was conducted. All mechanical ventilated critically ill patients whose fluid therapy was planned due to hypovolemia in Department of Critical Care Medicine of Beijing Tongren Hospital of Capital Medical University from April 2011 to April 2013 were enrolled. Volume expansion was performed with 500 mL Linger solution within 30 minutes. Patients were classified as responders if pulse pressure variation (PPV) increased ≥ 13% before volume expansion. The respiratory variation in superior vena cava peak velocity was calculated as the difference between maximum and minimum values of velocity in peak A, peak S and peak D over a single respiratory circle, and their variations (ΔA, ΔS, ΔD) were also calculated. The receiver operating characteristic curve (ROC curve) was plotted to assess the evaluative effect of respiratory variation of superior vena cava peak velocity on fluid responsiveness. Twenty-seven patients were enrolled in this study. Volume expansion increased PPV ≥ 13% happened in 14 patients (responders). The velocity of superior vena cava in peak A, peak S, peak D was significantly increased after volume expansion compared with that before volume expansion in responders [peak A (cm/s): 34.6 ± 2.2 vs. 31.3 ± 2.1, t=-2.493, P=0.027; peak S (cm/s): 39.1 ± 1.3 vs. 35.3 ± 2.1, t=-2.564, P=0.024; peak D (cm/s): 28.1 ± 1.2 vs. 23.3 ± 1.4, t=-4.995, P=0.000], but there was no significant difference in ΔA, ΔS and ΔD between before and after volume expansion. The ΔA, ΔS and ΔD were positively correlated with PPV (r=0.040, P=0.854; r=0.350, P=0.074; r=0.749, P=0.000). The area under ROC curve (AUC) of peak S was 0.36 [95% confidence interval (95%CI): 0.11-0.52], but the AUC of ΔS was 0.68 (95%CI 0.47-0.89), the

Early changes of parotid density and volume predict modifications at the end of therapy and intensity of acute xerostomia

International Nuclear Information System (INIS)

Belli, Maria Luisa; Broggi, Sara; Scalco, Elisa; Rizzo, Giovanna; Sanguineti, Giuseppe; Fiorino, Claudio; Cattaneo, Giovanni Mauro; Dinapoli, Nicola; Valentini, Vincenzo; Ricchetti, Francesco

2014-01-01

To quantitatively assess the predictive power of early variations of parotid gland volume and density on final changes at the end of therapy and, possibly, on acute xerostomia during IMRT for head-neck cancer. Data of 92 parotids (46 patients) were available. Kinetics of the changes during treatment were described by the daily rate of density (rΔρ) and volume (rΔvol) variation based on weekly diagnostic kVCT images. Correlation between early and final changes was investigated as well as the correlation with prospective toxicity data (CTCAEv3.0) collected weekly during treatment for 24/46 patients. A higher rΔρ was observed during the first compared to last week of treatment (-0,50 vs -0,05HU, p-value = 0.0001). Based on early variations, a good estimation of the final changes may be obtained (Δρ: AUC = 0.82, p = 0.0001; Δvol: AUC = 0.77, p = 0.0001). Both early rΔρ and rΔvol predict a higher ''mean'' acute xerostomia score (≥ median value, 1.57; p-value = 0.01). Median early density rate changes for patients with mean xerostomia score ≥ / 3 /day for rΔρ and rΔvol respectively. Further studies are necessary to definitively assess the potential of early density/volume changes in identifying more sensitive patients at higher risk of experiencing xerostomia. (orig.) [de

Predicting oropharyngeal tumor volume throughout the course of radiation therapy from pretreatment computed tomography data using general linear models.

Science.gov (United States)

Yock, Adam D; Rao, Arvind; Dong, Lei; Beadle, Beth M; Garden, Adam S; Kudchadker, Rajat J; Court, Laurence E

2014-05-01

The purpose of this work was to develop and evaluate the accuracy of several predictive models of variation in tumor volume throughout the course of radiation therapy. Nineteen patients with oropharyngeal cancers were imaged daily with CT-on-rails for image-guided alignment per an institutional protocol. The daily volumes of 35 tumors in these 19 patients were determined and used to generate (1) a linear model in which tumor volume changed at a constant rate, (2) a general linear model that utilized the power fit relationship between the daily and initial tumor volumes, and (3) a functional general linear model that identified and exploited the primary modes of variation between time series describing the changing tumor volumes. Primary and nodal tumor volumes were examined separately. The accuracy of these models in predicting daily tumor volumes were compared with those of static and linear reference models using leave-one-out cross-validation. In predicting the daily volume of primary tumors, the general linear model and the functional general linear model were more accurate than the static reference model by 9.9% (range: -11.6%-23.8%) and 14.6% (range: -7.3%-27.5%), respectively, and were more accurate than the linear reference model by 14.2% (range: -6.8%-40.3%) and 13.1% (range: -1.5%-52.5%), respectively. In predicting the daily volume of nodal tumors, only the 14.4% (range: -11.1%-20.5%) improvement in accuracy of the functional general linear model compared to the static reference model was statistically significant. A general linear model and a functional general linear model trained on data from a small population of patients can predict the primary tumor volume throughout the course of radiation therapy with greater accuracy than standard reference models. These more accurate models may increase the prognostic value of information about the tumor garnered from pretreatment computed tomography images and facilitate improved treatment management.

Predicting oropharyngeal tumor volume throughout the course of radiation therapy from pretreatment computed tomography data using general linear models

International Nuclear Information System (INIS)

Yock, Adam D.; Kudchadker, Rajat J.; Rao, Arvind; Dong, Lei; Beadle, Beth M.; Garden, Adam S.; Court, Laurence E.

2014-01-01

Purpose: The purpose of this work was to develop and evaluate the accuracy of several predictive models of variation in tumor volume throughout the course of radiation therapy. Methods: Nineteen patients with oropharyngeal cancers were imaged daily with CT-on-rails for image-guided alignment per an institutional protocol. The daily volumes of 35 tumors in these 19 patients were determined and used to generate (1) a linear model in which tumor volume changed at a constant rate, (2) a general linear model that utilized the power fit relationship between the daily and initial tumor volumes, and (3) a functional general linear model that identified and exploited the primary modes of variation between time series describing the changing tumor volumes. Primary and nodal tumor volumes were examined separately. The accuracy of these models in predicting daily tumor volumes were compared with those of static and linear reference models using leave-one-out cross-validation. Results: In predicting the daily volume of primary tumors, the general linear model and the functional general linear model were more accurate than the static reference model by 9.9% (range: −11.6%–23.8%) and 14.6% (range: −7.3%–27.5%), respectively, and were more accurate than the linear reference model by 14.2% (range: −6.8%–40.3%) and 13.1% (range: −1.5%–52.5%), respectively. In predicting the daily volume of nodal tumors, only the 14.4% (range: −11.1%–20.5%) improvement in accuracy of the functional general linear model compared to the static reference model was statistically significant. Conclusions: A general linear model and a functional general linear model trained on data from a small population of patients can predict the primary tumor volume throughout the course of radiation therapy with greater accuracy than standard reference models. These more accurate models may increase the prognostic value of information about the tumor garnered from pretreatment computed tomography

Interobserver variation in measurements of Cesarean scar defect and myometrium with 3D ultrasonography

DEFF Research Database (Denmark)

Madsen, Lene Duch; Glavind, Julie; Uldbjerg, Niels

Objectives: To evaluate the Cesarean scar defect depth and the residual myometrial thickness with 3-dimensional (3D) sonography concerning interobserver variation. Methods: Ten women were randomly selected from a larger cohort of Cesarean scar ultrasound evaluations. All women were examined 6......-16 months after their first Cesarean section with 2D transvaginal sonography and had 3D volumes recorded. Two observers independently evaluated “off-line” each of the 3D volumes stored. Residual myometrial thickness (RMT) and Cesarean scar defect depth (D) was measured in the sagittal plane with an interval...... of Cesarean section scar size and residual myometrium needs further investigation....

Impact of Different CT Slice Thickness on Clinical Target Volume for 3D Conformal Radiation Therapy

International Nuclear Information System (INIS)

Prabhakar, Ramachandran; Ganesh, Tharmar; Rath, Goura K.; Julka, Pramod K.; Sridhar, Pappiah S.; Joshi, Rakesh C.; Thulkar, Sanjay

2009-01-01

The purpose of this study was to present the variation of clinical target volume (CTV) with different computed tomography (CT) slice thicknesses and the impact of CT slice thickness on 3-dimensional (3D) conformal radiotherapy treatment planning. Fifty patients with brain tumors were selected and CT scans with 2.5-, 5-, and 10-mm slice thicknesses were performed with non-ionic contrast enhancement. The patients were selected with tumor volume ranging from 2.54 cc to 222 cc. Three-dimensional treatment planning was performed for all three CT datasets. The target coverage and the isocenter shift between the treatment plans for different slice thickness were correlated with the tumor volume. An important observation from our study revealed that for volume 25 cc, the target underdosage was less than 6.7% for 5-mm slice thickness and 8% for 10-mm slice thickness. For 3D conformal radiotherapy treatment planning (3DCRT), a CT slice thickness of 2.5 mm is optimum for tumor volume 25 cc

When high-volume PCI operators in high-volume hospitals move to lower volume hospitals-Do they still maintain high volume and quality of outcomes?

Science.gov (United States)

Lu, Tsung-Hsueh; Li, Sheng-Tun; Liang, Fu-Wen; Lee, Jo-Chi; Yin, Wei-Hsian

2017-10-31

The aim of this quasi-experimental study was to examine whether high-volume percutaneous coronary intervention (PCI) operators still maintain high volume and quality of outcomes when they moved to lower volume hospitals. Systematic reviews have indicated that high-volume PCI operators and hospitals have higher quality outcomes. However, little is known on whether high PCI volume and high quality outcomes are mainly due to operator characteristics (i.e., skill and experience) and is portable across organizations or whether it is due to hospital characteristics (i.e., equipment, team, and management system) and is less portable. We used Taiwan National Health Insurance claims data 2000-2012 to identify 98 high-volume PCI operators, 10 of whom moved from one hospital to another during the study period. We compared the PCI volume, risk-adjusted mortality ratio, and major adverse cardiovascular event (MACE) ratio before and after moving. Of the 10 high-volume operators who moved, 6 moved from high- to moderate- or low-volume hospitals, with median annual PCI volumes (interquartile range) of 130 (117-165) in prior hospitals and 54 (46-84) in subsequent hospitals (the hospital the operator moved to), and the remaining 4 moved from high to high-volume hospitals, with median annual PCI volumes (interquartile range) of 151 (133-162) in prior hospitals and 193 (178-239) in subsequent hospitals. No significant differences were observed in the risk-adjusted mortality ratios and MACE ratios between high-volume operators and matched controls before and after moving. High-volume operators cannot maintain high volume when they moved from high to moderate or low-volume hospitals; however, the quality of care is maintained. High PCI volume and high-quality outcomes are less portable and more hospital bound. © 2017 Wiley Periodicals, Inc.

Quantifying the performance of in vivo portal dosimetry in detecting four types of treatment parameter variations

International Nuclear Information System (INIS)

Bojechko, C.; Ford, E. C.

