
Sample records for volume fraction contiguity

  1. Effective moduli of high volume fraction particulate composites

    International Nuclear Information System (INIS)

    Kwon, P.; Dharan, C.K.H.


    Predictions using current micromechanics theories for the effective moduli of particulate-reinforced composites tend to break down at high volume fractions of the reinforcing phase. The predictions are usually well below experimentally measured values of the Young's modulus for volume fractions exceeding about 0.6. In this paper, the concept of contiguity, which is a measure of phase continuity, is applied to Mori-Tanaka micromechanics theory. It is shown that contiguity of the second phase increases with volume fraction, leading eventually to a reversal in the roles of the inclusion and matrix. In powder metallurgy practice, it is well known that at high volume fractions, sintering and consolidation of the reinforcement make it increasingly continuous and more like the matrix phase, while the former matrix tends to become more like the inclusion phase. The concept of contiguity applied to micromechanics theory results in very good agreement between the predicted Young's modulus and experimental data on tungsten carbide particulate-reinforced cobalt

  2. Cerebral blood volume alterations during fractional pneumoencephalography

    International Nuclear Information System (INIS)

    Voigt, K.; Greitz, T.


    Simultaneous and continuous measurements of the cerebral blood volume (CBV), cerebrospinal fluid (CSF) and blood pressure were carried out in six patients during fractional pneumoencephalography in order to examine intracranial volumetric interactions. Three patients (Group A) showed normal encephalographic findings, and in three patients (Group B) communicating hydrocephalus with convexity block was found encephalographically. In all patients the injection of air was followed by an immediate increase of CSF pressure and blood pressure and a concomitant decrease of CBV. The initial CSF pressure was invariably re-established within 3 to 3.5 min. During this time interval the CBV of the patients of Group B decreased significantly and 30 percent more than that of Group A. Furthermore, after restoration of the original CSF pressure, CBV returned to its initial level in all patients of Group A, whereas it remained unchanged or showed a further decrease in the patients of Group B. Removal of an amount of CSF corresponding to half of the amount of injected air was followed by a significant reactive hyperemic response in two normal patients. The intracranial volumetric alterations during fractional pneumoencephalography are discussed in detail with respect to the underlying physiologic mechanisms and are suggested as a model for acute and low pressure hydrocephalus

  3. Lamb Wave Assessment of Fiber Volume Fraction in Composites (United States)

    Seale, Michael D.; Smith, Barry T.; Prosser, W. H.; Zalameda, Joseph N.


    Among the various techniques available, ultrasonic Lamb waves offer a convenient method of examining composite materials. Since the Lamb wave velocity depends on the elastic properties of a material, an effective tool exists to evaluate composites by measuring the velocity of these waves. Lamb waves can propagate over long distances and are sensitive to the desired in-plane elastic properties of the material. This paper discusses a study in which Lamb waves were used to examine fiber volume fraction variations of approximately 0.40-0.70 in composites. The Lamb wave measurements were compared to fiber volume fractions obtained from acid digestion tests. Additionally, a model to predict the fiber volume fraction from Lamb wave velocity values was evaluated.

  4. Effect of reinforcement volume fraction on the density & elastic ...

    African Journals Online (AJOL)

    Effect of reinforcement volume fraction on the density & elastic parameters of BMG's matrix composites. Wahiba Metiri 1, Fatiha Hadjoub1, 2 and Leila Touati Tliba 1. 1 Laboratoire des Semi-Conducteurs, Département de Physique, Faculté des Sciences, Université Badji-. Mokhtar, BP 12, Annaba -23000, Algeria.

  5. Method and apparatus for probing relative volume fractions (United States)

    Jandrasits, Walter G.; Kikta, Thomas J.


    A relative volume fraction probe particularly for use in a multiphase fluid system includes two parallel conductive paths defining therebetween a sample zone within the system. A generating unit generates time varying electrical signals which are inserted into one of the two parallel conductive paths. A time domain reflectometer receives the time varying electrical signals returned by the second of the two parallel conductive paths and, responsive thereto, outputs a curve of impedance versus distance. An analysis unit then calculates the area under the curve, subtracts the calculated area from an area produced when the sample zone consists entirely of material of a first fluid phase, and divides this calculated difference by the difference between an area produced when the sample zone consists entirely of material of the first fluid phase and an area produced when the sample zone consists entirely of material of a second fluid phase. The result is the volume fraction.

  6. Laser-induced incandescence: Towards quantitative soot volume fraction measurements

    Energy Technology Data Exchange (ETDEWEB)

    Tzannis, A P; Wienbeucker, F; Beaud, P; Frey, H -M; Gerber, T; Mischler, B; Radi, P P [Paul Scherrer Inst. (PSI), Villigen (Switzerland)


    Laser-Induced Incandescence has recently emerged as a versatile tool for measuring soot volume fraction in a wide range of combustion systems. In this work we investigate the essential features of the method. LII is based on the acquisition of the incandescence of soot when heated through a high power laser pulse. Initial experiments have been performed on a model laboratory flame. The behaviour of the LII signal is studied experimentally. By applying numerical calculations we investigate the possibility to obtain two-dimensional soot volume fraction distributions. For this purpose a combination of LII with other techniques is required. This part is discussed in some extent and the future work is outlined. (author) 4 figs., 3 refs.

  7. Gamma ray densitometry techniques for measuring of volume fractions

    Energy Technology Data Exchange (ETDEWEB)

    Affonso, Renato Raoni Werneck; Silva, Ademir Xavier da; Salgado, Cesar Marques, E-mail:, E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)


    Knowledge of the volume fraction in a multiphase flow is of key importance in predicting the performance of many systems and processes. It is therefore an important parameter to characterize such flows. In the context of nuclear techniques, the gamma ray densitometry is promising and this is due to its non-invasive characteristics and very reliable results. It is used in several applications for multiphase flows (water-oil-air), which are employed tools such as: computational fluid dynamics, artificial neural networks and statistical methods of radiation transport, such as the Monte Carlo method. Based on the gamma radiation techniques for measurements of volume fractions, the aim of this paper is to present several techniques developed for this purpose. (author)

  8. Gamma ray densitometry techniques for measuring of volume fractions

    International Nuclear Information System (INIS)

    Affonso, Renato Raoni Werneck; Silva, Ademir Xavier da; Salgado, Cesar Marques


    Knowledge of the volume fraction in a multiphase flow is of key importance in predicting the performance of many systems and processes. It is therefore an important parameter to characterize such flows. In the context of nuclear techniques, the gamma ray densitometry is promising and this is due to its non-invasive characteristics and very reliable results. It is used in several applications for multiphase flows (water-oil-air), which are employed tools such as: computational fluid dynamics, artificial neural networks and statistical methods of radiation transport, such as the Monte Carlo method. Based on the gamma radiation techniques for measurements of volume fractions, the aim of this paper is to present several techniques developed for this purpose. (author)

  9. Absorbed fractions for alpha particles in ellipsoidal volumes

    International Nuclear Information System (INIS)

    Amato, Ernesto; Baldari, Sergio; Italiano, Antonio


    Internal dosimetry of alpha particles is gaining attention due to the increasing applications in cancer treatment and also for the assessment of environmental contamination from radionuclides. We developed a Monte Carlo simulation in GEANT4 in order to calculate the absorbed fractions for monoenergetic alpha particles in the energy interval between 0.1 and 10 MeV, uniformly distributed in ellipsoids made of soft tissue. For each volume, we simulated a spherical shape, three oblate and three prolate ellipsoids, and one scalene shape. For each energy and for every geometrical configuration, an analytical relationship between the absorbed fraction and a ‘generalized radius’ was found; and the dependence of the fit parameters on the alpha energy is discussed and fitted by parametric functions. With the proposed formulation, the absorbed fraction for alpha particles in the energy range explored can be calculated for volumes and for ellipsoidal shapes of practical interest. This method can be applied to the evaluation of absorbed fraction from alpha-emitting radionuclides. The contribution to the deposited energy coming from electron and photon emissions can be accounted for exploiting the specific formulations previously introduced. As an example of application, the dosimetry of 213 Bi and its decay chain in ellipsoids is reported. (paper)

  10. Calculation of Steam Volume Fraction in Subcooled Boiling

    Energy Technology Data Exchange (ETDEWEB)

    Rouhani, S Z


    An analysis of subcooled boiling is presented. It is assumed that heat is removed by vapor generation, heating of the liquid that replaces the detached bubbles, and to some extent by single phase heat transfer. Two regions of subcooled boiling are considered and a criterion is provided for obtaining the limiting value of subcooling between the two regions. Condensation of vapor in the subcooled liquid is analysed and the relative velocity of vapor with respect to the liquid is neglected in these regions. The theoretical arguments result in some equations for the calculation of steam volume fraction and true liquid subcooling.

  11. Microstrain evolution during creep of a high volume fraction superalloy

    Energy Technology Data Exchange (ETDEWEB)

    Ma, S. [Materials Department, New Mexico Tech, Socorro, NM 87801 (United States); Brown, D. [Los Alamos National Laboratory, Los Alamos, NM (United States); Bourke, M.A.M. [Los Alamos National Laboratory, Los Alamos, NM (United States); Daymond, M.R. [Rutherford Appleton Laboratory, ISIS Facility, Chilton, Didcot, Oxon OX11 0QX (United Kingdom); Majumdar, B.S. [Materials Department, New Mexico Tech, Socorro, NM 87801 (United States)]. E-mail:


    The creep of superalloys containing a high volume fraction of {gamma}' phase is significantly influenced by initial misfit and by the evolution of internal stresses. An in situ neutron diffraction technique was used to monitor elastic microstrains in a polycrystalline superalloy, CM247 LC. The misfit was nearly zero at room temperature and it increased to -0.17% at 900 deg. C. These values are rationalized in terms of thermal mismatch using an eigenstrain formulation and a simple formula is derived to relate the thermal mismatch to the misfit strain. During creep at 425 MPa at 900 deg. C, the material exhibited primarily tertiary behavior. For grains with [0 0 1] axis close to the loading direction, the elastic microstrain in the loading direction increased with creep time for the {gamma}' phase, whereas the opposite occurred for the {gamma} phase. These results are explained in terms of constrained deformation in the narrow {gamma} channels and by an interface dislocation buildup. TEM analysis of the crept microstructure provides evidence of the interface dislocation network.

  12. Airborne release fractions/rates and respirable fractions for nonreactor nuclear facilities. Volume 2, Appendices

    International Nuclear Information System (INIS)


    This document contains compiled data from the DOE Handbook on Airborne Release Fractions/Rates and Respirable Fractions for Nonreactor Nuclear facilities. Source data and example facilities utilized, such as the Plutonium Recovery Facility, are included

  13. Real-time particle volume fraction measurement in centrifuges by wireless electrical resistance detector

    International Nuclear Information System (INIS)

    Nagae, Fumiya; Okawa, Kazuya; Matsuno, Shinsuke; Takei, Masahiro; Zhao Tong; Ichijo, Noriaki


    In this study, wireless electrical resistance detector is developed as first step in order to develop electrical resistance tomography (ERT) that are attached wireless communication, and miniaturized. And the particle volume fraction measurement results appropriateness is qualitatively examined. The real-time particle volume fraction measurement is essential for centrifuges, because rotational velocity and supply should be controlled based on the results in order to obtain the effective separation, shorten process time and save energy. However, a technique for the particle volume fraction measurement in centrifuges has not existed yet. In other words, the real-time particle volume fraction measurement in centrifuges becomes innovative technologies. The experiment device reproduces centrifugation in two-phase using particle and salt solution as measuring object. The particle concentration is measured changing rotational velocity, supply and measurement section position. The measured concentration changes coincide with anticipated tendency of concentration changes. Therefore the particle volume fraction measurement results appropriateness are qualitatively indicated. (author)

  14. Comparison of 16-frame and 8-frame gated SPET imaging for determination of left ventricular volumes and ejection fraction

    International Nuclear Information System (INIS)

    Navare, Sachin M.; Liu, Yi-Hwa; Wackers, Frans J.T.


    Electrocardiographic (ECG) gated single-photon emission tomography (SPET) allows for simultaneous assessment of myocardial perfusion and left ventricular (LV) function. Presently 8-frame per cardiac cycle ECG gating of SPET images is standard. The aim of this study was to compare the effect of 8-frame and 16-frame gated SPET on measurements of LV volumes and to evaluate the effects of the presence of myocardial perfusion defects and of radiotracer dose administered on the calculation of LV volumes. A total of 86 patients underwent technetium-99m SPET myocardial perfusion imaging using 16-frame per cardiac cycle acquisition. Eight-frame gated SPET images were generated by summation of contiguous frames. Left ventricular end-diastolic volume (EDV), end-systolic volume (ESV) and ejection fraction (EF) were calculated from the 16-frame and 8-frame data sets. The patients were divided into groups according to the administered dose of the radiotracer and the size of the perfusion defect. Results. Sixteen frame per cardiac cycle acquisition resulted in significantly larger EDV (122±72 ml vs 115±68 ml, P<0.0001), smaller ESV (64±58.6 ml vs 67.6±59.5 ml, P<0.0001), and higher LVEF (55.3%±18% vs 49%±17.4%, P<0.0001) as compared to 8-frame SPET imaging. This effect was seen regardless of whether a high or a low dose was administered and whether or not significant perfusion defects were present. This study shows that EDV, ESV and LVEF determined by 16-frame gated SPET are significantly different from those determined by 8-frame gated SPET. The radiotracer dose and perfusion defects do not affect estimation of LV parameters by 16-frame gated SPET. (orig.)

  15. Nondestructive Determination of Reinforcement Volume Fractions in Particulate Composites : Ultrasonic Method

    International Nuclear Information System (INIS)

    Jeong, Hyun Jo


    A nondestructive ultrasonic technique is presented for estimating the reinforcement volume fractions of particulate composites. The proposed technique employs a theoretical model which accounts for composite microstructures, together with a measurement of ultrasonic velocity to determine the reinforcement volume fractions. The approach is used for a wide range of SiC particulate reinforced Al matrix (SiC p /AI) composites. The method is considered to be reliable in determining the reinforcement volume fractions. The technique could be adopted in a production unit for the quality assessment of the metal matrix particulate composite extrusions

  16. Accuracy of cancellous bone volume fraction measured by micro-CT scanning

    DEFF Research Database (Denmark)

    Ding, Ming; Odgaard, A; Hvid, I


    Volume fraction, the single most important parameter in describing trabecular microstructure, can easily be calculated from three-dimensional reconstructions of micro-CT images. This study sought to quantify the accuracy of this measurement. One hundred and sixty human cancellous bone specimens...... which covered a large range of volume fraction (9.8-39.8%) were produced. The specimens were micro-CT scanned, and the volume fraction based on Archimedes' principle was determined as a reference. After scanning, all micro-CT data were segmented using individual thresholds determined by the scanner...

  17. Determination of bone mineral volume fraction using impedance analysis and Bruggeman model

    Energy Technology Data Exchange (ETDEWEB)

    Ciuchi, Ioana Veronica; Olariu, Cristina Stefania, E-mail:; Mitoseriu, Liliana, E-mail:


    Highlights: • Mineral volume fraction of a bone sample was determined. • Dielectric properties for bone sample and for the collagen type I were determined by impedance spectroscopy. • Bruggeman effective medium approximation was applied in order to evaluate mineral volume fraction of the sample. • The computed values were compared with ones derived from a histogram test performed on SEM micrographs. -- Abstract: Measurements by impedance spectroscopy and Bruggeman effective medium approximation model were employed in order to determine the mineral volume fraction of dry bone. This approach assumes that two or more phases are present into the composite: the matrix (environment) and the other ones are inclusion phases. A fragment of femur diaphysis dense bone from a young pig was investigated in its dehydrated state. Measuring the dielectric properties of bone and its main components (hydroxyapatite and collagen) and using the Bruggeman approach, the mineral volume filling factor was determined. The computed volume fraction of the mineral volume fraction was confirmed by a histogram test analysis based on the SEM microstructures. In spite of its simplicity, the method provides a good approximation for the bone mineral volume fraction. The method which uses impedance spectroscopy and EMA modeling can be further developed by considering the conductive components of the bone tissue as a non-invasive in situ impedance technique for bone composition evaluation and monitoring.

  18. Determination of bone mineral volume fraction using impedance analysis and Bruggeman model

    International Nuclear Information System (INIS)

    Ciuchi, Ioana Veronica; Olariu, Cristina Stefania; Mitoseriu, Liliana


    Highlights: • Mineral volume fraction of a bone sample was determined. • Dielectric properties for bone sample and for the collagen type I were determined by impedance spectroscopy. • Bruggeman effective medium approximation was applied in order to evaluate mineral volume fraction of the sample. • The computed values were compared with ones derived from a histogram test performed on SEM micrographs. -- Abstract: Measurements by impedance spectroscopy and Bruggeman effective medium approximation model were employed in order to determine the mineral volume fraction of dry bone. This approach assumes that two or more phases are present into the composite: the matrix (environment) and the other ones are inclusion phases. A fragment of femur diaphysis dense bone from a young pig was investigated in its dehydrated state. Measuring the dielectric properties of bone and its main components (hydroxyapatite and collagen) and using the Bruggeman approach, the mineral volume filling factor was determined. The computed volume fraction of the mineral volume fraction was confirmed by a histogram test analysis based on the SEM microstructures. In spite of its simplicity, the method provides a good approximation for the bone mineral volume fraction. The method which uses impedance spectroscopy and EMA modeling can be further developed by considering the conductive components of the bone tissue as a non-invasive in situ impedance technique for bone composition evaluation and monitoring

  19. The coupled effect of fiber volume fraction and void fraction on hydraulic fluid absorption of quartz/BMI laminates (United States)

    Hurdelbrink, Keith R.; Anderson, Jacob P.; Siddique, Zahed; Altan, M. Cengiz


    Bismaleimide (BMI) resin with quartz (AQ581) fiber reinforcement is a composite material frequently used in aerospace applications, such as engine cowlings and radomes. Various composite components used in aircrafts are exposed to different types of hydraulic fluids, which may lead to anomalous absorption behavior over the service life of the composite. Accurate predictive models for absorption of liquid penetrants are particularly important as the composite components are often exposed to long-term degradation due to absorbed moisture, hydraulic fluids, or similar liquid penetrants. Microstructural features such as fiber volume fraction and void fraction can have a significant effect on the absorption behavior of fiber-reinforced composites. In this paper, hydraulic fluid absorption characteristics of quartz/BMI laminates fabricated from prepregs preconditioned at different relative humidity and subsequently cured at different pressures are presented. The composite samples are immersed into hydraulic fluid at room temperature, and were not subjected to any prior degradation. To generate process-induced microvoids, prepregs were conditioned in an environmental chamber at 2% or 99% relative humidity at room temperature for a period of 24 hours prior to laminate fabrication. To alter the fiber volume fraction, the laminates were fabricated at cure pressures of 68.9 kPa (10 psi) or 482.6 kPa (70 psi) via a hot-press. The laminates are shown to have different levels of microvoids and fiber volume fractions, which were observed to affect the absorption dynamics considerably and exhibited clear non-Fickian behavior. A one-dimensional hindered diffusion model (HDM) was shown to be successful in predicting the hydraulic fluid absorption. Model prediction indicates that as the fabrication pressure increased from 68.9 kPa to 482.6 kPa, the maximum fluid content (M∞) decreased from 8.0% wt. to 1.0% wt. The degree of non-Fickian behavior, measured by hindrance coefficient (

  20. Performance enhancement of direct ethanol fuel cell using Nafion composites with high volume fraction of titania (United States)

    Matos, B. R.; Isidoro, R. A.; Santiago, E. I.; Fonseca, F. C.


    The present study reports on the performance enhancement of direct ethanol fuel cell (DEFC) at 130 °C with Nafion-titania composite electrolytes prepared by sol-gel technique and containing high volume fractions of the ceramic phase. It is found that for high volume fractions of titania (>10 vol%) the ethanol uptake of composites is largely reduced while the proton conductivity at high-temperatures is weakly dependent on the titania content. Such tradeoff between alcohol uptake and conductivity resulted in a boost of DEFC performance at high temperatures using Nafion-titania composites with high fraction of the inorganic phase.

  1. Influence of titanium volume fraction on the mechanical properties of Mg-Ti composites

    Energy Technology Data Exchange (ETDEWEB)

    Perez, Pablo; Garces, Gerardo; Adeva, Paloma [Centro Nacional de Investigaciones Metalurgicas (CENIM, CSIC), Madrid (Spain). Dept. de Metalurgia Fisica


    The influence of titanium volume fraction on the mechanical properties of Mg-Ti composites prepared through a powder metallurgy route has been evaluated. Titanium was added as particles smaller than 25 {mu}m and volume fractions ranging from 5 to 15%. The increase in the volume fraction of titanium particles results in a slight decrease in the maximum strength. In contrast to this, the ductility of all composites was significantly enhanced by titanium additions. The mechanical properties can be explained on the basis of texture changes induced by the presence of titanium particles. The decrease in the basal texture along the extrusion direction as the amount of titanium is progressively increased accounts for the decrease in the maximum strength. (orig.)

  2. Soot volume fraction fields in unsteady axis-symmetric flames by continuous laser extinction technique. (United States)

    Kashif, Muhammad; Bonnety, Jérôme; Guibert, Philippe; Morin, Céline; Legros, Guillaume


    A Laser Extinction Method has been set up to provide two-dimensional soot volume fraction field time history at a tunable frequency up to 70 Hz inside an axis-symmetric diffusion flame experiencing slow unsteady phenomena preserving the symmetry. The use of a continuous wave laser as the light source enables this repetition rate, which is an incremental advance in the laser extinction technique. The technique is shown to allow a fine description of the soot volume fraction field in a flickering flame exhibiting a 12.6 Hz flickering phenomenon. Within this range of repetition rate, the technique and its subsequent post-processing require neither any method for time-domain reconstruction nor any correction for energy intrusion. Possibly complemented by such a reconstruction method, the technique should support further soot volume fraction database in oscillating flames that exhibit characteristic times relevant to the current efforts in the validation of soot processes modeling.

  3. Dosimetric impact of prostate volume change between CT-based HDR brachytherapy fractions

    International Nuclear Information System (INIS)

    Kim, Yongbok; Hsu, I-C.; Lessard, Etienne; Vujic, Jasmina; Pouliot, Jean


    Purpose: The objective is to evaluate the prostate volume change and its dosimetric consequences after the insertion of catheters for high-dose-rate brachytherapy. Methods and Materials: For 13 consecutive patients, a spiral CT scan was acquired before each of the 2 fractions, separated on average by 20 hours. The coordinates of the catheters were obtained on 3 axial CT slices corresponding to apex, mid portion, and base portion of the prostate. A mathematical expansion model was used to evaluate the change of prostate volumes between the 2 fractions. It is based on the difference in the cube of the average distance between the centroid and catheter positions. The variation of implant dose-volume histograms between fractions was computed for plans produced by either inverse planning based on simulated annealing or geometric optimization. Results: The average magnitude of either increase or reduction in prostate volume was 7.8% (range, 2-17%). This volume change corresponds to an average prostate radius change of only 2.5% (range, 0.7-5.4%). For 5 patients, the prostate volume increased on average by 9% (range, 2-17%), whereas a reduction was observed for 8 patients by an average of 7% (range, 2-13%). More variation was observed at the prostate base than at mid or apex gland. The comparison of implant dose-volume histograms showed a small reduction of V100 receiving the prescription dose, with an average of 3.5% (range, 0.5-12%) and 2.2% (range, 1-6%) for inverse planning based on our simulated annealing and geometric optimization plans, respectively. Conclusion: Small volume change was observed between treatment fractions. This translates into small changes in dose delivered to the prostate volume

  4. Effect of Fiber Volume Fraction and Water Absorption toward Bending Strength of Coconut Filters/ Polyester Composite

    Directory of Open Access Journals (Sweden)

    I Putu Lokantara


    Full Text Available The variation of fibre volume and the duration of water soaking take influence on the mechanical properties of composite. This research aim is to know the influence of fraction volume fibre and soaking duration on the mineral watertoward the tensile strength and flexural of polyester-coconut-tapis composite. This research used coconut-tapis fibre which is cut 1 cm in length with 0%, 5%, 7,5%, and 10% fiber volume fraction, unsaturated-polyester (UPRs matrix resin type Yucalac 157 BQTN-EX, and MEKPO hardener. The flexure specimen are made by press hand lay-up method and cut according ASTM D790-03 for the flexure test. The result of flexure test shows that the duration of soaking and the fiber volume fraction give a significant effect on the flexural strength of composite. The highest strength are reached by composite with 10% fibre volume on 48 hour soaking time equal to 41.994 MPa. The flexure modulus happenend shows increasing until 24 hour soaking time. The highest modulus are reached by composite with 10% fibre volume equal to 7.114 GPa while the lowest are reached by composite with 0% fibre volume equal to 3,023 GPa.

  5. Volume fraction calculation in multiphase system such as oil-water-gas using neutron

    Energy Technology Data Exchange (ETDEWEB)

    Ramos, Robson; Brandao, Luis E.B.; Salgado, Cesar Marques; Pereira, Claudio M.N.A. [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)]. E-mails:;;;; Schirru, Roberto; Silva, Ademir Xavier da [Universidade Federal, Rio de Janeiro, RJ (Brazil). Coordenacao dos Programas de Pos-graduacao de Engenharia. Programa de Engenharia Nuclear]. E-mails:;


    Multi-phase flows are common in diverse industrial sectors and the attainment of the volume fraction of each element that composes the flow system presents difficulties for the engineering process, therefore, to determine them is very important. In this work is presented methodology for determination of volume fractions in annular three-phase flow systems, such as oil-water-gas, based on the use of nuclear techniques and artificial intelligence. Using the principle of the fast-neutron transmission/scattering, come from an isotopic {sup 241}Am-Be source, and two point detectors, is gotten measured that they are influenced by the variations of the volume fractions of each phase present in the flow. An artificial neural network is trained to correlate such measures with the respective volume fractions. In order to get the data for training of the artificial neural network without necessity to carry through experiments, MCNP-X code is used, that simulates computational of the neutrons transport. The methodology is sufficiently advantageous, therefore, allows to develop a measurement system capable to determine the fractions of the phases (oil-water-gas), with proper requirements of each petroliferous installation and with national technology contributing, possibly, with reduction of costs and increase of productivity. (author)

  6. Volume fraction calculation in multiphase system such as oil-water-gas using neutron

    International Nuclear Information System (INIS)

    Ramos, Robson; Brandao, Luis E.B.; Salgado, Cesar Marques; Pereira, Claudio M.N.A.; Schirru, Roberto; Silva, Ademir Xavier da


    Multi-phase flows are common in diverse industrial sectors and the attainment of the volume fraction of each element that composes the flow system presents difficulties for the engineering process, therefore, to determine them is very important. In this work is presented methodology for determination of volume fractions in annular three-phase flow systems, such as oil-water-gas, based on the use of nuclear techniques and artificial intelligence. Using the principle of the fast-neutron transmission/scattering, come from an isotopic 241 Am-Be source, and two point detectors, is gotten measured that they are influenced by the variations of the volume fractions of each phase present in the flow. An artificial neural network is trained to correlate such measures with the respective volume fractions. In order to get the data for training of the artificial neural network without necessity to carry through experiments, MCNP-X code is used, that simulates computational of the neutrons transport. The methodology is sufficiently advantageous, therefore, allows to develop a measurement system capable to determine the fractions of the phases (oil-water-gas), with proper requirements of each petroliferous installation and with national technology contributing, possibly, with reduction of costs and increase of productivity. (author)

  7. Pancreas volume and fat fraction in children with Type 1 diabetes. (United States)

    Regnell, S E; Peterson, P; Trinh, L; Broberg, P; Leander, P; Lernmark, Å; Månsson, S; Elding Larsson, H


    People with Type 1 diabetes have smaller pancreases than healthy individuals. Several diseases causing pancreatic atrophy are associated with pancreatic steatosis, but pancreatic fat in Type 1 diabetes has not been measured. This cross-sectional study aimed to compare pancreas size and fat fraction in children with Type 1 diabetes and controls. The volume and fat fraction of the pancreases of 22 children with Type 1 diabetes and 29 controls were determined using magnetic resonance imaging. Pancreas volume was 27% smaller in children with diabetes (median 34.9 cm(3) ) than in controls (47.8 cm(3) ; P Pancreas volume correlated positively with age in controls (P = 0.033), but not in children with diabetes (P = 0.649). Pancreas volume did not correlate with diabetes duration, but it did correlate positively with units of insulin/kg body weight/day (P = 0.048). A linear model of pancreas volume as influenced by age, body surface area and insulin units/kg body weight/day found that insulin dosage correlated with pancreas volume after controlling for both age and body surface area (P = 0.009). Pancreatic fat fraction was not significantly different between the two groups (1.34% vs. 1.57%; P = 0.891). Our findings do not indicate that pancreatic atrophy in Type 1 diabetes is associated with an increased pancreatic fat fraction, unlike some other diseases featuring reduced pancreatic volume. We speculate that our results may support the hypotheses that much of pancreatic atrophy in Type 1 diabetes occurs before the clinical onset of the disease and that exogenous insulin administration decelerates pancreatic atrophy after diabetes onset. © 2016 Diabetes UK.

  8. Influence of bress laminate volume fraction on electromechanical properties of externally laminated coated conductor tapes

    Energy Technology Data Exchange (ETDEWEB)

    Bautista, Zhierwinjay M.; Shin, Hyung Seop [Dept. of Mechanical Design Engineering, Andong National University, Andong (Korea, Republic of); Lee, Jae Hun; Lee, Hun Ju; Moon, Seung Hyun [SuNAM Co Ltd., Anseong (Korea, Republic of)


    The enhancement of mechanical properties of coated conductor (CC) tapes in practical application are usually achieved by reinforcing through lamination or electroplating metal layers on either sides of the CC tape. Mechanical or electromechanical properties of the CC tapes have been largely affected by the lamination structure under various loading modes such as tension, bending or even cyclic. In this study, the influence of brass laminate volume fraction on electromechanical properties of RCE-DR processed Gadolinium-barium-copper-oxide (GdBCO) CC tapes was investigated. The samples used were composed of single-side and both-side laminate of brass layer to the Cu-stabilized CC tape and their Ic behaviors were compared to those of the Cu-stabilized CC tape without external lamination. The stress/strain dependences of Ic in laminated CC tapes under uniaxial tension were analyzed and the irreversible stress/strain limits were determined. As a result, the increase of brass laminate volume fraction initially increased the irreversible strain limit and became gradual. The corresponding irreversible stress limit, however, showed no difference even though the brass laminate volume fraction increased to 3.4. But the irreversible load limit linearly increased with the brass laminate volume fraction.

  9. Thermosetting resins with high fractions of free volume and inherently low dielectric constants. (United States)

    Lin, Liang-Kai; Hu, Chien-Chieh; Su, Wen-Chiung; Liu, Ying-Ling


    This work demonstrates a new class of thermosetting resins, based on Meldrum's acid (MA) derivatives, which have high fractions of free volume and inherently low k values of about 2.0 at 1 MHz. Thermal decomposition of the MA groups evolves CO2 and acetone to create air-trapped cavities so as to reduce the dielectric constants.

  10. Volume fraction dependence and reorganization in cluster-cluster aggregation processes

    NARCIS (Netherlands)

    Garderen, van H.F.; Dokter, W.H.; Beelen, T.P.M.; Santen, van R.A.; Pantos, E.; Michels, M.A.J.; Hilbers, P.A.J.


    Off-lattice diffusion limited cluster aggregation simulations in two dimensions have been performed in a wide volume fraction range between 0.001 and 0.60. Starting from a system of 10 000 monomers with radius 0.5, that follow Brownian trajectories, larger aggregates are generated by bond formation

  11. Planar measurements of soot volume fraction and OH in a JP-8 pool fire

    Energy Technology Data Exchange (ETDEWEB)

    Henriksen, Tara L.; Ring, Terry A.; Eddings, Eric G. [Department of Chemical Engineering, University of Utah, Salt Lake City, UT 84112 (United States); Nathan, Graham J. [School of Mechanical Engineering, University of Adelaide, SA 5005 (Australia); Alwahabi, Zeyad T.; Qamar, Nader [School of Chemical Engineering, University of Adelaide, SA 5005 (Australia)


    The simultaneous measurement of soot volume fraction by laser induced incandescence (LII) and qualitative imaging of OH by laser induced fluorescence (LIF) was performed in a JP-8 pool fire contained in a 152 mm diameter pan. Line of sight extinction was used to calibrate the LII system in a laminar flame, and to provide an independent method of measuring average soot volume fraction in the turbulent flame. The presence of soot in the turbulent flame was found to be approximately 50% probable, resulting in high levels of optical extinction, which increased slightly through the flame from approximately 30% near the base, to approximately 50% at the tip. This high soot loading pushes both techniques toward their detection limit. Nevertheless, useful accuracy was obtained, with the LII measurement of apparent extinction in the turbulent flame being approximately 21% lower than a direct measurement, consistent with the influence of signal trapping. The axial and radial distributions of soot volume fraction are presented, along with PDFs of volume fraction, and new insight into the behavior of soot sheets in pool fires are sought from the simultaneous measurements of OH and LII. (author)

  12. Study of volume fractions on biphasic stratified regime using gamma ray

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, William L.; Brandão, Luis E.B., E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)


    In the oil industries, interconnected pipelines are used to carry large quantities of petroleum and its byproducts. This modal has an advantage because they are more economical, eliminate a need for stocks and, in addition, great safety in operation minimizing a possibility of loss or theft when transported another way. In many cases, especially in the petrochemical industry, the same pipeline is used to carry more than one type of product. They are called poliduct. In the operation of a poliduct there is a sequence of products to be transported and during the exchange of the product, there are still fractions of the previous product and this generates contamination. It is therefore important to identify precisely this region in order to reduce the costs of reprocessing and treatment of discarded products. In this way, this work presents a methodology to evaluate the sensitivity of the gamma densitometry technique in a study of the calculation of volume fractions in biphasic systems, submitted to the stratified flow regime. Using computational simulations using the Monte Carlo Method with the MCNPX code measurement geometry was proposed that presented a higher sensitivity for the calculation of volume fractions. The relevant technical data to perform a simulation of the scintillator detectors were based on information obtained from the gammagraphy technique. The study had a theoretical validation through analytical equations, and the results show that it is possible to identify volume fractions equivalent to 3%. (author)

  13. Study of volume fractions on biphasic stratified regime using gamma ray

    International Nuclear Information System (INIS)

    Salgado, William L.; Brandão, Luis E.B.