2015-01-01

Purpose: To quantify the ability of electronic portal imaging device (EPID) dosimetry used during treatment (in vivo) in detecting variations that can occur in the course of patient treatment. Methods: Images of transmitted radiation from in vivo EPID measurements were converted to a 2D planar dose at isocenter and compared to the treatment planning dose using a prototype software system. Using the treatment planning system (TPS), four different types of variability were modeled: overall dose scaling, shifting the positions of the multileaf collimator (MLC) leaves, shifting of the patient position, and changes in the patient body contour. The gamma pass rate was calculated for the modified and unmodified plans and used to construct a receiver operator characteristic (ROC) curve to assess the detectability of the different parameter variations. The detectability is given by the area under the ROC curve (AUC). The TPS was also used to calculate the impact of the variations on the target dose–volume histogram. Results: Nine intensity modulation radiation therapy plans were measured for four different anatomical sites consisting of 70 separate fields. Results show that in vivo EPID dosimetry was most sensitive to variations in the machine output, AUC = 0.70 − 0.94, changes in patient body habitus, AUC = 0.67 − 0.88, and systematic shifts in the MLC bank positions, AUC = 0.59 − 0.82. These deviations are expected to have a relatively small clinical impact [planning target volume (PTV) D 99 change <7%]. Larger variations have even higher detectability. Displacements in the patient’s position and random variations in MLC leaf positions were not readily detectable, AUC < 0.64. The D 99 of the PTV changed by up to 57% for the patient position shifts considered here. Conclusions: In vivo EPID dosimetry is able to detect relatively small variations in overall dose, systematic shifts of the MLC’s, and changes in the patient habitus. Shifts in the patient�

Quantifying the performance of in vivo portal dosimetry in detecting four types of treatment parameter variations

Energy Technology Data Exchange (ETDEWEB)

Bojechko, C.; Ford, E. C., E-mail: eford@uw.edu [Department of Radiation Oncology, University of Washington, 1959 NE Pacific Street, Seattle, Washington 98195 (United States)

2015-12-15

Purpose: To quantify the ability of electronic portal imaging device (EPID) dosimetry used during treatment (in vivo) in detecting variations that can occur in the course of patient treatment. Methods: Images of transmitted radiation from in vivo EPID measurements were converted to a 2D planar dose at isocenter and compared to the treatment planning dose using a prototype software system. Using the treatment planning system (TPS), four different types of variability were modeled: overall dose scaling, shifting the positions of the multileaf collimator (MLC) leaves, shifting of the patient position, and changes in the patient body contour. The gamma pass rate was calculated for the modified and unmodified plans and used to construct a receiver operator characteristic (ROC) curve to assess the detectability of the different parameter variations. The detectability is given by the area under the ROC curve (AUC). The TPS was also used to calculate the impact of the variations on the target dose–volume histogram. Results: Nine intensity modulation radiation therapy plans were measured for four different anatomical sites consisting of 70 separate fields. Results show that in vivo EPID dosimetry was most sensitive to variations in the machine output, AUC = 0.70 − 0.94, changes in patient body habitus, AUC = 0.67 − 0.88, and systematic shifts in the MLC bank positions, AUC = 0.59 − 0.82. These deviations are expected to have a relatively small clinical impact [planning target volume (PTV) D{sub 99} change <7%]. Larger variations have even higher detectability. Displacements in the patient’s position and random variations in MLC leaf positions were not readily detectable, AUC < 0.64. The D{sub 99} of the PTV changed by up to 57% for the patient position shifts considered here. Conclusions: In vivo EPID dosimetry is able to detect relatively small variations in overall dose, systematic shifts of the MLC’s, and changes in the patient habitus. Shifts in the

Acute effects of volume-oriented incentive spirometry on chest wall volumes in patients after a stroke.

Science.gov (United States)

Lima, Illia Ndf; Fregonezi, Guilherme Af; Melo, Rodrigo; Cabral, Elis Ea; Aliverti, Andrea; Campos, Tânia F; Ferreira, Gardênia Mh

2014-07-01

The aim of the present study was to assess how volume-oriented incentive spirometry applied to patients after a stroke modifies the total and compartmental chest wall volume variations, including both the right and left hemithoraces, compared with controls. Twenty poststroke patients and 20 age-matched healthy subjects were studied by optoelectronic plethysmography during spontaneous quiet breathing (QB), during incentive spirometry, and during the recovery period after incentive spirometry. Incentive spirometry was associated with an increased chest wall volume measured at the pulmonary rib cage, abdominal rib cage and abdominal compartment (P = .001) and under 3 conditions (P spirometry, and postincentive spirometry, respectively. Under all 3 conditions, the contribution of the abdominal compartment to VT was greater in the stroke subjects (54.1, 43.2, and 48.9%) than in the control subjects (43.7, 40.8, and 46.1%, P = .039). In the vast majority of subjects (13/20 and 18/20 during QB and incentive spirometry, respectively), abdominal expansion precedes rib cage expansion during inspiration. Greater asymmetry between the right and left hemithoracic expansions occurred in stroke subjects compared with control subjects, but it decreased during QB (62.5%, P = .002), during incentive spirometry (19.7%), and postincentive spirometry (67.6%, P = .14). Incentive spirometry promotes increased expansion in all compartments of the chest wall and reduces asymmetric expansion between the right and left parts of the pulmonary rib cage; therefore, it should be considered as a tool for rehabilitation. Copyright © 2014 by Daedalus Enterprises.

Investigation of microbial adaptation to salinity variation for treatment of reverse osmosis concentrate by membrane bioreactor

DEFF Research Database (Denmark)

Jang, Duksoo; Moon, Chungman; Ahn, Kyuhong

2014-01-01

quantitative study on a microbial adaptation strategy for variations on salt concentration (0–20 g/L), lab-scale membrane bioreactors (7L working volume) with polypropylene hollow fiber membrane module (pore size 0.4 μm) were used with different adaptation strategies: instant and stepwise mode. The performance...

Transient regimes during high-temperature deformation of a bulk metallic glass: A free volume approach

International Nuclear Information System (INIS)

Bletry, M.; Guyot, P.; Brechet, Y.; Blandin, J.J.; Soubeyroux, J.L.

2007-01-01

The homogeneous deformation of a zirconium-based bulk metallic glass is investigated in the glass transition range. Compression and stress-relaxation tests have been conducted. The stress-strain curves are modeled in the framework of the free volume theory, including transient phenomena (overshoot and undershoot). This approach allows several physical parameters (activation volume, flow defect creation and relaxation coefficient) to be determined from a mechanical experiment. This model is able to rationalize the dependency of stress overshoot on relaxation time. It is shown that, due to the relationship between flow defect concentration and free volume model, it is impossible to determine the equilibrium flow defect concentration. However, the relative variation of flow defect is always the same, and all the model parameters depend on the equilibrium flow defect concentration. The methodology presented in this paper should, in the future, allow the consistency of the free volume model to be assessed

Speed, speed variation and crash relationships for urban arterials.

Science.gov (United States)

Wang, Xuesong; Zhou, Qingya; Quddus, Mohammed; Fan, Tianxiang; Fang, Shou'en

2018-04-01

Speed and speed variation are closely associated with traffic safety. There is, however, a dearth of research on this subject for the case of urban arterials in general, and in the context of developing nations. In downtown Shanghai, the traffic conditions in each direction are very different by time of day, and speed characteristics during peak hours are also greatly different from those during off-peak hours. Considering that traffic demand changes with time and in different directions, arterials in this study were divided into one-way segments by the direction of flow, and time of day was differentiated and controlled for. In terms of data collection, traditional fixed-based methods have been widely used in previous studies, but they fail to capture the spatio-temporal distributions of speed along a road. A new approach is introduced to estimate speed variation by integrating spatio-temporal speed fluctuation of a single vehicle with speed differences between vehicles using taxi-based high frequency GPS data. With this approach, this paper aims to comprehensively establish a relationship between mean speed, speed variation and traffic crashes for the purpose of formulating effective speed management measures, specifically using an urban dataset. From a total of 234 one-way road segments from eight arterials in Shanghai, mean speed, speed variation, geometric design features, traffic volume, and crash data were collected. Because the safety effects of mean speed and speed variation may vary at different segment lengths, arterials with similar signal spacing density were grouped together. To account for potential correlations among these segments, a hierarchical Poisson log-normal model with random effects was developed. Results show that a 1% increase in mean speed on urban arterials was associated with a 0.7% increase in total crashes, and larger speed variation was also associated with increased crash frequency. Copyright © 2018 Elsevier Ltd. All rights

LLE Review Quarterly Report (April-June 2001). Volume 87

Energy Technology Data Exchange (ETDEWEB)

Hinterman, Thomas H. [Univ. of Rochester, NY (United States). Lab. for Laser Energetics

2001-06-01

This volume of the LLE Review, covering April–June 2001, features ''A Self-Calibrating, Multichannel Streak Camera for Inertial Confinement Fusion Applications'' by Dr. W. R. Donaldson, R. Boni, R. L. Keck, and P. A. Jaanimagi. This article (p. 109) describes the 60-beam streak camera system used on OMEGA and focuses on the hardware and software calibration techniques that maximize its utility. The system can diagnose each of the beams on every target shot and can measure beam energies with 8% accuracy and timing at 7 ps rms. Beam-to-beam power variations of less than 5% can be detected. Other articles in this volume are: Evolution of Shell Nonuniformities Near Peak Compression of a Spherical Implosion; Multibeam Stimulated Brillouin Scattering from Hot Solid-Target Plasmas; Hot-Electron Effect in Superconductors and Is Applications for Radiation Sensors; and, Scaling Law for Marginal Ignition.

Role of cerebral blood volume changes in brain specific-gravity measurements

International Nuclear Information System (INIS)

Picozzi, P.; Todd, N.V.; Crockard, A.H.

1985-01-01

Cerebral blood volume (CBV) was calculated in gerbils from specific-gravity (SG) changes between normal and saline-perfused brains. Furthermore, changes in CBV were investigated during ischemia using carbon-14-labeled dextran (MW 70,000) as an intravascular marker. Both data were used to evaluate the possible error due to a change in CBV on the measurement of ischemic brain edema by the SG method. The methodological error found was 0.0004 for a 100% CBV change. This error is insignificant, being less than the standard deviation in the SG measured for the gerbil cortex. Thus, CBV changes are not responsible for the SG variations observed during the first phase of ischemia. These variations are better explained as an increase of brain water content during ischemia

Changes in synovial membrane and joint effusion volumes after intraarticular methylprednisolone. Quantitative assessment of inflammatory and destructive changes in arthritis by MRI

DEFF Research Database (Denmark)

Østergaard, Mikkel; Stoltenberg, M; Gideon, P

1996-01-01

OBJECTIVE: To evaluate synovial membrane volumes, effusion volumes, and cartilage and bone erosion scores determined by magnetic resonance imaging (MRI) as markers of disease activity and severity in arthritis. METHODS: Gadolinium-DTPA enhanced MRI of 18 arthritic knees was performed before and 1......, 7, 30 and 180 days after intraarticular methylprednisolone injection until clinical relapse. Intraobserver, interobserver, and inter-MRI variations were determined from 2 successive MRI of another 6 knees. RESULTS: In all knees synovial membrane and effusion volumes decreased within the first...... posttreatment week (median decrease 49 and 65%, respectively), and remained low during remission. Synovial volumes, but not effusion volumes, increased to pretreatment levels in case of clinical relapse, indicating that synovial volumes were most important to the clinical appearance. The intraobserver...

National Trends and Geographic Variation in Bilateral Internal Mammary Artery Use in the United States.

Science.gov (United States)

Iribarne, Alexander; Goodney, Philip P; Flores, Alyssa M; DeSimone, Joseph; DiScipio, Anthony W; Austin, Andrea; McCullough, Jock N

2017-12-01

The goal of this study was to characterize the adoption rate and regional variation in bilateral internal mammary artery (BIMA) use during coronary artery bypass grafting (CABG) in the United States. Observational study of 100% sample of fee-for-service Medicare beneficiaries aged 65 years or older, continuously enrolled in Parts A and B from 2009 to 2014 (n = 162,860,439). Rates of beneficiaries receiving a BIMA versus single internal mammary artery (SIMA) during CABG are expressed per 1,000 beneficiaries and aggregated by Hospital Referral Region (HRR). An HRR is a validated unit for quantifying regional variation in health care. The absolute national rate of BIMA use declined during the study period from 0.21 claims per 1,000 beneficiaries in 2009 to 0.13 in 2014 (p < 0.001). When indexed to overall CABG volume, no change was seen in the frequency of BIMA use over time (p = 0.883). SIMA use ranged from 1.3 to 8.5 claims per 1,000 Medicare beneficiaries, whereas BIMA use ranged from 0 to 1.5 (p < 0.001). A significant correlation was found between regional volume of SIMA use and likelihood of BIMA use (correlation coefficient 0.673, p < 0.001). Although both SIMA and BIMA use correlated with regional volume of diagnostic cardiac catheterization, the correlation was stronger for SIMA use (correlation coefficient 0.962 versus 0.682, p < 0.001). Over the past 5 years, no growth was seen in BIMA use among Medicare beneficiaries, and the frequency of BIMA use during CABG remained low. There was significant regional variation in BIMA use, however, which demonstrates opportunity for continued growth of BIMA grafting. Copyright © 2017 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

Effect of Fiber Volume Fraction and Water Absorption toward Bending Strength of Coconut Filters/ Polyester Composite

Directory of Open Access Journals (Sweden)

I Putu Lokantara

2012-11-01

Full Text Available The variation of fibre volume and the duration of water soaking take influence on the mechanical properties of composite. This research aim is to know the influence of fraction volume fibre and soaking duration on the mineral watertoward the tensile strength and flexural of polyester-coconut-tapis composite. This research used coconut-tapis fibre which is cut 1 cm in length with 0%, 5%, 7,5%, and 10% fiber volume fraction, unsaturated-polyester (UPRs matrix resin type Yucalac 157 BQTN-EX, and MEKPO hardener. The flexure specimen are made by press hand lay-up method and cut according ASTM D790-03 for the flexure test. The result of flexure test shows that the duration of soaking and the fiber volume fraction give a significant effect on the flexural strength of composite. The highest strength are reached by composite with 10% fibre volume on 48 hour soaking time equal to 41.994 MPa. The flexure modulus happenend shows increasing until 24 hour soaking time. The highest modulus are reached by composite with 10% fibre volume equal to 7.114 GPa while the lowest are reached by composite with 0% fibre volume equal to 3,023 GPa.