    In the oil industries, interconnected pipelines are used to carry large quantities of petroleum and its byproducts. This modal has an advantage because they are more economical, eliminate a need for stocks and, in addition, great safety in operation minimizing a possibility of loss or theft when transported another way. In many cases, especially in the petrochemical industry, the same pipeline is used to carry more than one type of product. They are called poliduct. In the operation of a poliduct there is a sequence of products to be transported and during the exchange of the product, there are still fractions of the previous product and this generates contamination. It is therefore important to identify precisely this region in order to reduce the costs of reprocessing and treatment of discarded products. In this way, this work presents a methodology to evaluate the sensitivity of the gamma densitometry technique in a study of the calculation of volume fractions in biphasic systems, submitted to the stratified flow regime. Using computational simulations using the Monte Carlo Method with the MCNPX code measurement geometry was proposed that presented a higher sensitivity for the calculation of volume fractions. The relevant technical data to perform a simulation of the scintillator detectors were based on information obtained from the gammagraphy technique. The study had a theoretical validation through analytical equations, and the results show that it is possible to identify volume fractions equivalent to 3%. (author)

  14. Crystallization of sheared hard spheres at 64.5% volume fraction (United States)

    Swinney, H. L.; Rietz, F.; Schroeter, M.; Radin, C.


    A classic experiment by G.D. Scott Nature 188, 908, 1960) showed that pouring balls into a rigid container filled the volume to an upper limit of 64% of the container volume, which is well below the 74% volume fraction filled by spheres in a hexagonal close packed (HCP) or face center cubic (FCC) lattice. Subsequent experiments have confirmed a ``random closed packed'' (RCP) fraction of about 64%. However, the physics of the RCP limit has remained a mystery. Our experiment on a cubical box filled with 49400 weakly sheared glass spheres reveals a first order phase transition from a disordered to an ordered state at a volume fraction of 64.5%. The ordered state consists of crystallites of mixed FCC and HCP symmetry that coexist with the amorphous bulk. The transition is initiated by homogeneous nucleation: in the shearing process small crystallites with about ten or fewer spheres dissolve, while larger crystallites grow. A movie illustrates the crystallization process. German Academic Exchange Service (DAAD), German Research Foundation (DFG), NSF DMS, and R.A. Welch Foundation.

  15. Models for high cell density bioreactors must consider biomass volume fraction: Cell recycle example. (United States)

    Monbouquette, H G


    Intrinsic models, which take into account biomass volume fraction, must be formulated for adequate simulation of high-biomass-density fermentations with cell recycle. Through comparison of corresponding intrinsic and non-intrinsic models in dimensionless form, constraints for non-intrinsic model usage in terms of biokinetic and fermenter operating parameters can be identified a priori. Analysis of a simple product-inhibition model indicates that the non-intrinsic approach is suitable only when the attainable biomass volume fraction in the fermentation broth is less than about 0.10. Inappropriate application of a non-intrinsic model can lead to gross errors in calculated substrate and product concentrations, substrate conversion, and volumetric productivity.

  16. Models for high cell density bioreactors must consider biomass volume fraction: cell recycle example

    Energy Technology Data Exchange (ETDEWEB)

    Monbouquette, H.G.


    Intrinsic models, which take into account biomass volume fraction, must be formulated for adequate simulation of high-biomass-density fermentations with cell recycle. Through comparison of corresponding intrinsic and non-intrinsic models in dimensionless form, constraints for non-intrinsic model usage in terms of biokinetic and fermenter operating parameters can be identified a priori. Analysis of a simple product-inhibition model indicates that the non-intrinsic approach is suitable only when the attainable biomass volume fraction in the fermentation broth is less than about 0.10. Inappropriate application of a non-intrinsic model can lead to gross errors in calculated substrate and product concentrations, substrate conversion, and volumetric productivity. (Refs. 14).

  17. Damping behavior of polymer composites with high volume fraction of NiMnGa powders (United States)

    Sun, Xiaogang; Song, Jie; Jiang, Hong; Zhang, Xiaoning; Xie, Chaoying


    Polymer composites inserted with high volume fraction (up to 70 Vol%) of NiMnGa powders were fabricated and their damping behavior was investigated by dynamic mechanical analysis. It is found that the polymer matrix has little influence on the transformation temperatures of NiMnGa powders. A damping peak appears for NiMnGa/epoxy resin (EP) composites accompanying with the martensitic transformation or reverse martensitic transformation of NiMnGa powders during cooling or heating. The damping capacity for NiMnGa/EP composites increases linearly with the increase of volume fraction of NiMnGa powders and, decreases dramatically as the test frequency increases. The fracture strain of NiMnGa/EP composites decrease with the increase of NiMnGa powders.

  18. Atomic force microscopy imaging to measure precipitate volume fraction in nickel-based superalloys

    International Nuclear Information System (INIS)

    Bourhettar, A.; Troyon, M.; Hazotte, A.


    In nickel-based superalloys, quantitative analysis of scanning electron microscopy images fails in providing accurate microstructural data, whereas more efficient techniques are very time-consuming. As an alternative approach, the authors propose to perform quantitative analysis of atomic force microscopy images of polished/etched surfaces (quantitative microprofilometry). This permits the measurement of microstructural parameters and the depth of etching, which is the main source of measurement bias. Thus, nonbiased estimations can be obtained by extrapolation of the measurements up to zero etching depth. In this article, the authors used this approach to estimate the volume fraction of γ' precipitates in a nickel-based superalloy single crystal. Atomic force microscopy images of samples etched for different times show definition, homogeneity, and contrast high enough to perform image analysis. The result after extrapolation is in very good agreement with volume fraction values available from published reports

  19. Volume Fraction Dependent Thermal Performance of UAlx-Al Dispersion Target

    Energy Technology Data Exchange (ETDEWEB)

    Kong, Eui Hyun; Tahk, Young Wook; Kim, Hyun Jung; Oh, Jae Yong; Yim, Jeong Sik [KAERI, Daejeon (Korea, Republic of)


    Unlike U-Al alloys, properties of UAl{sub x}-Al dispersion target can be highly sensitive to volume fraction of UAlx in a target meat due to the interface resistance between target particles and matrix. The interface resistance effects on properties of the target meat including thermal conductivity, thermal expansion coefficient, specific heat, elastic modulus and so on. Thermal performances of a dispersion target meat were theoretically evaluated under normal operation condition of KJRR (Kijang Research Reactor) during short effective full power days (EFPD) of 7 days, based on reported measured thermal conductivities of UAl{sub x}-Al dispersion fuels. Effective thermal conductivity determines maximum temperature of dispersion target plate. And for that volume fraction of UAlx in target meat has to be determined considering manufacturing of target plate without degradation of physical and mechanical characteristics.

  20. Effects of morphology and wavelength on the measurement accuracy of soot volume fraction by laser extinction (United States)

    Wang, Ya-fei; Huang, Qun-xing; Wang, Fei; Chi, Yong; Yan, Jian-hua


    A novel method to evaluate the quantitative effects of soot morphology and incident wavelength on the measurement accuracy of soot volume fraction, by the laser extinction (LE) technique is proposed in this paper. The results indicate that the traditional LE technique would overestimate soot volume fraction if the effects of morphology and wavelength are not considered. Before the agglomeration of isolated soot primary particles, the overestimation of the LE technique is in the range of 2-20%, and rises with increasing primary particle diameter and with decreasing incident wavelength. When isolated primary particles are agglomerated into fractal soot aggregates, the overestimation would exceed 30%, and rise with increasing primary particle number per soot aggregate, fractal dimension and fractal prefactor and with decreasing incident wavelength to a maximum value of 55%. Finally, based on these results above, the existing formula of the LE technique gets modified, and the modification factor is 0.65-0.77.

  1. The equivalent electrical permittivity of gas-solid mixtures at intermediate solid volume fractions.

    Energy Technology Data Exchange (ETDEWEB)

    Torczynski, John Robert; Ceccio, Steven Louis; Tortora, Paul Richard


    Several mixture models are evaluated for their suitability in predicting the equivalent permittivity of dielectric particles in a dielectric medium for intermediate solid volume fractions (0.4 to 0.6). Predictions of the Maxwell, Rayleigh, Bottcher and Bruggeman models are compared to computational simulations of several arrangements of solid particles in a gas and to the experimentally determined permittivity of a static particle bed. The experiment uses spherical glass beads in air, so air and glass permittivity values (1 and 7, respectively) are used with all of the models and simulations. The experimental system used to measure the permittivity of the static particle bed and its calibration are described. The Rayleigh model is found to be suitable for predicting permittivity over the entire range of solid volume fractions (0-0.6).

  2. Thermal Diffusivity and Thermal Conductivity of Dispersed Glass Sphere Composites Over a Range of Volume Fractions (United States)

    Carson, James K.


    Glass spheres are often used as filler materials for composites. Comparatively few articles in the literature have been devoted to the measurement or modelling of thermal properties of composites containing glass spheres, and there does not appear to be any reported data on the measurement of thermal diffusivities over a range of filler volume fractions. In this study, the thermal diffusivities of guar-gel/glass sphere composites were measured using a transient comparative method. The addition of the glass beads to the gel increased the thermal diffusivity of the composite, more than doubling the thermal diffusivity of the composite relative to the diffusivity of the gel at the maximum glass volume fraction of approximately 0.57. Thermal conductivities of the composites were derived from the thermal diffusivity measurements, measured densities and estimated specific heat capacities of the composites. Two approaches to modelling the effective thermal diffusivity were considered.

  3. Volume fraction dependence of transient absorption signal and nonlinearities in metal nanocolloids

    International Nuclear Information System (INIS)

    Jayabalan, J; Singh, Asha; Khan, Salahuddin; Chari, Rama


    Electron–lattice thermalization dynamics in metal nanoparticles or in bulk metal is usually estimated by measuring the decay time of the change in transmission following an optical excitation. Such measurements can be performed in transient absorption geometry using a femtosecond laser. We find that for silver nanoplatelet/water colloids, the decay time of the transient absorption depends on the volume fraction of silver in water. By estimating the volume fraction dependence of nonlinearities in the same samples, we show that the variation in the measured decay time is due to pump-depletion effects present in the sample. The correct correction factor for taking into account pump-depletion effects in fifth- and higher-order nonlinearities is also presented. (paper)

  4. Volume fraction prediction in biphasic flow using nuclear technique and artificial neural network

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, Cesar M.; Brandao, Luis E.B., E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)


    The volume fraction is one of the most important parameters used to characterize air-liquid two-phase flows. It is a physical value to determine other parameters, such as the phase's densities and to determine the flow rate of each phase. These parameters are important to predict the flow pattern and to determine a mathematical model for the system. To study, for example, heat transfer and pressure drop. This work presents a methodology for volume fractions prediction in water-gas stratified flow regime using the nuclear technique and artificial intelligence. The volume fractions calculate in biphasic flow systems is complex and the analysis by means of analytical equations becomes very difficult. The approach is based on gamma-ray pulse height distributions pattern recognition by means of the artificial neural network. The detection system uses appropriate broad beam geometry, comprised of a ({sup 137}Cs) energy gamma-ray source and a NaI(Tl) scintillation detector in order measure transmitted beam whose the counts rates are influenced by the phases composition. These distributions are directly used by the network without any parameterization of the measured signal. The ideal and static theoretical models for stratified regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the network. The detector also was modeled with this code and the results were compared to experimental photopeak efficiency measurements of radiation sources. The proposed network could obtain with satisfactory prediction of the volume fraction in water-gas system, demonstrating to be a promising approach for this purpose. (author)

  5. Volume fraction prediction in biphasic flow using nuclear technique and artificial neural network

    International Nuclear Information System (INIS)

    Salgado, Cesar M.; Brandao, Luis E.B.


    The volume fraction is one of the most important parameters used to characterize air-liquid two-phase flows. It is a physical value to determine other parameters, such as the phase's densities and to determine the flow rate of each phase. These parameters are important to predict the flow pattern and to determine a mathematical model for the system. To study, for example, heat transfer and pressure drop. This work presents a methodology for volume fractions prediction in water-gas stratified flow regime using the nuclear technique and artificial intelligence. The volume fractions calculate in biphasic flow systems is complex and the analysis by means of analytical equations becomes very difficult. The approach is based on gamma-ray pulse height distributions pattern recognition by means of the artificial neural network. The detection system uses appropriate broad beam geometry, comprised of a ( 137 Cs) energy gamma-ray source and a NaI(Tl) scintillation detector in order measure transmitted beam whose the counts rates are influenced by the phases composition. These distributions are directly used by the network without any parameterization of the measured signal. The ideal and static theoretical models for stratified regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the network. The detector also was modeled with this code and the results were compared to experimental photopeak efficiency measurements of radiation sources. The proposed network could obtain with satisfactory prediction of the volume fraction in water-gas system, demonstrating to be a promising approach for this purpose. (author)

  6. Left ventricular ejection fraction and volumes as measured by 3D echocardiography and ultrafast computed tomography

    International Nuclear Information System (INIS)

    Vieira, Marcelo Luiz Campos; Nomura, Cesar H.; Tranchesi Junior, Bernardino; Oliveira, Wercules A. de; Naccarato, Gustavo; Serpa, Bruna S.; Passos, Rodrigo B.D.; Funari, Marcelo B. G.; Fischer, Claudio H.; Morhy, Samira S.


    Background: Real-time three-dimensional echocardiography (RT-3D-Echo) and ultrafast computed tomography (CT) are two novel methods for the analysis of LV ejection fraction and volumes. Objective: To compare LVEF and volume measurements as obtained using RT-3D-Echo and ultrafast CT. Methods: Thirty nine consecutive patients (27 men, mean age of 57+- 12 years) were studied using RT-3D-Echo and 64-slice ultrafast CT. LVEF and LV volumes were analyzed. Statistical analysis: coefficient of correlation (r: Pearson), Bland-Altman analysis, linear regression analysis, 95% CI, p 5 .58)%; end-diastolic volume ranged from 49.6 to 178.2 (87+-27.8) ml; end-systolic volume ranged from 11.4 to 78 (33.1+-13.6) ml. CT scan measurements: LVEF ranged from 53 to 86% (67.8+-7.78); end-diastolic volume ranged from 51 to 186 (106.5+-30.3) ml; end-systolic volume ranged from 7 to 72 (35.5+-13.4)ml. Correlations between RT-3D-Echo and CT were: LVEF (r: 0.7888, p<0.0001, 95% CI 0.6301 to 0.8843); end-diastolic volume (r: 0.7695, p<0.0001, 95% CI 0.5995 to 0.8730); end-systolic volume (r: 0.8119, p<0.0001, 95% CI 0.6673 to 0.8975). Conclusion: Good correlation between LVEF and ventricular volume parameters as measured by RT-3D-Echo and 64-slice ultrafast CT was found in the present case series. (author)

  7. Modeling the Effect of Glass Microballoon (GMB) Volume Fraction on Behavior of Sylgard/GMB Composites.

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Judith Alice [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Long, Kevin Nicholas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)


    This work was done to support customer questions about whether a Sylgard/Glass Microballoon (GMB) potting material in current use could be replaced with pure Sylgard and if this would significantly change stresses imparted to internal components under thermal cycling conditions. To address these questions, we provide micromechanics analysis of Sylgard/GMB materials using both analytic composite theory and finite element simulations to better understand the role of the GMB volume fraction in determining thermal expansion coefficient, elastic constants, and behavior in both confined and unconfined compression boundary value problems. A key finding is that damage accumulation in the material from breakage of GMBs significantly limits the global stress magnitude and results in a plateau stress behavior over large ranges of compressive strain. The magnitude of this plateau stress is reduced with higher volume fractions of GMBs. This effect is particularly pronounced in confined compression, which we estimate bears the most similarity to the application of interest. This stress-limiting damage mechanism is not present in pure Sylgard, however, and the result is much higher stresses under confined compression. Thus, we recommend that some volume fraction greater than 10% GMBs be used for confined deformation applications.

  8. Controlling thermal deformation by using composite materials having variable fiber volume fraction

    International Nuclear Information System (INIS)

    Bouremana, M.; Tounsi, A.; Kaci, A.; Mechab, I.


    In application, many thin structural components such as beams, plates and shells experience a through-thickness temperature variation. This temperature variation can produce both an in-plane expansion and an out-of-plane (bending) curvature. Given that these thin components interact with or connect to other components, we often wish to minimize the thermal deformation or match the thermal deformation of another component. This is accomplished by using a composite whose fibers have a negative axial thermal expansion coefficient. By varying the fiber volume fraction within a symmetric laminated beam to create a functionally graded material (FGM), certain thermal deformations can be controlled or tailored. Specifically, a beam can be designed which does not curve under a steady-state through-thickness temperature variation. Continuous gradation of the fiber volume fraction in the FGM layer is modelled in the form of a mth power polynomial of the coordinate axis in thickness direction of the beam. The beam results are independent of the actual temperature values, within the limitations of steady-state heat transfer and constant material properties. The influence of volume fiber fraction distributions are studied to match or eliminate an in-plane expansion coefficient, or to match a desired axial stiffness. Combining two fiber types to create a hybrid FGM can offer desirable increase in axial and bending stiffness while still retaining the useful thermal deformation behavior.

  9. A framework to measure myocardial extracellular volume fraction using dual-phase low dose CT images

    International Nuclear Information System (INIS)

    Liu, Yixun; Summers, Ronald M.; Yao, Jianhua; Liu, Songtao; Sibley, Christopher T.; Bluemke, David A.; Nacif, Marcelo S.


    Purpose: Myocardial extracellular volume fraction (ECVF) is a surrogate imaging biomarker of diffuse myocardial fibrosis, a hallmark of pathologic ventricular remodeling. Low dose cardiac CT is emerging as a promising modality to detect diffuse interstitial myocardial fibrosis due to its fast acquisition and low radiation; however, the insufficient contrast in the low dose CT images poses great challenge to measure ECVF from the image. Methods: To deal with this difficulty, the authors present a complete ECVF measurement framework including a point-guided myocardial modeling, a deformable model-based myocardium segmentation, nonrigid registration of pre- and post-CT, and ECVF calculation. Results: The proposed method was evaluated on 20 patients by two observers. Compared to the manually delineated reference segmentations, the accuracy of our segmentation in terms of true positive volume fraction (TPVF), false positive volume fraction (FPVF), and average surface distance (ASD), were 92.18% ± 3.52%, 0.31% ± 0.10%, 0.69 ± 0.14 mm, respectively. The interobserver variability measured by concordance correlation coefficient regarding TPVF, FPVF, and ASD were 0.95, 0.90, 0.94, respectively, demonstrating excellent agreement. Bland-Altman method showed 95% limits of agreement between ECVF at CT and ECVF at MR. Conclusions: The proposed framework demonstrates its efficiency, accuracy, and noninvasiveness in ECVF measurement and dramatically advances the ECVF at cardiac CT toward its clinical use

  10. Salinity independent volume fraction prediction in water-gas-oil multiphase flows using artificial neural networks

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, C.M.; Pereira, Claudio M.N.A.; Brandao, Luis E.B., E-mail:, E-mail:, E-mail: [Instituto de Engenharia Nuclear (DIRA/IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Div. de Radiofarmacos


    This work investigates the response of a volume fraction prediction system for water-gas-oil multiphase flows considering variations on water salinity. The approach is based on gamma-ray pulse height distributions pattern recognition by means the artificial neural networks (ANNs). The detection system uses appropriate fan beam geometry, comprised of a dual-energy gamma-ray source and two NaI(Tl) detectors adequately positioned outside the pipe in order measure transmitted and scattered beams. An ideal and static theoretical model for annular flow regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the ANN. More than 500 simulations have been done, in which water salinity have been ranged from 0 to 16% in order to cover a most practical situations. Validation tests have included values of volume fractions and water salinity different from those used in ANN training phase. The results presented here show that the proposed approach may be successfully applied to material volume fraction prediction on watergas- oil multiphase flows considering practical (real) levels of variations in water salinity. (author)

  11. Salinity independent volume fraction prediction in water-gas-oil multiphase flows using artificial neural networks

    International Nuclear Information System (INIS)

    Salgado, C.M.; Pereira, Claudio M.N.A.; Brandao, Luis E.B.


    This work investigates the response of a volume fraction prediction system for water-gas-oil multiphase flows considering variations on water salinity. The approach is based on gamma-ray pulse height distributions pattern recognition by means the artificial neural networks (ANNs). The detection system uses appropriate fan beam geometry, comprised of a dual-energy gamma-ray source and two NaI(Tl) detectors adequately positioned outside the pipe in order measure transmitted and scattered beams. An ideal and static theoretical model for annular flow regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the ANN. More than 500 simulations have been done, in which water salinity have been ranged from 0 to 16% in order to cover a most practical situations. Validation tests have included values of volume fractions and water salinity different from those used in ANN training phase. The results presented here show that the proposed approach may be successfully applied to material volume fraction prediction on watergas- oil multiphase flows considering practical (real) levels of variations in water salinity. (author)

  12. A framework to measure myocardial extracellular volume fraction using dual-phase low dose CT images

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yixun; Summers, Ronald M.; Yao, Jianhua, E-mail: [Clinical Image Processing Service, Radiology and Imaging Sciences, NIH Clinical Center, Bethesda, Maryland 20892 (United States); Liu, Songtao; Sibley, Christopher T.; Bluemke, David A. [Radiology and Imaging Sciences, NIH Clinical Center, Bethesda, Maryland 20892-1182 and Molecular Biomedical Imaging Laboratory, National Institute of Biomedical Imaging and Bioengineering, NIH Clinical Center, Bethesda, Maryland 20892 (United States); Nacif, Marcelo S. [Radiology and Imaging Sciences, NIH Clinical Center, Bethesda, Maryland 20892-1182 (United States)


    Purpose: Myocardial extracellular volume fraction (ECVF) is a surrogate imaging biomarker of diffuse myocardial fibrosis, a hallmark of pathologic ventricular remodeling. Low dose cardiac CT is emerging as a promising modality to detect diffuse interstitial myocardial fibrosis due to its fast acquisition and low radiation; however, the insufficient contrast in the low dose CT images poses great challenge to measure ECVF from the image. Methods: To deal with this difficulty, the authors present a complete ECVF measurement framework including a point-guided myocardial modeling, a deformable model-based myocardium segmentation, nonrigid registration of pre- and post-CT, and ECVF calculation. Results: The proposed method was evaluated on 20 patients by two observers. Compared to the manually delineated reference segmentations, the accuracy of our segmentation in terms of true positive volume fraction (TPVF), false positive volume fraction (FPVF), and average surface distance (ASD), were 92.18% ± 3.52%, 0.31% ± 0.10%, 0.69 ± 0.14 mm, respectively. The interobserver variability measured by concordance correlation coefficient regarding TPVF, FPVF, and ASD were 0.95, 0.90, 0.94, respectively, demonstrating excellent agreement. Bland-Altman method showed 95% limits of agreement between ECVF at CT and ECVF at MR. Conclusions: The proposed framework demonstrates its efficiency, accuracy, and noninvasiveness in ECVF measurement and dramatically advances the ECVF at cardiac CT toward its clinical use.

  13. Soot volume fraction in a piloted turbulent jet non-premixed flame of natural gas

    Energy Technology Data Exchange (ETDEWEB)

    Qamar, N.H.; Alwahabi, Z.T.; King, K.D. [Fluid Mechanics, Energy and Combustion Group, University of Adelaide, Adelaide, SA 5005 (Australia); School of Chemical Engineering, University of Adelaide, Adelaide, SA 5005 (Australia); Chan, Q.N. [Fluid Mechanics, Energy and Combustion Group, University of Adelaide, Adelaide, SA 5005 (Australia); School of Chemical Engineering, University of Adelaide, Adelaide, SA 5005 (Australia); School of Mechanical Engineering, University of Adelaide, Adelaide, SA 5005 (Australia); Nathan, G.J. [Fluid Mechanics, Energy and Combustion Group, University of Adelaide, Adelaide, SA 5005 (Australia); School of Mechanical Engineering, University of Adelaide, Adelaide, SA 5005 (Australia); Roekaerts, D. [Department of Multi-Scale Physics, Faculty of Applied Sciences, Delft University of Technology, Lorentzweg, 1, NL-2628 CJ Delft (Netherlands)


    Planar laser-induced incandescence (LII) has been used to measure soot volume fraction in a well-characterised, piloted, turbulent non-premixed flame known as the ''Delft Flame III''. Simulated Dutch natural gas was used as the fuel to produce a flame closely matching those in which a wide range of previous investigations, both experimental and modelling, have been performed. The LII method was calibrated using a Santoro-style burner with ethylene as the fuel. Instantaneous and time-averaged data of the axial and radial soot volume fraction distributions of the flame are presented here along with the Probability Density Functions (PDFs) and intermittency. The PDFs were found to be well-characterised by a single exponential distribution function. The distribution of soot was found to be highly intermittent, with intermittency typically exceeding 97%, which increases measurement uncertainty. The instantaneous values of volume fraction are everywhere less than the values in strained laminar flames. This is consistent with the soot being found locally in strained flame sheets that are convected and distorted by the flow. (author)

  14. Physical aging and structural recovery in a colloidal glass subjected to volume-fraction jump conditions (United States)

    Peng, Xiaoguang; McKenna, Gregory B.


    Three important kinetic phenomena have been cataloged by Kovacs in the investigation of molecular glasses during structural recovery or physical aging. These are responses to temperature-jump histories referred to as intrinsic isotherms, asymmetry of approach, and memory effect. Here we use a thermosensitive polystyrene-poly (N -isopropylacrylamide)-poly (acrylic acid) core-shell particle-based dispersion as a colloidal model and by working at a constant number concentration of particles we use temperature changes to create volume-fraction changes. This imposes conditions similar to those defined by Kovacs on the colloidal system. We use creep experiments to probe the physical aging and structural recovery behavior of colloidal glasses in the Kovacs-type histories and compare the results with those seen in molecular glasses. We find that there are similarities in aging dynamics between molecular glasses and colloidal glasses, but differences also persist. For the intrinsic isotherms, the times teq needed for relaxing or evolving into the equilibrium (or stationary) state are relatively insensitive to the volume fraction and the values of teq are longer than the α -relaxation time τα at the same volume fraction. On the other hand, both of these times grow at least exponentially with decreasing temperature in molecular glasses. For the asymmetry of approach, similar nonlinear behavior is observed for both colloidal and molecular glasses. However, the equilibration time teq is the same for both volume-fraction up-jump and down-jump experiments, different from the finding in molecular glasses that it takes longer for the structure to evolve into equilibrium for the temperature up-jump condition than for the temperature down-jump condition. For the two-step volume-fraction jumps, a memory response is observed that is different from observations of structural recovery in two-step temperature histories in molecular glasses. The concentration dependence of the dynamics

  15. Validity of automated measurement of left ventricular ejection fraction and volume using the Philips EPIQ system. (United States)

    Hovnanians, Ninel; Win, Theresa; Makkiya, Mohammed; Zheng, Qi; Taub, Cynthia


    To assess the efficiency and reproducibility of automated measurements of left ventricular (LV) volumes and LV ejection fraction (LVEF) in comparison to manually traced biplane Simpson's method. This is a single-center prospective study. Apical four- and two-chamber views were acquired in patients in sinus rhythm. Two operators independently measured LV volumes and LVEF using biplane Simpson's method. In addition, the image analysis software a2DQ on the Philips EPIQ system was applied to automatically assess the LV volumes and LVEF. Time spent on each analysis, using both methods, was documented. Concordance of echocardiographic measures was evaluated using intraclass correlation (ICC) and Bland-Altman analysis. Manual tracing and automated measurement of LV volumes and LVEF were performed in 184 patients with a mean age of 67.3 ± 17.3 years and BMI 28.0 ± 6.8 kg/m 2 . ICC and Bland-Altman analysis showed good agreements between manual and automated methods measuring LVEF, end-systolic, and end-diastolic volumes. The average analysis time was significantly less using the automated method than manual tracing (116 vs 217 seconds/patient, P Automated measurement using the novel image analysis software a2DQ on the Philips EPIQ system produced accurate, efficient, and reproducible assessment of LV volumes and LVEF compared with manual measurement. © 2017, Wiley Periodicals, Inc.

  16. Quantitative gated SPECT: the effect of reconstruction filter on calculated left ventricular ejection fractions and volumes

    International Nuclear Information System (INIS)

    Wright, Graham A.; McDade, Mark; Martin, William; Hutton, William


    Gated SPECT (GSPECT) offers the possibility of obtaining additional functional information from perfusion studies, including calculation of left ventricular ejection fraction (LVEF). The calculation of LVEF relies upon the identification of the endocardial surface, which will be affected by the spatial resolution and statistical noise in the reconstructed images. The aim of this study was to compare LVEFs and ventricular volumes calculated from GSPECT using six reconstruction filters. GSPECT and radionuclide ventriculography (RNVG) were performed on 40 patients; filtered back projection was used to reconstruct the datasets with each filter. LVEFs and volumes were calculated using the Cedars-Sinai QGS package. The correlation coefficient between RNVG and GSPECT ranged from 0.81 to 0.86 with higher correlations for smoother filters. The narrowest prediction interval was 11±2%. There was a trend towards higher LVEF values with smoother filters, the ramp filter yielding LVEFs 2.55±3.10% (p<0.001) lower than the Hann filter. There was an overall fall in ventricular volumes with smoother filters with a mean difference of 13.98±10.15 ml (p<0.001) in EDV between the Butterworth-0.5 and Butterworth-0.3 filters. In conclusion, smoother reconstruction filters lead to lower volumes and higher ejection fractions with the QGS algorithm, with the Butterworth-0.4 filter giving the highest correlation with LVEFs from RNVG. Even if the optimal filter is chosen the uncertainty in the measured ejection fractions is still too great to be clinically acceptable. (author)

  17. Study of volume fractions for stratified and annular regime in multiphase flows using gamma-rays and artificial neural network

    International Nuclear Information System (INIS)

    Salgado, Cesar M.; Brandao, Luis Eduardo; Pereira, Claudio M.N.A.; Ramos, Robson; Schirru, Roberto; Silva, Ademir X.


    This work presents methodology based on the use of nuclear technique and artificial intelligence for attainment of volume fractions in stratified and annular multiphase flow regime, oil-water-gas, very frequent in the offshore industry petroliferous. Using the principles of absorption and scattering of gamma-rays and an adequate geometry scheme of detection with two detectors and two energies measurement are gotten and they vary as changes in the volume fractions of flow regime occur. The MCNP-X code was used in order to provide the data training for artificial neural network that matched such information with the respective actual volume fractions of each material. (author)

  18. Study of volume fractions for stratified and annular regime in multiphase flows using gamma-rays and artificial neural network

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, Cesar M.; Brandao, Luis Eduardo; Pereira, Claudio M.N.A.; Ramos, Robson [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)]. E-mail:;;;; Schirru, Roberto; Silva, Ademir X. [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Coordenacao dos Programas de Pos-Graduacao de Engenharia (COPPE). Programa de Energia Nuclear (PEN)]. E-mails:;


    This work presents methodology based on the use of nuclear technique and artificial intelligence for attainment of volume fractions in stratified and annular multiphase flow regime, oil-water-gas, very frequent in the offshore industry petroliferous. Using the principles of absorption and scattering of gamma-rays and an adequate geometry scheme of detection with two detectors and two energies measurement are gotten and they vary as changes in the volume fractions of flow regime occur. The MCNP-X code was used in order to provide the data training for artificial neural network that matched such information with the respective actual volume fractions of each material. (author)

  19. Non-equilibrium Inertial Separation Array for High-throughput, Large-volume Blood Fractionation. (United States)

    Mutlu, Baris R; Smith, Kyle C; Edd, Jon F; Nadar, Priyanka; Dlamini, Mcolisi; Kapur, Ravi; Toner, Mehmet


    Microfluidic blood processing is used in a range of applications from cancer therapeutics to infectious disease diagnostics. As these applications are being translated to clinical use, processing larger volumes of blood in shorter timescales with high-reliability and robustness is becoming a pressing need. In this work, we report a scaled, label-free cell separation mechanism called non-equilibrium inertial separation array (NISA). The NISA mechanism consists of an array of islands that exert a passive inertial lift force on proximate cells, thus enabling gentler manipulation of the cells without the need of physical contact. As the cells follow their size-based, deterministic path to their equilibrium positions, a preset fraction of the flow is siphoned to separate the smaller cells from the main flow. The NISA device was used to fractionate 400 mL of whole blood in less than 3 hours, and produce an ultrapure buffy coat (96.6% white blood cell yield, 0.0059% red blood cell carryover) by processing whole blood at 3 mL/min, or ∼300 million cells/second. This device presents a feasible alternative for fractionating blood for transfusion, cellular therapy and blood-based diagnostics, and could significantly improve the sensitivity of rare cell isolation devices by increasing the processed whole blood volume.