Diurnal and seasonal variations of NO, NO2 and PM2.5 mass as a function of traffic volumes alongside an urban arterial

Science.gov (United States)

Kendrick, Christine M.; Koonce, Peter; George, Linda A.

2015-12-01

Urban arterial corridors are landscapes that give rise to short and long-term exposures to transportation-related pollution. With high traffic volumes and a wide mix of road users, urban arterial environments are important targets for improved exposure assessment to traffic-related pollution. A common method to estimate exposure is to use traffic volumes as a proxy. The study presented here analyzes a unique yearlong dataset of simultaneous roadside air quality and traffic observations for a U.S. arterial to assess the reliability of using traffic volumes as a proxy for traffic-related exposure. Results show how the relationships of traffic volumes with NO and NO2 vary not only by time of day and season but also by time aggregation. At short-term aggregations (15 min) nitrogen oxides were found to have a significant linear relationship with traffic volumes during morning hours for all seasons although variability was still high (r2 = 0.1-0.45 NO, r2 = 0.14-0.27 NO2), and little to no relationship during evening periods (r2 road users, these results show when traffic volumes alone can be a reliable proxy for exposure and when this approach is not warranted.

RELAP-7 Software Verification and Validation Plan: Requirements Traceability Matrix (RTM) Part 1 – Physics and numerical methods

Energy Technology Data Exchange (ETDEWEB)

Choi, Yong Joon [Idaho National Lab. (INL), Idaho Falls, ID (United States); Yoo, Jun Soo [Idaho National Lab. (INL), Idaho Falls, ID (United States); Smith, Curtis Lee [Idaho National Lab. (INL), Idaho Falls, ID (United States)

2015-09-01

This INL plan comprehensively describes the Requirements Traceability Matrix (RTM) on main physics and numerical method of the RELAP-7. The plan also describes the testing-based software verification and validation (SV&V) process—a set of specially designed software models used to test RELAP-7.

Physical Therapy in Multiple Sclerosis Differs Across Europe: Information Regarding an Ongoing Study

Czech Academy of Sciences Publication Activity Database

Řasová, K.; Martinková, Patrícia; Cattaneo, D.; Jonsdottir, J.; Henze, T.; Baert, I.; Van Asch, P.; Santoyo, C.; Smedal, T.; Malgorzata, S.; Freeman, J.; Romberg, A.; Feys, P.

2014-01-01

Roč. 42, č. 5 (2014), s. 1185-1187 ISSN 0300-0605 Grant - others:UK(CZ) 260045/SVV/2014; Univerzita Karlova(CZ) Prvouk P34 Institutional support: RVO:67985807 Keywords : people * rehabilitation * services * care Subject RIV: FP - Other Medical Disciplines Impact factor: 1.438, year: 2014

Scheduling of multi-class multi-server queueing systems with abandonments

Czech Academy of Sciences Publication Activity Database

Ayesta, U.; Jacko, P.; Novák, Vladimír

2017-01-01

Roč. 20, č. 2 (2017), s. 129-145 ISSN 1094-6136 R&D Projects: GA MŠk(CZ) SVV260475 Institutional support: Progres-Q24 Keywords : stochastic scheduling * abandonment * restless bandits Subject RIV: AH - Economics OBOR OECD: Economic Theory Impact factor: 1.281, year: 2016

Big Data Analysis of Human Genome Variations

KAUST Repository

Gojobori, Takashi

2016-01-25

Since the human genome draft sequence was in public for the first time in 2000, genomic analyses have been intensively extended to the population level. The following three international projects are good examples for large-scale studies of human genome variations: 1) HapMap Data (1,417 individuals) (http://hapmap.ncbi.nlm.nih.gov/downloads/genotypes/2010-08_phaseII+III/forward/), 2) HGDP (Human Genome Diversity Project) Data (940 individuals) (http://www.hagsc.org/hgdp/files.html), 3) 1000 genomes Data (2,504 individuals) http://ftp.1000genomes.ebi.ac.uk/vol1/ftp/release/20130502/ If we can integrate all three data into a single volume of data, we should be able to conduct a more detailed analysis of human genome variations for a total number of 4,861 individuals (= 1,417+940+2,504 individuals). In fact, we successfully integrated these three data sets by use of information on the reference human genome sequence, and we conducted the big data analysis. In particular, we constructed a phylogenetic tree of about 5,000 human individuals at the genome level. As a result, we were able to identify clusters of ethnic groups, with detectable admixture, that were not possible by an analysis of each of the three data sets. Here, we report the outcome of this kind of big data analyses and discuss evolutionary significance of human genomic variations. Note that the present study was conducted in collaboration with Katsuhiko Mineta and Kosuke Goto at KAUST.

Evaluation of the Free Volume Theory to Predict Moisture Transport and Quality Changes During Broccoli Drying

NARCIS (Netherlands)

Jin, X.; Sman, van der R.G.M.; Boxtel, van A.J.B.

2011-01-01

Moisture diffusion in porous broccoli florets and stalks is modeled using the free volume and Maxwell-Eucken theories. These theories are based on the mobility of water and concern the variation of the effective diffusion coefficient for a wide range of temperature and moisture content during

Mineral density volume gradients in normal and diseased human tissues.

Directory of Open Access Journals (Sweden)

Sabra I Djomehri

Full Text Available Clinical computed tomography provides a single mineral density (MD value for heterogeneous calcified tissues containing early and late stage pathologic formations. The novel aspect of this study is that, it extends current quantitative methods of mapping mineral density gradients to three dimensions, discretizes early and late mineralized stages, identifies elemental distribution in discretized volumes, and correlates measured MD with respective calcium (Ca to phosphorus (P and Ca to zinc (Zn elemental ratios. To accomplish this, MD variations identified using polychromatic radiation from a high resolution micro-computed tomography (micro-CT benchtop unit were correlated with elemental mapping obtained from a microprobe X-ray fluorescence (XRF using synchrotron monochromatic radiation. Digital segmentation of tomograms from normal and diseased tissues (N=5 per group; 40-60 year old males contained significant mineral density variations (enamel: 2820-3095 mg/cc, bone: 570-1415 mg/cc, cementum: 1240-1340 mg/cc, dentin: 1480-1590 mg/cc, cementum affected by periodontitis: 1100-1220 mg/cc, hypomineralized carious dentin: 345-1450 mg/cc, hypermineralized carious dentin: 1815-2740 mg/cc, and dental calculus: 1290-1770 mg/cc. A plausible linear correlation between segmented MD volumes and elemental ratios within these volumes was established, and Ca/P ratios for dentin (1.49, hypomineralized dentin (0.32-0.46, cementum (1.51, and bone (1.68 were observed. Furthermore, varying Ca/Zn ratios were distinguished in adapted compared to normal tissues, such as in bone (855-2765 and in cementum (595-990, highlighting Zn as an influential element in prompting observed adaptive properties. Hence, results provide insights on mineral density gradients with elemental concentrations and elemental footprints that in turn could aid in elucidating mechanistic processes for pathologic formations.

Mineral Density Volume Gradients in Normal and Diseased Human Tissues

Science.gov (United States)

Djomehri, Sabra I.; Candell, Susan; Case, Thomas; Browning, Alyssa; Marshall, Grayson W.; Yun, Wenbing; Lau, S. H.; Webb, Samuel; Ho, Sunita P.

2015-01-01

Clinical computed tomography provides a single mineral density (MD) value for heterogeneous calcified tissues containing early and late stage pathologic formations. The novel aspect of this study is that, it extends current quantitative methods of mapping mineral density gradients to three dimensions, discretizes early and late mineralized stages, identifies elemental distribution in discretized volumes, and correlates measured MD with respective calcium (Ca) to phosphorus (P) and Ca to zinc (Zn) elemental ratios. To accomplish this, MD variations identified using polychromatic radiation from a high resolution micro-computed tomography (micro-CT) benchtop unit were correlated with elemental mapping obtained from a microprobe X-ray fluorescence (XRF) using synchrotron monochromatic radiation. Digital segmentation of tomograms from normal and diseased tissues (N=5 per group; 40-60 year old males) contained significant mineral density variations (enamel: 2820-3095mg/cc, bone: 570-1415mg/cc, cementum: 1240-1340mg/cc, dentin: 1480-1590mg/cc, cementum affected by periodontitis: 1100-1220mg/cc, hypomineralized carious dentin: 345-1450mg/cc, hypermineralized carious dentin: 1815-2740mg/cc, and dental calculus: 1290-1770mg/cc). A plausible linear correlation between segmented MD volumes and elemental ratios within these volumes was established, and Ca/P ratios for dentin (1.49), hypomineralized dentin (0.32-0.46), cementum (1.51), and bone (1.68) were observed. Furthermore, varying Ca/Zn ratios were distinguished in adapted compared to normal tissues, such as in bone (855-2765) and in cementum (595-990), highlighting Zn as an influential element in prompting observed adaptive properties. Hence, results provide insights on mineral density gradients with elemental concentrations and elemental footprints that in turn could aid in elucidating mechanistic processes for pathologic formations. PMID:25856386

Correlation between free-volume parameters and physical properties of polyethylene-nitrile rubber blend

Science.gov (United States)

Gomaa, E.; Mostafa, N.; Mohsen, M.; Mohammed, M.

2004-10-01

Positron annihilation lifetime spectroscopy (PALS) was used to study the immiscibility of a polar nitrile rubber (NBR) that had been blended with pure and waste, low- and high-density polyethylene (PE). The effect of the weight percent of the rubber added to the PE was also investigated. It was found that a complicated variation (positive and negative) in both free-volume parameters (τ3 and I 3) from the values of the initial polymers forms an immiscible blend. These results are supported by a significant broadening in the free-volume hole size distributions. This has been interpreted in terms of interfacial spaces created between the boundaries of the two phases. Furthermore, a correlation was established between the free-volume parameters (τ3 and I 3) and the electrical and mechanical properties of the before mentioned polymer blends as a function of the weight percent of waste PE.

Quantitative assessment of inter-clinician variability of target volume delineation for medulloblastoma: quality assurance for the SIOP PNET 4 trial protocol

International Nuclear Information System (INIS)

Coles, Charlotte E.; Hoole, Andrew C.F.; Harden, Susan V; Burnet, Neil G.; Twyman, Nicola; Taylor, Roger E.; Kortmann, Rolf D.; Williams, Michael V.

2003-01-01

Background and purpose: To assess inter-clinician variability amongst specialist paediatric radiation oncologists in delineating clinical target volumes for treating medulloblastoma as a quality assurance exercise prior to the introduction of the SIOP PNET 4 trial protocol of conformal radiotherapy to the posterior fossa and tumour bed. Patients and methods: Participants from 17 UK centres attended an educational meeting and then completed a clinical planning exercise to outline: (1) the whole posterior fossa and (2) the tumour bed. Quantitative analysis of the volumes, lengths, spatial positioning and axial planes for each individual was carried out and variation between individuals analysed. Results: Outlining of the posterior fossa was reasonably consistent, although most variation was seen in defining the superior border of the tentorium. A major difference was the decision whether or not to include the post-surgical meningocoele in the clinical target volume (CTV). The CTV for the tumour bed was under treated by all participants due to lack of inclusion of pre-operative tumour extent. Conclusions: This exercise demonstrated several ambiguities in the draft protocol and highlighted particular areas of inter-clinician variation. Consequently the protocol was revised and improved to take account of these findings. We recommend that planning exercises, in conjunction with education and training, should be implemented before the start of any new radiotherapy trial. In the future, the use of image transfer will allow prospective peer review of target volumes before treatment commences. These measures are essential to ensure that alterations in clinical practice are achieved in a uniform way

Does the oscillation of the water volume of the reservoir influence in the same way in fish diet?

Directory of Open Access Journals (Sweden)

Jean Carlos Dantas de Oliveira

2018-04-01

Full Text Available Abstract Aim: To evaluate the fish feeding and to establish the preferential and secondary items of their diets, to determine the trophic guilds and the possible trophic structure variations in function of the water volume in Umari reservoir, Rio Grande do Norte, Brazilian semiarid. Methods The fish were captured quarterly between February and November of 2013, with gill nets with different meshes, being the apparatuses exposed at 5:00 p.m., with removal at 5:00 a.m. The food items were identified using stereoscopic and optical microscopes and evaluated through the Feeding Index (IAi, being the results of this procedure used in food similarity analysis. The volume of the items was orderly in NMDS and the time differences were tested in PERMANOVA. Results A total of 740 individuals belonging to 14 species were sampled, being analyzed a total of 258 stomachs and 8 intestines of 11 species. From the IAi values used in the trophic similarity analysis, the species were classified into five trophic guilds: detritivorous, insectivorous, malacophagous, carcinophagous and piscivorous. Conclusion The oscillation in the water volume of the reservoir did not influence the diet of the guild detritivorous, which shows that the variations in the volume of water of the reservoir do not influence in the same way the diet of the local ichthyofauna.

Variational methods for crystalline microstructure analysis and computation

CERN Document Server

Dolzmann, Georg

2003-01-01

Phase transformations in solids typically lead to surprising mechanical behaviour with far reaching technological applications. The mathematical modeling of these transformations in the late 80s initiated a new field of research in applied mathematics, often referred to as mathematical materials science, with deep connections to the calculus of variations and the theory of partial differential equations. This volume gives a brief introduction to the essential physical background, in particular for shape memory alloys and a special class of polymers (nematic elastomers). Then the underlying mathematical concepts are presented with a strong emphasis on the importance of quasiconvex hulls of sets for experiments, analytical approaches, and numerical simulations.

Trends in Arctic Sea Ice Volume 2010-2013 from CryoSat-2

Science.gov (United States)

Tilling, R.; Ridout, A.; Wingham, D.; Shepherd, A.; Haas, C.; Farrell, S. L.; Schweiger, A. J.; Zhang, J.; Giles, K.; Laxon, S.

2013-12-01

Satellite records show a decline in Arctic sea ice extent over the past three decades with a record minimum in September 2012, and results from the Pan-Arctic Ice-Ocean Modelling and Assimilation System (PIOMAS) suggest that this has been accompanied by a reduction in volume. We use three years of measurements recorded by the European Space Agency CryoSat-2 (CS-2) mission, validated with in situ data, to generate estimates of seasonal variations and inter-annual trends in Arctic sea ice volume between 2010 and 2013. The CS-2 estimates of sea ice thickness agree with in situ estimates derived from upward looking sonar measurements of ice draught and airborne measurements of ice thickness and freeboard to within 0.1 metres. Prior to the record minimum in summer 2012, autumn and winter Arctic sea ice volume had fallen by ~1300 km3 relative to the previous year. Using the full 3-year period of CS-2 observations, we estimate that winter Arctic sea ice volume has decreased by ~700 km3/yr since 2010, approximately twice the average rate since 1980 as predicted by the PIOMAS.

Alternative free volume models and positron cages for the characterisation of nanoporosity in materials

International Nuclear Information System (INIS)

Felix, M.V.; Morones, R.; Castano, V.M.

2004-01-01

Three semi-empirical positron stationary Quantum Models were developed for the study of nanoporosity in a wide range of solid porous materials. The cubic, conic and cylindrical well potentials were considered and their geometric parameters related to the Positron Annihilation LifeTime (PALT) measurements. If a conic or a cubic symmetry is assumed, a resonance lifetime phenomenon was found, which enables proposal of a technique to catch positrons in free volume sites. In the cylindrical case, an alternative method to determine free volume sizes in materials was developed. The free volume equations of these new models were then compared to the well-known and widely utilised Spherical Free Volume Model (SFVM) and remarkable differences were found. A strong variation of the free volume size-positron lifetime relation with the geometry involved was observed and a remarkable dependence of the electron layer thickness parameter ΔR with the hole-shape under study and with the nature of the material considered. The mathematical functions appearing in the conic and cylindrical cases are the superposition of Bessel functions of the first kind and trigonometric functions in the cubic case. Generalised free volume diagrams were constructed and a brief geometrical scheme of the diverse cases considered was obtained. (author)

Robust isotropic super-resolution by maximizing a Laplace posterior for MRI volumes

Science.gov (United States)

Han, Xian-Hua; Iwamoto, Yutaro; Shiino, Akihiko; Chen, Yen-Wei

2014-03-01

Magnetic resonance imaging can only acquire volume data with finite resolution due to various factors. In particular, the resolution in one direction (such as the slice direction) is much lower than others (such as the in-plane direction), yielding un-realistic visualizations. This study explores to reconstruct MRI isotropic resolution volumes from three orthogonal scans. This proposed super- resolution reconstruction is formulated as a maximum a posterior (MAP) problem, which relies on the generation model of the acquired scans from the unknown high-resolution volumes. Generally, the deviation ensemble of the reconstructed high-resolution (HR) volume from the available LR ones in the MAP is represented as a Gaussian distribution, which usually results in some noise and artifacts in the reconstructed HR volume. Therefore, this paper investigates a robust super-resolution by formulating the deviation set as a Laplace distribution, which assumes sparsity in the deviation ensemble based on the possible insight of the appeared large values only around some unexpected regions. In addition, in order to achieve reliable HR MRI volume, we integrates the priors such as bilateral total variation (BTV) and non-local mean (NLM) into the proposed MAP framework for suppressing artifacts and enriching visual detail. We validate the proposed robust SR strategy using MRI mouse data with high-definition resolution in two direction and low-resolution in one direction, which are imaged in three orthogonal scans: axial, coronal and sagittal planes. Experiments verifies that the proposed strategy can achieve much better HR MRI volumes than the conventional MAP method even with very high-magnification factor: 10.

Derivation of a volume-averaged neutron diffusion equation; Atomos para el desarrollo de Mexico

Energy Technology Data Exchange (ETDEWEB)

Vazquez R, R.; Espinosa P, G. [UAM-Iztapalapa, Av. San Rafael Atlixco 186, Col. Vicentina, Mexico D.F. 09340 (Mexico); Morales S, Jaime B. [UNAM, Laboratorio de Analisis en Ingenieria de Reactores Nucleares, Paseo Cuauhnahuac 8532, Jiutepec, Morelos 62550 (Mexico)]. e-mail: rvr@xanum.uam.mx

2008-07-01

This paper presents a general theoretical analysis of the problem of neutron motion in a nuclear reactor, where large variations on neutron cross sections normally preclude the use of the classical neutron diffusion equation. A volume-averaged neutron diffusion equation is derived which includes correction terms to diffusion and nuclear reaction effects. A method is presented to determine closure-relationships for the volume-averaged neutron diffusion equation (e.g., effective neutron diffusivity). In order to describe the distribution of neutrons in a highly heterogeneous configuration, it was necessary to extend the classical neutron diffusion equation. Thus, the volume averaged diffusion equation include two corrections factor: the first correction is related with the absorption process of the neutron and the second correction is a contribution to the neutron diffusion, both parameters are related to neutron effects on the interface of a heterogeneous configuration. (Author)

Altitude Acclimatization and Blood Volume: Effects of Exogenous Erythrocyte Volume Expansion

National Research Council Canada - National Science Library

Sawka, M

1996-01-01

...: (a) altitude acclimatization effects on erythrocyte volume and plasma volume; (b) if exogenous erythrocyte volume expansion alters subsequent erythrocyte volume and plasma volume adaptations; (c...

Knowledge-based reconstruction for measurement of right ventricular volumes on cardiovascular magnetic resonance images in a mixed population.

Science.gov (United States)

Pieterman, Elise D; Budde, Ricardo P J; Robbers-Visser, Daniëlle; van Domburg, Ron T; Helbing, Willem A

2017-09-01

Follow-up of right ventricular performance is important for patients with congenital heart disease. Cardiac magnetic resonance imaging is optimal for this purpose. However, observer-dependency of manual analysis of right ventricular volumes limit its use. Knowledge-based reconstruction is a new semiautomatic analysis tool that uses a database including knowledge of right ventricular shape in various congenital heart diseases. We evaluated whether knowledge-based reconstruction is a good alternative for conventional analysis. To assess the inter- and intra-observer variability and agreement of knowledge-based versus conventional analysis of magnetic resonance right ventricular volumes, analysis was done by two observers in a mixed group of 22 patients with congenital heart disease affecting right ventricular loading conditions (dextro-transposition of the great arteries and right ventricle to pulmonary artery conduit) and a group of 17 healthy children. We used Bland-Altman analysis and coefficient of variation. Comparison between the conventional method and the knowledge-based method showed a systematically higher volume for the latter group. We found an overestimation for end-diastolic volume (bias -40 ± 24 mL, r = .956), end-systolic volume (bias -34 ± 24 mL, r = .943), stroke volume (bias -6 ± 17 mL, r = .735) and an underestimation of ejection fraction (bias 7 ± 7%, r = .671) by knowledge-based reconstruction. The intra-observer variability of knowledge-based reconstruction varied with a coefficient of variation of 9% for end-diastolic volume and 22% for stroke volume. The same trend was noted for inter-observer variability. A systematic difference (overestimation) was noted for right ventricular size as assessed with knowledge-based reconstruction compared with conventional methods for analysis. Observer variability for the new method was comparable to what has been reported for the right ventricle in children and congenital

Elastic modulus of Al-Si/SiC metal matrix composites as a function of volume fraction

Energy Technology Data Exchange (ETDEWEB)

Santhosh Kumar, S; Rajasekharan, T [Powder Metallurgy Group, Defence Metallurgical Research Laboratory, Kanchanbagh PO, Hyderabad-500 058 (India); Seshu Bai, V [School of Physics, University of Hyderabad, Central University PO, Hyderabad-500 046 (India); Rajkumar, K V; Sharma, G K; Jayakumar, T, E-mail: dearsanthosh@gmail.co [Non-Destructive Evaluation Division, Indira Gandhi Center for Atomic Research, Kalpakkam, Chennai-603 102 (India)

2009-09-07

Aluminum alloy matrix composites have emerged as candidate materials for electronic packaging applications in the field of aerospace semiconductor electronics. Composites prepared by the pressureless infiltration technique with high volume fractions in the range 0.41-0.70 were studied using ultrasonic velocity measurements. For different volume fractions of SiC, the longitudinal velocity and shear velocity were found to be in the range of 7600-9300 m s{sup -1} and 4400-5500 m s{sup -1}, respectively. The elastic moduli of the composites were determined from ultrasonic velocities and were analysed as a function of the volume fraction of the reinforcement. The observed variation is discussed in the context of existing theoretical models for the effective elastic moduli of two-phase systems.

Combining high-resolution satellite images and altimetry to estimate the volume of small lakes

Science.gov (United States)

Baup, F.; Frappart, F.; Maubant, J.

2014-05-01

This study presents an approach to determining the volume of water in small lakes (manager of the lake. Three independent approaches are developed to estimate the lake volume and its temporal variability. The first two approaches (HRBV and ABV) are empirical and use synchronous ground measurements of the water volume and the satellite data. The results demonstrate that altimetry and imagery can be effectively and accurately used to monitor the temporal variations of the lake (R2ABV = 0.98, RMSEABV = 5%, R2HRBV = 0.90, and RMSEABV = 7.4%), assuming a time-varying triangular shape for the shore slope of the lake (this form is well adapted since it implies a difference inferior to 2% between the theoretical volume of the lake and the one estimated from bathymetry). The third method (AHRBVC) combines altimetry (to measure the lake level) and satellite images (of the lake surface) to estimate the volume changes of the lake and produces the best results (R2AHRBVC = 0.98) of the three methods, demonstrating the potential of future Sentinel and SWOT missions to monitor small lakes and reservoirs for agricultural and irrigation applications.

Evaluation of the free volume theory to predict moisture transport and quality changes during broccoli drying

NARCIS (Netherlands)

Jin, X.; Sman, van der R.G.M.; Boxtel, van A.J.B.

2010-01-01

Abstract: Moisture diffusion in porous broccoli florets and stalks is modeled by using the free volume and Maxwell-Eucken theories. These theories are based on the mobility of water and show the variation of the effective diffusion coefficient for a wide range of temperatures and moisture content of

Risk preferences under acute stress

Czech Academy of Sciences Publication Activity Database

Cahlíková, Jana; Cingl, L.

2017-01-01

Roč. 20, č. 1 (2017), s. 209-236 ISSN 1386-4157 R&D Projects: GA MŠk(CZ) SVV 265801/2012 Institutional support: Progres-Q24 Keywords : risk preferences * risk aversion * stress Subject RIV: AH - Economics OBOR OECD: Applied Economics, Econometrics Impact factor: 2.391, year: 2016

New insights into the stochastic ray production frontier

Czech Academy of Sciences Publication Activity Database

Henningsen, A.; Bělín, Matěj; Henningsen, G.