  20. Birth weight and neonatal adiposity prediction using fractional limb volume obtained with 3D ultrasound. (United States)

    O'Connor, Clare; O'Higgins, Amy; Doolan, Anne; Segurado, Ricardo; Stuart, Bernard; Turner, Michael J; Kennelly, Máireád M


    The objective of this investigation was to study fetal thigh volume throughout gestation and explore its correlation with birth weight and neonatal body composition. This novel technique may improve birth weight prediction and lead to improved detection rates for fetal growth restriction. Fractional thigh volume (TVol) using 3D ultrasound, fetal biometry and soft tissue thickness were studied longitudinally in 42 mother-infant pairs. The percentages of neonatal body fat, fat mass and fat-free mass were determined using air displacement plethysmography. Correlation and linear regression analyses were performed. Linear regression analysis showed an association between TVol and birth weight. TVol at 33 weeks was also associated with neonatal fat-free mass. There was no correlation between TVol and neonatal fat mass. Abdominal circumference, estimated fetal weight (EFW) and EFW centile showed consistent correlations with birth weight. Thigh volume demonstrated an additional independent contribution to birth weight prediction when added to the EFW centile from the 38-week scan (p = 0.03). Fractional TVol performed at 33 weeks gestation is correlated with birth weight and neonatal lean body mass. This screening test may highlight those at risk of fetal growth restriction or macrosomia.

  1. An investigation of the relation between the 30 meter running time and the femoral volume fraction in the thigh

    Directory of Open Access Journals (Sweden)

    MY Tasmektepligil


    Full Text Available Leg components are thought to be a related to speed. Only a limited number of studies have, however, examined the interaction between speed and bone size. In this study, we examined the relationship between the time taken by football players to run thirty meters and the fraction which the femur forms compared to the entire thigh region. Data collected from thirty male football players of average age 17.3 (between 16-19 years old were analyzed. First we detected the thirty meter running times and then we estimated the volume fraction of the femur to the entire thigh region using stereological methods on magnetic resonance images. Our data showed that there was a highly negative relationship between the 30 meter running times and the volume fraction of the bone to the thigh region. Thus, 30 meter running time decreases as the fraction of the bone to the thigh region increases. In other words, speed increases as the fraction of bone volume increases. Our data indicate that selecting sportsman whose femoral volume fractions are high will provide a significant benefit to enhancing performance in those branches of sports which require speed. Moreover, we concluded that training which can increase the bone volume fraction should be practiced when an increase in speed is desired and that the changes in the fraction of thigh region components should be monitored during these trainings.

  2. Entropy of level-cut random Gaussian structures at different volume fractions. (United States)

    Marčelja, Stjepan


    Cutting random Gaussian fields at a given level can create a variety of morphologically different two- or several-phase structures that have often been used to describe physical systems. The entropy of such structures depends on the covariance function of the generating Gaussian random field, which in turn depends on its spectral density. But the entropy of level-cut structures also depends on the volume fractions of different phases, which is determined by the selection of the cutting level. This dependence has been neglected in earlier work. We evaluate the entropy of several lattice models to show that, even in the cases of strongly coupled systems, the dependence of the entropy of level-cut structures on molar fractions of the constituents scales with the simple ideal noninteracting system formula. In the last section, we discuss the application of the results to binary or ternary fluids and microemulsions.

  3. Entropy of level-cut random Gaussian structures at different volume fractions (United States)

    Marčelja, Stjepan


    Cutting random Gaussian fields at a given level can create a variety of morphologically different two- or several-phase structures that have often been used to describe physical systems. The entropy of such structures depends on the covariance function of the generating Gaussian random field, which in turn depends on its spectral density. But the entropy of level-cut structures also depends on the volume fractions of different phases, which is determined by the selection of the cutting level. This dependence has been neglected in earlier work. We evaluate the entropy of several lattice models to show that, even in the cases of strongly coupled systems, the dependence of the entropy of level-cut structures on molar fractions of the constituents scales with the simple ideal noninteracting system formula. In the last section, we discuss the application of the results to binary or ternary fluids and microemulsions.

  4. SOLA-VOF, 2-D Transient Hydrodynamic Using Fractional Volume of Fluid Method

    International Nuclear Information System (INIS)

    Nichols, B.D.; Hirt, C.W.; Hotchkiss, R.S.


    1 - Description of problem or function: SOLA-VOF is a program for the solution of two-dimensional transient fluid flow with free boundaries, based on the concept of a fractional volume of fluid (VOF). Its basic mode of operation is for single fluid calculations having multiple free surfaces. However, SOLA-VOF can also be used for calculations involving two fluids separated by a sharp interface. In either case, the fluids may be treated as incompressible or as having limited compressibility. Surface tension forces with wall adhesion are permitted in both cases. Internal obstacles may be defined by blocking out any desired combination of cells in the mesh, which is composed of rectangular cells of variable size. 2 - Method of solution: The basis of the SOLA-VOF method is the fractional volume of fluid scheme for tracking free boundaries. In this technique, a function F(x,y,t) is defined whose value is unity at any point occupied by fluid and zero elsewhere. When averaged over the cells of a computational mesh, the average value of F in a cell is equal to the fractional volume of the cell occupied by fluid. In particular, a unit value of F corresponds to a cell full of fluid, whereas a zero value indicates that the cell contains no fluid. Cells with F values between zero and one contain a free surface. SOLA-VOF uses an Eulerian mesh of rectangular cells having variable sizes. The fluid equations solved are the finite difference approximations of the Navier-Stokes equations. 3 - Restrictions on the complexity of the problem: The setting of array dimensions is controlled through PARAMETER statements

  5. A randomized trial comparing bladder volume consistency during fractionated prostate radiation therapy

    LENUS (Irish Health Repository)

    Mullaney, L.


    Organ motion is a contributory factor to the variation in location of the prostate and organs at risk during a course of fractionated prostate radiation therapy (RT). A prospective randomized controlled trial was designed with the primary endpoint to provide evidence-based bladder-filling instructions to achieve a consistent bladder volume (BV) and thus reduce the bladder-related organ motion. The secondary endpoints were to assess the incidence of acute and late genitourinary (GU) and gastrointestinal (GI) toxicity for patients and patients’ satisfaction with the bladder-filling instructions.

  6. Structuring polymer blends with bicontinuous phase morphology. Part II. Tailoring blends with ultralow critical volume fraction

    DEFF Research Database (Denmark)

    Lyngaae-Jørgensen, Jørgen; Utracki, Leszek


    A hypothesis providing a guideline for the development of immiscible polymer blends with co-continuous phase structure at very low critical volume fraction of one component is. postulated and experimentally verified. Based on a number of simplifying assumptions the following relation was derived......: phi(cr) = k(lambdagamma)(1-z)/(theta(b)(*))(z) where lambdagamma is a Deborah number and theta(b)(*) is a dimensionless break-up time. The equation parameters, k and z are constant that depend on the flow field hence on the blending equipment. For the studies an internal mixer with Walzenkneter...

  7. System modeling and identification in indicator dilution method for assessment of ejection fraction and pulmonary blood volume

    NARCIS (Netherlands)

    Bharath, H.N.; Prabhu, K.M.M.; Korsten, H.H.M.; Mischi, M.


    Clinically relevant cardiovascular parameters, such as pulmonary blood volume (PBV) and ejection fraction (EF), can be assessed through indicator dilution techniques. Among these techniques, which are typically invasive due to the need for central catheterization, contrast ultrasonography provides a

  8. Effects of diluents on soot surface temperature and volume fraction in diluted ethylene diffusion flames at pressure

    KAUST Repository

    Kailasanathan, Ranjith Kumar Abhinavam; Zhang, Ji; Fang, Tiegang; Roberts, William L.


    Soot surface temperature and volume fraction are measured in ethylene/air coflowing laminar diffusion flames at high pressures, diluted with one of four diluents (argon, helium, nitrogen, and carbon dioxide) using a two-color technique. Both

  9. Self Absorbed Fraction for Electrons and Beta Particles in Small Spherical Volumes

    International Nuclear Information System (INIS)

    Grosev, D.


    Absorbed fraction and target organ mass are important parameters of internal dosimetry calculations that define the geometry of the system. Standard MIRD (Medical Internal Radiation Dosimetry) formalism assumes that the absorbed fraction for non-penetrating radiations (e.g., electrons, beta particles) is 1. This may not be correct in cases where dimensions of organs/tissues are comparable with the ranges of electrons/beta particles. Such is the case for example in radiodine ablation of thyroid remnant tissue. In this work the self-absorbed fraction (source and target volumes are the same) for monoenergetic electrons and beta particles is calculated for small spherical volumes of various sizes and unit density. Absorbed fraction can be expressed as an integral of the product of two quantities: (a) Scaled beta dose point kernel (mean absorbed dose rate per activity of the point source in infinite homogenous medium), F β ; (b) special geometrical reduction factor (GRF). F β is calculated using EGS4 Monte Carlo (MC) code for transport of electrons and photons. MC source code calculates the deposition of energy inside concentric spherical shells around the isotropic point source of electrons/beta particles in infinite medium (water). Shell thickness was δr=0.02·X 90 , where X 90 represents the radius of the sphere inside which 90% of the source energy is absorbed. Number of concentric spherical shells was 100, 10000 electron histories were started in each program run, and 10 runs were repeated for statistical reason. Numerical integration of the product of F β , calculated by MC program, and GRF for sphere was done using Simpson method. Absorbed fractions were calculated for spheres with mass from 0.01-20 g (r = 0.13 - 1.68 cm). Results are given for monoenergetic electrons with kinetic energy T=0.2, 0.4, 1.0 MeV, and for three beta emitters 1 31I , 3 2P , 9 0Y . For quantitative dosimetric protocols in radioiodine ablation therapy, results for 1 31I are of

  10. Energy Performance and Pressure Fluctuation of a Multiphase Pump with Different Gas Volume Fractions

    Directory of Open Access Journals (Sweden)

    Jinsong Zhang


    Full Text Available Large petroleum resources in deep sea, and huge market demands for petroleum need advanced petroleum extraction technology. The multiphase pump, which can simultaneously transport oil and gas with considerable efficiency, has been a crucial technology in petroleum extraction. A numerical approach with mesh generation and a Navier-Stokes equation solution is employed to evaluate the effects of gas volume fraction on energy performance and pressure fluctuations of a multiphase pump. Good agreement of experimental and calculation results indicates that the numerical approach can accurately simulate the multiphase flow in pumps. The pressure rise of a pump decreases with the increasing of flow rate, and the pump efficiency decreases with the increasing of GVF (the ratio of the gas volume to the whole volume. Results show that the dominant frequencies of pressure fluctuation in the impeller and diffuser are eleven and three times those of the impeller rotational frequency, respectively. Due to the larger density of water and centrifugal forces, the water aggregates to the shroud and the gas gathers to the hub, which renders the distribution of GVF in the pump uneven. A vortex develops at the blade suction side, near the leading edge, induced by the leakage flow, and further affects the pressure fluctuation in the impeller. The obvious vortex in the diffuser indicates that the design of the divergence angle of the diffuser is not optimal, which induces flow separation due to large diffusion ratio. A uniform flow pattern in the impeller indicates good hydraulic performance of the pump.

  11. Scaling relations between trabecular bone volume fraction and microstructure at different skeletal sites. (United States)

    Räth, Christoph; Baum, Thomas; Monetti, Roberto; Sidorenko, Irina; Wolf, Petra; Eckstein, Felix; Matsuura, Maiko; Lochmüller, Eva-Maria; Zysset, Philippe K; Rummeny, Ernst J; Link, Thomas M; Bauer, Jan S


    In this study, we investigated the scaling relations between trabecular bone volume fraction (BV/TV) and parameters of the trabecular microstructure at different skeletal sites. Cylindrical bone samples with a diameter of 8mm were harvested from different skeletal sites of 154 human donors in vitro: 87 from the distal radius, 59/69 from the thoracic/lumbar spine, 51 from the femoral neck, and 83 from the greater trochanter. μCT images were obtained with an isotropic spatial resolution of 26μm. BV/TV and trabecular microstructure parameters (TbN, TbTh, TbSp, scaling indices ( and σ of α and αz), and Minkowski Functionals (Surface, Curvature, Euler)) were computed for each sample. The regression coefficient β was determined for each skeletal site as the slope of a linear fit in the double-logarithmic representations of the correlations of BV/TV versus the respective microstructure parameter. Statistically significant correlation coefficients ranging from r=0.36 to r=0.97 were observed for BV/TV versus microstructure parameters, except for Curvature and Euler. The regression coefficients β were 0.19 to 0.23 (TbN), 0.21 to 0.30 (TbTh), -0.28 to -0.24 (TbSp), 0.58 to 0.71 (Surface) and 0.12 to 0.16 (), 0.07 to 0.11 (), -0.44 to -0.30 (σ(α)), and -0.39 to -0.14 (σ(αz)) at the different skeletal sites. The 95% confidence intervals of β overlapped for almost all microstructure parameters at the different skeletal sites. The scaling relations were independent of vertebral fracture status and similar for subjects aged 60-69, 70-79, and >79years. In conclusion, the bone volume fraction-microstructure scaling relations showed a rather universal character. © 2013.

  12. Airborne release fractions/rates and respirable fractions for nonreactor nuclear facilities. Volume 1, Analysis of experimental data

    International Nuclear Information System (INIS)


    This handbook contains (1) a systematic compilation of airborne release and respirable fraction experimental data for nonreactor nuclear facilities, (2) assessments of the data, and (3) values derived from assessing the data that may be used in safety analyses when the data are applicable. To assist in consistent and effective use of this information, the handbook provides: identification of a consequence determination methodology in which the information can be used; discussion of the applicability of the information and its general technical limits; identification of specific accident phenomena of interest for which the information is applicable; and examples of use of the consequence determination methodology and airborne release and respirable fraction information

  13. Immunoglobulin G levels during collection of large volume plasma for fractionation. (United States)

    Burkhardt, Thomas; Rothe, Remo; Moog, Rainer


    There is a need of comprehensive work dealing with the quality of plasma for fractionation with respect to the IgG content as today most plasma derivates are used to treat patients with immunodeficiencies and autoimmune disorders. Therefore, a prospective study was carried out to analyse IgG levels before plasmapheresis and every 200ml collected plasma. Fifty-four experienced plasmapheresis donors were recruited for subsequent 850ml plasmapheresis using the Aurora Plasmapheresis System. Donorś peripheral blood counts were analysed before and after plasmapheresis using an electronic counter. Total protein, IgG and citrate were measured turbidometrically before, during and after apheresis as well as in the plasma product. Furthermore, platelets, red and white blood cells were analysed as parameters of product quality. An average of 2751±247ml blood was processed in 47±6min. The collected plasma volume was 850±1mL and citrate consumption was 177±15mL. A continuous drop of donors' IgG level was observed during plasmapheresis. The drop was 13% of the IgG baseline value at 800mL collected plasma. Total protein, IgG and cell counts of the plasma product met current guidelines of plasma for fractionation. Donors' IgG levels during apheresis showed a steady decrease without compromising the quality of plasma product. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. SU-E-T-429: Uncertainties of Cell Surviving Fractions Derived From Tumor-Volume Variation Curves

    International Nuclear Information System (INIS)

    Chvetsov, A


    Purpose: To evaluate uncertainties of cell surviving fraction reconstructed from tumor-volume variation curves during radiation therapy using sensitivity analysis based on linear perturbation theory. Methods: The time dependent tumor-volume functions V(t) have been calculated using a twolevel cell population model which is based on the separation of entire tumor cell population in two subpopulations: oxygenated viable and lethally damaged cells. The sensitivity function is defined as S(t)=[δV(t)/V(t)]/[δx/x] where δV(t)/V(t) is the time dependent relative variation of the volume V(t) and δx/x is the relative variation of the radiobiological parameter x. The sensitivity analysis was performed using direct perturbation method where the radiobiological parameter x was changed by a certain error and the tumor-volume was recalculated to evaluate the corresponding tumor-volume variation. Tumor volume variation curves and sensitivity functions have been computed for different values of cell surviving fractions from the practically important interval S 2 =0.1-0.7 using the two-level cell population model. Results: The sensitivity functions of tumor-volume to cell surviving fractions achieved a relatively large value of 2.7 for S 2 =0.7 and then approached zero as S 2 is approaching zero Assuming a systematic error of 3-4% we obtain that the relative error in S 2 is less that 20% in the range S2=0.4-0.7. This Resultis important because the large values of S 2 are associated with poor treatment outcome should be measured with relatively small uncertainties. For the very small values of S2<0.3, the relative error can be larger than 20%; however, the absolute error does not increase significantly. Conclusion: Tumor-volume curves measured during radiotherapy can be used for evaluation of cell surviving fractions usually observed in radiation therapy with conventional fractionation

  15. Elastic modulus of Al-Si/SiC metal matrix composites as a function of volume fraction

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh Kumar, S; Rajasekharan, T [Powder Metallurgy Group, Defence Metallurgical Research Laboratory, Kanchanbagh PO, Hyderabad-500 058 (India); Seshu Bai, V [School of Physics, University of Hyderabad, Central University PO, Hyderabad-500 046 (India); Rajkumar, K V; Sharma, G K; Jayakumar, T, E-mail: [Non-Destructive Evaluation Division, Indira Gandhi Center for Atomic Research, Kalpakkam, Chennai-603 102 (India)


    Aluminum alloy matrix composites have emerged as candidate materials for electronic packaging applications in the field of aerospace semiconductor electronics. Composites prepared by the pressureless infiltration technique with high volume fractions in the range 0.41-0.70 were studied using ultrasonic velocity measurements. For different volume fractions of SiC, the longitudinal velocity and shear velocity were found to be in the range of 7600-9300 m s{sup -1} and 4400-5500 m s{sup -1}, respectively. The elastic moduli of the composites were determined from ultrasonic velocities and were analysed as a function of the volume fraction of the reinforcement. The observed variation is discussed in the context of existing theoretical models for the effective elastic moduli of two-phase systems.

  16. An unstructured finite volume solver for two phase water/vapour flows based on an elliptic oriented fractional step method

    International Nuclear Information System (INIS)

    Mechitoua, N.; Boucker, M.; Lavieville, J.; Pigny, S.; Serre, G.


    Based on experience gained at EDF and Cea, a more general and robust 3-dimensional (3D) multiphase flow solver has been being currently developed for over three years. This solver, based on an elliptic oriented fractional step approach, is able to simulate multicomponent/multiphase flows. Discretization follows a 3D full unstructured finite volume approach, with a collocated arrangement of all variables. The non linear behaviour between pressure and volume fractions and a symmetric treatment of all fields are taken into account in the iterative procedure, within the time step. It greatly enforces the realizability of volume fractions (i.e 0 < α < 1), without artificial numerical needs. Applications to widespread test cases as static sedimentation, water hammer and phase separation are shown to assess the accuracy and the robustness of the flow solver in different flow conditions, encountered in nuclear reactors pipes. (authors)

  17. Volume fractions of DCE-MRI parameter as early predictor of histologic response in soft tissue sarcoma: A feasibility study. (United States)

    Xia, Wei; Yan, Zhuangzhi; Gao, Xin


    To find early predictors of histologic response in soft tissue sarcoma through volume transfer constant (K trans ) analysis based on dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). 11 Patients with soft tissue sarcoma of the lower extremity that underwent preoperative chemoradiotherapy followed by limb salvage surgery were included in this retrospective study. For each patient, DCE-MRI data sets were collected before and two weeks after therapy initiation, and histologic tumor cell necrosis rate (TCNR) was reported at surgery. The DCE-MRI volumes were aligned by registration. Then, the aligned volumes were used to obtain the K trans variation map. Accordingly, three sub-volumes (with increased, decreased or unchanged K trans ) were defined and identified, and fractions of the sub-volumes, denoted as F + , F - and F 0 , respectively, were calculated. The predictive ability of volume fractions was determined by using area under a receiver operating characteristic curve (AUC). Linear regression analysis was performed to investigate the relationship between TCNR and volume fractions. In addition, the K trans values of the sub-volumes were compared. The AUC for F - (0.896) and F 0 (0.833) were larger than that for change of tumor longest diameter ΔD (0.625) and the change of mean K trans ΔK trans ¯ (0.792). Moreover, the regression results indicated that TCNR was directly proportional to F 0 (R 2 =0.75, P=0.0003), while it was inversely proportional to F - (R 2 =0.77, P=0.0002). However, TCNR had relatively weak linear relationship with ΔK trans ¯ (R 2 =0.64, P=0.0018). Additionally, TCNR did not have linear relationship with DD (R 2 =0.16, P=0.1246). The volume fraction F - and F 0 have potential as early predictors of soft tissue sarcoma histologic response. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Myocardial T1 and extracellular volume fraction mapping at 3 tesla

    Directory of Open Access Journals (Sweden)

    Lee Jason J


    Full Text Available Abstract Background To compare 11 heartbeat (HB and 17 HB modified lock locker inversion recovery (MOLLI pulse sequence at 3T and to establish preliminary reference values for myocardial T1 and the extracellular volume fraction (ECV. Methods Both phantoms and normal volunteers were scanned at 3T using 11 HB and 17 HB MOLLI sequence with the following parameters: spatial resolution = 1.75 × 1.75 × 10 mm on a 256 × 180 matrix, TI initial = 110 ms, TI increment = 80 ms, flip angle = 35°, TR/TE = 1.9/1.0 ms. All volunteers were administered Gadolinium-DTPA (Magnevist, 0.15 mmol/kg, and multiple post-contrast MOLLI scans were performed at the same pre-contrast position from 3.5-23.5 minutes after a bolus contrast injection. Late gadolinium enhancement (LGE images were also acquired 12-30 minutes after the gadolinium bolus. Results T1 values of 11 HB and 17 HB MOLLI displayed good agreement in both phantom and volunteers. The average pre-contrast myocardial and blood T1 was 1315 ± 39 ms and 2020 ± 129 ms, respectively. ECV was stable between 8.5 to 23.5 minutes post contrast with an average of 26.7 ± 1.0%. Conclusion The 11 HB MOLLI is a faster method for high-resolution myocardial T1 mapping at 3T. ECV fractions are stable over a wide time range after contrast administration.

  19. Artificial neural network and neutron application in a volume fraction calculation in annular and stratified multiphase system

    International Nuclear Information System (INIS)

    Ramos, Robson; Brandao, Luis E.B.; Pereira, Claudio M.N.A.; Schirru, Roberto; Silva, Ademir Xavier da


    Multiphase flows, type oil-water-gas are very common among different industrial activities, such as chemical industries and petroleum extraction, and its measurements show some difficulties to be taken. Precisely determining the volume fraction of each one of the elements that composes a multiphase flow is very important in chemical plants and petroleum industries. This work presents a methodology able to determine volume fraction on Annular and Stratified multiphase flow system with the use of neutrons and artificial intelligence, using the principles of transmission/scattering of fast neutrons from a 241 Am-Be source and measurements of point flow that are influenced by variations of volume fractions. The proposed geometries used on the mathematical model was used to obtain a data set where the thicknesses referred of each material had been changed in order to obtain volume fraction of each phase providing 119 compositions that were used in the simulation with MCNP-X -computer code based on Monte Carlo Method that simulates the radiation transport. An artificial neural network (ANN) was trained with data obtained using the MCNP-X, and used to correlate such measurements with the respective real fractions. The ANN was able to correlate the data obtained on the simulation with MCNP-X with the volume fractions of the multiphase flows (oil-water-gas), both in the pattern of annular flow as stratified, resulting in a average relative error (%) for each production set of: annular (air = 3.85; water = 4.31; oil=1.08); stratified (air = 3.10, water 2.01, oil = 1.45). The method demonstrated good efficiency in the determination of each material that composes the phases, thus demonstrating the feasibility of the technique. (author)

  20. Artificial neural network and neutron application in a volume fraction calculation in annular and stratified multiphase system

    Energy Technology Data Exchange (ETDEWEB)

    Ramos, Robson; Brandao, Luis E.B.; Pereira, Claudio M.N.A., E-mail:, E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Div. de Radiofarmacos; Schirru, Roberto; Silva, Ademir Xavier da, E-mail: schirru@lmp.ufrj.b, E-mail: ademir@con.ufrj.b [Coordenacao dos Programas de Pos-Graduacao de Engenharia (COPPE/UFRJ), RJ (Brazil). Nuclear Engineering Dept.


    Multiphase flows, type oil-water-gas are very common among different industrial activities, such as chemical industries and petroleum extraction, and its measurements show some difficulties to be taken. Precisely determining the volume fraction of each one of the elements that composes a multiphase flow is very important in chemical plants and petroleum industries. This work presents a methodology able to determine volume fraction on Annular and Stratified multiphase flow system with the use of neutrons and artificial intelligence, using the principles of transmission/scattering of fast neutrons from a {sup 241}Am-Be source and measurements of point flow that are influenced by variations of volume fractions. The proposed geometries used on the mathematical model was used to obtain a data set where the thicknesses referred of each material had been changed in order to obtain volume fraction of each phase providing 119 compositions that were used in the simulation with MCNP-X -computer code based on Monte Carlo Method that simulates the radiation transport. An artificial neural network (ANN) was trained with data obtained using the MCNP-X, and used to correlate such measurements with the respective real fractions. The ANN was able to correlate the data obtained on the simulation with MCNP-X with the volume fractions of the multiphase flows (oil-water-gas), both in the pattern of annular flow as stratified, resulting in a average relative error (%) for each production set of: annular (air = 3.85; water = 4.31; oil=1.08); stratified (air = 3.10, water 2.01, oil = 1.45). The method demonstrated good efficiency in the determination of each material that composes the phases, thus demonstrating the feasibility of the technique. (author)

  1. Enlarged thalamic volumes and increased fractional anisotropy in the thalamic radiations in Veterans with suicide behaviors

    Directory of Open Access Journals (Sweden)

    Melissa eLopez-Larson


    Full Text Available Post-mortem studies have suggested a link between the thalamus, psychiatric disorders, and suicide. We evaluated the thalamus and anterior thalamic radiations (ATR in a group of Veterans with and without a history of suicidal behavior (SB to determine if thalamic abnormalities were associated with an increased risk of SB. Forty Veterans with mild traumatic brain injury (TBI and no SB (TBI-SB, 19 Veterans with mild TBI and a history of SB (TB+SB and 15 healthy controls (HC underwent MRI scanning including a structural and diffusion tensor imaging scan. Suicidal behaviors were evaluated utilizing the Columbia Suicide Rating Scale and impulsivity was measured using the Barratt Impulsiveness Scale (BIS. Differences in thalamic volumes and ATR fractional anisotropy (FA were examined between 1 TBI+SB versus HC and 2 TBI+SB versus combined HC and TBI-SB and 2 between TBI+SB and TBI-SB. Left and right thalamic volumes were significantly increased in those with TBI+SB compared to the HC, TBI-SB and the combined group. Veterans with TBI+SB had increased FA bilaterally compared to the HC, HC and TBI-SB group, and the TBI-SB only group. Significant positive associations were found for bilateral ATR and BIS in the TBI+SB group. Our findings of thalamic enlargement and increased FA in individuals with TBI+SB suggest that this region may be a biomarker for suicide risk. Our findings are consistent with previous evidence indicating that suicide may be associated with behavioral disinhibition and frontal-thalamic-limbic dysfunction and suggest a neurobiologic mechanism that may increase vulnerability to suicide.

  2. The effect of strain path change on subgrain volume fraction determined from in situ X-ray measurements

    DEFF Research Database (Denmark)

    Wejdemann, Christian; Poulsen, Henning Friis; Lienert, U.


    to additional 5% strain is performed in situ while mapping a selected X-ray reflection from one particular bulk grain with high angular resolution. The reciprocal space maps are analyzed with a recently developed fitting method, and a correlation is found between the evolution of the subgrain volume fraction...

  3. CMR reference values for left ventricular volumes, mass, and ejection fraction using computer-aided analysis : The Framingham Heart Study

    NARCIS (Netherlands)

    Chuang, Michael L.; Gona, Philimon; Hautvast, Gilion L.T.F.; Salton, Carol J.; Breeuwer, Marcel; O'Donnell, Christopher J.; Manning, Warren J.

    Purpose To determine sex-specific reference values for left ventricular (LV) volumes, mass, and ejection fraction (EF) in healthy adults using computer-aided analysis and to examine the effect of age on LV parameters. Materials and Methods We examined data from 1494 members of the Framingham Heart

  4. ECG-gated blood pool tomography in the determination of left ventricular volume, ejection fraction, and wall motion

    International Nuclear Information System (INIS)

    Underwood, S.R.; Ell, P.J.; Jarritt, P.H.; Emanuel, R.W.; Swanton, R.H.


    ECG-gated blood pool tomography promises to provide a ''gold standard'' for noninvasive measurement of left ventricular volume, ejection fraction, and wall motion. This study compares these measurements with those from planar radionuclide imaging and contrast ventriculography. End diastolic and end systolic blood pool images were acquired tomographically using an IGE400A rotating gamma camera and Star computer, and slices were reconstructed orthogonal to the long axis of the heart. Left ventricular volume was determined by summing the areas of the slices, and wall motion was determined by comparison of end diastolic and end systolic contours. In phantom experiments this provided an accurate measurement of volume (r=0.98). In 32 subjects who were either normal or who had coronary artery disease left ventricular volume (r=0.83) and ejection fraction (r=0.89) correlated well with those using a counts based planar technique. In 16 of 18 subjects who underwent right anterior oblique X-ray contrast ventriculography, tomographic wall motion agreed for anterior, apical, and inferior walls, but abnormal septal motion which was not apparent by contrast ventriculography, was seen in 12 subjects tomographically. All 12 had disease of the left anterior descending coronary artery and might have been expected to have abnormal septal motion. ECG-gated blood pool tomography can thus determine left ventricular volume and ejection fraction accurately, and provides a global description of wall motion in a way that is not possible from any single planar image

  5. Effects of diluents on soot surface temperature and volume fraction in diluted ethylene diffusion flames at pressure

    KAUST Repository

    Kailasanathan, Ranjith Kumar Abhinavam


    Soot surface temperature and volume fraction are measured in ethylene/air coflowing laminar diffusion flames at high pressures, diluted with one of four diluents (argon, helium, nitrogen, and carbon dioxide) using a two-color technique. Both temperature and soot measurements presented are line-of-sight averages. The results aid in understanding the kinetic and thermodynamic behavior of the soot formation and oxidation chemistry with changes in diluents, ultimately leading to possible methods of reducing soot emission from practical combustion hardware. The diluted fuel and coflow exit velocities (top-hat profiles) were matched at all pressures to minimize shear effects. In addition to the velocity-matched flow rates, the mass fluxes were held constant for all pressures. Addition of a diluent has a pronounced effect on both the soot surface temperature and volume fraction, with the helium diluted flame yielding the maximum and carbon dioxide diluted flame yielding minimum soot surface temperature and volume fraction. At low pressures, peak soot volume fraction exists at the tip of the flame, and with an increase in pressure, the location shifts lower to the wings of the flame. Due to the very high diffusivity of helium, significantly higher temperature and volume fraction are measured and explained. Carbon dioxide has the most dramatic soot suppression effect. By comparing the soot yield with previously measured soot precursor concentrations in the same flame, it is clear that the lower soot yield is a result of enhanced oxidation rates rather than a reduction in precursor formation. Copyright © 2014 Taylor & Francis Group, LLC.