2017-01-01

Roč. 156, July (2017), s. 18-21 ISSN 0165-1765 R&D Projects: GA MŠk(CZ) SVV260475 Institutional support: Progres-Q24 Keywords : stochastic ray production frontier * distance function * multiple outputs Subject RIV: AH - Economics OBOR OECD: Economic Theory Impact factor: 0.558, year: 2016

Predictive equations for lung volumes from computed tomography for size matching in pulmonary transplantation.

Science.gov (United States)

Konheim, Jeremy A; Kon, Zachary N; Pasrija, Chetan; Luo, Qingyang; Sanchez, Pablo G; Garcia, Jose P; Griffith, Bartley P; Jeudy, Jean

2016-04-01

Size matching for lung transplantation is widely accomplished using height comparisons between donors and recipients. This gross approximation allows for wide variation in lung size and, potentially, size mismatch. Three-dimensional computed tomography (3D-CT) volumetry comparisons could offer more accurate size matching. Although recipient CT scans are universally available, donor CT scans are rarely performed. Therefore, predicted donor lung volumes could be used for comparison to measured recipient lung volumes, but no such predictive equations exist. We aimed to use 3D-CT volumetry measurements from a normal patient population to generate equations for predicted total lung volume (pTLV), predicted right lung volume (pRLV), and predicted left lung volume (pLLV), for size-matching purposes. Chest CT scans of 400 normal patients were retrospectively evaluated. 3D-CT volumetry was performed to measure total lung volume, right lung volume, and left lung volume of each patient, and predictive equations were generated. The fitted model was tested in a separate group of 100 patients. The model was externally validated by comparison of total lung volume with total lung capacity from pulmonary function tests in a subset of those patients. Age, gender, height, and race were independent predictors of lung volume. In the test group, there were strong linear correlations between predicted and actual lung volumes measured by 3D-CT volumetry for pTLV (r = 0.72), pRLV (r = 0.72), and pLLV (r = 0.69). A strong linear correlation was also observed when comparing pTLV and total lung capacity (r = 0.82). We successfully created a predictive model for pTLV, pRLV, and pLLV. These may serve as reference standards and predict donor lung volume for size matching in lung transplantation. Copyright © 2016 The American Association for Thoracic Surgery. Published by Elsevier Inc. All rights reserved.

Influence of unstable footwear on lower leg muscle activity, volume change and subjective discomfort during prolonged standing.

Science.gov (United States)

Karimi, Zanyar; Allahyari, Teimour; Azghani, Mahmood Reza; Khalkhali, Hamidreza

2016-03-01

The present study was an attempt to investigate the effect of unstable footwear on lower leg muscle activity, volume change and subjective discomfort during prolonged standing. Ten healthy subjects were recruited to stand for 2 h in three footwear conditions: barefoot, flat-bottomed shoe and unstable shoe. During standing, lower leg discomfort and EMG activity of medial gastrocnemius (MG) and tibialis anterior (TA) muscles were continuously monitored. Changes in lower leg volume over standing time also were measured. Lower leg discomfort rating reduced significantly while subjects standing on unstable shoe compared to the flat-bottomed shoe and barefoot condition. For lower leg volume, less changes also were observed with unstable shoe. The activity level and variation of right MG muscle was greater with unstable shoe compared to the other footwear conditions; however regarding the left MG muscle, significant difference was found between unstable shoe and flat-bottomed shoe only for activity level. Furthermore no significant differences were observed for the activity level and variation of TA muscles (right/left) among all footwear conditions. The findings suggested that prolonged standing with unstable footwear produces changes in lower leg muscles activity and leads to less volume changes. Perceived discomfort also was lower for this type of footwear and this might mean that unstable footwear can be used as ergonomic solution for employees whose work requires prolonged standing. Copyright © 2015 Elsevier Ltd and The Ergonomics Society. All rights reserved.

Advances in variational and hemivariational inequalities theory, numerical analysis, and applications

CERN Document Server

Migórski, Stanisław; Sofonea, Mircea

2015-01-01

Highlighting recent advances in variational and hemivariational inequalities with an emphasis on theory, numerical analysis and applications, this volume serves as an indispensable resource to graduate students and researchers interested in the latest results from recognized scholars in this relatively young and rapidly-growing field. Particularly, readers will find that the volume’s results and analysis present valuable insights into the fields of pure and applied mathematics, as well as civil, aeronautical, and mechanical engineering. Researchers and students will find new results on well posedness to stationary and evolutionary inequalities and their rigorous proofs. In addition to results on modeling and abstract problems, the book contains new results on the numerical methods for variational and hemivariational inequalities. Finally, the applications presented illustrate the use of these results in the study of miscellaneous mathematical models which describe the contact between deformable bodies and a...

Modification of unilateral otolith responses following spaceflight.

Science.gov (United States)

Clarke, Andrew H; Schönfeld, Uwe

2015-12-01

The aim of the study was to resolve the issue of spaceflight-induced, adaptive modification of the otolith system by measuring unilateral otolith responses in a pre- versus post-flight design. The study represents the first comprehensive approach to examining unilateral otolith function following space flight. Ten astronauts participated in unilateral otolith function tests three times preflight and up to four times after Shuttle flights from landing day through the subsequent 10 days. During unilateral centrifugation, utricular function was examined by the perceptual changes reflected by the subjective visual vertical (SVV) and the otolith-mediated ocular counter-roll, designated as utriculo-ocular response (UOR). Unilateral saccular reflexes were recorded by measurement of collic vestibular evoked myogenic potentials (cVEMP). The findings demonstrate a general increase in interlabyrinth asymmetry of otolith responses on landing day relative to preflight baseline, with subsequent reversal in asymmetry within 2-3 days. Recovery to baseline levels was achieved within 10 days. This fluctuation in asymmetry was consistent for the utricle tests (SVV and UOR) while apparently stronger for SVV. A similar asymmetry was observed during cVEMP testing. In addition, the results provide initial evidence of a dominant labyrinth. The findings require reconsideration of the otolith asymmetry hypothesis; in general, on landing day, the response from one labyrinth was equivalent to preflight values, while the other showed considerable discrepancy. The finding that one otolith response can return to one-g level within hours after re-entry while the other takes considerably longer demonstrates the importance of considering the otolith response as a result of both peripheral and associated central neural processing.

Is perception of vertical impaired in individuals with chronic stroke with a history of 'pushing'?

Science.gov (United States)

Mansfield, Avril; Fraser, Lindsey; Rajachandrakumar, Roshanth; Danells, Cynthia J; Knorr, Svetlana; Campos, Jennifer

2015-03-17

Post-stroke 'pushing' behaviour appears to be caused by impaired perception of vertical in the roll plane. While pushing behaviour typically resolves with stroke recovery, it is not known if misperception of vertical persists. The purpose of this study was to determine if perception of vertical is impaired amongst stroke survivors with a history of pushing behaviour. Fourteen individuals with chronic stroke (7 with history of pushing) and 10 age-matched healthy controls participated. Participants sat upright on a chair surrounded by a curved projection screen in a laboratory mounted on a motion base. Subjective visual vertical (SVV) was assessed using a 30 trial, forced-choice protocol. For each trial participants viewed a line projected on the screen and indicated if the line was tilted to the right or the left. For the subjective postural vertical (SPV), participants wore a blindfold and the motion base was tilted to the left or right by 10-20°. Participants were asked to adjust the angular movements of the motion base until they felt upright. SPV was not different between groups. SVV was significantly more biased towards the contralesional side for participants with history of pushing (-3.6 ± 4.1°) than those without (-0.1 ± 1.4°). Two individuals with history of pushing had SVV or SPV outside the maximum for healthy controls. Impaired vertical perception may persist in some individuals with prior post-stroke pushing, despite resolution of pushing behaviours, which could have consequences for functional mobility and falls. Copyright © 2015 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

Estimation of ocular volume from axial length.

Science.gov (United States)

Nagra, Manbir; Gilmartin, Bernard; Logan, Nicola S

2014-12-01

To determine which biometric parameters provide optimum predictive power for ocular volume. Sixty-seven adult subjects were scanned with a Siemens 3-T MRI scanner. Mean spherical error (MSE) (D) was measured with a Shin-Nippon autorefractor and a Zeiss IOLMaster used to measure (mm) axial length (AL), anterior chamber depth (ACD) and corneal radius (CR). Total ocular volume (TOV) was calculated from T2-weighted MRIs (voxel size 1.0 mm(3)) using an automatic voxel counting and shading algorithm. Each MR slice was subsequently edited manually in the axial, sagittal and coronal plane, the latter enabling location of the posterior pole of the crystalline lens and partitioning of TOV into anterior (AV) and posterior volume (PV) regions. Mean values (±SD) for MSE (D), AL (mm), ACD (mm) and CR (mm) were -2.62±3.83, 24.51±1.47, 3.55±0.34 and 7.75±0.28, respectively. Mean values (±SD) for TOV, AV and PV (mm(3)) were 8168.21±1141.86, 1099.40±139.24 and 7068.82±1134.05, respectively. TOV showed significant correlation with MSE, AL, PV (all p<0.001), CR (p=0.043) and ACD (p=0.024). Bar CR, the correlations were shown to be wholly attributable to variation in PV. Multiple linear regression indicated that the combination of AL and CR provided optimum R(2) values of 79.4% for TOV. Clinically useful estimations of ocular volume can be obtained from measurement of AL and CR. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

Comparing colon cancer outcomes: The impact of low hospital case volume and case-mix adjustment.

Science.gov (United States)

Fischer, C; Lingsma, H F; van Leersum, N; Tollenaar, R A E M; Wouters, M W; Steyerberg, E W

2015-08-01

When comparing performance across hospitals it is essential to consider the noise caused by low hospital case volume and to perform adequate case-mix adjustment. We aimed to quantify the role of noise and case-mix adjustment on standardized postoperative mortality and anastomotic leakage (AL) rates. We studied 13,120 patients who underwent colon cancer resection in 85 Dutch hospitals. We addressed differences between hospitals in postoperative mortality and AL, using fixed (ignoring noise) and random effects (incorporating noise) logistic regression models with general and additional, disease specific, case-mix adjustment. Adding disease specific variables improved the performance of the case-mix adjustment models for postoperative mortality (c-statistic increased from 0.77 to 0.81). The overall variation in standardized mortality ratios was similar, but some individual hospitals changed considerably. For the standardized AL rates the performance of the adjustment models was poor (c-statistic 0.59 and 0.60) and overall variation was small. Most of the observed variation between hospitals was actually noise. Noise had a larger effect on hospital performance than extended case-mix adjustment, although some individual hospital outcome rates were affected by more detailed case-mix adjustment. To compare outcomes between hospitals it is crucial to consider noise due to low hospital case volume with a random effects model. Copyright © 2015 Elsevier Ltd. All rights reserved.

A variational approach to nonsmooth dynamics applications in unilateral mechanics and electronics

CERN Document Server

Adly, Samir

2017-01-01

This brief examines mathematical models in nonsmooth mechanics and nonregular electrical circuits, including evolution variational inequalities, complementarity systems, differential inclusions, second-order dynamics, Lur'e systems and Moreau's sweeping process. The field of nonsmooth dynamics is of great interest to mathematicians, mechanicians, automatic controllers and engineers. The present volume acknowledges this transversality and provides a multidisciplinary view as it outlines fundamental results in nonsmooth dynamics and explains how to use them to study various problems in engineering. In particular, the author explores the question of how to redefine the notion of dynamical systems in light of modern variational and nonsmooth analysis. With the aim of bridging between the communities of applied mathematicians, engineers and researchers in control theory and nonlinear systems, this brief outlines both relevant mathematical proofs and models in unilateral mechanics and electronics.