  6. Efficacy and safety of 10,600-nm carbon dioxide fractional laser on facial skin with previous volume injections

    Directory of Open Access Journals (Sweden)

    Josiane Hélou


    Full Text Available Background: Fractionated carbon dioxide (CO 2 lasers are a new treatment modality for skin resurfacing. The cosmetic rejuvenation market abounds with various injectable devices (poly-L-lactic acid, polymethyl-methacrylate, collagens, hyaluronic acids, silicone. The objective of this study is to examine the efficacy and safety of 10,600-nm CO 2 fractional laser on facial skin with previous volume injections. Materials and Methods: This is a retrospective study including 14 patients treated with fractional CO 2 laser and who have had previous facial volume restoration. The indication for the laser therapy, the age of the patients, previous facial volume restoration, and side effects were all recorded from their medical files. Objective assessments were made through clinical physician global assessment records and improvement scores records. Patients′ satisfaction rates were also recorded. Results: Review of medical records of the 14 patients show that five patients had polylactic acid injection prior to the laser session. Eight patients had hyaluronic acid injection prior to the laser session. Two patients had fat injection, two had silicone injection and one patient had facial thread lift. Side effects included pain during the laser treatment, post-treatment scaling, post-treatment erythema, hyperpigmentation which spontaneously resolved within a month. Concerning the previous facial volume restoration, no granulomatous reactions were noted, no facial shape deformation and no asymmetry were encountered whatever the facial volume product was. Conclusion: CO 2 fractional laser treatments do not seem to affect facial skin which had previous facial volume restoration with polylactic acid for more than 6 years, hyaluronic acid for more than 0.5 year, silicone for more than 6 years, or fat for more than 1.4 year. Prospective larger studies focusing on many other variables (skin phototype, injected device type are required to achieve better

  7. Measurement of Soot Volume Fraction and Temperature for Oxygen-Enriched Ethylene Combustion Based on Flame Image Processing

    Directory of Open Access Journals (Sweden)

    Weijie Yan


    Full Text Available A method for simultaneously visualizing the two-dimensional distributions of temperature and soot volume fraction in an ethylene flame was presented. A single-color charge-coupled device (CCD camera was used to capture the flame image in the visible spectrum considering the broad-response spectrum of the R and G bands of the camera. The directional emissive power of the R and G bands were calibrated and used for measurement. Slightly increased temperatures and reduced soot concentration were predicted in the central flame without self-absorption effects considered, an iterative algorithm was used for eliminating the effect of self-absorption. Nine different cases were presented in the experiment to demonstrate the effects of fuel mass flow rate and oxygen concentration on temperature and soot concentration in three different atmospheres. For ethylene combustion in pure-air atmosphere, as the fuel mass flow rate increased, the maximum temperature slightly decreased, and the maximum soot volume fraction slightly increased. For oxygen fractions of 30%, 40%, and 50% combustion in O2/N2 oxygen-enhanced atmospheres, the maximum flame temperatures were 2276, 2451, and 2678 K, whereas combustion in O2/CO2 atmospheres were 1916, 2322, and 2535 K. The maximum soot volume fractions were 4.5, 7.0, and 9.5 ppm in oxygen-enriched O2/N2 atmosphere and 13.6, 15.3, and 14.8 ppm in oxygen-enriched O2/CO2 atmosphere. Compared with the O2/CO2 atmosphere, combustion in the oxygen-enriched O2/N2 atmosphere produced higher flame temperature and larger soot volume fraction. Preliminary results indicated that this technique is reliable and can be used for combustion diagnosis.

  8. 40 CFR 63.2854 - How do I determine the weighted average volume fraction of HAP in the actual solvent loss? (United States)


    ... volume fraction of HAP in the actual solvent loss? 63.2854 Section 63.2854 Protection of Environment... AIR POLLUTANTS FOR SOURCE CATEGORIES National Emission Standards for Hazardous Air Pollutants: Solvent... average volume fraction of HAP in the actual solvent loss? (a) This section describes the information and...

  9. SU-E-T-427: Cell Surviving Fractions Derived From Tumor-Volume Variation During Radiotherapy for Non-Small Cell Lung Cancer: Comparison with Predictive Assays

    International Nuclear Information System (INIS)

    Chvetsov, A; Schwartz, J; Mayr, N; Yartsev, S


    Purpose: To show that a distribution of cell surviving fractions S 2 in a heterogeneous group of patients can be derived from tumor-volume variation curves during radiotherapy for non-small cell lung cancer. Methods: Our analysis was based on two data sets of tumor-volume variation curves for heterogeneous groups of 17 patients treated for nonsmall cell lung cancer with conventional dose fractionation. The data sets were obtained previously at two independent institutions by using megavoltage (MV) computed tomography (CT). Statistical distributions of cell surviving fractions S 2 and cell clearance half-lives of lethally damaged cells T1/2 have been reconstructed in each patient group by using a version of the two-level cell population tumor response model and a simulated annealing algorithm. The reconstructed statistical distributions of the cell surviving fractions have been compared to the distributions measured using predictive assays in vitro. Results: Non-small cell lung cancer presents certain difficulties for modeling surviving fractions using tumor-volume variation curves because of relatively large fractional hypoxic volume, low gradient of tumor-volume response, and possible uncertainties due to breathing motion. Despite these difficulties, cell surviving fractions S 2 for non-small cell lung cancer derived from tumor-volume variation measured at different institutions have similar probability density functions (PDFs) with mean values of 0.30 and 0.43 and standard deviations of 0.13 and 0.18, respectively. The PDFs for cell surviving fractions S 2 reconstructed from tumor volume variation agree with the PDF measured in vitro. Comparison of the reconstructed cell surviving fractions with patient survival data shows that the patient survival time decreases as the cell surviving fraction increases. Conclusion: The data obtained in this work suggests that the cell surviving fractions S 2 can be reconstructed from the tumor volume variation curves measured

  10. Systematic Investigation of Magnetostriction in Composite Magnetorheological Elastomers: the Effect of Particle Shape, Alignment, and Volume Fraction (United States)

    Kassner, Christopher; Rieger, William; von Lockette, Paris; Lofland, Samuel


    We have completed a study of the magnetoelastic properties of several types of magnetorheological elastomers (MREs), composites consisting of magnetic particles cured in an elastic matrix. We have made a number of samples with different particle arrangements (pseudo-random and aligned), volume fraction, and particle shape (rods, spheres, and disks) and measured the field dependent strain in order to determine the magnetostriction. We found that the magnetostriction in these samples is highly dependent on the sample particle shape (aspect ratio) and volume fraction and ordering to a lesser extent. While much of the past work has focused on spherical particles, our results indicate that both rods and disks can yield enhanced results. We discuss our findings in terms of magnetic energy of the particles and elastic energy of the matrix. We then consider the issue of optimization. This work was supported in part by NSF Grant CMMI - 0927326.

  11. Fractionation in normal tissues: the (α/β)eff concept can account for dose heterogeneity and volume effects. (United States)

    Hoffmann, Aswin L; Nahum, Alan E


    The simple Linear-Quadratic (LQ)-based Withers iso-effect formula (WIF) is widely used in external-beam radiotherapy to derive a new tumour dose prescription such that there is normal-tissue (NT) iso-effect when changing the fraction size and/or number. However, as conventionally applied, the WIF is invalid unless the normal-tissue response is solely determined by the tumour dose. We propose a generalized WIF (gWIF) which retains the tumour prescription dose, but replaces the intrinsic fractionation sensitivity measure (α/β) by a new concept, the normal-tissue effective fractionation sensitivity, [Formula: see text], which takes into account both the dose heterogeneity in, and the volume effect of, the late-responding normal-tissue in question. Closed-form analytical expressions for [Formula: see text] ensuring exact normal-tissue iso-effect are derived for: (i) uniform dose, and (ii) arbitrary dose distributions with volume-effect parameter n = 1 from the normal-tissue dose-volume histogram. For arbitrary dose distributions and arbitrary n, a numerical solution for [Formula: see text] exhibits a weak dependence on the number of fractions. As n is increased, [Formula: see text] increases from its intrinsic value at n = 0 (100% serial normal-tissue) to values close to or even exceeding the tumour (α/β) at n = 1 (100% parallel normal-tissue), with the highest values of [Formula: see text] corresponding to the most conformal dose distributions. Applications of this new concept to inverse planning and to highly conformal modalities are discussed, as is the effect of possible deviations from LQ behaviour at large fraction sizes.

  12. Influence of Fiber Volume Fraction on the Tensile Properties and Dynamic Characteristics of Coconut Fiber Reinforced Composite


    Izzuddin Zaman; Al Emran Ismail; Muhamad Khairudin Awang


    The utilization of coconut fibers as reinforcement in polymer composites has been increased significantly due to their low cost and high specific mechanical properties. In this paper, the mechanical properties and dynamic characteristics of a proposed combined polymer composite which consist of a polyester matrix and coconut fibers are determined. The influence of fibers volume fraction (%) is also evaluated and composites with volumetric amounts of coconut fiber up to 15% are fabricated. In ...

  13. Non-invasive measurement of stroke volume and left ventricular ejection fraction. Radionuclide cardiography compared with left ventricular cardioangiography

    DEFF Research Database (Denmark)

    Kelbaek, H; Svendsen, J H; Aldershvile, J


    The stroke volume (SV) was determined by first passage radionuclide cardiography and the left ventricular ejection fraction (LVEF) by multigated radionuclide cardiography in 20 patients with ischemic heart disease. The results were evaluated against those obtained by the invasive dye dilution or ...... are reliable. The discrepancy between the non-invasive and invasive LVEF values raises the question, whether LVEF is overestimated by cardioangiography or underestimated by radionuclide cardiography....

  14. Critical Void Volume Fraction fc at Void Coalescence for S235JR Steel at Low Initial Stress Triaxiality (United States)

    Grzegorz Kossakowski, Paweł; Wciślik, Wiktor


    The paper is concerned with the nucleation, growth and coalescence of microdefects in the form of voids in S235JR steel. The material is known to be one of the basic steel grades commonly used in the construction industry. The theory and methods of damage mechanics were applied to determine and describe the failure mechanisms that occur when the material undergoes deformation. Until now, engineers have generally employed the Gurson-Tvergaard- Needleman model. This material model based on damage mechanics is well suited to define and analyze failure processes taking place in the microstructure of S235JR steel. It is particularly important to determine the critical void volume fraction fc , which is one of the basic parameters of the Gurson-Tvergaard-Needleman material model. As the critical void volume fraction fc refers to the failure stage, it is determined from the data collected for the void coalescence phase. A case of multi-axial stresses is considered taking into account the effects of spatial stress state. In this study, the parameter of stress triaxiality η was used to describe the failure phenomena. Cylindrical tensile specimens with a circumferential notch were analysed to obtain low values of initial stress triaxiality (η = 0.556 of the range) in order to determine the critical void volume fraction fc . It is essential to emphasize how unique the method applied is and how different it is from the other more common methods involving parameter calibration, i.e. curve-fitting methods. The critical void volume fraction fc at void coalescence was established through digital image analysis of surfaces of S235JR steel, which involved studying real, physical results obtained directly from the material tested.

  15. Effects of retained austenite volume fraction, morphology, and carbon content on strength and ductility of nanostructured TRIP-assisted steels

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Y.F., E-mail: [Key Laboratory for Anisotropy and Texture of Materials (MOE), Northeastern University, 3 Wenhua Road, Shenyang 110004 (China); Qiu, L.N. [Key Laboratory for Anisotropy and Texture of Materials (MOE), Northeastern University, 3 Wenhua Road, Shenyang 110004 (China); Sun, X. [Pacific Northwest National Laboratory, PO Box 999, Richland, WA 99352 (United States); Zuo, L. [Key Laboratory for Anisotropy and Texture of Materials (MOE), Northeastern University, 3 Wenhua Road, Shenyang 110004 (China); Liaw, P.K. [Department of Materials Science and Engineering, The University of Tennessee, Knoxville, TN 37996 (United States); Raabe, D. [Max-Planck-Institut fuer Eisenforschung, Max-Planck-Str. 1, 8, 40237 Düsseldorf (Germany)


    With a suite of multi-modal and multi-scale characterization techniques, the present study unambiguously proves that a substantially-improved combination of ultrahigh strength and good ductility can be achieved by tailoring the volume fraction, morphology, and carbon content of the retained austenite (RA) in a transformation-induced-plasticity (TRIP) steel with the nominal chemical composition of 0.19C–0.30Si–1.76Mn–1.52Al (weight percent, wt%). After intercritical annealing and bainitic holding, a combination of ultimate tensile strength (UTS) of 1100 MPa and true strain of 50% has been obtained, as a result of the ultrafine RA lamellae, which are alternately arranged in the bainitic ferrite around junction regions of ferrite grains. For reference, specimens with a blocky RA, prepared without the bainitic holding, yield a low ductility (35%) and a low UTS (800 MPa). The volume fraction, morphology, and carbon content of RA have been characterized using various techniques, including the magnetic probing, scanning electron microscopy (SEM), electron-backscatter-diffraction (EBSD), and transmission electron microscopy (TEM). Interrupted tensile tests, mapped using EBSD in conjunction with the kernel average misorientation (KAM) analysis, reveal that the lamellar RA is the governing microstructure component responsible for the higher mechanical stability, compared to the blocky one. By coupling these various techniques, we quantitatively demonstrate that in addition to the RA volume fraction, its morphology and carbon content are equally important in optimizing the strength and ductility of TRIP-assisted steels.

  16. The Effect of Fiber Strength Stochastics and Local Fiber Volume Fraction on Multiscale Progressive Failure of Composites (United States)

    Ricks, Trenton M.; Lacy, Jr., Thomas E.; Bednarcyk, Brett A.; Arnold, Steven M.


    Continuous fiber unidirectional polymer matrix composites (PMCs) can exhibit significant local variations in fiber volume fraction as a result of processing conditions that can lead to further local differences in material properties and failure behavior. In this work, the coupled effects of both local variations in fiber volume fraction and the empirically-based statistical distribution of fiber strengths on the predicted longitudinal modulus and local tensile strength of a unidirectional AS4 carbon fiber/ Hercules 3502 epoxy composite were investigated using the special purpose NASA Micromechanics Analysis Code with Generalized Method of Cells (MAC/GMC); local effective composite properties were obtained by homogenizing the material behavior over repeating units cells (RUCs). The predicted effective longitudinal modulus was relatively insensitive to small (8%) variations in local fiber volume fraction. The composite tensile strength, however, was highly dependent on the local distribution in fiber strengths. The RUC-averaged constitutive response can be used to characterize lower length scale material behavior within a multiscale analysis framework that couples the NASA code FEAMAC and the ABAQUS finite element solver. Such an approach can be effectively used to analyze the progressive failure of PMC structures whose failure initiates at the RUC level. Consideration of the effect of local variations in constituent properties and morphologies on progressive failure of PMCs is a central aspect of the application of Integrated Computational Materials Engineering (ICME) principles for composite materials.

  17. Fractional filling with the microdepot technique as an alternative to bolus hyaluronic acid injections in facial volume restoration. (United States)

    Lim, Adrian C; Lowe, Patricia M


    For volume restoration of the face, hyaluronic acid is conventionally injected through long, large-bore, 18-gauge needles because of the higher viscosity subtypes required. These hyaluronic acids are either more highly cross-linked or larger in particle size than the less-viscous subtypes. The microdepot injection technique involves using the 31-gauge BD insulin syringe (Becton-Dickinson, North Ryde, NSW Australia) to deposit small amounts of filler (0.05-0.1 mL) throughout the area of volume loss. The procedure is extremely well tolerated, requiring only topical and ice anaesthesia. Using this method, volume restoration can be achieved naturally and progressively over a period of time. Fractional filling every 3-4 months is continued until the desired level of volume correction is attained. Patients undergoing fractional filling followed over a 12-month period did not indicate any observable compromise in filler longevity, even when highly viscous hyaluronic acid fillers were injected through small-bore, 31-gauge insulin syringes. © 2011 The Authors. Australasian Journal of Dermatology © 2011 The Australasian College of Dermatologists.

  18. Usefulness of acoustic quantification method in left ventricular volume and ejection fraction. Compared with ventriculography and scintigraphy

    International Nuclear Information System (INIS)

    Shibata, Takahiro; Honda, Youichi; Kashiwagi, Hidehiko


    Acoustic quantification method (AQ: on-line automated boundary detection system) has proved to have a good correlation with left ventriculography (LVG) and scintigraphy (SG) in patients with normal left ventricular (LV) function. The aim of this study is to determine whether AQ is also useful in patients with abnormal LV function. We examined 54 patients with LV asynergy. End-diastolic volumes with AQ, LVG and SG were 77, 135, 118 ml. A good correlation was found between AQ and LVG and SG (LVG; r=0.81, SG; r=0.68). End-systolic volumes with AQ, LVG and SG were 38, 64 and 57 ml. Left ventricular volumes obtained from AQ had a good correlation with LVG and SG, but were underestimated. LV ejection fraction obtained from AQ had good correlation with those with LVG and SG (LVG; r=0.84. SG; r=0.77). On-line AQ appears to be a useful noninvasive method for evaluation of the left ventricular ejection fraction, but care must be exercised when estimations of left ventricular volumes are made. (author)

  19. Optimization of the fractionated irradiation scheme considering physical doses to tumor and organ at risk based on dose–volume histograms

    Energy Technology Data Exchange (ETDEWEB)

    Sugano, Yasutaka [Graduate School of Health Sciences, Hokkaido University, Kita-12, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-0812 (Japan); Mizuta, Masahiro [Laboratory of Advanced Data Science, Information Initiative Center, Hokkaido University, Kita-11, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-0811 (Japan); Takao, Seishin; Shirato, Hiroki; Sutherland, Kenneth L. [Department of Radiation Medicine, Graduate School of Medicine, Hokkaido University, Kita-15, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-8638 (Japan); Date, Hiroyuki, E-mail: [Faculty of Health Sciences, Hokkaido University, Kita-12, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-0812 (Japan)


    Purpose: Radiotherapy of solid tumors has been performed with various fractionation regimens such as multi- and hypofractionations. However, the ability to optimize the fractionation regimen considering the physical dose distribution remains insufficient. This study aims to optimize the fractionation regimen, in which the authors propose a graphical method for selecting the optimal number of fractions (n) and dose per fraction (d) based on dose–volume histograms for tumor and normal tissues of organs around the tumor. Methods: Modified linear-quadratic models were employed to estimate the radiation effects on the tumor and an organ at risk (OAR), where the repopulation of the tumor cells and the linearity of the dose-response curve in the high dose range of the surviving fraction were considered. The minimization problem for the damage effect on the OAR was solved under the constraint that the radiation effect on the tumor is fixed by a graphical method. Here, the damage effect on the OAR was estimated based on the dose–volume histogram. Results: It was found that the optimization of fractionation scheme incorporating the dose–volume histogram is possible by employing appropriate cell surviving models. The graphical method considering the repopulation of tumor cells and a rectilinear response in the high dose range enables them to derive the optimal number of fractions and dose per fraction. For example, in the treatment of prostate cancer, the optimal fractionation was suggested to lie in the range of 8–32 fractions with a daily dose of 2.2–6.3 Gy. Conclusions: It is possible to optimize the number of fractions and dose per fraction based on the physical dose distribution (i.e., dose–volume histogram) by the graphical method considering the effects on tumor and OARs around the tumor. This method may stipulate a new guideline to optimize the fractionation regimen for physics-guided fractionation.

  20. The capability of radial basis function to forecast the volume fractions of the annular three-phase flow of gas-oil-water. (United States)

    Roshani, G H; Karami, A; Salehizadeh, A; Nazemi, E


    The problem of how to precisely measure the volume fractions of oil-gas-water mixtures in a pipeline remains as one of the main challenges in the petroleum industry. This paper reports the capability of Radial Basis Function (RBF) in forecasting the volume fractions in a gas-oil-water multiphase system. Indeed, in the present research, the volume fractions in the annular three-phase flow are measured based on a dual energy metering system including the 152 Eu and 137 Cs and one NaI detector, and then modeled by a RBF model. Since the summation of volume fractions are constant (equal to 100%), therefore it is enough for the RBF model to forecast only two volume fractions. In this investigation, three RBF models are employed. The first model is used to forecast the oil and water volume fractions. The next one is utilized to forecast the water and gas volume fractions, and the last one to forecast the gas and oil volume fractions. In the next stage, the numerical data obtained from MCNP-X code must be introduced to the RBF models. Then, the average errors of these three models are calculated and compared. The model which has the least error is picked up as the best predictive model. Based on the results, the best RBF model, forecasts the oil and water volume fractions with the mean relative error of less than 0.5%, which indicates that the RBF model introduced in this study ensures an effective enough mechanism to forecast the results. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Evaluation of gamma prime volume fractions and lattice misfits in a nickel base superalloy using the external standard X-ray diffraction method

    Energy Technology Data Exchange (ETDEWEB)

    Tiley, J., E-mail: [Air Force Research Laboratory, Materials and Manufacturing Directorate, WPAFB, OH (United States); Viswanathan, G.B. [Air Force Research Laboratory, Materials and Manufacturing Directorate, WPAFB, OH (United States); Hwang, J.Y. [Materials Engineering Department, University of North Texas, Denton, TX (United States); Shiveley, A. [Air Force Research Laboratory, Materials and Manufacturing Directorate, WPAFB, OH (United States); Banerjee, R. [Materials Engineering Department, University of North Texas, Denton, TX (United States)


    The unconstrained lattice parameters and volume fractions of {gamma}' for a low misfit nickel based superalloy were evaluated using X-ray diffraction techniques. Extraction techniques were used to provide unconstrained {gamma}' powders for both water quenched and slow cooled samples that were aged at 760 deg. C for 0, 25, 50, 100, and 200 h. The external standard method was used to determine the volume fraction for the unaged water quenched sample and the slow cooled sample aged for 200 h. These two extremes in processing conditions provided an increase in the total volume fraction of {gamma}'.

  2. Prediction of gas volume fraction in fully-developed gas-liquid flow in a vertical pipe

    Energy Technology Data Exchange (ETDEWEB)

    Islam, A.S.M.A.; Adoo, N.A.; Bergstrom, D.J., E-mail: [University of Saskatchewan, Department of Mechanical Engineering, Saskatoon, SK (Canada); Wang, D.F. [Canadian Nuclear Laboratories, Chalk River, ON (Canada)


    An Eulerian-Eulerian two-fluid model has been implemented for the prediction of the gas volume fraction profile in turbulent upward gas-liquid flow in a vertical pipe. The two-fluid transport equations are discretized using the finite volume method and a low Reynolds number κ-ε turbulence model is used to predict the turbulence field for the liquid phase. The contribution to the effective turbulence by the gas phase is modeled by a bubble induced turbulent viscosity. For the fully-developed flow being considered, the gas volume fraction profile is calculated using the radial momentum balance for the bubble phase. The model potentially includes the effect of bubble size on the interphase forces and turbulence model. The results obtained are in good agreement with experimental data from the literature. The one-dimensional formulation being developed allows for the efficient assessment and further development of both turbulence and two-fluid models for multiphase flow applications in the nuclear industry. (author)

  3. Prediction of gas volume fraction in fully-developed gas-liquid flow in a vertical pipe

    International Nuclear Information System (INIS)

    Islam, A.S.M.A.; Adoo, N.A.; Bergstrom, D.J.; Wang, D.F.


    An Eulerian-Eulerian two-fluid model has been implemented for the prediction of the gas volume fraction profile in turbulent upward gas-liquid flow in a vertical pipe. The two-fluid transport equations are discretized using the finite volume method and a low Reynolds number κ-ε turbulence model is used to predict the turbulence field for the liquid phase. The contribution to the effective turbulence by the gas phase is modeled by a bubble induced turbulent viscosity. For the fully-developed flow being considered, the gas volume fraction profile is calculated using the radial momentum balance for the bubble phase. The model potentially includes the effect of bubble size on the interphase forces and turbulence model. The results obtained are in good agreement with experimental data from the literature. The one-dimensional formulation being developed allows for the efficient assessment and further development of both turbulence and two-fluid models for multiphase flow applications in the nuclear industry. (author)

  4. Determination of average fission fraction produced by 14 MeV neutrons in assemblies with large volume of depleted uranium

    International Nuclear Information System (INIS)

    Wang Dalun; Li Benci; Wang Xiuchun; Li Yijun; Zhang Shaohua; He Yongwu


    The average fission fraction of 238 U caused by 14 MeV neutrons in assemblies with large volume depleted uranium has been determined. The measured value of p f 238U (R ∞ depleted ) 14 was 0.897 ± 0.036. Measurements were also completed for neutron flux distribution and average fission fraction of 235 U isotope in depleted uranium sphere. Values of p f 238U (R depleted ) have been obtained by using a series of uranium spheres. For a sphere with Φ 600 the p f 23 '8 U (R 300 depleted ) is 0.823 ± 0.041, the density of depleted uranium assembly is 18.8g/cm 3 and total weight of assembly is about 2.8t

  5. Reference intervals for mean platelet volume and immature platelet fraction determined on a sysmex XE5000 hematology analyzer

    DEFF Research Database (Denmark)

    Jørgensen, Mikala Klok; Bathum, L.


    Background New parameters describing the platelet population of the blood are mean platelet volume (MPV), which is a crude estimate of thrombocyte reactivity, and immature platelet fraction (IPF), which reflects megakaryopoietic activity. This study aimed to define reference intervals for MPV...... and IPF and to investigate whether separate reference intervals according to smoking status, age or sex are necessary.Methods Blood samples were obtained from subjects participating in The Danish General Suburban Population Study. MPV and IPF measurements were performed by the use of the Sysmex XE-5000...

  6. Theoretical Model for Volume Fraction of UC, 235U Enrichment, and Effective Density of Final U 10Mo Alloy

    Energy Technology Data Exchange (ETDEWEB)

    Devaraj, Arun [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Prabhakaran, Ramprashad [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Joshi, Vineet V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Hu, Shenyang Y. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); McGarrah, Eric J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Lavender, Curt A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL)


    The purpose of this document is to provide a theoretical framework for (1) estimating uranium carbide (UC) volume fraction in a final alloy of uranium with 10 weight percent molybdenum (U-10Mo) as a function of final alloy carbon concentration, and (2) estimating effective 235U enrichment in the U-10Mo matrix after accounting for loss of 235U in forming UC. This report will also serve as a theoretical baseline for effective density of as-cast low-enriched U-10Mo alloy. Therefore, this report will serve as the baseline for quality control of final alloy carbon content

  7. Integer, fractional, and anomalous quantum Hall effects explained with Eyring's rate process theory and free volume concept. (United States)

    Hao, Tian


    The Hall effects, especially the integer, fractional and anomalous quantum Hall effects, have been addressed using Eyring's rate process theory and free volume concept. The basic assumptions are that the conduction process is a common rate controlled "reaction" process that can be described with Eyring's absolute rate process theory; the mobility of electrons should be dependent on the free volume available for conduction electrons. The obtained Hall conductivity is clearly quantized as with prefactors related to both the magnetic flux quantum number and the magnetic quantum number via the azimuthal quantum number, with and without an externally applied magnetic field. This article focuses on two dimensional (2D) systems, but the approaches developed in this article can be extended to 3D systems.

  8. Prediction of the Soil Water Characteristic from Soil Particle Volume Fractions

    DEFF Research Database (Denmark)

    Naveed, Muhammad; Møldrup, Per; Tuller, Markus


    Modelling water distribution and flow in partially saturated soils requires knowledge of the soil-water characteristic (SWC). However, measurement of the SWC is challenging and time-consuming, and in some cases not feasible. This study introduces two predictive models (Xw-model and Xw......*-model) for the SWC, derived from readily available soil properties such as texture and bulk density. A total of 46 soils from different horizons at 15 locations across Denmark were used for models evaluation. The Xw-model predicts the volumetric water content as a function of volumetric fines content (organic matter...... (organic matter, clay, silt, fine and coarse sand), variably included in the model depending on the pF value. The volumetric content of a particular soil particle size fraction was included in the model if it was assumed to contribute to the pore size fraction still occupied with water at the given p...

  9. A glimpse beneath Antarctic sea ice: observation of platelet-layer thickness and ice-volume fraction with multifrequency EM (United States)

    Hoppmann, Mario; Hunkeler, Priska A.; Hendricks, Stefan; Kalscheuer, Thomas; Gerdes, Rüdiger


    In Antarctica, ice crystals (platelets) form and grow in supercooled waters below ice shelves. These platelets rise, accumulate beneath nearby sea ice, and subsequently form a several meter thick, porous sub-ice platelet layer. This special ice type is a unique habitat, influences sea-ice mass and energy balance, and its volume can be interpreted as an indicator of the health of an ice shelf. Although progress has been made in determining and understanding its spatio-temporal variability based on point measurements, an investigation of this phenomenon on a larger scale remains a challenge due to logistical constraints and a lack of suitable methodology. In the present study, we applied a lateral constrained Marquardt-Levenberg inversion to a unique multi-frequency electromagnetic (EM) induction sounding dataset obtained on the ice-shelf influenced fast-ice regime of Atka Bay, eastern Weddell Sea. We adapted the inversion algorithm to incorporate a sensor specific signal bias, and confirmed the reliability of the algorithm by performing a sensitivity study using synthetic data. We inverted the field data for sea-ice and platelet-layer thickness and electrical conductivity, and calculated ice-volume fractions within the platelet layer using Archie's Law. The thickness results agreed well with drillhole validation datasets within the uncertainty range, and the ice-volume fraction yielded results comparable to other studies. Both parameters together enable an estimation of the total ice volume within the platelet layer, which was found to be comparable to the volume of landfast sea ice in this region, and corresponded to more than a quarter of the annual basal melt volume of the nearby Ekström Ice Shelf. Our findings show that multi-frequency EM induction sounding is a suitable approach to efficiently map sea-ice and platelet-layer properties, with important implications for research into ocean/ice-shelf/sea-ice interactions. However, a successful application of this

  10. A probabilistic method for determining the volume fraction of pre-embedded capsules in self-healing materials

    International Nuclear Information System (INIS)

    Lv, Zhong; Chen, Huisu


    Autonomous healing of cracks using pre-embedded capsules containing healing agent is becoming a promising approach to restore the strength of damaged structures. In addition to the material properties, the size and volume fraction of capsules influence crack healing in the matrix. Understanding the crack and capsule interaction is critical in the development and design of structures made of self-healing materials. Assuming that the pre-embedded capsules are randomly dispersed we theoretically model flat ellipsoidal crack interaction with capsules and determine the probability of a crack intersecting the pre-embedded capsules i.e. the self-healing probability. We also develop a probabilistic model of a crack simultaneously meeting with capsules and catalyst carriers in two-component self-healing system matrix. Using a risk-based healing approach, we determine the volume fraction and size of the pre-embedded capsules that are required to achieve a certain self-healing probability. To understand the effect of the shape of the capsules on self-healing we theoretically modeled crack interaction with spherical and cylindrical capsules. We compared the results of our theoretical model with Monte-Carlo simulations of crack interaction with capsules. The formulae presented in this paper will provide guidelines for engineers working with self-healing structures in material selection and sustenance. (paper)

  11. Stratification of mixtures in evaporating liquid films occurs only for a range of volume fractions of the smaller component (United States)

    Sear, Richard P.


    I model the drying of a liquid film containing small and big colloid particles. Fortini et al. [Phys. Rev. Lett. 116, 118301 (2016)] studied these films with both computer simulation and experiment. They found that at the end of drying, the mixture had stratified with a layer of the smaller particles on top of the big particles. I develop a simple model for this process. The model has two ingredients: arrest of the diffusion of the particles at high density and diffusiophoretic motion of the big particles due to gradients in the volume fraction of the small particles. The model predicts that stratification only occurs over a range of initial volume fractions of the smaller colloidal species. Above and below this range, the downward diffusiophoretic motion of the big particles is too slow to remove the big particles from the top of the film, and so there is no stratification. In agreement with earlier work, the model also predicts that large Péclet numbers for drying are needed to see stratification.

  12. SU-E-T-480: Radiobiological Dose Comparison of Single Fraction SRS, Multi-Fraction SRT and Multi-Stage SRS of Large Target Volumes Using the Linear-Quadratic Formula

    International Nuclear Information System (INIS)

    Ding, C; Hrycushko, B; Jiang, S; Meyer, J; Timmerman, R


    Purpose: To compare the radiobiological effect on large tumors and surrounding normal tissues from single fraction SRS, multi-fractionated SRT, and multi-staged SRS treatment. Methods: An anthropomorphic head phantom with a centrally located large volume target (18.2 cm 3 ) was scanned using a 16 slice large bore CT simulator. Scans were imported to the Multiplan treatment planning system where a total prescription dose of 20Gy was used for a single, three staged and three fractionated treatment. Cyber Knife treatment plans were inversely optimized for the target volume to achieve at least 95% coverage of the prescription dose. For the multistage plan, the target was segmented into three subtargets having similar volume and shape. Staged plans for individual subtargets were generated based on a planning technique where the beam MUs of the original plan on the total target volume are changed by weighting the MUs based on projected beam lengths within each subtarget. Dose matrices for each plan were export in DICOM format and used to calculate equivalent dose distributions in 2Gy fractions using an alpha beta ratio of 10 for the target and 3 for normal tissue. Results: Singe fraction SRS, multi-stage plan and multi-fractionated SRT plans had an average 2Gy dose equivalent to the target of 62.89Gy, 37.91Gy and 33.68Gy, respectively. The normal tissue within 12Gy physical dose region had an average 2Gy dose equivalent of 29.55Gy, 16.08Gy and 13.93Gy, respectively. Conclusion: The single fraction SRS plan had the largest predicted biological effect for the target and the surrounding normal tissue. The multi-stage treatment provided for a more potent biologically effect on target compared to the multi-fraction SRT treatments with less biological normal tissue than single-fraction SRS treatment

  13. Calculation of Void Volume Fraction in the Subcooled and Quality Boiling Regions

    Energy Technology Data Exchange (ETDEWEB)

    Rouhani, S Z; Axelsson, E


    The complex problem of void calculation in the different regions of flow boiling is divided in two parts. The first part includes only the description of the mechanisms and the calculation of the rates of heat transfer for vapour and liquid. It is assumed that heat is removed by vapour generation, heating of the liquid that replaces the detached bubbles, and in some parts, by single phase heat transfer. By considering the rate of vapour condensation in liquid, an equation for the differential changes in the true steam quality throughout the boiling regions is obtained. Integration of this equation yields the vapour weight fraction at any position. The second part of the problem concerns the determination of the void fractions corresponding to the calculated steam qualities. For this purpose we use the derivations of Zuber and Findlay. This model is compared with data from different geometries including small rectangular channels and large rod bundles. The data covered pressures from 19 to 138 bars, heat fluxes from 18 to 120 W/cm{sup 2} with many different subcoolings and mass velocities. The agreement is generally very good.

  14. Calculation of Void Volume Fraction in the Subcooled and Quality Boiling Regions

    International Nuclear Information System (INIS)

    Rouhani, S.Z.; Axelsson, E.