Structure analyses of swollen rubber-carbon black systems by contrast variation SANS

International Nuclear Information System (INIS)

Takenaka, Mikihito; Nishitsuji, Shotaro; Fujii, Sumiaki; Amino, Naoya; Ishikawa, Yasuhiro; Yamaguchi, Daisuke; Koizumi, Satoshi

2010-01-01

The polymer layers adsorbed on carbon black (CB) aggregates in rubber/CB systems have been investigated with contrast variation small-angle neutron scattering (SANS) method. Specimens were swollen by toluene/deuterated toluene solvents having various scattering length densities and their scattering intensities were measured with SANS. The contrast variation SANS for the specimens yielded partial scattering functions: the scattering function for polymer-polymer correlation S pp (q), the scattering function for CB- CB correlation S cc (q), and the scattering function for polymer- CB correlation S pc (q). The analyses of the partial scattering functions explored the existence of dense polymer layers around CB aggregates. Several characteristic parameters are estimated from the analyses, such as the size of aggregates, the thickness of layers, and the volume fractions of polymer of layers and matrix. (author)

Sparse PDF Volumes for Consistent Multi-Resolution Volume Rendering

KAUST Repository

Sicat, Ronell Barrera

2014-12-31

This paper presents a new multi-resolution volume representation called sparse pdf volumes, which enables consistent multi-resolution volume rendering based on probability density functions (pdfs) of voxel neighborhoods. These pdfs are defined in the 4D domain jointly comprising the 3D volume and its 1D intensity range. Crucially, the computation of sparse pdf volumes exploits data coherence in 4D, resulting in a sparse representation with surprisingly low storage requirements. At run time, we dynamically apply transfer functions to the pdfs using simple and fast convolutions. Whereas standard low-pass filtering and down-sampling incur visible differences between resolution levels, the use of pdfs facilitates consistent results independent of the resolution level used. We describe the efficient out-of-core computation of large-scale sparse pdf volumes, using a novel iterative simplification procedure of a mixture of 4D Gaussians. Finally, our data structure is optimized to facilitate interactive multi-resolution volume rendering on GPUs.

Multi-subject atlas-based auto-segmentation reduces interobserver variation and improves dosimetric parameter consistency for organs at risk in nasopharyngeal carcinoma: A multi-institution clinical study

International Nuclear Information System (INIS)

Tao, Chang-Juan; Yi, Jun-Lin; Chen, Nian-Yong; Ren, Wei; Cheng, Jason; Tung, Stewart; Kong, Lin; Lin, Shao-Jun; Pan, Jian-Ji; Zhang, Guang-Shun; Hu, Jiang; Qi, Zhen-Yu; Ma, Jun; Lu, Jia-De; Yan, Di; Sun, Ying

2015-01-01

Background and purpose: To assess whether consensus guideline-based atlas-based auto-segmentation (ABAS) reduces interobserver variation and improves dosimetric parameter consistency for organs at risk (OARs) in nasopharyngeal carcinoma (NPC). Materials and methods: Eight radiation oncologists from 8 institutes contoured 20 OARs on planning CT images of 16 patients via manual contouring and manually-edited ABAS contouring. Interobserver variation [volume coefficient of variation (CV), Dice similarity coefficient (DSC), three-dimensional isocenter difference (3D-ICD)] and dosimetric parameters were compared between the two methods of contouring for each OAR. Results: Interobserver variation was significant for all OARs in manual contouring, resulting in significant dosimetric parameter variation (P < 0.05). Edited ABAS significantly improved multiple metrics and reduced dosimetric parameter variation for most OARs; brainstem, spinal cord, cochleae, temporomandibular joint (TMJ), larynx and pharyngeal constrictor muscle (PCM) obtained most benefit (range of mean DSC, volume CV and main ICD values was 0.36–0.83, 12.1–84.3%, 2.2–5.0 mm for manual contouring and 0.42–0.86, 7.2–70.6%, 1.2–3.5 mm for edited ABAS contouring, respectively; range of dose CV reduction: 1.0–3.0%). Conclusion: Substantial objective interobserver differences occur during manual contouring, resulting in significant dosimetric parameter variation. Edited ABAS reduced interobserver variation and improved dosimetric parameter consistency, particularly for brainstem, spinal cord, cochleae, TMJ, larynx and PCM

Photoperiodic differences in a forebrain nucleus involved in vocal plasticity: enkephalin immunoreactivity reveals volumetric variation in song nucleus lMAN but not NIf in male European starlings (Sturnus vulgaris).

Science.gov (United States)

Stevenson, Tyler J; Ball, Gregory F

2010-09-15

Seasonal variation in the volume of various song control nuclei in many passerine species remains one of the best examples of naturally occurring adult neuroplasticity among vertebrates. The lateral portion of the magnocellular nucleus of the anterior nidopallium (lMAN) is a song nucleus that is important for song learning and seems to be critical for inducing variability in the song structure that is later pruned via a feedback process to produce adult crystallized song. To date, lMAN has not been shown to exhibit seasonal changes in volume, probably because it is difficult to resolve the boundaries of lMAN when employing histological methods based on Nissl staining. Here, lMAN(core) volumes were examined in intact photostimulated (i.e., breeding), castrated photostimulated and photorefractory (i.e., nonbreeding) male starlings (Sturnus vulgaris) to investigate the degree of seasonal variation in brain morphology. We present data demonstrating that the volumes of the total MAN and lMAN(core) delineated by enkephalin immunoreactivity are greater in photostimulated male starlings as compared to photorefractory males. Moreover, two other regions associated with the song system that have not been investigated previously in the context of seasonal plasticity namely (i) the medial portion of MAN (mMAN), and (ii) the nucleus interfacialis (NIf) did not display significant volumetric variation. We propose that greater lMAN(core) volumes are associated with the increase in vocal plasticity that is generally observed prior to production of stereotyped song.

Equilibrium and Dynamic Osmotic Behaviour of Aqueous Solutions with Varied Concentration at Constant and Variable Volume

Science.gov (United States)

Minkov, Ivan L.; Manev, Emil D.; Sazdanova, Svetla V.; Kolikov, Kiril H.

2013-01-01

Osmosis is essential for the living organisms. In biological systems the process usually occurs in confined volumes and may express specific features. The osmotic pressure in aqueous solutions was studied here experimentally as a function of solute concentration (0.05–0.5 M) in two different regimes: of constant and variable solution volume. Sucrose, a biologically active substance, was chosen as a reference solute for the complex tests. A custom made osmotic cell was used. A novel operative experimental approach, employing limited variation of the solution volume, was developed and applied for the purpose. The established equilibrium values of the osmotic pressure are in agreement with the theoretical expectations and do not exhibit any evident differences for both regimes. In contrast, the obtained kinetic dependences reveal striking divergence in the rates of the process at constant and varied solution volume for the respective solute concentrations. The rise of pressure is much faster at constant solution volume, while the solvent influx is many times greater in the regime of variable volume. The results obtained suggest a feasible mechanism for the way in which the living cells rapidly achieve osmotic equilibrium upon changes in the environment. PMID:24459448

Dynamics of nonholonomic systems from variational principles embedded variation identity

International Nuclear Information System (INIS)

Guo Yongxin; Liu Shixing; Liu Chang; Chang Peng

2009-01-01

Nondeterminacy of dynamics, i.e., the nonholonomic or the vakonomic, fundamental variational principles, e.g., the Lagrange-d'Alembert or Hamiltonian, and variational operators, etc., of nonholonomic mechanical systems can be attributed to the non-uniqueness of ways how to realize nonholonomic constraints. Making use of a variation identity of nonholonomic constraints embedded into the Hamilton's principle with the method of Lagrange undetermined multipliers, three kinds of dynamics for the nonholonomic systems including the vakonomic and nonholonomic ones and a new one are obtained if the variation is respectively reduced to three conditional variations: vakonomic variation, Hoelder's variation and Suslov's variation, defined by the identity. Therefore, different dynamics of nonholonomic systems can be derived from an integral variational principle, utilizing one way of embedding constraints into the principle, with different variations. It is verified that the similar embedding of the identity into the Lagrange-d'Alembert principle gives rise to the nonholonomic dynamics but fails to give the vakonomic one unless the constraints are integrable.

Can endocranial volume be estimated accurately from external skull measurements in great-tailed grackles (Quiscalus mexicanus?

Directory of Open Access Journals (Sweden)

Corina J. Logan

2015-06-01

Full Text Available There is an increasing need to validate and collect data approximating brain size on individuals in the field to understand what evolutionary factors drive brain size variation within and across species. We investigated whether we could accurately estimate endocranial volume (a proxy for brain size, as measured by computerized tomography (CT scans, using external skull measurements and/or by filling skulls with beads and pouring them out into a graduated cylinder for male and female great-tailed grackles. We found that while females had higher correlations than males, estimations of endocranial volume from external skull measurements or beads did not tightly correlate with CT volumes. We found no accuracy in the ability of external skull measures to predict CT volumes because the prediction intervals for most data points overlapped extensively. We conclude that we are unable to detect individual differences in endocranial volume using external skull measurements. These results emphasize the importance of validating and explicitly quantifying the predictive accuracy of brain size proxies for each species and each sex.

Surface area-volume ratios in insects.

Science.gov (United States)

Kühsel, Sara; Brückner, Adrian; Schmelzle, Sebastian; Heethoff, Michael; Blüthgen, Nico

2017-10-01

Body mass, volume and surface area are important for many aspects of the physiology and performance of species. Whereas body mass scaling received a lot of attention in the literature, surface areas of animals have not been measured explicitly in this context. We quantified surface area-volume (SA/V) ratios for the first time using 3D surface models based on a structured light scanning method for 126 species of pollinating insects from 4 orders (Diptera, Hymenoptera, Lepidoptera, and Coleoptera). Water loss of 67 species was measured gravimetrically at very dry conditions for 2 h at 15 and 30 °C to demonstrate the applicability of the new 3D surface measurements and relevance for predicting the performance of insects. Quantified SA/V ratios significantly explained the variation in water loss across species, both directly or after accounting for isometric scaling (residuals of the SA/V ∼ mass 2/3 relationship). Small insects with a proportionally larger surface area had the highest water loss rates. Surface scans of insects to quantify allometric SA/V ratios thus provide a promising method to predict physiological responses, improving the potential of body mass isometry alone that assume geometric similarity. © 2016 Institute of Zoology, Chinese Academy of Sciences.

Tumor and normal tissue motion in the thorax during respiration: Analysis of volumetric and positional variations using 4D CT

International Nuclear Information System (INIS)

Weiss, Elisabeth; Wijesooriya, Krishni; Dill, S. Vaughn; Keall, Paul J.

2007-01-01

Purpose: To investigate temporospatial variations of tumor and normal tissue during respiration in lung cancer patients. Methods and Materials: In 14 patients, gross tumor volume (GTV) and normal tissue structures were manually contoured on four-dimensional computed tomography (4D-CT) scans. Structures were evaluated for volume changes, centroid (center of mass) motion, and phase dependence of variations relative to inspiration. Only volumetrically complete structures were used for analysis (lung in 2, heart in 8, all other structures in >10 patients). Results: During respiration, the magnitude of contoured volumes varied up to 62.5% for GTVs, 25.5% for lungs, and 12.6% for hearts. The range of maximum three-dimensional centroid movement for individual patients was 1.3-24.0 mm for GTV, 2.4-7.9 mm for heart, 5.2-12.0 mm for lungs, 0.3-5.5 mm for skin markers, 2.9-10.0 mm for trachea, and 6.6-21.7 mm for diaphragm. During respiration, the centroid positions of normal structures varied relative to the centroid position of the respective GTV by 1.5-8.1 mm for heart, 2.9-9.3 mm for lungs, 1.2-9.2 mm for skin markers, 0.9-7.1 mm for trachea, and 2.7-16.4 mm for diaphragm. Conclusion: Using 4D-CT, volumetric changes, positional alterations as well as changes in the position of contoured structures relative to the GTV were observed with large variations between individual patients. Although the interpretation of 4D-CT data has considerable uncertainty because of 4D-CT artifacts, observer variations, and the limited acquisition time, the findings might have a significant impact on treatment planning

Clinical variability of target volume description and treatment plans in conformal radiotherapy in muscle invasive bladder cancer

International Nuclear Information System (INIS)

Logue, John P; Sharrock, Carole L; Cowan, Richard A.; Read, Graham; Marrs, Julie; Mott, David

1996-01-01

Purpose/Objective: The delineation of tumor and the production of a treatment plan to encompass this is the prime step in radiotherapy planning. Conformal radiotherapy is developing rapidly and although plentiful research has addressed the implementation of the radiotherapy prescription, scant attention has been made to the fundamental step of production, by the clinician, of an appropriate target volume. As part of an ongoing randomized trial of conformal radiotherapy, in bladder cancer, we have therefore assessed the interphysician variability of radiologists and radiation oncologists (RO) in assessing Gross Tumor Volume(GTV) (ICRU 50) and the adherence of the radiation oncologists to the study protocol of producing a Planning Target Volume (PTV). Materials and Methods: Four patients with T3 carcinoma of bladder who had been entered into the trial were identified. The clinical details, MR scans and CT scans were made available. Eight RO and 3 dedicated diagnostic oncology radiologists were invited to directly outline the GTV onto CT images on a planning computer consul. The RO in addition created a PTV following the trial protocol of 15mm margin around the GTV. Three RO sub-specialized in Urological radiotherapy; all RO had completed training. Volumes were produced, for each clinician, and comparison of these volumes and their isocenters were analyzed. In addition the margins allowed were measured and compared. Results: There was a maximum variation ratio (largest to smallest volume outlined) of the GTV in the four cases of 1.74 among radiologists and 3.74 among oncologists. There was a significant difference (p=0.01) in mean GTV between RO and the radiologists. The mean GTV of the RO exceeded the radiologists by a factor of 1.29 with a mean difference of 13.4 cm 3 The between observer variance within speciality comprised only 9.9% of the total variance in the data having accounted for case and observers speciality. The variation ratio in PTV among oncologists

Sparse PDF Volumes for Consistent Multi-Resolution Volume Rendering

KAUST Repository

Sicat, Ronell Barrera; Kruger, Jens; Moller, Torsten; Hadwiger, Markus

2014-01-01

This paper presents a new multi-resolution volume representation called sparse pdf volumes, which enables consistent multi-resolution volume rendering based on probability density functions (pdfs) of voxel neighborhoods. These pdfs are defined

Estudos sobre a regeneração do figado - variação do volume nuclear das celulas hepáticas em repouso divisional

Directory of Open Access Journals (Sweden)

Fernando Ubatuba

1948-12-01

Full Text Available Surgical removal of large amounts of hepatic tissue in male albino rats results in a rapid and conspicuous raise in cellular nuclear volumes. Measurements were made exclusively in resting nuclei. This volume variation is transitory. Nuclear volumes return to the normal value withins 6 days of restoration. The higher value are abserved 48 hours after the hepatic removal, indicating probably that this effect is due to hydration of the nucei, as occurs in the cytoplasm. This hydration could be correlated to the mitotic activity of the renmant tissue since a peak of mitoses parallels the changes in the nuclear volumes.