    The complex problem of void calculation in the different regions of flow boiling is divided in two parts. The first part includes only the description of the mechanisms and the calculation of the rates of heat transfer for vapour and liquid. It is assumed that heat is removed by vapour generation, heating of the liquid that replaces the detached bubbles, and in some parts, by single phase heat transfer. By considering the rate of vapour condensation in liquid, an equation for the differential changes in the true steam quality throughout the boiling regions is obtained. Integration of this equation yields the vapour weight fraction at any position. The second part of the problem concerns the determination of the void fractions corresponding to the calculated steam qualities. For this purpose we use the derivations of Zuber and Findlay. This model is compared with data from different geometries including small rectangular channels and large rod bundles. The data covered pressures from 19 to 138 bars, heat fluxes from 18 to 120 W/cm 2 with many different subcoolings and mass velocities. The agreement is generally very good

  15. SU-E-T-427: Cell Surviving Fractions Derived From Tumor-Volume Variation During Radiotherapy for Non-Small Cell Lung Cancer: Comparison with Predictive Assays

    Energy Technology Data Exchange (ETDEWEB)

    Chvetsov, A; Schwartz, J; Mayr, N [University of Washington, Seattle, WA (United States); Yartsev, S [London Health Sciences Centre, London, Ontario (Canada)


    Purpose: To show that a distribution of cell surviving fractions S{sub 2} in a heterogeneous group of patients can be derived from tumor-volume variation curves during radiotherapy for non-small cell lung cancer. Methods: Our analysis was based on two data sets of tumor-volume variation curves for heterogeneous groups of 17 patients treated for nonsmall cell lung cancer with conventional dose fractionation. The data sets were obtained previously at two independent institutions by using megavoltage (MV) computed tomography (CT). Statistical distributions of cell surviving fractions S{sup 2} and cell clearance half-lives of lethally damaged cells T1/2 have been reconstructed in each patient group by using a version of the two-level cell population tumor response model and a simulated annealing algorithm. The reconstructed statistical distributions of the cell surviving fractions have been compared to the distributions measured using predictive assays in vitro. Results: Non-small cell lung cancer presents certain difficulties for modeling surviving fractions using tumor-volume variation curves because of relatively large fractional hypoxic volume, low gradient of tumor-volume response, and possible uncertainties due to breathing motion. Despite these difficulties, cell surviving fractions S{sub 2} for non-small cell lung cancer derived from tumor-volume variation measured at different institutions have similar probability density functions (PDFs) with mean values of 0.30 and 0.43 and standard deviations of 0.13 and 0.18, respectively. The PDFs for cell surviving fractions S{sup 2} reconstructed from tumor volume variation agree with the PDF measured in vitro. Comparison of the reconstructed cell surviving fractions with patient survival data shows that the patient survival time decreases as the cell surviving fraction increases. Conclusion: The data obtained in this work suggests that the cell surviving fractions S{sub 2} can be reconstructed from the tumor volume

  16. Agreement of left ventricular ejection fraction and volumes between adenosine stress TL-201 gated SPECT and echocardiography

    Energy Technology Data Exchange (ETDEWEB)

    Pai, M. S. [College of Medicine, Univ. of Ewha, Seoul (Korea, Republic of); Moon, D. H.; Kim, H. M.; Yang, Y. J.; Kang, D. H. [Asan Medical Center, Seoul (Korea, Republic of)


    Electrocardiogram-gated TI-201 SPECT measurements of left ventricular ejection fraction (EF), end-diastolic volume (EDV), and end-systolic volume (ESV) have shown high correlation with conventional methods. However, how much these parameters measured by TI-201 gated SPECT differ from those by echocardiography has not been assessed. Adenosine stress (Ad-G) and redistribution TI-201 gated SPECT (Re-G) and resting echocardiography were conducted in 337 patients (184 male, 153 female). EDV, ESV and LVEF measured by QGS software were compared with the results by echocardiography. Patients with arrhythmia (atrial fibrillation or frequent premature contractions) or evidence of fixed or reversible perfusion defects on TI-201 SPECT were excluded. EF, EDV and ESV measured by Ad-G (63.3{+-}9.8,73.8{+-}30.2,29.1{+-}20.1) and Re-G (65.2{+-}11.6,69.1{+-}30.1,26.5{+-}20.3) correlated well with those by Echo (61.4{+-}7.9,78.3{+-}2.7, 30.7{+-} 17.5 ; r of Ad-G=0.547, 0.850, 0.827, p<0.001 ; r of Re-G=0.585, 0.838, 0.819, p<0.001). However the difference (mean, SD, SEE of Echo - gated SPECT) was statistically significant (EF: Ad-G=1.71, 8.92, 0.48, Re-G=3.59, 10.39, 0.56, p<0.001 ; EDV: Ad-G=4.75, 16.21, 0.88, Re-G=9.53, 16.77, 0.91, p<0.001 ; ESV: Ad-G=1.75, 11.35, 0.61, p<0.05, Re-G=4.29, 11.7, 0.63, p<0.001). Bland-Altman plots showed that the difference of EDV and ESV did not vary in any systematic way over the range of measurement, whereas the difference of EF increased with increasing average EF by Echo and gated-SPECT. The difference of EF, EDV, and ESV between Ad-G and Echo was significantly smaller than those between Re-G and Echo (p<0.001). Gated TI-201 SPECT underestimates EDV and ESV over a wide range of volume. As a result, EF by gated TI-201 SPECT is overestimated especially in patients with small LV volume. Ad-G is preferable to Re-G in assessing left ventricular ejection fraction and volume in place of Echo because of smaller bias.

  17. In vivo assessment of the tolerance dose of small liver volumes after single-fraction HDR irradiation

    International Nuclear Information System (INIS)

    Ricke, Jens; Seidensticker, Max; Luedemann, Lutz; Pech, Maciej; Wieners, Gero; Hengst, Susanne; Mohnike, Konrad; Cho, Chie Hee; Lopez Haenninen, Enrique; Al-Abadi, Hussain; Felix, Roland; Wust, Peter


    Purpose: To prospectively assess a dose-response relationship for small volumes of liver parenchyma after single-fraction irradiation. Methods and Materials: Twenty-five liver metastases were treated by computed tomography (CT)-guided interstitial brachytherapy. Magnetic resonance imaging was performed 1 day before and 3 days and 6, 12, and 24 weeks after therapy. MR sequences included T1-w gradient echo (GRE) enhanced by hepatocyte-targeted gadobenate dimeglumine. All MRI data sets were merged with 3D dosimetry data and evaluated by two radiologists. The reviewers indicated the border of hyperintensity on T2-w images (edema) or hypointensity on T1-w images (loss of hepatocyte function). Based on the total 3D data, a dose-volume histogram was calculated. We estimated the threshold dose for either edema or function loss as the D 90 , i.e., the dose achieved in at least 90% of the pseudolesion volume. Results: Between 3 days and 6 weeks, the extension of the edema increased significantly from the 12.9 Gy isosurface to 9.9 Gy (standard deviation [SD], 3.3 and 2.6). No significant change was detected between 6 and 12 weeks. After 24 weeks, the edematous tissue had shrunk significantly to 14.7 Gy (SD, 4.2). Three days postbrachytherapy, the D 90 for hepatocyte function loss reached the 14.9 Gy isosurface (SD, 3.9). At 6 weeks, the respective zone had increased significantly to 9.9 Gy (SD, 2.3). After 12 and 24 weeks, the dysfunction volume had decreased significantly to the 11.9 Gy and 15.2 Gy isosurface, respectively (SD, 3 and 4.1). Conclusions: The 95% interval from 7.6 to 12.2 Gy found as the minimal hepatocyte tolerance after 6 weeks accounts for the radiobiologic variations found in CT-guided brachytherapy, including heterogeneous dose rates by variable catheter arrays

  18. A technique of using gated-CT images to determine internal target volume (ITV) for fractionated stereotactic lung radiotherapy

    International Nuclear Information System (INIS)

    Jin Jianyue; Ajlouni, Munther; Chen Qing; Yin, Fang-Fang; Movsas, Benjamin


    Background and purpose: To develop and evaluate a technique and procedure of using gated-CT images in combination with PET image to determine the internal target volume (ITV), which could reduce the planning target volume (PTV) with adequate target coverage. Patients and methods: A skin marker-based gating system connected to a regular single slice CT scanner was used for this study. A motion phantom with adjustable motion amplitude was used to evaluate the CT gating system. Specifically, objects of various sizes/shapes, considered as virtual tumors, were placed on the phantom to evaluate the number of phases of gated images required to determine the ITV while taking into account tumor size, shape and motion. A procedure of using gated-CT and PET images to define ITV for patients was developed and was tested in patients enrolled in an IRB approved protocol. Results: The CT gating system was capable of removing motion artifacts for target motion as large as 3-cm when it was gated at optimal phases. A phantom study showed that two gated-CT scans at the end of expiration and the end of inspiration would be sufficient to determine the ITV for tumor motion less than 1-cm, and another mid-phase scan would be required for tumors with 2-cm motion, especially for small tumors. For patients, the ITV encompassing visible tumors in all sets of gated-CT and regular spiral CT images seemed to be consistent with the target volume determined from PET images. PTV expanded from the ITV with a setup uncertainty margin had less volume than PTVs from spiral CT images with a 10-mm generalized margin or an individualized margin determined at fluoroscopy. Conclusions: A technique of determining the ITV using gated-CT images was developed and was clinically implemented successfully for fractionated stereotactic lung radiotherapy

  19. Quantifying uncertainty in soot volume fraction estimates using Bayesian inference of auto-correlated laser-induced incandescence measurements (United States)

    Hadwin, Paul J.; Sipkens, T. A.; Thomson, K. A.; Liu, F.; Daun, K. J.


    Auto-correlated laser-induced incandescence (AC-LII) infers the soot volume fraction (SVF) of soot particles by comparing the spectral incandescence from laser-energized particles to the pyrometrically inferred peak soot temperature. This calculation requires detailed knowledge of model parameters such as the absorption function of soot, which may vary with combustion chemistry, soot age, and the internal structure of the soot. This work presents a Bayesian methodology to quantify such uncertainties. This technique treats the additional "nuisance" model parameters, including the soot absorption function, as stochastic variables and incorporates the current state of knowledge of these parameters into the inference process through maximum entropy priors. While standard AC-LII analysis provides a point estimate of the SVF, Bayesian techniques infer the posterior probability density, which will allow scientists and engineers to better assess the reliability of AC-LII inferred SVFs in the context of environmental regulations and competing diagnostics.

  20. Effect of Volume Fraction of Particle on Wear Resistance of Al2O3/Steel Composites at Elevated Temperature

    Institute of Scientific and Technical Information of China (English)

    BAO Chong-gao; WANG En-ze; GAO Yi-min; XING Jian-dong


    Based on previous work,abrasive wear resistance of Al2 O3/steel composites with different Al2 O3 parti cle volume fraction (VOF) at 900 C was investigated.The experimental results showed that a suitable particle VOF is important to protect the metal matrix from wear at elevated temperature.Both too high and too low particle VOF lead to a poor abrasive wear because a bulk matrix is easily worn off by grits when it exceeds the suitable VOF and also because when VOF is low,the Al2O3 particles are easily dug out by grits during wearing as well.When the particle VOF is 39%,the wear resistance of tested composites is excellent.

  1. The Effect of Type and Volume Fraction (Vf) of Steel Fiber on the Mechanical Properties of Self-Compacting Concrete

    DEFF Research Database (Denmark)

    Ghanbarpour, S.; Mazaheripour, H.; Mirmoradi, S. H.


    is to investigate the effects of type and volume fraction of steel fiber on the compressive strength, split tensile strength, flexural strength and modulus of elasticity of steel fiber reinforced self-compacting concrete (SFRSCC). Design/methodology/approach – For this purpose, Micro wire and Wave type steel fibers......Purpose – Self-compacting concrete (SCC) offers several economic and technical benefits; the use of steel fibers extends its possibilities. Steel fibers bridge cracks, retard their propagation, and improve several characteristics and properties of the SCC. The purpose of this paper...... – It was found that, inclusion of steel fibers significantly affect the split tensile and flexural strength of SCC accordance with type and vf. Besides, mathematical expressions were developed to estimate the flexural, modulus of elasticity and split tensile strength of SFRSCCs regarding of compressive strength...

  2. 2D and 3D milled surface roughness of high volume fraction SiCp/Al composites

    Directory of Open Access Journals (Sweden)

    Tao Wang


    Full Text Available This paper presents a study on surface roughness generated by high speed milling of high volume fraction (65% silicon carbide particle-reinforced aluminum matrix (SiCp/Al composites. Typical 2D (Ra and Rz and 3D (Sa and Sq surface roughness parameters were selected to evaluate the influence of the milling parameters on the surface quality in comparison with aluminum alloy. The 3D topography of the milled surface was studied as well. The results indicate that 3D parameters (Sa and Sq are more capable to describe the influence of the milling parameters on the surface quality, and among them Sq is preferable due to its good sensitivity. Sq decreases with milling speed and increases with feed rate. The influence of axial depth of cut (ADOC is negligible.

  3. Synthesis and characterization of high volume fraction Al-Al2O3 nanocomposite powders by high-energy milling

    International Nuclear Information System (INIS)

    Prabhu, B.; Suryanarayana, C.; An, L.; Vaidyanathan, R.


    Al-Al 2 O 3 metal matrix composite (MMC) powders with volume fractions of 20, 30, and 50% Al 2 O 3 were synthesized by high-energy milling of the blended component powders. The particle sizes of Al 2 O 3 studied were 50 nm, 150 nm, and 5 μm. A uniform distribution of the Al 2 O 3 reinforcement in the Al matrix was successfully obtained after milling the powders for a period of 20 h at a ball-to-powder ratio of 10:1 in a SPEX mill. The uniform distribution of Al 2 O 3 in the Al matrix was confirmed by characterizing these nanocomposite powders by scanning electron microscopy (SEM), energy dispersive spectrometry (EDS), X-ray mapping, and X-ray diffraction (XRD) techniques

  4. Study of geometry to obtain the volume fraction of multiphase flows using the MCNP-X code

    International Nuclear Information System (INIS)

    Peixoto, Philippe N.B.; Salgado, Cesar M.


    The gamma ray attenuation technique is used in many works to obtaining volume fraction of multiphase flows in the oil industry, because it is a noninvasive technique with good precision. In these studies are simulated various geometries with different flow regime, compositions of materials, source-detector positions and types of collimation for sources. This work aim evaluate the interference in the results of the geometry changes and obtaining the best measuring geometry to provide the volume fractions accurately by evaluating different geometries simulations (ranging the source-detector position, flow schemes and homogeneity Makeup) in the MCNP-X code. The study was performed for two types of biphasic compositions of materials (oil-water and oil-air), two flow regimes (annular and smooth stratified) and was varied the position of each material in relative to source and detector positions. Another study to evaluate the interference of homogeneity of the compositions in the results was also conducted in order to verify the possibility of removing part of the composition and make a homogeneous blend using a mixer equipment. All these variations were simulated with two different types of beam, divergent beam and pencil beam. From the simulated geometries, it was possible to compare the differences between the areas of the spectra generated for each model. The results indicate that the flow regime and the differences in the material's densities interfere in the results being necessary to establish a specific simulation geometry for each flows regime. However, the simulations indicate that changing the type of collimation of sources do not affect the results, but improving the counts statistics, increasing the accurate. (author)

  5. Study of geometry to obtain the volume fraction of multiphase flows using the MCNP-X code

    Energy Technology Data Exchange (ETDEWEB)

    Peixoto, Philippe N.B.; Salgado, Cesar M., E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)


    The gamma ray attenuation technique is used in many works to obtaining volume fraction of multiphase flows in the oil industry, because it is a noninvasive technique with good precision. In these studies are simulated various geometries with different flow regime, compositions of materials, source-detector positions and types of collimation for sources. This work aim evaluate the interference in the results of the geometry changes and obtaining the best measuring geometry to provide the volume fractions accurately by evaluating different geometries simulations (ranging the source-detector position, flow schemes and homogeneity Makeup) in the MCNP-X code. The study was performed for two types of biphasic compositions of materials (oil-water and oil-air), two flow regimes (annular and smooth stratified) and was varied the position of each material in relative to source and detector positions. Another study to evaluate the interference of homogeneity of the compositions in the results was also conducted in order to verify the possibility of removing part of the composition and make a homogeneous blend using a mixer equipment. All these variations were simulated with two different types of beam, divergent beam and pencil beam. From the simulated geometries, it was possible to compare the differences between the areas of the spectra generated for each model. The results indicate that the flow regime and the differences in the material's densities interfere in the results being necessary to establish a specific simulation geometry for each flows regime. However, the simulations indicate that changing the type of collimation of sources do not affect the results, but improving the counts statistics, increasing the accurate. (author)

  6. On the surviving fraction in irradiated multicellular tumour spheroids: calculation of overall radiosensitivity parameters, influence of hypoxia and volume effects

    International Nuclear Information System (INIS)

    Horas, Jorge A; Olguin, Osvaldo R; Rizzotto, Marcos G


    We model the heterogeneous response to radiation of multicellular tumour spheroids assuming position- and volume-dependent radiosensitivity. We propose a method to calculate the overall radiosensitivity parameters to obtain the surviving fraction of tumours. A mathematical model of a spherical tumour with a hypoxic core and a viable rim which is a caricature of a real tumour is constructed. The model is embedded in a two-compartment linear-quadratic (LQ) model, assuming a mixed bivariated Gaussian distribution to attain the radiosensitivity parameters. Ergodicity, i.e., the equivalence between ensemble and volumetric averages is used to obtain the overall radiosensitivities for the two compartments. We obtain expressions for the overall radiosensitivity parameters resulting from the use of both a linear and a nonlinear dependence of the local radiosensitivity with position. The model's results are compared with experimental data of surviving fraction (SF) for multicellular spheroids of different sizes. We make one fit using only the smallest spheroid data and we are able to predict the SF for the larger spheroids. These predictions are acceptable particularly using bounded sensitivities. We conclude with the importance of taking into account the contribution of clonogenic hypoxic cells to radiosensitivity and with the convenience of using bounded local sensitivities to predict overall radiosensitivity parameters

  7. Task mapping for non-contiguous allocations.

    Energy Technology Data Exchange (ETDEWEB)

    Leung, Vitus Joseph; Bunde, David P.; Ebbers, Johnathan; Price, Nicholas W.; Swank, Matthew.; Feer, Stefan P.; Rhodes, Zachary D.


    This paper examines task mapping algorithms for non-contiguously allocated parallel jobs. Several studies have shown that task placement affects job running time for both contiguously and non-contiguously allocated jobs. Traditionally, work on task mapping either uses a very general model where the job has an arbitrary communication pattern or assumes that jobs are allocated contiguously, making them completely isolated from each other. A middle ground between these two cases is the mapping problem for non-contiguous jobs having a specific communication pattern. We propose several task mapping algorithms for jobs with a stencil communication pattern and evaluate them using experiments and simulations. Our strategies improve the running time of a MiniApp by as much as 30% over a baseline strategy. Furthermore, this improvement increases markedly with the job size, demonstrating the importance of task mapping as systems grow toward exascale.

  8. Quantitative grain-scale ferroic domain volume fractions and domain switching strains from three-dimensional X-ray diffraction data

    DEFF Research Database (Denmark)

    Oddershede, Jette; Majkut, Marta; Caosyd, Qinghua


    A method for the extension of the three-dimensional X-ray diffraction technique to allow the extraction of domain volume fractions in polycrystalline ferroic materials is presented. This method gives access to quantitative domain volume fractions of hundreds of independent embedded grains within...... are applied to tetragonal coarse-grained Ba0.88Ca0.12Zr0.06Ti0.94O3 and rhombohedral fine-grained (0.82)Bi0.5Na0.5TiO3–(0.18)Bi0.5K0.5TiO3 electroceramic materials. The fitted volume fraction information is used to calculate grain-scale non-180° ferroelectric domain switching strains. The absolute errors...

  9. Influence of primary α-phase volume fraction on the mechanical properties of Ti-6Al-4V alloy at different strain rates and temperatures (United States)

    Ren, Yu; Zhou, Shimeng; Luo, Wenbo; Xue, Zhiyong; Zhang, Yajing


    Bimodal microstructures with primary α-phase volume fractions ranging from 14.3% to 57.1% were gained in Ti-6Al-4V (Ti-64) alloy through annealed in two-phase region at various temperatures below the β-transus point. Then the influence of the primary α-phase volume fraction on the mechanical properties of Ti-64 were studied. The results show that, at room temperature and a strain rate of 10‑3 s‑1, the yield stress decreases but the fracture strain augments with added primary α-phase volume fraction. The equiaxed primary α-phase possesses stronger ability to coordinate plastic deformation, leading to the improvement of the ductile as well as degradation of the strength of Ti-64 with higher primary α-phase volume fraction. As the temperature goes up to 473 K, the quasi-static yield stress and ultimate strength decrease first and then increase with the incremental primary α-phase volume fraction, due to the interaction between the work hardening and the softening caused by the DRX and the growth of the primary α-phase. At room temperature and a strain rate of 3×103 s‑1, the varying pattern of strength with the primary α-phase volume fraction resembles that at a quasi-static strain rate. However, the flow stress significantly increases but the strain-hardening rate decreases compared to those at quasi-static strain rate due to the competition between the strain rate hardening and the thermal softening during dynamic compression process.

  10. Right heart ejection fraction, ventricular volumes, and left to right cardiac shunt measurements with a conventional Anger camera in congenital heart disease

    International Nuclear Information System (INIS)

    Cook, S.A.; Go, R.T.; MacIntyre, W.J.; Moodie, D.S.; Houser, T.S.; Ceimo, J.; Underwood, D.; Yiannikas, J.


    The object of this investigation was to demonstrate that a conventional Anger camera can be used for measurement of right heart ejection fraction, ventricular volumes and left to right shunts in routine clinical determinations. The automatic selection of chamber and lung regions, the recirculation subtraction of recirculation, and the filtering of the right heart ejection fraction dilution curves are all done entirely without operator intervention. Thus, this entire evaluation has been incorporated into the routine procedures of patient care

  11. The effect of different fibre volume fraction on mechanical properties of banana/pineapple leaf (PaLF)/glass hybrid composite (United States)

    Hanafee, Z. M.; Khalina, A.; Norkhairunnisa, M.; Syams, Z. Edi; Liew, K. E.


    This paper investigates the effect of fibre volume fraction on mechanical properties of banana-pineapple leaf (PaLF)-glass reinforced epoxy resin under tensile loading. Uniaxial tensile tests were carried out on specimens with different fibre contents (30%, 40%, 50% in weight). The composite specimens consists of 13 different combinations. The effect of hybridisation between synthetic and natural fibre onto tensile properties was determined and the optimum fibre volume fraction was obtained at 50% for both banana and PaLF composites. Additional 1 layer of woven glass fibre increased the tensile strength of banana-PaLF composite up to 85%.

  12. Use of fractional dose–volume histograms to model risk of acute rectal toxicity among patients treated on RTOG 94-06

    International Nuclear Information System (INIS)

    Tucker, Susan L.; Michalski, Jeff M.; Bosch, Walter R.; Mohan, Radhe; Dong, Lei; Winter, Kathryn; Purdy, James A.; Cox, James D.


    Background and purpose: For toxicities occurring during the course of radiotherapy, it is conceptually inaccurate to perform normal-tissue complication probability analyses using the complete dose–volume histogram. The goal of this study was to analyze acute rectal toxicity using a novel approach in which the fit of the Lyman–Kutcher–Burman (LKB) model is based on the fractional rectal dose–volume histogram (DVH). Materials and methods: Grade ⩾2 acute rectal toxicity was analyzed in 509 patients treated on Radiation Therapy Oncology Group (RTOG) protocol 94-06. These patients had no field reductions or treatment-plan revisions during therapy, allowing the fractional rectal DVH to be estimated from the complete rectal DVH based on the total number of dose fractions delivered. Results: The majority of patients experiencing Grade ⩾2 acute rectal toxicity did so before completion of radiotherapy (70/80 = 88%). Acute rectal toxicity depends on fractional mean rectal dose, with no significant improvement in the LKB model fit when the volume parameter differs from n = 1. The incidence of toxicity was significantly lower for patients who received hormone therapy (P = 0.024). Conclusions: Variations in fractional mean dose explain the differences in incidence of acute rectal toxicity, with no detectable effect seen here for differences in numbers of dose fractions delivered.

  13. Dose fractionated gamma knife radiosurgery for large arteriovenous malformations on daily or alternate day schedule outside the linear quadratic model: Proof of concept and early results. A substitute to volume fractionation. (United States)

    Mukherjee, Kanchan Kumar; Kumar, Narendra; Tripathi, Manjul; Oinam, Arun S; Ahuja, Chirag K; Dhandapani, Sivashanmugam; Kapoor, Rakesh; Ghoshal, Sushmita; Kaur, Rupinder; Bhatt, Sandeep


    To evaluate the feasibility, safety and efficacy of dose fractionated gamma knife radiosurgery (DFGKRS) on a daily schedule beyond the linear quadratic (LQ) model, for large volume arteriovenous malformations (AVMs). Between 2012-16, 14 patients of large AVMs (median volume 26.5 cc) unsuitable for surgery or embolization were treated in 2-3 of DFGKRS sessions. The Leksell G frame was kept in situ during the whole procedure. 86% (n = 12) patients had radiologic evidence of bleed, and 43% (n = 6) had presented with a history of seizures. 57% (n = 8) patients received a daily treatment for 3 days and 43% (n = 6) were on an alternate day (2 fractions) regimen. The marginal dose was split into 2 or 3 fractions of the ideal prescription dose of a single fraction of 23-25 Gy. The median follow up period was 35.6 months (8-57 months). In the three-fraction scheme, the marginal dose ranged from 8.9-11.5 Gy, while in the two-fraction scheme, the marginal dose ranged from 11.3-15 Gy at 50% per fraction. Headache (43%, n = 6) was the most common early postoperative complication, which was controlled with short course steroids. Follow up evaluation of at least three years was achieved in seven patients, who have shown complete nidus obliteration in 43% patients while the obliteration has been in the range of 50-99% in rest of the patients. Overall, there was a 67.8% reduction in the AVM volume at 3 years. Nidus obliteration at 3 years showed a significant rank order correlation with the cumulative prescription dose (p 0.95, P value 0.01), with attainment of near-total (more than 95%) obliteration rates beyond 29 Gy of the cumulative prescription dose. No patient receiving a cumulative prescription dose of less than 31 Gy had any severe adverse reaction. In co-variate adjusted ordinal regression, only the cumulative prescription dose had a significant correlation with common terminology criteria for adverse events (CTCAE) severity (P value 0.04), independent of age, AVM volume

  14. Imaging water velocity and volume fraction distributions in water continuous multiphase flows using inductive flow tomography and electrical resistance tomography

    International Nuclear Information System (INIS)

    Meng, Yiqing; Lucas, Gary P


    This paper presents the design and implementation of an inductive flow tomography (IFT) system, employing a multi-electrode electromagnetic flow meter (EMFM) and novel reconstruction techniques, for measuring the local water velocity distribution in water continuous single and multiphase flows. A series of experiments were carried out in vertical-upward and upward-inclined single phase water flows and ‘water continuous’ gas–water and oil–gas–water flows in which the velocity profiles ranged from axisymmetric (single phase and vertical-upward multiphase flows) to highly asymmetric (upward-inclined multiphase flows). Using potential difference measurements obtained from the electrode array of the EMFM, local axial velocity distributions of the continuous water phase were reconstructed using two different IFT reconstruction algorithms denoted RT#1, which assumes that the overall water velocity profile comprises the sum of a series of polynomial velocity components, and RT#2, which is similar to RT#1 but which assumes that the zero’th order velocity component may be replaced by an axisymmetric ‘power law’ velocity distribution. During each experiment, measurement of the local water volume fraction distribution was also made using the well-established technique of electrical resistance tomography (ERT). By integrating the product of the local axial water velocity and the local water volume fraction in the cross section an estimate of the water volumetric flow rate was made which was compared with a reference measurement of the water volumetric flow rate. In vertical upward flows RT#2 was found to give rise to water velocity profiles which are consistent with the previous literature although the profiles obtained in the multiphase flows had relatively higher central velocity peaks than was observed for the single phase profiles. This observation was almost certainly a result of the transfer of axial momentum from the less dense dispersed phases to the

  15. Imaging water velocity and volume fraction distributions in water continuous multiphase flows using inductive flow tomography and electrical resistance tomography (United States)

    Meng, Yiqing; Lucas, Gary P.


    This paper presents the design and implementation of an inductive flow tomography (IFT) system, employing a multi-electrode electromagnetic flow meter (EMFM) and novel reconstruction techniques, for measuring the local water velocity distribution in water continuous single and multiphase flows. A series of experiments were carried out in vertical-upward and upward-inclined single phase water flows and ‘water continuous’ gas-water and oil-gas-water flows in which the velocity profiles ranged from axisymmetric (single phase and vertical-upward multiphase flows) to highly asymmetric (upward-inclined multiphase flows). Using potential difference measurements obtained from the electrode array of the EMFM, local axial velocity distributions of the continuous water phase were reconstructed using two different IFT reconstruction algorithms denoted RT#1, which assumes that the overall water velocity profile comprises the sum of a series of polynomial velocity components, and RT#2, which is similar to RT#1 but which assumes that the zero’th order velocity component may be replaced by an axisymmetric ‘power law’ velocity distribution. During each experiment, measurement of the local water volume fraction distribution was also made using the well-established technique of electrical resistance tomography (ERT). By integrating the product of the local axial water velocity and the local water volume fraction in the cross section an estimate of the water volumetric flow rate was made which was compared with a reference measurement of the water volumetric flow rate. In vertical upward flows RT#2 was found to give rise to water velocity profiles which are consistent with the previous literature although the profiles obtained in the multiphase flows had relatively higher central velocity peaks than was observed for the single phase profiles. This observation was almost certainly a result of the transfer of axial momentum from the less dense dispersed phases to the water

  16. Quality-assured evaluation of effective porosity using fit-for-purpose estimates of clay-mineral volume fraction (United States)

    Worthington, Paul F.


    Reservoirs that contain dispersed clay minerals traditionally have been evaluated petrophysically using either the effective or the total porosity system. The major weakness of the former is its reliance on "shale" volume fraction ( Vsh) as a clay-mineral indicator in the determination of effective porosity from well logs. Downhole clay-mineral indicators have usually delivered overestimates of fractional clay-mineral volume ( Vcm) because they use as a reference nearby shale beds that are often assumed to comprise clay minerals exclusively, whereas those beds also include quartzitic silts and other detritus. For this reason, effective porosity is often underestimated significantly, and this shortfall transmits to computed hydrocarbons in place and thence to estimates of ultimate recovery. The problem is overcome here by using, as proxy groundtruths, core porosities that have been upscaled to match the spatial resolutions of porosity logs. Matrix and fluid properties are established over clean intervals in the usual way. Log-derived values of Vsh are tuned so that, on average, the resulting log-derived porosities match the corresponding core porosities over an evaluation interval. In this way, Vsh is rendered fit for purpose as an indicator of clay-mineral content Vcm for purposes of evaluating effective porosity. The method is conditioned to deliver a value of effective porosity that shows overall agreement with core porosity to within the limits of uncertainty of the laboratory measurements. This is achieved through function-, reservoir- and tool-specific Vsh reduction factors that can be applied to downhole estimates of clay-mineral content over uncored intervals of similar reservoir character. As expected, the reduction factors can also vary for different measurement conditions. The reduction factors lie in the range of 0.29-0.80, which means that in its raw form, log-derived Vsh can overestimate the clay-mineral content by more than a factor of three. This

  17. Determination of volume fraction in biphasic flows oil-gas and water-gas using artificial neural network and gamma densitometry

    International Nuclear Information System (INIS)

    Peixoto, Philippe Netto Belache


    This study presents a methodology based on the principles of gamma ray attenuation to identify volume fractions in biphasic systems composed of oil-gas-water and gas which are found in the offshore oil industry. This methodology is based on the acknowledgment counts per second on the photopeak energy using a detection system composed of a NaI (Tl) detector, a source of 137 Cs without collimation positioned at 180 ° relative to the detector on a smooth stratified flow regime. The mathematical modeling for computational simulation using the code MCNP-X was performed using the experimental measurements of the detector characteristics (energy resolution and efficiency), characteristics of the material water and oil (density and coefficient attenuation) and measurement of the volume fractions. To predict these fractions were used artificial neural networks (ANNs), and to obtain an adequate training the ANNs for the prediction of volume fractions were simulated a larger number of volume fractions in MCNP-X. The experimental data were used in the set data necessary for validation of ANNs and the data generated using the computer code MCNP-X were used in training and test sets of the ANNs. Were used ANNs of type feed-forward Multilayer Perceptron (MLP) and analyzed two functions of training, Levenberg-Marquardt (LM) and gradient descent with momentum (GDM), both using the Backpropagation training algorithm. The ANNs identified correctly the volume fractions of the multiphase system with mean relative errors lower than 1.21 %, enabling the application of this methodology for this purpose. (author)

  18. Inter fraction variations in rectum and bladder volumes and dose distributions during high dose rate brachytherapy treatment of the uterine cervix investigated by repetitive CT-examinations

    International Nuclear Information System (INIS)

    Hellebust, Taran Paulsen; Dale, Einar; Skjoensberg, Ane; Olsen, Dag Rune


    Purpose: To evaluate variation of dose to organs at risk for patients receiving fractionated high dose rate gynaecological brachytherapy by using CT-based 3D treatment planning and dose-volume histograms (DVH). Materials and methods: Fourteen patients with cancer of the uterine cervix underwent three to six CT examinations (mean 4.9) during their course of high-dose-rate brachytherapy using radiographically compatible applicators. The rectal and bladder walls were delineated and DVHs were calculated. Results: Inter fraction variation of the bladder volume (CV mean =44.1%) was significantly larger than the inter fraction variation of the mean dose (CV mean =19.9%, P=0.005) and the maximum dose (CV mean =17.5%, P=0.003) of the bladder wall. The same trend was seen for rectum, although the figures were not significantly different. Performing CT examinations at four of seven brachytherapy fractions reduced the uncertainty to 4 and 7% for the bladder and rectal doses, respectively. A linear regression analysis showed a significant, negative relationship between time after treatment start and the whole bladder volume (P=0.018), whereas no correlation was found for the rectum. For both rectum and bladder a linear regression analysis revealed a significant, negative relationship between the whole volume and median dose (P<0.05). Conclusion: Preferably a CT examination should be provided at every fraction. However, this is logistically unfeasible in most institutions. To obtain reliable DVHs the patients will in the future undergo 3-4 CT examinations during the course of brachytherapy at our institution. Since this study showed an association between large bladder volumes and dose reductions, the patients will be treated with a standardized bladder volume

  19. 46 CFR 154.174 - Transverse contiguous hull structure. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Transverse contiguous hull structure. 154.174 Section... Equipment Hull Structure § 154.174 Transverse contiguous hull structure. (a) The transverse contiguous hull...) The transverse contiguous hull structure of a vessel having cargo containment systems with secondary...

  20. Effects of local single and fractionated X-ray doses on rat bone marrow blood flow and red blood cell volume

    International Nuclear Information System (INIS)

    Pitkaenen, M.A.; Hopewell, J.W.


    Time and dose dependent changes in blood flow and red blood cell volume were studied in the locally irradiated bone marrow of the rat femur after single and fractionated doses of X-rays. With the single dose of 10 Gy the bone marrow blood flow although initially reduced returned to the control levels by seven months after irradiation. With doses >=15 Gy the blood flow was still significantly reduced at seven months. The total dose levels predicted by the nominal standard dose equation for treatments in three, six or nine fractions produced approximately the same degree of reduction in the bone marrow blood flow seven months after the irradiation. However, the fall in the red blood cell volume was from 23 to 37% greater in the three fractions groups compared with that in the nine fractions groups. Using the red blood cell volume as a parameter the nominal standard dose formula underestimated the severity of radiation damage in rat bone marrow at seven months for irradiation with small numbers of large dose fractions. (orig.) [de

  1. Effects of Low Volume Fraction of Polyvinyl Alcohol Fibers on the Mechanical Properties of Oil Palm Shell Lightweight Concrete

    Directory of Open Access Journals (Sweden)

    Ming Kun Yew


    Full Text Available This paper presents the effects of low volume fraction (Vf of polyvinyl alcohol (PVA fibers on the mechanical properties of oil palm shell (OPS high strength lightweight concrete mixtures. The slump, density, compressive strength, splitting tensile strength, flexural strength, and modulus of elasticity under various curing conditions have been measured and evaluated. The results indicate that an increase in PVA fibers decreases the workability of the concrete and decreases the density slightly. The 28-day compressive strength of oil palm shell fiber-reinforced concrete (OPSFRC high strength lightweight concrete (HSLWC subject to continuous moist curing was within the range of 43–49 MPa. The average modulus of elasticity (E value is found to be 16.1 GPa for all mixes, which is higher than that reported in previous studies and is within the range of normal weight concrete. Hence, the findings of this study revealed that the PVA fibers can be used as an alternative material to enhance the properties of OPS HSLWC for building and construction applications.

  2. Myocardial extracellular volume fraction quantified by cardiovascular magnetic resonance is increased in hypertension and associated with left ventricular remodeling

    International Nuclear Information System (INIS)

    Wang, Shuli; Li, Jinghui; Chen, Xiuyu; Yin, Gang; Lan, Tian; Dai, Linlin; Zhang, Yan; Yin, Xiaorong; Zhao, Shihua; Hu, Hongjie; Lu, Minjie; Sirajuddin, Arlene; Arai, Andrew E.; An, Jing; Song, Lei; Dang, Aimin; Kellman, Peter


    To determine whether extracellular volume fraction (ECV) quantification by cardiac magnetic resonance (CMR) can demonstrate left ventricle (LV) abnormalities and relationship between ECV and LV remodeling in hypertension (HTN) patients ECV quantification was prospectively performed in 134 consecutive HTN patients and 97 healthy subjects. Individual and regional ECV were compared to the regions on late gadolinium enhancement (LGE) images. Statistical analysis of the relationship between LV global functional parameters and ECV was carried out using Pearson's correlation, Student's t test and multiple regressions. In the HTN group, 70.1% (94/134) were LGE negative and 29.9% (40/134) LGE positive. The mean ECV after adjusting for age, sex, BMI, diabetes, smoking and dyslipidaemia in healthy controls and LGE-negative patients were 26.9 ± 2.67% and 28.5 ± 2.9% (p < 0.001), respectively. The differences in ECV reached statistical significance among the regions of LGE, LGE-Peri, LGE remote and the normal area between the control and LGE-positive subgroup (all p < 0.05). Global ECV significantly correlated with LVEF (r = -0.466, p < 0.001) and LV hypertrophy (r = 0.667, p < 0.001). ECV can identify LV abnormalities at an early stage in HTN patients without LGE. These abnormalities may reflect an increase in diffuse myocardial fibrosis and are associated with LV remodeling. (orig.)

  3. Myocardial extracellular volume fraction quantified by cardiovascular magnetic resonance is increased in hypertension and associated with left ventricular remodeling

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Shuli; Li, Jinghui; Chen, Xiuyu; Yin, Gang; Lan, Tian; Dai, Linlin; Zhang, Yan; Yin, Xiaorong; Zhao, Shihua [Chinese Academy of Medical Sciences and Peking Union Medical College, Department of Magnetic Resonance Imaging, Cardiovascular Imaging and Intervention Center, State Key Laboratory of Cardiovascular Disease, Fuwai Hospital, National Center for Cardiovascular Diseases, Beijing (China); Hu, Hongjie [Zhejiang University, Department of Radiology, Sir Run Run Shaw Hospital, School of Medicine, Hangzhou (China); Lu, Minjie [Chinese Academy of Medical Sciences and Peking Union Medical College, Department of Magnetic Resonance Imaging, Cardiovascular Imaging and Intervention Center, State Key Laboratory of Cardiovascular Disease, Fuwai Hospital, National Center for Cardiovascular Diseases, Beijing (China); Laboratory for Advanced Cardiovascular Imaging, National Heart, Lung, and Blood Institute (NHLBI), National Institutes of Health (NIH), Department of Health and Human Services, Bethesda, MD (United States); Sirajuddin, Arlene; Arai, Andrew E. [Laboratory for Advanced Cardiovascular Imaging, National Heart, Lung, and Blood Institute (NHLBI), National Institutes of Health (NIH), Department of Health and Human Services, Bethesda, MD (United States); An, Jing [Siemens Shenzhen Magnetic Resonance Ltd., Siemens MRI Center, Shenzhen, Guangdong (China); Song, Lei; Dang, Aimin [Chinese Academy of Medical Sciences and Peking Union Medical College, Department of Cardiology, State Key Laboratory of Cardiovascular Disease, Fuwai Hospital, National Center for Cardiovascular Diseases, Beijing (China); Kellman, Peter [National Heart, Lung and Blood Institute (NHLBI), National Institutes of Health (NIH), US Department of Health and Human Services, Cardiovascular and Pulmonary Branch, Bethesda, MD (United States)


    To determine whether extracellular volume fraction (ECV) quantification by cardiac magnetic resonance (CMR) can demonstrate left ventricle (LV) abnormalities and relationship between ECV and LV remodeling in hypertension (HTN) patients ECV quantification was prospectively performed in 134 consecutive HTN patients and 97 healthy subjects. Individual and regional ECV were compared to the regions on late gadolinium enhancement (LGE) images. Statistical analysis of the relationship between LV global functional parameters and ECV was carried out using Pearson's correlation, Student's t test and multiple regressions. In the HTN group, 70.1% (94/134) were LGE negative and 29.9% (40/134) LGE positive. The mean ECV after adjusting for age, sex, BMI, diabetes, smoking and dyslipidaemia in healthy controls and LGE-negative patients were 26.9 ± 2.67% and 28.5 ± 2.9% (p < 0.001), respectively. The differences in ECV reached statistical significance among the regions of LGE, LGE-Peri, LGE remote and the normal area between the control and LGE-positive subgroup (all p < 0.05). Global ECV significantly correlated with LVEF (r = -0.466, p < 0.001) and LV hypertrophy (r = 0.667, p < 0.001). ECV can identify LV abnormalities at an early stage in HTN patients without LGE. These abnormalities may reflect an increase in diffuse myocardial fibrosis and are associated with LV remodeling. (orig.)

  4. A mathematical model for the effects of volume fraction and fiber aspect ratio of biomass mixture during enzymatic hydrolysis (United States)

    Jamil, Norazaliza Mohd; Wang, Qi


    Renewable energy or biofuel from lignocellulosic biomass is an alternative way to replace the depleting fossil fuels. The production cost can be reduced by increasing the concentration of biomass particles. However, lignocellulosic biomass is a suspension of natural fibres, and processing at high solid concentration is a challenging task. Thus, understanding the factors that affect the rheology of biomass suspension is crucial in order to maximize the production at a minimum cost. Our aim was to develop a mathematical model for enzymatic hydrolysis of cellulose by combining three scales: the macroscopic flow field, the mesoscopic particle orientation, and the microscopic reactive kinetics. The governing equations for the flow field, particle stress, kinetic equations, and particle orientation were coupled and were simultaneously solved using a finite element method based software, COMSOL. One of the main results was the changes in rheology of biomass suspension were not only due to the decrease in volume fraction of particles, but also due the types of fibres. The results from the simulation model agreed qualitatively with the experimental findings. This approach has enables us to obtain better predictive capabilities, hence increasing our understanding on the behaviour of biomass suspension.

  5. Application of artificial neural networks for the prediction of volume fraction using spectra of gamma rays backscattered by three-phase flows (United States)

    Gholipour Peyvandi, R.; Islami Rad, S. Z.


    The determination of the volume fraction percentage of the different phases flowing in vessels using transmission gamma rays is a conventional method in petroleum and oil industries. In some cases, with access only to the one side of the vessels, attention was drawn toward backscattered gamma rays as a desirable choice. In this research, the volume fraction percentage was measured precisely in water-gasoil-air three-phase flows by using the backscatter gamma ray technique andthe multilayer perceptron (MLP) neural network. The volume fraction determination in three-phase flows requires two gamma radioactive sources or a dual-energy source (with different energies) while in this study, we used just a 137Cs source (with the single energy) and a NaI detector to analyze backscattered gamma rays. The experimental set-up provides the required data for training and testing the network. Using the presented method, the volume fraction was predicted with a mean relative error percentage less than 6.47%. Also, the root mean square error was calculated as 1.60. The presented set-up is applicable in some industries with limited access. Also, using this technique, the cost, radiation safety and shielding requirements are minimized toward the other proposed methods.

  6. Interfacial effect on physical properties of composite media: Interfacial volume fraction with non-spherical hard-core-soft-shell-structured particles. (United States)

    Xu, Wenxiang; Duan, Qinglin; Ma, Huaifa; Chen, Wen; Chen, Huisu


    Interfaces are known to be crucial in a variety of fields and the interfacial volume fraction dramatically affects physical properties of composite media. However, it is an open problem with great significance how to determine the interfacial property in composite media with inclusions of complex geometry. By the stereological theory and the nearest-surface distribution functions, we first propose a theoretical framework to symmetrically present the interfacial volume fraction. In order to verify the interesting generalization, we simulate three-phase composite media by employing hard-core-soft-shell structures composed of hard mono-/polydisperse non-spherical particles, soft interfaces, and matrix. We numerically derive the interfacial volume fraction by a Monte Carlo integration scheme. With the theoretical and numerical results, we find that the interfacial volume fraction is strongly dependent on the so-called geometric size factor and sphericity characterizing the geometric shape in spite of anisotropic particle types. As a significant interfacial property, the present theoretical contribution can be further drawn into predicting the effective transport properties of composite materials.

  7. Pre-chemotherapy values for left and right ventricular volumes and ejection fraction by gated tomographic radionuclide angiography using a cadmium-zinc-telluride detector gamma camera

    DEFF Research Database (Denmark)

    Haarmark, Christian; Haase, Christine; Jensen, Maria Maj


    age and both left and right ventricular volumes in women (r = -0.4, P right end systolic ventricular volume in men (r = -0.3, P = .001). CONCLUSION: A set of reference values for cardiac evaluation prior to chemotherapy in cancer patients without other known cardiopulmonary......BACKGROUND: Estimation of left ventricular ejection fraction (LVEF) using equilibrium radionuclide angiography is an established method for assessment of left ventricular function. The purpose of this study was to establish normative data on left and right ventricular volumes and ejection fraction......, using cadmium-zinc-telluride SPECT camera. METHODS AND RESULTS: From routine assessments of left ventricular function in 1172 patients, we included 463 subjects (194 men and 269 women) without diabetes, previous potentially cardiotoxic chemotherapy, known cardiovascular or pulmonary disease. The lower...

  8. Influence of magnification on the calculated value of left ventricular ejection fraction and volumes using quantitative gated perfusion SPECT

    International Nuclear Information System (INIS)

    Nunez, M.; Beretta, M.; Alonso, O.; Alvarez, B.; Canepa, J.; Mut, F.


    Aim: To compare left ventricular ejection fraction (LVEF), end-diastolic volumes (EDV) and end-systolic volumes (ESV) measured by quantitative gated SPECT (QGSPECT) in studies acquired with and without magnification factor (zoom). Material and Methods: We studied 30 consecutive patients (17 men, ages 61±14 years) referred for myocardial perfusion evaluation with a 2-day protocol. Studies were performed after injection of 925 MBq (25 mCi) of 99mTc-MIBI in the resting state. Gated SPECT was first acquired using a x2 zoom factor and immediately repeated with x1 zoom (no magnification), using a 64x64 matrix and 8 frames/cardiac cycle. Patients with arrhythmia were not included in the investigation. According to the median EDV calculated with the x2 zoom acquisition, the population was further divided in two sub-groups regarding the size of the LV cavity. Average LVEF, EDV, ESV and difference between values (delta) were then calculated for the total population and for each sub-group (a and b). Results: For the total population, results are expressed.Pearson correlation showed r=0.954 between LVEF with and without zoom (p<0.0001), but linear regression analysis did not fit a specific model (p=0.18). Median EDV with zoom was 92.5 ml, allowing to separate 15 cases with EDV above (a) and 15 below that value (b). Results for both sub-groups are presented. Conclusion: Calculated LVEF is higher with no zoom, at the expense of decreasing both EDV and ESV. Although differences were very significant for all parameters, ESV changes were specially relevant with no zoom, particularly in patients with smaller hearts. Although good correlation was found between LVEF with and without zoom, no specific correction factor was found to convert one value into the other. Magnification factor should be kept constant in gated SPECT if calculated LVEF values QGSPECT are expected to be reliable, and validation of the method using different zoom factors should be considered

  9. A novel contiguous deletion involving NDP, MAOB and EFHC2 gene ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 6. A novel contiguous deletion involving NDP, MAOBand EFHC2gene in a patient with familial Norrie disease: bilateral blindness and leucocoria without other deficits. BEI JIA LIPING HUANG YAOYU CHEN SIPING LIU CUIHUA CHEN KE XIONG LANLIN SONG YULAI ...

  10. A novel contiguous deletion involving NDP, MAOB and EFHC2 gene ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 6. A novel contiguous deletion involving NDP, MAOBitalic> and EFHC2italic> gene in a patient with familial Norrie disease: bilateral blindness and leucocoria without other deficits. BEI JIA LIPING HUANG YAOYU CHEN SIPING LIU CUIHUA CHEN KE XIONG LANLIN ...

  11. The roles of auxeticity and volume fraction on γ‧ precipitate microstructures in nickel-base alloys (United States)

    Ardell, Alan J.


    New correlations are found between the elastic constants and late-stage precipitate microstructures in Ni-Al, Ni-Ga, Ni-Ge and Ni-Si alloys. The auxetic behaviour of Poisson's ratio, ν, measured parallel to [0 0 1] or ? in response to [1 1 0] loading, favours the amalgamation of Ni3Al and Ni3Ga precipitates into non-equilibrium shapes along cube directions when δν = (νγ‧ - νγ)/νγ‧ > 0, the superscripts referring to the γ‧ (Ni3X) and γ (Ni-X) phases, respectively. When δν 0 amalgamation of Ni3Al and Ni3Ga occurs readily, primarily producing laths of both phases. The γ‧ volume fraction, f, is also shown to play a role in the late-stage microstructures of Ni-Al alloys, with an increasing tendency to form Ni3Al laths, rather than plates, as f increases. The shapes of elastically soft γ precipitates in inverse Ni-Al and Ni-Ge alloys are different; Ni-Al precipitates are lath shaped, but Ni-Ge precipitates are plate shaped. The Ni-Ge plate shape, in a non-auxetic Ni3Ge matrix (Ni3Ge being the sole non-auxetic Ni3X phase of the four studied), is the only example of persistent plates in any of the Ni-base alloys investigated to date. The combination of an elastically soft precipitate (Ni-Ge) in a non-auxetic matrix suggests a connection between auxeticity and shape.

  12. Cardiac T1 mapping in congenital heart disease: bolus vs. infusion protocols for measurements of myocardial extracellular volume fraction. (United States)

    Al-Wakeel-Marquard, Nadya; Rastin, Sanaz; Muench, Frédéric; O H-Ici, Darach; Yilmaz, Sevim; Berger, Felix; Kuehne, Titus; Messroghli, Daniel R


    Myocardial extracellular volume fraction (ECV) reflecting diffuse myocardial fibrosis can be measured with T1 mapping cardiovascular magnetic resonance (CMR) before and after the application of a gadolinium-based extracellular contrast agent. The equilibrium between blood and myocardium contrast concentration required for ECV measurements can be obtained with a primed contrast infusion (equilibrium contrast-CMR). We hypothesized that equilibrium can also be achieved with a single contrast bolus to accurately measure diffuse myocardial fibrosis in patients with congenital heart disease (CHD). Healthy controls (n = 17; median age 24.0 years) and patients with CHD (n = 19; 25.0 years) were prospectively enrolled. Using modified Look-Locker inversion recovery T1 mapping before, 15 min after bolus injection, and during constant infusion of gadolinium-DOTA, T1 values were obtained for blood pool and myocardium of the left ventricle (LV), the interventricular septum (IVS), and the right ventricle (RV) in a single midventricular plane in short axis or in transverse orientation. ECV of LV, IVS and RV by bolus-only and bolus-infusion correlated significantly in CHD patients (r = 0.94, 0.95, and 0.74; p < 0.01, respectively) and healthy controls (r = 0.96, 0.89, and 0.64; p < 0.05, respectively). Bland-Altman plots revealed no significant bias between the techniques for any of the analyzed regions. ECV of LV and RV myocardium measured by bolus-only T1 mapping agrees well with bolus-infusion measurements in patients with CHD. The use of a bolus-only approach facilitates the integration of ECV measurements into existing CMR imaging protocols, allowing for assessment of diffuse myocardial fibrosis in CHD in clinical routine.

  13. Assessment of vasodilator therapy in patients with severe congestive heart failure: limitations of measurements of left ventricular ejection fraction and volumes

    International Nuclear Information System (INIS)

    Firth, B.G.; Dehmer, G.J.; Markham, R.V. Jr.; Willerson, J.T.; Hillis, L.D.


    Although noninvasive techniques are often used to assess the effect of vasodilator therapy in patients with congestive heart failure, it is unknown whether changes in noninvasively determined left ventricular ejection fraction, volume, or dimension reliably reflect alterations in intracardiac pressure and flow. Accordingly, we compared the acute effect of sodium nitroprusside on left ventricular volume and ejection fraction (determined scintigraphically) with its effect on intracardiac pressure and forward cardiac index (determined by thermodilution) in 12 patients with severe, chronic congestive heart failure and a markedly dilated left ventricle. Nitroprusside (infused at 1.3 +/- 1.1 [mean +/- standard deviation] microgram/kg/min) caused a decrease in mean systemic arterial, mean pulmonary arterial, and mean pulmonary capillary wedge pressure as well as a concomitant increase in forward cardiac index. Simultaneously, left ventricular end-diastolic and end-systolic volume indexes decreased, but the scintigraphically determined cardiac index did not change significantly. Left ventricular ejection fraction averaged 0.19 +/- 0.05 before nitroprusside administration and increased by less than 0.05 units in response to nitroprusside in 11 of 12 patients. The only significant correlation between scintigraphically and invasively determined variables was that between the percent change in end-diastolic volume index and the percent change in pulmonary capillary wedge pressure (r . 0.68, p . 0.01). Although nitroprusside produced changes in scintigraphically determined left ventricular ejection fraction, end-systolic volume index, and cardiac index, these alterations bore no predictable relation to changes in intracardiac pressure, forward cardiac index, or vascular resistance. Furthermore, nitroprusside produced a considerably greater percent change in the invasively measured variables than in the scintigraphically determined ones

  14. Calculation of left ventricular volumes and ejection fraction from dynamic cardiac-gated 15O-water PET/CT: 5D-PET. (United States)

    Nordström, Jonny; Kero, Tanja; Harms, Hendrik Johannes; Widström, Charles; Flachskampf, Frank A; Sörensen, Jens; Lubberink, Mark


    Quantitative measurement of myocardial blood flow (MBF) is of increasing interest in the clinical assessment of patients with suspected coronary artery disease (CAD). 15 O-water positron emission tomography (PET) is considered the gold standard for non-invasive MBF measurements. However, calculation of left ventricular (LV) volumes and ejection fraction (EF) is not possible from standard 15 O-water uptake images. The purpose of the present work was to investigate the possibility of calculating LV volumes and LVEF from cardiac-gated parametric blood volume (V B ) 15 O-water images and from first pass (FP) images. Sixteen patients with mitral or aortic regurgitation underwent an eight-gate dynamic cardiac-gated 15 O-water PET/CT scan and cardiac MRI. V B and FP images were generated for each gate. Calculations of end-systolic volume (ESV), end-diastolic volume (EDV), stroke volume (SV) and LVEF were performed with automatic segmentation of V B and FP images, using commercially available software. LV volumes and LVEF were calculated with surface-, count-, and volume-based methods, and the results were compared with gold standard MRI. Using V B images, high correlations between PET and MRI ESV (r = 0.89, p  0.86, p dynamic 15 O-water PET is feasible and shows good correlation with MRI. However, the analysis method is laborious, and future work is needed for more automation to make the method more easily applicable in a clinical setting.

  15. About the use of the Monte-Carlo code based tracing algorithm and the volume fraction method for S n full core calculations

    Energy Technology Data Exchange (ETDEWEB)

    Gurevich, M. I.; Oleynik, D. S. [RRC Kurchatov Inst., Kurchatov Sq., 1, 123182, Moscow (Russian Federation); Russkov, A. A.; Voloschenko, A. M. [Keldysh Inst. of Applied Mathematics, Miusskaya Sq., 4, 125047, Moscow (Russian Federation)


    The tracing algorithm that is implemented in the geometrical module of Monte-Carlo transport code MCU is applied to calculate the volume fractions of original materials by spatial cells of the mesh that overlays problem geometry. In this way the 3D combinatorial geometry presentation of the problem geometry, used by MCU code, is transformed to the user defined 2D or 3D bit-mapped ones. Next, these data are used in the volume fraction (VF) method to approximate problem geometry by introducing additional mixtures for spatial cells, where a few original materials are included. We have found that in solving realistic 2D and 3D core problems a sufficiently fast convergence of the VF method takes place if the spatial mesh is refined. Virtually, the proposed variant of implementation of the VF method seems as a suitable geometry interface between Monte-Carlo and S{sub n} transport codes. (authors)

  16. Characterization of the evolution of the volume fraction of precipitates in aged AlMgSiCu alloys using DSC technique

    International Nuclear Information System (INIS)

    Esmaeili, Shahrzad; Lloyd, David J.


    Differential scanning calorimetry is used to quantify the evolution of the volume fraction of precipitates during age hardening in AlMgSiCu alloys. The calorimetry tests are run on alloy samples after aging for various times at 180 deg. C and the change in the collective heat effects from the major precipitation and dissolution processes in each run are used to determine the precipitation state of the samples. The method is implemented on alloys with various thermal histories prior to artificial aging, including commercial pre-aging histories. The estimated values for the relative volume fraction of precipitates are compared with the results from a newly developed analytical method using isothermal calorimetry and a related quantitative transmission electron microscopy work. Excellent agreement is obtained between the results from various methods

  17. Variability of left ventricular ejection fraction and volumes with quantitative gated SPECT: influence of algorithm, pixel size and reconstruction parameters in small and normal-sized hearts

    International Nuclear Information System (INIS)

    Hambye, Anne-Sophie; Vervaet, Ann; Dobbeleir, Andre


    Several software packages are commercially available for quantification of left ventricular ejection fraction (LVEF) and volumes from myocardial gated single-photon emission computed tomography (SPECT), all of which display a high reproducibility. However, their accuracy has been questioned in patients with a small heart. This study aimed to evaluate the performances of different software and the influence of modifications in acquisition or reconstruction parameters on LVEF and volume measurements, depending on the heart size. In 31 patients referred for gated SPECT, 64 2 and 128 2 matrix acquisitions were consecutively obtained. After reconstruction by filtered back-projection (Butterworth, 0.4, 0.5 or 0.6 cycles/cm cut-off, order 6), LVEF and volumes were computed with different software [three versions of Quantitative Gated SPECT (QGS), the Emory Cardiac Toolbox (ECT) and the Stanford University (SU-Segami) Medical School algorithm] and processing workstations. Depending upon their end-systolic volume (ESV), patients were classified into two groups: group I (ESV>30 ml, n=14) and group II (ESV 2 to 128 2 were associated with significantly larger volumes as well as lower LVEF values. Increasing the filter cut-off frequency had the same effect. With SU-Segami, a larger matrix was associated with larger end-diastolic volumes and smaller ESVs, resulting in a highly significant increase in LVEF. Increasing the filter sharpness, on the other hand, had no influence on LVEF though the measured volumes were significantly larger. (orig.)

  18. Comparison of automatic quantification software for the measurement of ventricular volume and ejection fraction in gated myocardial perfusion SPECT

    International Nuclear Information System (INIS)

    Van Staden, J.A.; Herbst, C.P.; Du Raan, H.; Lotter, M.G.; Otto, A.C.


    Full text: Introduction: Gated myocardial perfusion SPECT has been used to calculate left ventricular ejection fraction (LVEF) and left ventricular end-diastolic volume (LVEDV) and has correlated well with conventional methods. However, the comparative accuracy of and correlations across various types of gated SPECT software are not well understood. Materials and methods: Twelve patients participated in a radionuclide gated blood-pool (GBP) study in addition to undergoing 99m Tc-sestamibi gated SPECT. Three different software algorithms, Quantitative Gated SPECT (QGS) from Cedars-Sinai, MultiDim from Stanford University Medical School and GQUANT from Alfa Nuclear were used to compute LVEF and LVEDV. These software algorithms operate in 3-dimensional space, two dependent on surface detection and the other on statistical parameters. The LVEF as calculated from gated SPECT myocardial perfusion images were compared with LVEF calculated from the GBP studies in the same patients to assess accuracy of the three software algorithms. Results: The software success-rate was 92% (11/12 pts) for MultiDim and 100% for the QGS and GQUANT. Agreement between LVEF measured with MultiDim and QGS, MultiDim and GQUANT and QGS and GQUANT were excellent (LVEF-MuItidim 0.80 LVEF QGS +5.02, r = 0.93, LVEF GQUANT = 1.10 LVEF MuItidim -1.33, r 0.90 and LVEF GQUANT = 1.02 LVEF QGS -1.40, r = 0.96). The correlation coefficient for LVEF between gated SPECT and the GBP study was 0.95, 0.95 and 0.97, for MultiDim, GQUANT and QGS, respectively. Conclusion: All 3 software programs showed good correlation between LVEF for gated SPECT and the GBP study. Good agreement for LVEF was observed also between the three software algorithms. However, because each method has unique characteristics that depend on its specific algorithm and thus behaves differently in the various patients, the methods should not be used interchangeably. (author)

  19. Large volume TENAX {sup registered} extraction of the bioaccessible fraction of sediment-associated organic compounds for a subsequent effect-directed analysis

    Energy Technology Data Exchange (ETDEWEB)

    Schwab, K.; Brack, W. [UFZ - Helmholtz Centre or Environmental Research, Leipzig (Germany). Dept. of Effect-Directed Analysis


    Background, Aim and Scope: Effect-directed analysis (EDA) is a powerful tool for the identification of key toxicants in complex environmental samples. In most cases, EDA is based on total extraction of organic contaminants leading to an erroneous prioritization with regard to hazard and risk. Bioaccessibility-directed extraction aims to discriminate between contaminants that take part in partitioning between sediment and biota in a relevant time frame and those that are enclosed in structures, that do not allow rapid desorption. Standard protocols of targeted extraction of rapidly desorbing, and thus bioaccessible fraction using TENAX {sup registered} are based only on small amounts of sediment. In order to get sufficient amounts of extracts for subsequent biotesting, fractionation, and structure elucidation a large volume extraction technique needs to be developed applying one selected extraction time and excluding toxic procedural blanks. Materials and Methods: Desorption behaviour of sediment contaminants was determined by a consecutive solid-solid extraction of sediment using TENAX {sup registered} fitting a tri-compartment model on experimental data. Time needed to remove the rapidly desorbing fraction trap was calculated to select a fixed extraction time for single extraction procedures. Up-scaling by about a factor of 100 provided a large volume extraction technique for EDA. Reproducibility and comparability to small volume approach were proved. Blanks of respective TENAX {sup registered} mass were investigated using Scenedesmus vacuolatus and Artemia salina as test organisms. Results: Desorption kinetics showed that 12 to 30 % of sediment associated pollutants are available for rapid desorption. t{sub r}ap is compound dependent and covers a range of 2 to 18 h. On that basis a fixed extraction time of 24 h was selected. Validation of large volume approach was done by the means of comparison to small method and reproducibility. The large volume showed a good

  20. Calculation of left ventricular volumes and ejection fraction from dynamic cardiac-gated 15O-water PET/CT: 5D-PET


    Jonny Nordström; Tanja Kero; Hendrik Johannes Harms; Charles Widström; Frank A. Flachskampf; Jens Sörensen; Mark Lubberink


    BACKGROUND: Quantitative measurement of myocardial blood flow (MBF) is of increasing interest in the clinical assessment of patients with suspected coronary artery disease (CAD). (15)O-water positron emission tomography (PET) is considered the gold standard for non-invasive MBF measurements. However, calculation of left ventricular (LV) volumes and ejection fraction (EF) is not possible from standard (15)O-water uptake images. The purpose of the present work was to investigate the possibility...

  1. [Effect of SO2 volume fraction in flue gas on the adsorption behaviors adsorbed by ZL50 activated carbon and kinetic analysis]. (United States)

    Gao, Ji-xian; Wang, Tie-feng; Wang, Jin-fu


    The influence of SO2 dynamic adsorption behaviors using ZL50 activated carbon for flue gas desulphurization and denitrification under different SO2 volume fraction was investigated experimentally, and the kinetic analysis was conducted by kinetic models. With the increase of SO2 volume fraction in flue gas, the SO2 removal ratio and the activity ratio of ZL50 activated carbon decreased, respectively, and SO2 adsorption rate and capacity increased correspondingly. The calculated results indicate that Bangham model has the best prediction effect, the chemisorption processes of SO2 was significantly affected by catalytic oxidative reaction. The adsorption rate constant of Lagergren's pseudo first order model increased with the increase of inlet SO, volume fraction, which indicated that catalytic oxidative reaction of SO2 adsorbed by ZL50 activated carbon may be the rate controlling step in earlier adsorption stage. The Lagergren's and Bangham's initial adsorption rate were deduced and defined, respectively. The Ho's and Elovich's initial adsorption rate were also deduced in this paper. The Bangham's initial adsorption rate values were defined in good agreement with those of experiments. The defined Bangham's adsorptive reaction kinetic model can describe the SO2 dynamic adsorption rate well. The studied results indicated that the SO2 partial order of initial reaction rate was one or adjacent to one, while the O2 and water vapor partial order of initial reaction rate were constants ranging from 0.15-0.20 and 0.45-0.50, respectively.