GSTM1 Gene Expression Correlates to Leiomyoma Volume Regression in Response to Mifepristone Treatment

Science.gov (United States)

Engman, Mikael; Varghese, Suby; Lagerstedt Robinson, Kristina; Malmgren, Helena; Hammarsjö, Anna; Byström, Birgitta; L Lalitkumar, Parameswaran Grace; Gemzell-Danielsson, Kristina

2013-01-01

Progesterone receptor modulators, such as mifepristone are useful and well tolerated in reducing leiomyoma volume although with large individual variation. The objective of this study was to investigate the molecular basis for the observed leiomyoma volume reduction, in response to mifepristone treatment and explore a possible molecular marker for the selective usage of mifepristone in leiomyoma patients. Premenopausal women (N = 14) were treated with mifepristone 50 mg, every other day for 12 weeks prior to surgery. Women were arbitrarily sub-grouped as good (N = 4), poor (N = 4) responders to treatment or intermediate respondents (N = 3). Total RNA was extracted from leiomyoma tissue, after surgical removal of the tumour and the differential expression of genes were analysed by microarray. The results were analysed using Ingenuity Pathway Analysis software. The glutathione pathway was the most significantly altered canonical pathway in which the glutathione-s transferase mu 1 (GSTM1) gene was significantly over expressed (+8.03 folds) among the good responders compared to non responders. This was further confirmed by Real time PCR (p = 0.024). Correlation of immunoreactive scores (IRS) for GSTM1 accumulation in leiomyoma tissue was seen with base line volume change of leiomyoma R = −0.8 (p = 0.011). Furthermore the accumulation of protein GSTM1 analysed by Western Blot correlated significantly with the percentual leiomyoma volume change R = −0.82 (p = 0.004). Deletion of the GSTM1 gene in leiomyoma biopsies was found in 50% of the mifepristone treated cases, with lower presence of the GSTM1 protein. The findings support a significant role for GSTM1 in leiomyoma volume reduction induced by mifepristone and explain the observed individual variation in this response. Furthermore the finding could be useful to further explore GSTM1 as a biomarker for tailoring medical treatment of uterine leiomyomas for optimizing the response

To what extent do long-duration high-volume dam releases influence river–aquifer interactions? A case study in New South Wales, Australia

KAUST Repository

Graham, Peter W.

2014-11-20

Long-duration high-volume dam releases are unique anthropogenic events with no naturally occurring equivalents. The impact from such dam releases on a downstream Quaternary alluvial aquifer in New South Wales, Australia, is assessed. It is observed that long-duration (>26 days), high-volume dam releases (>8,000 ML/day average) result in significant variations in river–aquifer interactions. These variations include a flux from the river to the aquifer up to 6.3 m3/day per metre of bank (at distances of up to 330 m from the river bank), increased extent and volume of recharge/bank storage, and a long-term (>100 days) reversal of river–aquifer fluxes. In contrast, during lower-volume events (<2,000 ML/day average) the flux was directed from the aquifer to the river at rates of up to 1.6 m3/day per metre of bank. A groundwater-head prediction model was constructed and river–aquifer fluxes were calculated; however, predicted fluxes from this method showed poor correlation to fluxes calculated using actual groundwater heads. Long-duration high-volume dam releases have the potential to skew estimates of long-term aquifer resources and detrimentally alter the chemical and physical properties of phreatic aquifers flanking the river. The findings have ramifications for improved integrated management of dam systems and downstream aquifers.

Precision and accuracy of the subjective haptic vertical in the roll plane

Directory of Open Access Journals (Sweden)

Bockisch Christopher J

2010-07-01

Full Text Available Abstract Background When roll-tilted, the subjective visual vertical (SVV deviates up to 40° from earth-vertical and trial-to-trial variability increases with head roll. Imperfections in the central processing of visual information were postulated to explain these roll-angle dependent errors. For experimental conditions devoid of visual input, e.g. adjustments of body posture or of an object along vertical in darkness, significantly smaller errors were noted. Whereas the accuracy of verticality adjustments seems to depend strongly on the paradigm, we hypothesize that the precision, i.e. the inverse of trial-to-trial variability, is less influenced by the experimental setup and mainly reflects properties of the otoliths. Here we measured the subjective haptic vertical (SHV and compared findings with previously reported SVV data. Twelve healthy right-handed human subjects (handedness assessed based on subjects' verbal report adjusted a rod with the right hand along perceived earth-vertical during static head roll-tilts (0-360°, steps of 20°. Results SHV adjustments showed a tendency for clockwise rod rotations to deviate counter-clockwise and for counter-clockwise rod rotations to deviate clockwise, indicating hysteresis. Clockwise rod rotations resulted in counter-clockwise shifts of perceived earth-vertical up to -11.7° and an average counter-clockwise SHV shift over all roll angles of -3.3° (± 11.0°; ± 1 StdDev. Counter-clockwise rod rotations yielded peak SHV deviations in clockwise direction of 8.9° and an average clockwise SHV shift over all roll angles of 1.8° (± 11.1°. Trial-to-trial variability was minimal in upright position, increased with increasing roll (peaking around 120-140° and decreased to intermediate values in upside-down orientation. Compared to SVV, SHV variability near upright and upside-down was non-significantly (p > 0.05 larger; both showed an m-shaped pattern of variability as a function of roll position

Interfractional variation in bladder volume and its impact on cervical cancer radiotherapy: Clinical significance of portable bladder scanner

Energy Technology Data Exchange (ETDEWEB)

Luo, Huanli; Jin, Fu; Yang, Dingyi; Wang, Ying; Li, Chao; Guo, Mingfang; Ran, Xueqi; Liu, Xianfeng; Zhou, Qi; Wu, Yongzhong, E-mail: jfazj@126.com [Department of Radiation Oncology, Chongqing Cancer Institute, No. 181, Han Yu Road, Chongqing 400030 (China)

2016-07-15

Purpose: A constant bladder volume (BV) is essential to direct the radiotherapy (RT) of pelvic tumors with precision. The purpose of this study was to investigate changes in BV and their impact on cervical cancer RT and to assess the clinical significance of a portable bladder scanner (BS) in achieving a constant BV. Methods: A standard bladder phantom (133 ml) and measurements of actual urine volume were both used as benchmarks to evaluate the accuracy of the BS. Comparisons of BS with computed tomography (CT), cone-beam CT (CBCT), and an ultrasound diagnostic device (iU22) were made. Twenty-two consecutive patients with cervical cancer treated with external beam radical RT were divided into an experimental group (13 patients) and a control group (9 patients). In the experimental group, the BV was measured multiple times by BS pre-RT until it was consistent with that found by planning CT. Then a CBCT was performed. The BV was measured again immediately post-RT, after which the patient’s urine was collected and recorded. In the control group, CBCT only was performed pre-RT. Interfractional changes in BV and their impact on cervical cancer RT were investigated in both groups. The time of bladder filling was also recorded and analyzed. Results: In measuring the volume of the standard bladder phantom, the BS deviated by 1.4% in accuracy. The difference between the measurements of the BS and the iU22 had no statistical significance (linear correlation coefficient 0.96, P < 0.05). The BV measured by the BS was strongly correlated with the actual urine volume (R = 0.95, P < 0.05), planning CT (R = 0.95, P < 0.05), or CBCT (R = 0.91, P < 0.05). Compared with the BV at the time of CT, its value changed by −36.1% [1 SD (standard deviation) 42.3%; range, −79.1%–29.4%] in the control group, and 5.2% (1 SD 21.5%; range, −13.3%–22.1%) in the experimental group during treatment. The change in BV affected the target position in the superior–inferior (SI) direction

Evaluation of regional cerebral blood flow and volume of rapidly exchangeable water in man by positron emission tomography

International Nuclear Information System (INIS)

Depresseux, J.C.; Cheslet, J.P.; Hodiaumont, J.

1982-01-01

The present investigation uses bolus inhalation of C 15 O 2 and sequential positron emission tomography of the brain in view to simultaneously evaluate regional cerebral blood flow and regional cerebral volume of rapidly exchangeable water in normal human subjects. Arguments allow to infer that the cerebral distribution volume of radiowater does vary with time during the initial period of invasion of tissue by the indicator. Implications of this variation on the validity of classical data procedures is discussed and an alternative original method is proposed [fr

Effectiveness evaluation of two volumizing hyaluronic acid dermal fillers in a controlled, randomized, double-blind, split-face clinical study

Directory of Open Access Journals (Sweden)

Kerscher M

2017-06-01

Full Text Available Martina Kerscher,1 Karla Agsten,2 Maria Kravtsov,3 Welf Prager4 1Department of Cosmetic Science, University of Hamburg, 2SCIderm GmbH, Hamburg, Germany; 3Anteis S.A., Geneva, Switzerland; 4Prager & Partner Dermatologische Praxis, Hamburg, Germany Background: Enhancement of the midface can be achieved with volumizing hyaluronic acid (HA fillers.Objective: The objective of this study was to compare the safety and effectiveness of Cohesive Polydensified Matrix® 26 mg/mL HA gel (CPM-26 and Vycross® 20 mg/ml HA gel (VYC-20 in a controlled, randomized, evaluator-blind, split-face clinical study.Patients and methods: Subjects with moderate-to-severe malar volume loss on the Merz Aesthetics Scale (MAS received CPM-26 on one side and VYC-20 on the contralateral side of the face. Effectiveness assessments were performed by blinded evaluators including photographic and live MAS ratings and live Global Aesthetic Improvement Scale (GAIS ratings. Calculations of anatomical volume variations at month 3 (M3, month 6 (M6, month 12 (M12 and month 18 (M18 were also performed.Results: Non-inferiority of CPM-26 versus VYC-20 was demonstrated at M3 (primary end point based on MAS. GAIS rating showed that significantly more subjects had better improvement with CPM-26 than with VYC-20 at month 1, M3, M12 and M18 (p=0.0032, p=0.0074, p=0.0384 and p=0.0110, respectively. Standardized evaluation of volume variations from baseline to M3, M12 and M18 showed that CPM-26 created more volume augmentation at all time points, and the difference was significant at M3.Conclusion: CPM-26 was non-inferior to VYC-20 based on MAS ratings at M3 and demonstrated a favorable safety and effectiveness profile for midfacial volume enhancement with results lasting up to M18. Keywords: cohesive polydensified matrix, hyaluronic acid fillers, Belotero® Volume, Modélis® SHAPE, Juvéderm® VOLUMA®, volumizing

An evaluation of soil sampling for 137Cs using various field-sampling volumes.

Science.gov (United States)

Nyhan, J W; White, G C; Schofield, T G; Trujillo, G

1983-05-01

The sediments from a liquid effluent receiving area at the Los Alamos National Laboratory and soils from an intensive study area in the fallout pathway of Trinity were sampled for 137Cs using 25-, 500-, 2500- and 12,500-cm3 field sampling volumes. A highly replicated sampling program was used to determine mean concentrations and inventories of 137Cs at each site, as well as estimates of spatial, aliquoting, and counting variance components of the radionuclide data. The sampling methods were also analyzed as a function of soil size fractions collected in each field sampling volume and of the total cost of the program for a given variation in the radionuclide survey results. Coefficients of variation (CV) of 137Cs inventory estimates ranged from 0.063 to 0.14 for Mortandad Canyon sediments, whereas CV values for Trinity soils were observed from 0.38 to 0.57. Spatial variance components of 137Cs concentration data were usually found to be larger than either the aliquoting or counting variance estimates and were inversely related to field sampling volume at the Trinity intensive site. Subsequent optimization studies of the sampling schemes demonstrated that each aliquot should be counted once, and that only 2-4 aliquots out of as many as 30 collected need be assayed for 137Cs. The optimization studies showed that as sample costs increased to 45 man-hours of labor per sample, the variance of the mean 137Cs concentration decreased dramatically, but decreased very little with additional labor.

Development of large-volume rhyolitic ignibrites (LRI'S): The Chalupas Caldera, an example from Ecuador

International Nuclear Information System (INIS)

Hammersley, L.; DePaolo, D.J; Beate, B

2001-01-01

The mechanisms responsible for the generation of large volumes of silicic magma and the eruption of large-volume rhyolitic ignimbrites (LRI's) remain poorly understood. Of particular interest are the relative roles of crustal assimilation, fractional crystallization and magma supply and the processes by which large volumes of magma accumulate in crustal chambers rather than erupt in smaller batches. Isotope geochemistry, combined with study of major and trace element variations of lavas, can be used to infer the relative contribution of crustal material and continued magmatic supply. Timescales for the accumulation of magma can be estimated using detailed geochronology. Magma supply rates can be estimated from eruption rates of nearby volcanoes. In this study we investigate the evolution of the Chalupas LRI, a caldera system in the Ecuadorian Andes where LRI's are rare in comparison to the Southern Volcanic Zone (SVZ) of South America (au)

Effect of pulse frequency variation in laser welding of stainless steel

International Nuclear Information System (INIS)

Ahmed, E.; Manzoor, T.; Hussain, N.

2007-01-01

A parametric investigation by variations of frequencies was conducted to evaluate their effect on microstructural changes in the fusion and heat affected zones. Ferrite plus martensite microstructure was developed in these regions with visible grain coarsening in the fusion zone. The grain coarsening possibly be due to poor heat conductivity in this region. The morphology and volume fraction of martensite was changed with an increase in the frequency. At lower frequency the martensite laths and grain boundary growth was progressively changed to a network, forming connectivity of martensite and decreasing its volume fraction. The restricted growth of martensite particles to the grain boundaries for connectivity of martensite is little effective in raising the hardness of the fusion zone. An increase in the hardness ratio of fusion to heat affected zones with connected martensite particles indicates that hardness loss due to grain coarsening is compensated to some extent. (author)

On Convergence of Kernel Density Estimates in Particle Filtering

Czech Academy of Sciences Publication Activity Database

Coufal, David

2016-01-01

Roč. 52, č. 5 (2016), s. 735-756 ISSN 0023-5954 Grant - others:GA ČR(CZ) GA16-03708S; SVV(CZ) 260334/2016 Institutional support: RVO:67985807 Keywords : Fourier analysis * kernel methods * particle filter Subject RIV: BB - Applied Statistics, Operational Research Impact factor: 0.379, year: 2016

Labor supply consequences of family taxation: evidence from the Czech Republic

Czech Academy of Sciences Publication Activity Database

Kalíšková, Klára

2014-01-01

Roč. 30, October (2014), s. 234-244 ISSN 0927-5371 R&D Projects: GA MŠk(CZ) SVV260126 Grant - others:UK(CZ) GAUK 595812 Institutional support: PRVOUK-P23 Keywords : joint tax ation * labor supply * diffrence-in-differences Subject RIV: AH - Economics Impact factor: 0.916, year: 2014

Sneller veiliger : inleiding op het Nationaal Verkeersveiligheidscongres NVVC, Amsterdam, 18 april 2002.

NARCIS (Netherlands)

Wegman, F.C.M.

2003-01-01

In the Dutch Second Transport Structure Plan (SVV-2), the 2000 target was formulated as 25% less casualties than in 1986. This reduction was achieved for the road deaths, but not for the number injured: only half the target percentage was realised. In order to reduce the number of casualties

Growth of electoral fraud in non-democracies: the role of uncertainty

Czech Academy of Sciences Publication Activity Database

Vorobyev, Dmitriy

-, č. 420 (2010), s. 1-40 ISSN 1211-3298 R&D Projects: GA MŠk LC542 Grant - others:MŠk(CZ) SVV-2010-261801 Institutional research plan: CEZ:MSM0021620846 Keywords : election * voting * fraud * learning Subject RIV: AH - Economics http://www.cerge-ei.cz/pdf/wp/Wp420.pdf

MOND prediction of a new giant shell in the elliptical galaxy NGC 3923

Czech Academy of Sciences Publication Activity Database

Bílek, Michal; Bartošková, Kateřina; Ebrová, Ivana; Jungwiert, Bruno

2014-01-01

Roč. 566, June (2014), A151/1-A151/11 ISSN 0004-6361 Grant - others:GA MŠk(CZ) LM2010005; UK(CZ) SVV-26089 Institutional support: RVO:67985815 Keywords : gravitation * galaxies: kinematics and dynamics * galaxies: formation Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 4.378, year: 2014

Studies in the history of the English language V: variation and change in English grammar and lexicon: contemporary approaches

NARCIS (Netherlands)

Cloutier, R.A.; Hamilton-Brehm, A.M.; Kretzschmar, W.A.

2010-01-01

This collection of essays focuses on current approaches to variation and change in historical English grammar and lexicon. Of the twelve papers in the collection, half are based on grammar and syntax, half on lexical developments. The volume highlights the contributions that strong empirical

Dynamics of nonholonomic systems from variational principles embedded variation identity

Energy Technology Data Exchange (ETDEWEB)

Guo Yongxin, E-mail: yxguo@lnu.edu.c [College of Physics, Liaoning University, Shenyang 110036 (China); Liu Shixing [College of Physics, Liaoning University, Shenyang 110036 (China); Liu Chang; Chang Peng [Department of Applied Mechanics, Beijing Institute of Technology, Beijing 100081 (China)

2009-10-19

Nondeterminacy of dynamics, i.e., the nonholonomic or the vakonomic, fundamental variational principles, e.g., the Lagrange-d'Alembert or Hamiltonian, and variational operators, etc., of nonholonomic mechanical systems can be attributed to the non-uniqueness of ways how to realize nonholonomic constraints. Making use of a variation identity of nonholonomic constraints embedded into the Hamilton's principle with the method of Lagrange undetermined multipliers, three kinds of dynamics for the nonholonomic systems including the vakonomic and nonholonomic ones and a new one are obtained if the variation is respectively reduced to three conditional variations: vakonomic variation, Hoelder's variation and Suslov's variation, defined by the identity. Therefore, different dynamics of nonholonomic systems can be derived from an integral variational principle, utilizing one way of embedding constraints into the principle, with different variations. It is verified that the similar embedding of the identity into the Lagrange-d'Alembert principle gives rise to the nonholonomic dynamics but fails to give the vakonomic one unless the constraints are integrable.

Planning target volume (PTV) definition and its effects in the radiotherapy

International Nuclear Information System (INIS)

Poli, Maria Esmeralda Ramos

2007-01-01

Tills work intends to study the margins required to define a planning target volume (PTV) for adequate treatment of the mobile tumors such as prostate or those located in areas with less mobility as the ones in head and neck region, in the absence of daily localization imaging based. It is also intends to evaluate the impact caused by the PTV, in terms of dose, to the critical structures surrounding the PTV and its influence when inverse planning is used in the intensity-modulated radiation therapy (IMRT). Data from 387 prostate patients were analyzed retrospectively. Every patient in the study received daily pre-treatment localization with 2D ultrasound resulting in a total of 10,327 localizations, each comprising of an isocenter displacement in 3 directions: anterior-posterior (AP), right-left lateral (RL), and superior-inferior (SI). The mean displacement and standard deviation (SD) for each direction for each patient was computed from daily treatment records. The uncertainties (SD) in the target position were 4.4 mm (AP), 3.6 mm (RL), and 4.5 mm (SI). A study of the uncertainties in the daily positioning of 78 head and neck patients who used thermoplastic mask to immobilize them, evaluated with electronic portal imaging device (EPID), showed variations (SD) in the isocenter treatment position of 3.1 mm (AP), 1.5 mm (RL), and 4.5 mm (SI). By applying these shifts in an anthropomorphic phantom it was studied the dose-volume histograms resultant of the isocenter displacement in the daily treatment. The result showed the importance of putting margins in the clinical target volume to assure an adequate treatment and also showed that isocenter daily variation can cause an increase to the dose greater than the tolerance level to the critical organs. (author)

Partial molar volumes and partial molar adiabatic compressibilities of a short chain perfluorosurfactant: Sodium heptafluorobutyrate in aqueous solutions at different temperatures

Energy Technology Data Exchange (ETDEWEB)

Blanco, Elena [Group of Biophysics and Interfaces, Department of Applied Physics, Faculty of Physics, University of Santiago de Compostela, E-15782 Santiago de Compostela (Spain); Ruso, Juan M. [Group of Biophysics and Interfaces, Department of Applied Physics, Faculty of Physics, University of Santiago de Compostela, E-15782 Santiago de Compostela (Spain)]. E-mail: faruso@usc.es; Prieto, Gerardo [Group of Biophysics and Interfaces, Department of Applied Physics, Faculty of Physics, University of Santiago de Compostela, E-15782 Santiago de Compostela (Spain); Sarmiento, Felix [Group of Biophysics and Interfaces, Department of Applied Physics, Faculty of Physics, University of Santiago de Compostela, E-15782 Santiago de Compostela (Spain)

2005-12-15

Density and ultrasound measurements of sodium heptafluorobutyrate in aqueous solutions at T = (283.15, 288.15, 293.15, 298.15, 303.15, 308.15, 313.15, 318.15, and 323.15) K have been obtained. From these results partial molar volumes and isentropic partial molar adiabatic compressibilities were calculated. Deviations from the Debye-Hueckel limiting law provide evidence for limited association at lower concentrations. The change of the partial molar volume and isentropic partial molar adiabatic compressibility upon aggregation was calculated. Variations of the change of partial molar volumes and isentropic partial molar adiabatic compressibility upon aggregation are discussed in terms of temperature.

Partial molar volumes and partial molar adiabatic compressibilities of a short chain perfluorosurfactant: Sodium heptafluorobutyrate in aqueous solutions at different temperatures

International Nuclear Information System (INIS)

Blanco, Elena; Ruso, Juan M.; Prieto, Gerardo; Sarmiento, Felix

2005-01-01

Density and ultrasound measurements of sodium heptafluorobutyrate in aqueous solutions at T = (283.15, 288.15, 293.15, 298.15, 303.15, 308.15, 313.15, 318.15, and 323.15) K have been obtained. From these results partial molar volumes and isentropic partial molar adiabatic compressibilities were calculated. Deviations from the Debye-Hueckel limiting law provide evidence for limited association at lower concentrations. The change of the partial molar volume and isentropic partial molar adiabatic compressibility upon aggregation was calculated. Variations of the change of partial molar volumes and isentropic partial molar adiabatic compressibility upon aggregation are discussed in terms of temperature

Variations in pCO2 during summer in the surface water of an unproductive lake in northern Sweden

International Nuclear Information System (INIS)

Jonsson, A.; Aaberg, J.; Jansson, M.

2007-01-01

Unproductive lakes are generally supersaturated with carbon dioxide (CO 2 ) and emit CO 2 to the atmosphere continuously during ice-free periods. However, temporal variation of the partial pressure of CO 2 (pCO 2 ) and thus of CO 2 evasion to atmosphere is poorly documented. We therefore carried out temporally high-resolution (every 6 h) measurements of the pCO 2 using an automated logger system in the surface water of a subarctic, unproductive, lake in the birch forest belt. The study period was June-September 2004. We found that the pCO 2 showed large seasonal variation, but low daily variation. The seasonal variation was likely mainly caused by variations in input and mineralization of allochthonous organic matter. Stratification depth probably also influenced pCO 2 of the surface water by controlling the volume in which mineralization of dissolved organic carbon (DOC) occurred. In lakes, with large variations in pCO 2 , as in our study lake a high (weekly) sampling intensity is recommended for obtaining accurate estimates of the evasion of CO 2

Dosimetric variation due to CT inter-slice spacing in four-dimensional carbon beam lung therapy