  2. The effect of the volume fraction and viscosity on the compression and tension behavior of the cobalt-ferrite magneto-rheological fluids

    Directory of Open Access Journals (Sweden)

    H. Shokrollahi


    Full Text Available The purpose of this work is to investigate the effects of the volume fraction and bimodal distribution of solid particles on the compression and tension behavior of the Co-ferrite-based magneto-rheological fluids (MRFs containing silicon oil as a carrier. Hence, Co-ferrite particles (CoFe2O4 with two various sizes were synthesized by the chemical co-precipitation method and mixed so as to prepare the bimodal MRF. The X-Ray Diffraction (XRD analysis, Fourier Transform Infrared Spectroscopy (FTIR, Laser Particle Size Analysis (LPSA and Vibrating Sample Magnetometer (VSM were conducted to examine the structural and magnetic properties, respectively. The results indicated that the increase of the volume fraction has a direct increasing influence on the values of the compression and tension strengths of fluids. In addition, the compression and tension strengths of the mixed MRF sample (1.274 and 0.647 MPa containing 60 and 550 nm samples were higher than those of the MRF sample with the same volume fraction and uniform particle size of 550 nm.

  3. Study on the detection of three-dimensional soot temperature and volume fraction fields of a laminar flame by multispectral imaging system

    International Nuclear Information System (INIS)

    Ni, Mingjiang; Zhang, Haidan; Wang, Fei; Xie, Zhengchao; Huang, Qunxing; Yan, Jianhua; Cen, Kefa


    Highlights: • Multispectral flame images were used to reconstruct the soot temperature and volume fraction. • The proposed multi-wavelength method and the original two-color method were compared. • The effect of signal to noise ratio (SNR) was discussed. • The best number of selected wavelengths was determined to be 6–11. - Abstract: Charge-coupled device (CCD) cameras with liquid crystal tunable filters (LCTF) were introduced to capture the multispectral flame images for obtaining the line-of-sight radiation intensities. A least square QR decomposition method was applied to solve the reconstruction matrix equation and obtain the multi-wavelength local emission distributions from which temperature and volume fraction profiles can be retrieved. Compared with the original two-color method, the use of a wide range of spectral data was proved to be capable of reducing the reconstruction error. Reconstruction results of the two methods with different signal to noise ratio (SNR) were discussed. The effect of selected wavelength number is analyzed and the best number is determined to be in the range of 6–11. The proposed multispectral imaging system was verified to be feasible for the reconstruction of temperature and soot volume fraction distributions according to the experimental measurement results.

  4. Calculation of left ventricular volumes and ejection fraction from dynamic cardiac-gated 15O-water PET/CT: 5D-PET

    Directory of Open Access Journals (Sweden)

    Jonny Nordström


    Full Text Available Abstract Background Quantitative measurement of myocardial blood flow (MBF is of increasing interest in the clinical assessment of patients with suspected coronary artery disease (CAD. 15O-water positron emission tomography (PET is considered the gold standard for non-invasive MBF measurements. However, calculation of left ventricular (LV volumes and ejection fraction (EF is not possible from standard 15O-water uptake images. The purpose of the present work was to investigate the possibility of calculating LV volumes and LVEF from cardiac-gated parametric blood volume (V B 15O-water images and from first pass (FP images. Sixteen patients with mitral or aortic regurgitation underwent an eight-gate dynamic cardiac-gated 15O-water PET/CT scan and cardiac MRI. V B and FP images were generated for each gate. Calculations of end-systolic volume (ESV, end-diastolic volume (EDV, stroke volume (SV and LVEF were performed with automatic segmentation of V B and FP images, using commercially available software. LV volumes and LVEF were calculated with surface-, count-, and volume-based methods, and the results were compared with gold standard MRI. Results Using V B images, high correlations between PET and MRI ESV (r = 0.89, p  0.86, p < 0.001. Conclusion Calculation of LV volumes and LVEF from dynamic 15O-water PET is feasible and shows good correlation with MRI. However, the analysis method is laborious, and future work is needed for more automation to make the method more easily applicable in a clinical setting.

  5. Effect of Coarse Particle Volume Fraction on the Yield Stress of Muddy Sediments from Marennes Oléron Bay

    Directory of Open Access Journals (Sweden)

    A. Pantet


    Full Text Available Coastal erosion results from a combination of various factors, both natural and humaninduced, which have different time and space patterns. In addition, uncertainties still remain about the interactions of the forcing agents, as well as on the significance of non-local causes of erosion. We focused about the surface sediments in the Marennes Oléron bay, after a general description of the site that has many various activities. The superficial sediments show a mechanical behavior, mainly depends on the fine fraction for a composition that contains up to 60% of sandy material. Fine sediments fraction has a typical yield stress depending naturally of concentration or water content. This yield could be modified slightly or significantly by adding silt or sand. As a result, the rheological measurement sensitivity allows us to characterize five typical sediments that correlate with solid fraction and fine fraction.

  6. On Coding Non-Contiguous Letter Combinations

    Directory of Open Access Journals (Sweden)

    Frédéric eDandurand


    Full Text Available Starting from the hypothesis that printed word identification initially involves the parallel mapping of visual features onto location-specific letter identities, we analyze the type of information that would be involved in optimally mapping this location-specific orthographic code onto a location-invariant lexical code. We assume that some intermediate level of coding exists between individual letters and whole words, and that this involves the representation of letter combinations. We then investigate the nature of this intermediate level of coding given the constraints of optimality. This intermediate level of coding is expected to compress data while retaining as much information as possible about word identity. Information conveyed by letters is a function of how much they constrain word identity and how visible they are. Optimization of this coding is a combination of minimizing resources (using the most compact representations and maximizing information. We show that in a large proportion of cases, non-contiguous letter sequences contain more information than contiguous sequences, while at the same time requiring less precise coding. Moreover, we found that the best predictor of human performance in orthographic priming experiments was within-word ranking of conditional probabilities, rather than average conditional probabilities. We conclude that from an optimality perspective, readers learn to select certain contiguous and non-contiguous letter combinations as information that provides the best cue to word identity.

  7. A Causal Contiguity Effect That Persists across Time Scales (United States)

    Kilic, Asli; Criss, Amy H.; Howard, Marc W.


    The contiguity effect refers to the tendency to recall an item from nearby study positions of the just recalled item. Causal models of contiguity suggest that recalled items are used as probes, causing a change in the memory state for subsequent recall attempts. Noncausal models of the contiguity effect assume the memory state is unaffected by…

  8. 46 CFR 154.176 - Longitudinal contiguous hull structure. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Longitudinal contiguous hull structure. 154.176 Section... Equipment Hull Structure § 154.176 Longitudinal contiguous hull structure. (a) The longitudinal contiguous hull structure of a vessel having cargo containment systems without secondary barriers must meet the...

  9. 46 CFR 154.178 - Contiguous hull structure: Heating system. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Heating system. 154.178... Equipment Hull Structure § 154.178 Contiguous hull structure: Heating system. The heating system for transverse and longitudinal contiguous hull structure must: (a) Be shown by a heat load calculation to have...

  10. 46 CFR 154.180 - Contiguous hull structure: Welding procedure. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Welding procedure. 154.180... Equipment Hull Structure § 154.180 Contiguous hull structure: Welding procedure. Welding procedure tests for contiguous hull structure designed for a temperature colder than −18 °C (0 °F) must meet § 54.05-15 and...

  11. Investigating the evolution of the phase behavior of AOT-based w/o microemulsions in dodecane as a function of droplet volume fraction. (United States)

    Ganguly, R; Choudhury, N


    AOT-based water in oil (w/o) microemulsions are one of the most extensively studied reverse micellar systems because of their rich phase behavior and their ability to form in the absence of any co-surfactant. The aggregation characteristics and interaction of the microemulsion droplets in these systems are known to be governed by AOT-oil compatibility and water to AOT molar ratio (w). In this manuscript by using Dynamic Light Scattering (DLS) and viscometry techniques, we show that droplet volume fraction too plays an important role in shaping the phase behavior of these microemulsions in dodecane. The phase separation characteristics and the evolution of the viscosity and the hydrodynamic radius of the microemulsion droplets on approaching the cloud points have thus been found to undergo complete transformation as one goes from low to high droplet volume fraction even at a fixed 'w'. Modeling of the DLS data attributes this to the weakening of inter droplet attractive interaction caused by the growing dominance of the excluded volume effect with increase in droplet volume fraction. In the literature, the inter droplet attractive interaction driven phase separation in these microemulsions is explained based on gas-liquid type phase transition, conceptualized in the framework of Baxter adhesive hard sphere theory. The modeling of our viscosity data, however, does not support such proposition as the characteristic stickiness parameter (τ(-1)) of the microemulsion droplets in this system remains much lower than the critical value (τ(c)(-1)≈10.25) required to enforce such phase transition. Copyright © 2012 Elsevier Inc. All rights reserved.

  12. BASIC program to compute uranium density and void volume fraction in laboratory-scale uranium silicide aluminum dispersion plate-type fuel

    International Nuclear Information System (INIS)

    Ugajin, Mitsuhiro


    BASIC program simple and easy to operate has been developed to compute uranium density and void volume fraction for laboratory-scale uranium silicide aluminum dispersion plate-type fuel, so called miniplate. An example of the result of calculation is given in order to demonstrate how the calculated void fraction correlates with the microstructural distribution of the void in a miniplate prepared in our laboratory. The program is also able to constitute data base on important parameters for miniplates from experimentally-determined values of density, weight of each constituent and dimensions of miniplates. Utility programs pertinent to the development of the BASIC program are also given which run in the popular MS-DOS environment. All the source lists are attached and brief description for each program is made. (author)

  13. 11C-methionine PET improves the target volume delineation of meningiomas treated with stereotactic fractionated radiotherapy

    International Nuclear Information System (INIS)

    Grosu, Anca-Ligia; Weber, Wolfgang A.; Astner, Sabrina T.; Adam, Markus; Krause, Bernd J.; Schwaiger, Markus; Molls, Michael; Nieder, Carsten


    Purpose: To evaluate the role of 11 C-methionine positron emission tomography (MET-PET) in target volume delineation for meningiomas and to determine the interobserver variability. Methods and Materials: Two independent observers performed treatment planning in 10 patients according to a prospective written protocol. In the first step, they used coregistered computed tomography (CT) and magnetic resonance imaging (MRI). In the second step, MET-PET was added to CT/MRI (image fusion based on mutual information). Results: The correlation between gross tumor volume (GTVs) delineated by the two observers based on CT/MRI was r = 0.855 (Spearman's correlation coefficient, p = 0.002) and r = 0.988 (p = 0.000) when MET-PET/CT/MRI were used. The number of patients with agreement in more then 80% of the outlined volume increased with the availability of MET-PET from 1 in 10 to 5 in 10. The median volume of intersection between the regions delineated by two observers increased significantly from 69% (from the composite volume) to 79%, by the addition of MET-PET (p = 0.005). The information of MET-PET was useful to delineate GTV in the area of cavernous sinus, orbit, and base of the skull. Conclusions: The hypothesis-generating findings of potential normal tissue sparing and reduced interobserver variability provide arguments for invasive studies of the correlation between MET-PET images and histologic tumor extension and for prospective trials of target volume delineation with CT/MRI/MET-PET image fusion

  14. Calculation of left ventricular volume and ejection fraction from ECG-gated myocardial SPECT. Automatic detection of endocardial borders by threshold method

    International Nuclear Information System (INIS)

    Fukushi, Shoji; Teraoka, Satomi.


    A new method which calculate end-diastolic volume (EDV), end-systolic volume (ESV) and ejection fraction (LVEF) of the left ventricle from myocardial short axis images of ECG-gated SPECT using 99m Tc myocardial perfusion tracer has been designed. Eight frames per cardiac cycle ECG-gated 180 degrees SPECT was performed. Threshold method was used to detect myocardial borders automatically. The optimal threshold was 45% by myocardial SPECT phantom. To determine if EDV, ESV and LVEF can also be calculated by this method, 12 patients were correlated ventriculography (LVG) for 10 days each. The correlation coefficient with LVG was 0.918 (EDV), 0.935 (ESV) and 0.900 (LVEF). This method is excellent at objectivity and reproductivity because of the automatic detection of myocardial borders. It also provides useful information on heart function in addition to myocardial perfusion. (author)

  15. Endochondral fracture healing with external fixation in the Sost knockout mouse results in earlier fibrocartilage callus removal and increased bone volume fraction and strength. (United States)

    Morse, A; Yu, N Y C; Peacock, L; Mikulec, K; Kramer, I; Kneissel, M; McDonald, M M; Little, D G


    Sclerostin deficiency, via genetic knockout or anti-Sclerostin antibody treatment, has been shown to cause increased bone volume, density and strength of calluses following endochondral bone healing. However, there is limited data on the effect of Sclerostin deficiency on the formative early stage of fibrocartilage (non-bony tissue) formation and removal. In this study we extensively investigate the early fibrocartilage callus. Closed tibial fractures were performed on Sost(-/-) mice and age-matched wild type (C57Bl/6J) controls and assessed at multiple early time points (7, 10 and 14days), as well as at 28days post-fracture after bony union. External fixation was utilized, avoiding internal pinning and minimizing differences in stability stiffness, a variable that has confounded previous research in this area. Normal endochondral ossification progressed in wild type and Sost(-/-) mice with equivalent volumes of fibrocartilage formed at early day 7 and day 10 time points, and bony union in both genotypes by day 28. There were no significant differences in rate of bony union; however there were significant increases in fibrocartilage removal from the Sost(-/-) fracture calluses at day 14 suggesting earlier progression of endochondral healing. Earlier bone formation was seen in Sost(-/-) calluses over wild type with greater bone volume at day 10 (221%, p<0.01). The resultant Sost(-/-) united bony calluses at day 28 had increased bone volume fraction compared to wild type calluses (24%, p<0.05), and the strength of the fractured Sost(-/-) tibiae was greater than that that of wild type fractured tibiae. In summary, bony union was not altered by Sclerostin deficiency in externally-fixed closed tibial fractures, but fibrocartilage removal was enhanced and the resultant united bony calluses had increased bone fraction and increased strength. Crown Copyright © 2014. Published by Elsevier Inc. All rights reserved.

  16. Contiguity and quantum theory of measurement

    Energy Technology Data Exchange (ETDEWEB)

    Green, H.S. [Adelaide Univ., SA (Australia). Dept. of Mathematical Physics]|[Adelaide Univ., SA (Australia). Dept. of Physics


    This paper presents a comprehensive treatment of the problem of measurement in microscopic physics, consistent with the indeterministic Copenhagen interpretation of quantum mechanics and information theory. It is pointed out that there are serious difficulties in reconciling the deterministic interpretations of quantum mechanics, based on the concepts of a universal wave function or hidden variables, with the principle of contiguity. Quantum mechanics is reformulated entirely in terms of observables, represented by matrices, including the statistical matrix, and the utility of information theory is illustrated by a discussion of the EPR paradox. The principle of contiguity is satisfied by all conserved quantities. A theory of the operation of macroscopic measuring devices is given in the interaction representation, and the attenuation of the indeterminacy of a microscopic observable in the process of measurement is related to observable changes of entropy. 28 refs.

  17. Contiguity and quantum theory of measurement

    International Nuclear Information System (INIS)

    Green, H.S.; Adelaide Univ., SA


    This paper presents a comprehensive treatment of the problem of measurement in microscopic physics, consistent with the indeterministic Copenhagen interpretation of quantum mechanics and information theory. It is pointed out that there are serious difficulties in reconciling the deterministic interpretations of quantum mechanics, based on the concepts of a universal wave function or hidden variables, with the principle of contiguity. Quantum mechanics is reformulated entirely in terms of observables, represented by matrices, including the statistical matrix, and the utility of information theory is illustrated by a discussion of the EPR paradox. The principle of contiguity is satisfied by all conserved quantities. A theory of the operation of macroscopic measuring devices is given in the interaction representation, and the attenuation of the indeterminacy of a microscopic observable in the process of measurement is related to observable changes of entropy. 28 refs

  18. Effect of the metallic glass volume fraction on the mechanical properties of Zr-based metallic glass reinforced with porous W composite

    International Nuclear Information System (INIS)

    Zhang, X.Q.; Wang, L.; Xue, Y.F.; Cheng, X.W.; Wang, Y.D.; Nie, Z.H.; Zhang, H.F.; Fu, H.M.; Ma, L.L.; Ren, Y.


    The mechanical properties of both as-cast and as-extruded Zr-based metallic glass reinforced with tungsten composites with 33, 28, and 21 vol. % of metallic glass were investigated under quasi-static compression at strain rates from 10 −4 s −1 to 10 −1 s −1 . These two types of composites exhibited a strain rate sensitivity exponent that increased with the increase of the tungsten volume fraction. Compared to the composites with 33 and 21 vol. % of the metallic glass, the two types of composites with 28 vol. % of the metallic glass phase exhibited superior fracture energies. The in-situ compression test on the as-cast composites using high-energy synchrotron X-ray diffraction (HEXRD) revealed that the yield stress of the tungsten phase increased with a decrease in the metallic glass volume fraction. The as-cast composite with 28 vol. % of the metallic glass exhibited relatively great mechanical properties compared to the composites that contained 33 and 21 vol. % of the metallic glass. This result was attributed to the great coupling of the load distribution between the two phases and the high lattice strain in the tungsten phase.

  19. Temperature effect on the inter-micellar collision and maximum packaging volume fraction in water/AOT/isooctane micro-emulsions

    International Nuclear Information System (INIS)

    Guettari, Moez; Ben Naceur, Imen; Kassab, Ghazi; Tajouri, Tahar


    We have studied the viscosity behaviour of water/AOT/isooctane micro-emulsions as a function of the volume fraction of the dispersed phase over a temperature range from the (298.15 to 328.15) K. For all the studied temperature range, a sharp increase of the viscosities is observed when the droplets concentration was varied. Several equations based on hard sphere model were examined to explain the behaviours of micro-emulsions under temperature and concentration effects. According to these equations, the shape factor and the inter-particle interaction parameters were found to be dependent on temperature which is in contradiction with experimental results reported in the literature. A modified Vand equation, taking into account the inter-particle collision time, is used to interpret the results obtained. This deviation is attributed to the aggregation of the droplets which becomes important by increasing temperature. The maximum packaging volume fraction of particles Φ_d_m and the intrinsic viscosity [η] were determined according to the Krieger and Dougherty equation through the temperature range studied. These two parameters were shown to be dependent on temperature but their product was found to be constant and close to 2 as reported in theory.

  20. Is 16-frame really superior to 8-frame gated SPECT for the assessment of left ventricular volumes and ejection fraction? Comparison of two simultaneously acquired gated SPECT studies

    International Nuclear Information System (INIS)

    Montelatici, Giulia; Sciagra, Roberto; Passeri, Alessandro; Dona, Manjola; Pupi, Alberto


    Conflicting data exist about the difference between 8- and 16-frame gated single-photon emission computed tomography (SPECT) left ventricular volumes and ejection fraction (EF); moreover, the influence of framing on detection of stress-induced functional changes is unknown. In 133 patients, two separate gated SPECT studies, one with 8 and one with 16 frames, were simultaneously acquired during a single gantry orbit using dedicated software. In 33 of 133 patients, two additional studies (with 8 and 16 frames, respectively) were acquired using arrhythmia rejection. Left ventricular EF and volumes were calculated using the QGS software. Stress-induced ischemia was identified on summed perfusion images. Arrhythmia-rejection did not influence volumes and EF independently of framing rate. Using data without arrhythmia-rejection, there was a significant difference in volumes and EF between 8 and 16 frames both in resting and post-stress gated SPECT. However, the difference was small: 2.6% for resting and 2.8% for post-stress EF. Both using 8 and 16 frames, there were significantly larger volumes and lower EF in patients with than without stress-induced ischemia. A stress-induced decrease >5 EF units was observed in 26 of 133 patients using 8 and in 23 of 133 using 16 frames, respectively, with finding agreement in 19 patients. Comparing two simultaneously acquired studies, the use of 16 instead of 8 frames has minor and predictable influence on functional data. Furthermore, there are no differences in the detection of stress-induced functional changes. The advantage of 16 over 8 frames in the daily clinical practice appears questionable. (orig.)

  1. Comparison of echocardiographic and cardiac magnetic resonance imaging measurements of functional single ventricular volumes, mass, and ejection fraction (from the Pediatric Heart Network Fontan Cross-Sectional Study). (United States)

    Margossian, Renee; Schwartz, Marcy L; Prakash, Ashwin; Wruck, Lisa; Colan, Steven D; Atz, Andrew M; Bradley, Timothy J; Fogel, Mark A; Hurwitz, Lynne M; Marcus, Edward; Powell, Andrew J; Printz, Beth F; Puchalski, Michael D; Rychik, Jack; Shirali, Girish; Williams, Richard; Yoo, Shi-Joon; Geva, Tal


    Assessment of the size and function of a functional single ventricle (FSV) is a key element in the management of patients after the Fontan procedure. Measurement variability of ventricular mass, volume, and ejection fraction (EF) among observers by echocardiography and cardiac magnetic resonance imaging (CMR) and their reproducibility among readers in these patients have not been described. From the 546 patients enrolled in the Pediatric Heart Network Fontan Cross-Sectional Study (mean age 11.9 +/- 3.4 years), 100 echocardiograms and 50 CMR studies were assessed for measurement reproducibility; 124 subjects with paired studies were selected for comparison between modalities. Interobserver agreement for qualitative grading of ventricular function by echocardiography was modest for left ventricular (LV) morphology (kappa = 0.42) and weak for right ventricular (RV) morphology (kappa = 0.12). For quantitative assessment, high intraclass correlation coefficients were found for echocardiographic interobserver agreement (LV 0.87 to 0.92, RV 0.82 to 0.85) of systolic and diastolic volumes, respectively. In contrast, intraclass correlation coefficients for LV and RV mass were moderate (LV 0.78, RV 0.72). The corresponding intraclass correlation coefficients by CMR were high (LV 0.96, RV 0.85). Volumes by echocardiography averaged 70% of CMR values. Interobserver reproducibility for the EF was similar for the 2 modalities. Although the absolute mean difference between modalities for the EF was small (<2%), 95% limits of agreement were wide. In conclusion, agreement between observers of qualitative FSV function by echocardiography is modest. Measurements of FSV volume by 2-dimensional echocardiography underestimate CMR measurements, but their reproducibility is high. Echocardiographic and CMR measurements of FSV EF demonstrate similar interobserver reproducibility, whereas measurements of FSV mass and LV diastolic volume are more reproducible by CMR.

  2. A glimpse beneath Antarctic sea ice: observation of platelet-layer thickness and ice-volume fraction with multi-frequency EM (United States)

    Hendricks, S.; Hoppmann, M.; Hunkeler, P. A.; Kalscheuer, T.; Gerdes, R.


    In Antarctica, ice crystals (platelets) form and grow in supercooled waters below ice shelves. These platelets rise and accumulate beneath nearby sea ice to form a several meter thick sub-ice platelet layer. This special ice type is a unique habitat, influences sea-ice mass and energy balance, and its volume can be interpreted as an indicator for ice - ocean interactions. Although progress has been made in determining and understanding its spatio-temporal variability based on point measurements, an investigation of this phenomenon on a larger scale remains a challenge due to logistical constraints and a lack of suitable methodology. In the present study, we applied a lateral constrained Marquardt-Levenberg inversion to a unique multi-frequency electromagnetic (EM) induction sounding dataset obtained on the ice-shelf influenced fast-ice regime of Atka Bay, eastern Weddell Sea. We adapted the inversion algorithm to incorporate a sensor specific signal bias, and confirmed the reliability of the algorithm by performing a sensitivity study using synthetic data. We inverted the field data for sea-ice and sub-ice platelet-layer thickness and electrical conductivity, and calculated ice-volume fractions from platelet-layer conductivities using Archie's Law. The thickness results agreed well with drill-hole validation datasets within the uncertainty range, and the ice-volume fraction also yielded plausible results. Our findings imply that multi-frequency EM induction sounding is a suitable approach to efficiently map sea-ice and platelet-layer properties. However, we emphasize that the successful application of this technique requires a break with traditional EM sensor calibration strategies due to the need of absolute calibration with respect to a physical forward model.

  3. County-Level Climate Uncertainty for Risk Assessments: Volume 21 Appendix T - Forecast Sea Ice Area Fraction.

    Energy Technology Data Exchange (ETDEWEB)

    Backus, George A.; Lowry, Thomas Stephen; Jones, Shannon M; Walker, La Tonya Nicole; Roberts, Barry L; Malczynski, Leonard A.


    This report uses the CMIP5 series of climate model simulations to produce country- level uncertainty distributions for use in socioeconomic risk assessments of climate change impacts. It provides appropriate probability distributions, by month, for 169 countries and autonomous-areas on temperature, precipitation, maximum temperature, maximum wind speed, humidity, runoff, soil moisture and evaporation for the historical period (1976-2005), and for decadal time periods to 2100. It also provides historical and future distributions for the Arctic region on ice concentration, ice thickness, age of ice, and ice ridging in 15-degree longitude arc segments from the Arctic Circle to 80 degrees latitude, plus two polar semicircular regions from 80 to 90 degrees latitude. The uncertainty is meant to describe the lack of knowledge rather than imprecision in the physical simulation because the emphasis is on unfalsified risk and its use to determine potential socioeconomic impacts. The full report is contained in 27 volumes.

  4. County-Level Climate Uncertainty for Risk Assessments: Volume 20 Appendix S - Historical Sea Ice Area Fraction

    Energy Technology Data Exchange (ETDEWEB)

    Backus, George A.; Lowry, Thomas Stephen; Jones, Shannon M; Walker, La Tonya Nicole; Roberts, Barry L; Malczynski, Leonard A.


    This report uses the CMIP5 series of climate model simulations to produce country- level uncertainty distributions for use in socioeconomic risk assessments of climate change impacts. It provides appropriate probability distributions, by month, for 169 countries and autonomous-areas on temperature, precipitation, maximum temperature, maximum wind speed, humidity, runoff, soil moisture and evaporation for the historical period (1976-2005), and for decadal time periods to 2100. It also provides historical and future distributions for the Arctic region on ice concentration, ice thickness, age of ice, and ice ridging in 15-degree longitude arc segments from the Arctic Circle to 80 degrees latitude, plus two polar semicircular regions from 80 to 90 degrees latitude. The uncertainty is meant to describe the lack of knowledge rather than imprecision in the physical simulation because the emphasis is on unfalsified risk and its use to determine potential socioeconomic impacts. The full report is contained in 27 volumes.

  5. Radiobiological restrictions and tolerance doses of repeated single-fraction hdr-irradiation of intersecting small liver volumes for recurrent hepatic metastases

    Directory of Open Access Journals (Sweden)

    Wust Peter


    Full Text Available Abstract Background To assess radiobiological restrictions and tolerance doses as well as other toxic effects derived from repeated applications of single-fraction high dose rate irradiation of small liver volumes in clinical practice. Methods Twenty patients with liver metastases were treated repeatedly (2 - 4 times at identical or intersecting locations by CT-guided interstitial brachytherapy with varying time intervals. Magnetic resonance imaging using the hepatocyte selective contrast media Gd-BOPTA was performed before and after treatment to determine the volume of hepatocyte function loss (called pseudolesion, and the last acquired MRI data set was merged with the dose distributions of all administered brachytherapies. We calculated the BED (biologically equivalent dose for a single dose d = 2 Gy for different α/β values (2, 3, 10, 20, 100 based on the linear-quadratic model and estimated the tolerance dose for liver parenchyma D90 as the BED exposing 90% of the pseudolesion in MRI. Results The tolerance doses D90 after repeated brachytherapy sessions were found between 22 - 24 Gy and proved only slightly dependent on α/β in the clinically relevant range of α/β = 2 - 10 Gy. Variance analysis showed a significant dependency of D90 with respect to the intervals between the first irradiation and the MRI control (p 90 and the pseudolesion's volume. No symptoms of liver dysfunction or other toxic effects such as abscess formation occurred during the follow-up time, neither acute nor on the long-term. Conclusions Inactivation of liver parenchyma occurs at a BED of approx. 22 - 24 Gy corresponding to a single dose of ~10 Gy (α/β ~ 5 Gy. This tolerance dose is consistent with the large potential to treat oligotopic and/or recurrent liver metastases by CT-guided HDR brachytherapy without radiation-induced liver disease (RILD. Repeated small volume irradiation may be applied safely within the limits of this study.

  6. Effects of perfusion detect on the measurement of left ventricular mass, ventricular volume and post-stress left ventricular ejection fraction in gated myocardial perfusion SPECT

    International Nuclear Information System (INIS)

    Ahn, Byeong Cheol; Bae, Sun Keun; Lee, Sang Woo; Jeong, Sin Young; Lee, Jae Tae; Lee, Kyu Bo


    The presence of perfusion defect may influence the left ventricular mass (LVM) measurement by quantitative gated myocardial perfusion SPECT (QGS), and ischemic myocardium, usually showing perfusion defect may produce post-stress LV dysfunction. This study was aimed to evaluated the effects of extent and reversibility of perfusion defect on the automatic measurement of LVM by QGS and to investigate the effect of reversibility of perfusion defect on post-stress LV dysfunction. Forty-six patients (male/female=34:12, mean age=64 years) with perfusion defect on myocardial perfusion SPECT underwent rest and post-stress QGS. Forty patients (87%) showed reversible defect. End-diastolic volume (EDV), end-systolic volume (ESV), LV ejection fraction (EF), and LV myocardial volume were obtained from QGS by autoquant program, and LVM was calculated by multiplying the LV myocardial volume by the specific gravity of myocardium. LVMs measured at rest and post-stress QGS showed good correlation, and higher correlation was founded in the subjects with fixed perfusion defect and with small defect (smaller than 20%). There were no significant differences in EDVs, ESVs and EFs between obtained by rest and post-stress QGS in patients with fixed myocardial defect. Whereas, EF obtained by post-stress QGS was lower than that by rest QGS in patients with reversible defect and 10 (25%) of them showed decreases in EF more than 5% in post-stress QGS, as compared to that of rest QGS. Excellent correlations of EDVs, ESVs, EFs between rest and post-stress QGS were noted. Patients with fixed defect had higher correlation between defect can affect LVM measurement by QGS and patients with reversible defect shows post-stress LV dysfunction more frequently than patients with fixed perfusion defect

  7. Multi-slice CT (MSCT) in cardiac function imaging: threshold-value-supported 3D volume reconstructions to determine the left ventricular ejection fraction in comparison to MRI

    International Nuclear Information System (INIS)

    Ehrhard, K.; Oberholzer, K.; Gast, K.; Mildenberger, P.; Kreitner, K.F.; Thelen, M.


    Purpose: To assess MSCT of the heart to determining left ventricular ejection fraction (EF) based on threshold-value-supported 3D volume reconstructions compared to MRI. Methods: Cardiac MSCT was performed in 7 patients. Images were reconstructed during end-systolic and end-diastolic phases of the cardiac cycle and transformed to 3D volumes to determine end-systolic (ESV) and end-diastolic volume (EDV) by using different lower threshold values: besides fixed lower threshold values, identical for each image sequence, individual lower threshold values dependent on contrast enhancement of the left ventricle were applied. The latter represent the mean value calculated by combining the average CT-density of the myocardium and the contrast-enhanced blood in the left ventricle. The EF derived from ESV and EDV. Results: The best correlation with MR imaging was obtained for ESV and EDV by using the individual lower threshold values for the respective sequence. The correlation coefficient for ESV was 0.95 and for EDV it was 0.93. On average, the ESV was overestimated by 3.72 ml, while the ESD was underestimated by 2.85 ml. The respective standard deviation for the ESV was 14,87 ml, for the EDV it was 26.83 ml. On average, the EF was underestimated by 3.57% with a standard deviation of 9.43% and a correlation coefficient of 0.83 in comparison to MRI. Conclusion: The threshold-value-supported 3D volume reconstruction of the left ventricle represents a good method to determine the left ventricular function parameters. Due to the differences in the contrast enhancement, the use of an individual lower threshold value for every image sequence is of particular importance. (orig.) [de

  8. The relationship between I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}){sup 2} and crystalline volume fraction in microcrystalline silicon growth

    Energy Technology Data Exchange (ETDEWEB)

    Chantana, Jakapan; Higuchi, Takuya; Nagai, Tomoyuki; Sasaki, Shota; Sobajima, Yasushi; Toyama, Toshihiko; Sada, Chitose; Matsuda, Akihisa; Okamoto, Hiroaki [Graduate School of Engineering Science, Osaka University, 1-3 Machikaneyama-cho, Toyonaka, Osaka 560-8531 (Japan)


    Optical-emission-intensity ratio of I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}) during film growth has been used as a simple indicator to predict crystallinity (crystal-volume fraction: X{sub C}) in the resulting microcrystalline silicon ({mu}c-Si:H) thin films. The relationship between I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}) and X{sub C} has been checked under a wide variety of film-preparation conditions including low-deposition-rate (<0.1 nm/s) and high-deposition-rate (>5 nm/s) cases. On the basis of theoretical consideration, we have proposed optical-emission-intensity ratio of I{sub H{sub {alpha}}} /(I{sub SiH}{sup *}) {sup 2} as a new indicator of X{sub C} during film growth of {mu}c-Si:H. (Abstract Copyright [2010], Wiley Periodicals, Inc.)

  9. In vivo assessment of the gastric mucosal tolerance dose after single fraction, small volume irradiation of liver malignancies by computed tomography-guided, high-dose-rate brachytherapy

    International Nuclear Information System (INIS)

    Streitparth, Florian; Pech, Maciej; Boehmig, Michael; Ruehl, Ricarda; Peters, Nils; Wieners, Gero; Steinberg, Johannes; Lopez-Haenninen, Enrique; Felix, Roland; Wust, Peter; Ricke, Jens


    Purpose: The aim of this study was to assess the tolerance dose of gastric mucosa for single-fraction computed tomography (CT)-guided, high-dose-rate (HDR) brachytherapy of liver malignancies. Methods and Materials: A total of 33 patients treated by CT-guided HDR brachytherapy of liver malignancies in segments II and/or III were included. Dose planning was performed upon a three-dimensional CT data set acquired after percutaneous applicator positioning. All patients received gastric protection post-treatment. For further analysis, the contours of the gastric wall were defined in every CT slice using Brachyvision Software. Dose-volume histograms were calculated for each treatment and correlated with clinical data derived from questionnaires assessing Common Toxicity Criteria (CTC). All patients presenting symptoms of upper GI toxicity were examined endoscopically. Results: Summarizing all patients the minimum dose applied to 1 ml of the gastric wall (D 1ml ) ranged from 6.3 to 34.2 Gy; median, 14.3 Gy. Toxicity was present in 18 patients (55%). We found nausea in 16 (69%), emesis in 9 (27%), cramping in 13 (39%), weight loss in 12 (36%), gastritis in 4 (12%), and ulceration in 5 patients (15%). We found a threshold dose D 1ml of 11 Gy for general gastric toxicity and 15.5 Gy for gastric ulceration verified by an univariate analysis (p = 0.01). Conclusions: For a single fraction, small volume irradiation we found in the upper abdomen a threshold dose D 1ml of 15.5 Gy for the clinical endpoint ulceration of the gastric mucosa. This in vivo assessment is in accordance with previously published tolerance data

  10. Effects of nano anatase-rutile TiO2 volume fraction with natural dye containing anthocyanin on the dye sensitized solar cell performance (United States)

    Agustini, S.; Wahyuono, R. A.; Sawitri, D.; Risanti, D. D.


    Since its first development, efforts to improve efficiency of Dye Sensitized Solar Cell (DSSC) are continuously carried out, either through selection of dye materials, the type of semiconductor, counter electrode design or the sandwiched structure. It is widely known that anatase and rutile are phases of TiO2 that often being used for fabrication of DSSC. Rutile is thermodynamically more stable phase having band-gap suitable for absorption of sunlight spectrum. On the other hand, anatase has higher electrical conductivity, capability to adsorp dye as well as higher electron diffusion coefficient than those of rutile. Present research uses mangosteen pericarp and Rhoeo spathacea extracted in ethanol as natural dye containing anthocyanin. These dyes were characterized by using UV-Vis and FTIR, showing that the absorption maxima peaks obtained at 389 nm and 413 nm, for mangosteen and Rhoeo spathacea, respectively. The nano TiO2 was prepared by means of co-precipitation method. The particle size were 9-11 nm and 54.5 nm for anatase and rutile, respectively, according to Scherrer's equation. DSSCs were fabricated in various volume fractions of anatase and rutile TiO2. The fabricated DSSCs were tested under 17 mW/cm2 of solar irradiation. The current-voltage (I-V) characteristic of DSSCs employing 75%: 25% volume fraction of anatase and rutile TiO2 have outstanding result than others. The highest conversion efficiencies of 0.037% and 0.013% are obtained for DSSC employing natural dye extract from mangosteen pericarp and Rhoeo spathacea, respectively.

  11. The effect of sintering conditions and ZrN volume fraction on the mechanical properties of spark plasma sintered W/ZrN composites

    International Nuclear Information System (INIS)

    Lee, Dongju; Umer, Malik Adeel; Shin, Yoochul; Jeon, Seokwoo; Hong, Soonhyung


    Highlights: ► Effect of sintering conditions on properties of W composites was investigated. ► Effect of ZrN volume fraction on properties of W composites was investigated. ► The grain size and relative density increased with increasing sintering temperature. ► ZrN particles led to an increase in strength of W and a decrease in grain size. ► Highest flexural strength was obtained for 10 vol.% W/ZrN with lowest agglomeration. - Abstract: In an effort to improve the room temperature mechanical properties of tungsten, W/ZrN composites were fabricated by high energy ball milling followed by spark plasma sintering at temperatures in a range of 1200–1700 °C under a pressure of 50 MPa. The effects of sintering conditions and ZrN volume fraction on the mechanical properties of the W/ZrN composites were studied and the results were compared to the properties of monolithic tungsten. The grain size of monolith tungsten and W/ZrN composites was found to increase with an increase in sintering temperature and time. In the case of the W/ZrN composites, ZrN particles led to an increase in the compressive strength of tungsten and a decrease in grain size. The increase in compressive strength of the composites was attributed to a reinforcement effect of ZrN particles as well as grain size refinement according to the Hall–Petch relation. Compressive strength of the composites increased with increasing ZrN content while the flexural strength decreased for samples with ZrN content exceeding 10 vol.%. This was attributed to the effects of ZrN agglomeration within the tungsten matrix.

  12. Target volume geometric change and/or deviation from the cranium during fractionated stereotactic radiotherapy for brain metastases: potential pitfalls in image guidance based on bony anatomy alignment. (United States)

    Ohtakara, Kazuhiro; Hoshi, Hiroaki


    This study sought to evaluate the potential geometrical change and/or displacement of the target relative to the cranium during fractionated stereotactic radiotherapy (FSRT) for treating newly developed brain metastases. For 16 patients with 21 lesions treated with image-guided frameless FSRT in 5 or 10 fractions using a 6-degree-of-freedom image guidance system-integrated platform, the unenhanced computed tomography or T2-weighted magnetic resonance images acquired until the completion of FSRT were fused to the planning image datasets for comparison. Significant change was defined as ≥3-mm change in the tumour diameter or displacement of the tumour centroid. FSRT was started 1 day after planning image acquisition. Tumour shrinkage, deviation and both were observed in 2, 1 and 1 of the 21 lesions, respectively, over a period of 7-13 days. Tumour shrinkage or deviation resulted in an increase or decrease in the marginal dose to the tumour, respectively, and a substantial increase in the irradiated volume for the surrounding tissue irrespective of the pattern of alteration. No obvious differences in the clinical and treatment characteristics were noted among the populations with or without significant changes in tumour volume or position. Target deformity and/or deviation can unexpectedly occur even during relatively short-course FSRT, inevitably leading to a gradual discrepancy between the planned and actually delivered doses to the tumour and surrounding tissue. To appropriately weigh the treatment outcome against the planned dose distribution, target deformity and/or deviation should also be considered in addition to the immobilisation accuracy, as image guidance with bony anatomy alignment does not necessarily guarantee accurate target localisation until completion of FSRT. © 2014 The Royal Australian and New Zealand College of Radiologists.

  13. Measurement of Mechanical Coherency Temperature and Solid Volume Fraction in Al-Zn Alloys Using In Situ X-ray Diffraction During Casting (United States)

    Drezet, Jean-Marie; Mireux, Bastien; Kurtuldu, Güven; Magdysyuk, Oxana; Drakopoulos, Michael


    During solidification of metallic alloys, coalescence leads to the formation of solid bridges between grains or grain clusters when both solid and liquid phases are percolated. As such, it represents a key transition with respect to the mechanical behavior of solidifying alloys and to the prediction of solidification cracking. Coalescence starts at the coherency point when the grains begin to touch each other, but are unable to sustain any tensile loads. It ends up at mechanical coherency when the solid phase is sufficiently coalesced to transmit macroscopic tensile strains and stresses. Temperature at mechanical coherency is a major input parameter in numerical modeling of solidification processes as it defines the point at which thermally induced deformations start to generate internal stresses in a casting. This temperature has been determined for Al-Zn alloys using in situ X-ray diffraction during casting in a dog-bone-shaped mold. This setup allows the sample to build up internal stress naturally as its contraction is prevented. The cooling on both extremities of the mold induces a hot spot at the middle of the sample which is irradiated by X-ray. Diffraction patterns were recorded every 0.5 seconds using a detector covering a 426 × 426 mm2 area. The change of diffraction angles allowed measuring the general decrease of the lattice parameter of the fcc aluminum phase. At high solid volume fraction, a succession of strain/stress build up and release is explained by the formation of hot tears. Mechanical coherency temperatures, 829 K to 866 K (556 °C to 593 °C), and solid volume fractions, ca. 98 pct, are shown to depend on solidification time for grain refined Al-6.2 wt pct Zn alloys.

  14. Effects of ductile phase volume fraction on the mechanical properties of Ti-Al3Ti metal-intermetallic laminate (MIL) composites

    International Nuclear Information System (INIS)

    Price, Richard D.; Jiang Fengchun; Kulin, Robb M.; Vecchio, Kenneth S.


    Research highlights: → Residual Al improves the mechanical properties of Ti-Al 3 Ti MIL composites. → Residual Al can eliminate intermetallic centerline delaminations in MILs. → Low levels of residual Al increase fracture toughness in MIL composites. → MIL stiffness, strength, and fracture toughness can be optimized at low Al levels. - Abstract: Metal-intermetallic laminate (MIL) composites consisting of alternating layers of Ti, Al, and the intermetallic Al 3 Ti have been fabricated by reactive foil sintering in open air. Six initially identical stacks of alternating Ti-3Al-2.5 V and 1100-Al foils were processed for different lengths of time, yielding specimens with different metal and intermetallic volume fractions. Their mechanical properties have been investigated with an emphasis on the effect of residual Al at the intermetallic centerline on composite strength and fracture toughness, as well as fracture and failure modes. Samples were cut from each composite plate (in layer orientations parallel and perpendicular to the intended load direction) for mechanical testing in compression and four-point bending under quasi-static and high-rate loading conditions. Examination of the damaged specimens and their fracture surfaces by optical and scanning electron microscopy was performed to establish a correlation between the failure mechanisms present, composite strength, and microstructure. Results indicated that regardless of loading direction, cracks always initiated in the intermetallic region, rarely at the centerline, and crack propagation and failure were heavily influenced by the thickness of the residual aluminum layers. There is an ideal residual aluminum volume fraction that represents the amount of ductile reinforcement that maximizes the combined properties of strength, toughness and stiffness.

  15. A two-phase debris-flow model that includes coupled evolution of volume fractions, granular dilatancy, and pore-fluid pressure (United States)

    George, David L.; Iverson, Richard M.


    Pore-fluid pressure plays a crucial role in debris flows because it counteracts normal stresses at grain contacts and thereby reduces intergranular friction. Pore-pressure feedback accompanying debris deformation is particularly important during the onset of debrisflow motion, when it can dramatically influence the balance of forces governing downslope acceleration. We consider further effects of this feedback by formulating a new, depth-averaged mathematical model that simulates coupled evolution of granular dilatancy, solid and fluid volume fractions, pore-fluid pressure, and flow depth and velocity during all stages of debris-flow motion. To illustrate implications of the model, we use a finite-volume method to compute one-dimensional motion of a debris flow descending a rigid, uniformly inclined slope, and we compare model predictions with data obtained in large-scale experiments at the USGS debris-flow flume. Predictions for the first 1 s of motion show that increasing pore pressures (due to debris contraction) cause liquefaction that enhances flow acceleration. As acceleration continues, however, debris dilation causes dissipation of pore pressures, and this dissipation helps stabilize debris-flow motion. Our numerical predictions of this process match experimental data reasonably well, but predictions might be improved by accounting for the effects of grain-size segregation.

  16. Phase volume fractions and strain measurements in an ultrafine-grained NiTi shape-memory alloy during tensile loading

    International Nuclear Information System (INIS)

    Young, M.L.; Wagner, M.F.-X.; Frenzel, J.; Schmahl, W.W.; Eggeler, G.


    An ultrafine-grained pseudoelastic NiTi shape-memory alloy wire with 50.9 at.% Ni was examined using synchrotron X-ray diffraction during in situ uniaxial tensile loading (up to 1 GPa) and unloading. Both macroscopic stress-strain measurements and volume-averaged lattice strains are reported and discussed. The loading behavior is described in terms of elasto-plastic deformation of austenite, emergence of R phase, stress-induced martensitic transformation, and elasto-plastic deformation, grain reorientation and detwinning of martensite. The unloading behavior is described in terms of stress relaxation and reverse plasticity of martensite, reverse transformation of martensite to austenite due to stress relaxation, and stress relaxation of austenite. Microscopically, lattice strains in various crystallographic directions in the austenitic B2, martensitic R, and martensitic B19' phases are examined during loading and unloading. It is shown that the phase transformation occurs in a localized manner along the gage length at the plateau stress. Phase volume fractions and lattice strains in various crystallographic reflections in the austenite and martensite phases are examined over two transition regions between austenite and martensite, which have a width on the order of the wire diameter. Anisotropic effects observed in various crystallographic reflections of the austenitic phase are also discussed. The results contribute to a better understanding of the tensile loading behavior, both macroscopically and microscopically, of NiTi shape-memory alloys.

  17. 46 CFR 154.172 - Contiguous steel hull structure. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous steel hull structure. 154.172 Section 154.172... STANDARDS FOR SELF-PROPELLED VESSELS CARRYING BULK LIQUEFIED GASES Design, Construction and Equipment Hull Structure § 154.172 Contiguous steel hull structure. (a) Except as allowed in paragraphs (b) and (c) of this...

  18. Spatial Contiguity and Incidental Learning in Multimedia Environments (United States)

    Paek, Seungoh; Hoffman, Daniel L.; Saravanos, Antonios


    Drawing on dual-process theories of cognitive function, the degree to which spatial contiguity influences incidental learning outcomes was examined. It was hypothesized that spatial contiguity would mediate what was learned even in the absence of an explicit learning goal. To test this hypothesis, 149 adults completed a multimedia-related task…

  19. Comparison of Gated SPECT Myocardial Perfusion Imaging with Echocardiography for the Measurement of Left Ventricular Volumes and Ejection Fraction in Patients With Severe Heart Failure (United States)

    Shojaeifard, Maryam; Ghaedian, Tahereh; Yaghoobi, Nahid; Malek, Hadi; Firoozabadi, Hasan; Bitarafan-Rajabi, Ahmad; Haghjoo, Majid; Amin, Ahmad; Azizian, Nasrin; Rastgou, Feridoon


    Background: Gated single-photon emission computed tomography (SPECT) myocardial perfusion imaging (MPI) is known as a feasible tool for the measurement of left ventricular ejection fraction (EF) and volumes, which are of great importance in the management and follow-up of patients with coronary artery diseases. However, considering the technical shortcomings of SPECT in the presence of perfusion defect, the accuracy of this method in heart failure patients is still controversial. Objectives: The aim of the present study was to compare the results from gated SPECT MPI with those from echocardiography in heart failure patients to compare echocardiographically-derived left ventricular dimension and function data to those from gated SPECT MPI in heart failure patients. Patients and Methods: Forty-one patients with severely reduced left ventricular systolic function (EF ≤ 35%) who were referred for gated SPECT MPI were prospectively enrolled. Quantification of EF, end-diastolic volume (EDV), and end-systolic volume (ESV) was performed by using quantitative gated spect (QGS) (QGS, version 0.4, May 2009) and emory cardiac toolbox (ECTb) (ECTb, revision 1.0, copyright 2007) software packages. EF, EDV, and ESV were also measured with two-dimensional echocardiography within 3 days after MPI. Results: A good correlation was found between echocardiographically-derived EF, EDV, and ESV and the values derived using QGS (r = 0.67, r = 0.78, and r = 0.80 for EF, EDV, and ESV, respectively; P echocardiography. ECTb-derived EDV was also significantly higher than the EDV measured with echocardiography and QGS. The highest correlation between echocardiography and gated SPECT MPI was found for mean values of ESV different. Conclusions: Gated SPECT MPI has a good correlation with echocardiography for the measurement of left ventricular EF, EDV, and ESV in patients with severe heart failure. However, the absolute values of these functional parameters from echocardiography and gated

  20. Electric-field-dependent phase volume fractions and enhanced piezoelectricity near the polymorphic phase boundary of (K0.5Na0.5)1-xLixNbO3 textured ceramics (United States)

    Ge, Wenwei; Li, Jiefang; Viehland, D.; Chang, Yunfei; Messing, Gary L.


    The structure, ferroelectric and piezoelectric properties of textured (K0.5Na0.5)0.98Li0.02NbO3 ceramics were investigated as a function of temperature and dc bias E. X-ray diffraction revealed an orthorhombic (O) → tetragonal (T) polymorphic phase boundary (PPB). Phase coexistence was found near the PPB over a 30 °C temperature range, where the relative phase volume fractions changed with temperature. Furthermore, increasing E applied along the texture direction resulted in a notable increase in the volume fraction of the T phase at the expense of the O phase, effectively shifting the O → T boundary to lower temperature. An enhancement in the piezoelectric properties was found to accompany this increase in the T volume fraction.

  1. Contiguous spinal metastasis mimicking infectious spondylodiscitis

    International Nuclear Information System (INIS)

    Lee, Chul Min; Lee, Seung Hun; Bae, Ji Yoon


    Differential diagnosis between spinal metastasis and infectious spondylodiscitis is one of the occasional challenges in daily clinical practice. We encountered an unusual case of spinal metastasis in a 75-year-old female breast cancer patient that mimicked infectious spondylodiscitis. Magnetic resonance imaging (MRI) showed diffuse bone marrow infiltrations with paraspinal soft tissue infiltrative changes in 5 contiguous cervical vertebrae without significant compression fracture or cortical destruction. These MRI findings made it difficult to differentiate between spinal metastasis and infectious spondylodiscitis. Infectious spondylodiscitis such as tuberculous spondylodiscitis was regarded as the more appropriate diagnosis due to the continuous involvement of > 5 cervical vertebrae. The patient's clinical presentation also supported the presumptive diagnosis of infectious spondylodiscitis rather than spinal metastasis. Intravenous antibiotics were administered, but clinical symptoms worsened despite treatment. After pathologic confirmation by computed tomography-guided biopsy, we were able to confirm a final diagnosis of spinal metastasis

  2. Contiguous spinal metastasis mimicking infectious spondylodiscitis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chul Min; Lee, Seung Hun [Dept. of Radiology, Hanyang University Hospital, Seoul (Korea, Republic of); Bae, Ji Yoon [Dept. of Pathology, National Police Hospital, Seoul (Korea, Republic of)


    Differential diagnosis between spinal metastasis and infectious spondylodiscitis is one of the occasional challenges in daily clinical practice. We encountered an unusual case of spinal metastasis in a 75-year-old female breast cancer patient that mimicked infectious spondylodiscitis. Magnetic resonance imaging (MRI) showed diffuse bone marrow infiltrations with paraspinal soft tissue infiltrative changes in 5 contiguous cervical vertebrae without significant compression fracture or cortical destruction. These MRI findings made it difficult to differentiate between spinal metastasis and infectious spondylodiscitis. Infectious spondylodiscitis such as tuberculous spondylodiscitis was regarded as the more appropriate diagnosis due to the continuous involvement of > 5 cervical vertebrae. The patient's clinical presentation also supported the presumptive diagnosis of infectious spondylodiscitis rather than spinal metastasis. Intravenous antibiotics were administered, but clinical symptoms worsened despite treatment. After pathologic confirmation by computed tomography-guided biopsy, we were able to confirm a final diagnosis of spinal metastasis.

  3. A bench evaluation of fraction of oxygen in air delivery and tidal volume accuracy in home care ventilators available for hospital use (United States)

    Baboi, Loredana; Subtil, Fabien


    Background Turbine-powered ventilators are not only designed for long-term ventilation at home but also for hospital use. It is important to verify their capabilities in delivering fraction of oxygen in air (FIO2) and tidal volume (VT). Methods We assessed the FIO2 accuracy and the VT delivery in four home care ventilators (HCV) on the bench. The four HCV were Astral 150, Elisée 150, Monnal T50 and Trilogy 200 HCV, which were connected to a lung model (ASL 5000). For assessing FIO2 accuracy, lung model was set to mimic an obstructive lung and HCV were set in volume controlled mode (VC). They supplied with air, 3 or 15 L/min oxygen and FIO2 was measured by using a ventilator tester (Citrex H4TM). For the VT accuracy, the lung model was set in a way to mimic three adult configurations (normal, obstructive, or restrictive respiratory disorder) and one pediatric configuration. Each HCV was set in VC. Two VT (300 and 500 mL) in adult lung configuration and one 50 mL VT in pediatric lung configuration, at two positive end expiratory pressures 5 and 10 cmH2O, were tested. VT accuracy was measured as volume error (the relative difference between set and measured VT). Statistical analysis was performed by suing one-factor ANOVA with a Bonferroni correction for multiple tests. Results For Astral 150, Elisée 150, Monnal T50 and Trilogy 200, FIO2 averaged 99.2%, 93.7%, 86.3%, and 62.1%, respectively, at 15 L/min oxygen supplementation rate (P<0.001). Volume error was 0.5%±0%, −38%±0%, −9%±0%, −29%±0% and −36%±0% for pediatric lung condition (P<0.001). In adult lung configurations, Monnal T50 systematically over delivered VT and Trilogy 150 was sensitive to lung configuration when VT was set to 300 mL at either positive end-expiratory pressure (PEEP). Conclusions HCV are different in terms of FIO2 efficiency and VT delivery. PMID:28149559

  4. Assessment of a simplified set of momentum closure relations for low volume fraction regimes in STAR-CCM+ and OpenFOAM

    International Nuclear Information System (INIS)

    Sugrue, Rosemary; Magolan, Ben; Lubchenko, Nazar; Baglietto, Emilio


    Highlights: •A simplified set of momentum closures – Bubbly And Moderate void Fraction (BAMF) – is proposed. •BAMF model is assessed by simulation of 12 cases from the Liu and Bankoff experimental database. •Portability between STAR-CCM+ and OpenFOAM CFD softwares is demonstrated. •Both CFD softwares yield mean flow predictions in close agreement with experimental results. -- Abstract: Multiphase computational fluid dynamics (M-CFD) modeling approaches provide three-dimensional resolution of complex two-phase flow and boiling heat transfer phenomena, which makes them an invaluable tool for nuclear reactor design applications. By virtue of the Eulerian-Eulerian spatial and temporal averaging framework, additional terms manifest in the phase momentum equations that require closure through prescription of interfacial forces in the stream-wise and lateral flow directions, as well as in the near-wall region. These momentum closures are critical to M-CFD prediction of mean flow profiles, including velocity and volume fraction distributions, and yet while an overwhelming number of them has been developed, no consensus exists on how to assemble them to achieve a simplified set of closures that is numerically robust and extensible to a wide array of flow configurations; further, no consistent demonstration has been shown of the cross-code portability of these closures between CFD softwares. To address these challenges, we propose in this work a simplified set of momentum closures for stream-wise drag and lateral redistribution mechanisms—collectively referred to as the Bubbly And Moderate void Fraction (BAMF) model—and assess its performance by simulation of 12 cases from the Liu and Bankoff experimental database using STAR-CCM+ and OpenFOAM. Both CFD softwares yield mean flow predictions that are in close agreement with the experimental results, and also in close agreement with each other. These results confirm the effectiveness of the BAMF model and its

  5. Identification of radiation response genes and proteins from mouse pulmonary tissues after high-dose per fraction irradiation of limited lung volumes. (United States)

    Jin, Hee; Jeon, Seulgi; Kang, Ga-Young; Lee, Hae-June; Cho, Jaeho; Lee, Yun-Sil


    The molecular effects of focal exposure of limited lung volumes to high-dose per fraction irradiation (HDFR) such as stereotactic body radiotherapy (SBRT) have not been fully characterized. In this study, we used such an irradiation system and identified the genes and proteins after HDFR to mouse lung, similar to those associated with human therapy. High focal radiation (90 Gy) was applied to a 3-mm volume of the left lung of C57BL6 mice using a small-animal stereotactic irradiator. As well as histological examination for lungs, a cDNA micro array using irradiated lung tissues and a protein array of sera were performed until 4 weeks after irradiation, and radiation-responsive genes and proteins were identified. For comparison, the long-term effects (12 months) of 20 Gy radiation wide-field dose to the left lung were also investigated. The genes ermap, epb4.2, cd200r3 (up regulation) and krt15, hoxc4, gdf2, cst9, cidec, and bnc1 (down-regulation) and the proteins of AIF, laminin, bNOS, HSP27, β-amyloid (upregulation), and calponin (downregulation) were identified as being responsive to 90 Gy HDFR. The gdf2, cst9, and cidec genes also responded to 20 Gy, suggesting that they are universal responsive genes in irradiated lungs. No universal proteins were identified in both 90 Gy and 20 Gy. Calponin, which was downregulated in protein antibody array analysis, showed a similar pattern in microarray data, suggesting a possible HDFR responsive serum biomarker that reflects gene alteration of irradiated lung tissue. These genes and proteins also responded to the lower doses of 20 Gy and 50 Gy HDFR. These results suggest that identified candidate genes and proteins are HDFR-specifically expressed in lung damage induced by HDFR relevant to SBRT in humans.

  6. Factors affecting accuracy of ventricular volume and ejection fraction measured by gated Tl-201 myocardial perfusion single photon emission computed tomography

    International Nuclear Information System (INIS)

    Pai, Moon Sun; Yang, You Jung; Im, Ki Chun; Hong, Il Ki; Yun, Sung Cheol; Kang, Duk Hyun; Song, Jae Kwan; Moon, Dae Hyuk


    Systemic errors in the gated single photon emission computed tomography (SPECT) measurement of left ventricular (LV) end-diastolic volume (EDV), end-systolic volume (ESV) and ejection fraction (EF) may occur. We evaluated whether patient-related factors affected the accuracy of EDV, ESV, and EF measured by electrocardiogram-gated Tl-201 SPECT. A total of 518 patients without perfusion defects on Tl-201 SPECT or coronary artery disease were studied. EDV, ESV, and EF were measured from echocardiography and adenosine stress/redistribution gated Tl-201 SPECT using commercially available software packages (QGS and 4D-MSPECT). We identified factors affecting the accuracy of gated SPECT via multiple linear regression analysis of the differences between echocardiography and gated SPECT. Gated SPECT analyzed with QGS underestimated EDV and ESV, and overestimated EF, but 4D-MSPECT overestimated all those values (p<0.001). Independent variables that increased the difference in EDV between echocardiography and gated SPECT were decreasing LV end-diastolic wall thickness, decreasing body surface area, female sex and increasing EDV (p< 0.001). Those for ESV were decreasing LV end-systolic wall thickness, female sex, and decreasing ESV (p<0.001). Increasing end-systolic wall thickness, male sex and decreasing age were independent determinants associated with an increased difference in EF (p< 0.001). Adenosine stress SPECT showed significantly higher EDV and ESV values and a lower EF than did redistribution SPECT (p< 0.001). In determination of EF, QGS demonstrated a smaller bias than did 4D-MSPECT. However, in men with LV hypertrophy, 4D-MSPECT was superior to QGS. Systemic error by gated Tl-201 SPECT is determined by individual patient-characteristics

  7. Influence of copper volume fraction on tensile strain/stress tolerances of critical current in a copper-plated DyBCO-coated conductor

    International Nuclear Information System (INIS)

    Ochiai, Shojiro; Okuda, Hiroshi; Arai, Takahiro; Sugano, Michinaka; Osamura, Kozo; Prusseit, Werner


    The influence of the volume fraction (V f ) of copper, plated at room temperature over a DyBa 2 Cu 3 O 7-δ -coated conductor, on the tensile strain tolerance and stress tolerance of critical current at 77 K was studied over a wide range of copper V f values. The copper plating exerts a tensile stress during cooling because copper has a higher coefficient of thermal expansion than the substrate conductor. Before application of tensile strain, the copper plated at room temperature yielded at 77 K when the copper V f was lower than a critical value, and was in an elastic state at 77 K when the copper V f was higher than the critical value. The strain tolerance of critical current increased with increasing copper V f due to an increase in thermally induced compressive strain in the substrate tape. The stress tolerance of critical current decreased with increasing copper V f because copper is softer than the substrate tape. These results, together with the trade-off between strain tolerance and stress tolerance (i.e., stress tolerance decreases with increasing strain tolerance), were analyzed by modeling. The results show that the restriction imposed by the trade-off, which limits the ability to simultaneously obtain a high strain tolerance and a high stress tolerance, can be relaxed by strengthening the copper. (author)

  8. Mechanical properties of a co-extruded Metallic Glass/Alloy (MeGA) rod-Effect of the metallic glass volume fraction

    International Nuclear Information System (INIS)

    Gravier, S.; Blandin, J.J.; Suery, M.


    A Metallic Glass/Alloy (MeGA) rod with a core in zirconium-based bulk metallic glass and a sleeve in aluminium alloy has been successfully elaborated by co-extrusion. SEM observations of the cross-section of the rod show that the interface between the glass and the alloy is defect-free. Compression tests are carried out at room temperature on the MeGA rods containing various glass volume fractions. The yield stress is well described by the rule of mixtures which combines the strength of the glass and that of the alloy, suggesting isostrain behaviour as could be expected. During compression, a good mechanical bonding is observed in the MeGA-rod even after the first fracture of the metallic glass. Finally, push-out tests are performed to evaluate the bonding quality between the two materials. Large values of the shear strength are measured which confirms that co-extrusion leads to good bonding between the glass and the aluminium alloy.


    Institute of Scientific and Technical Information of China (English)

    Yirang YUAN; Qing YANG; Changfeng LI; Tongjun SUN


    Transient behavior of three-dimensional semiconductor device with heat conduction is described by a coupled mathematical system of four quasi-linear partial differential equations with initial-boundary value conditions.The electric potential is defined by an elliptic equation and it appears in the following three equations via the electric field intensity.The electron concentration and the hole concentration are determined by convection-dominated diffusion equations and the temperature is interpreted by a heat conduction equation.A mixed finite volume element approximation,keeping physical conservation law,is used to get numerical values of the electric potential and the accuracy is improved one order.Two concentrations and the heat conduction are computed by a fractional step method combined with second-order upwind differences.This method can overcome numerical oscillation,dispersion and decreases computational complexity.Then a three-dimensional problem is solved by computing three successive one-dimensional problems where the method of speedup is used and the computational work is greatly shortened.An optimal second-order error estimate in L2 norm is derived by using prior estimate theory and other special techniques of partial differential equations.This type of mass-conservative parallel method is important and is most valuable in numerical analysis and application of semiconductor device.

  10. Influence of the Metal Volume Fraction on the permanent dent depth and energy absorption of GLARE plates subjected to low velocity impact (United States)

    Bikakis, GSE; Savaidis, A.; Zalimidis, P.; Tsitos, S.


    Fiber-metal laminates are hybrid composite materials, consisting of alternating metal layers bonded to fiber-reinforced prepreg layers. GLARE (GLAss REinforced) belongs to this new family of materials. GLARE is the most successful fiber-metal laminate up to now and is currently being used for the construction of primary aerospace structures, such as the fuselage of the Airbus A380 air plane. Impact properties are very important in aerospace structures, since impact damage is caused by various sources, such as maintenance damage from dropped tools, collision between service cars or cargo and the structure, bird strikes and hail. The principal objective of this article is to evaluate the influence of the Metal Volume Fraction (MVF) on the low velocity impact response of GLARE fiber-metal laminates. Previously published differential equations of motion are employed for this purpose. The low velocity impact behavior of various circular GLARE plates is predicted and characteristic values of impact variables, which represent the impact phenomenon, are evaluated versus the corresponding MVF of the examined GLARE material grades. The considered GLARE plates are subjected to low velocity impact under identical impact conditions. A strong effect of the MVF on the maximum impact load and a significant effect on the maximum plate deflection of GLARE plates has been found.

  11. Influence of the Metal Volume Fraction on the maximum deflection and impact load of GLARE plates subjected to low velocity impact (United States)

    Bikakis, GSE; Savaidis, A.; Zalimidis, P.; Tsitos, S.


    Fiber-metal laminates are hybrid composite materials, consisting of alternating metal layers bonded to fiber-reinforced prepreg layers. GLARE (GLAss REinforced) belongs to this new family of materials. GLARE is the most successful fiber-metal laminate up to now and is currently being used for the construction of primary aerospace structures, such as the fuselage of the Airbus A380 air plane. Impact properties are very important in aerospace structures, since impact damage is caused by various sources, such as maintenance damage from dropped tools, collision between service cars or cargo and the structure, bird strikes and hail. The principal objective of this article is to evaluate the influence of the Metal Volume Fraction (MVF) on the low velocity impact response of GLARE fiber-metal laminates. Previously published differential equations of motion are employed for this purpose. The low velocity impact behavior of various circular GLARE plates is predicted and characteristic values of impact variables, which represent the impact phenomenon, are evaluated versus the corresponding MVF of the examined GLARE material grades. The considered GLARE plates are subjected to low velocity impact under identical impact conditions. A strong effect of the MVF on the maximum impact load and a significant effect on the maximum plate deflection of GLARE plates has been found.

  12. Deformation mechanisms in a fine-grained Udimet 720LI nickel-base superalloy with high volume fractions of γ′ phases

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Jiayu, E-mail:; Dong, Jianxin; Zhang, Maicang; Yao, Zhihao


    Hot-deformation behaviors and mechanisms below γ′ solvus of U720LI with fine-grained microstructure and high volume fractions of γ′ phases were studied. MTS hot-compressed samples under hot-deformation parameters (Temperatures of 1040 °C, 1070 °C, 1100 °C, 1130 °C, strain rates of 0.01 s{sup −1}, 0.1 s{sup −1}, 0.5 s{sup −1} and strains of 0.11, 0.36, 0.69 and 1.2) were investigated by using multiple microstructural analysis methods, such as transmission electron microscopy (TEM), electron channeling contrast image (ECCI), et al.. Rare recovery and recrystallization were observed indicating that other deformation mechanisms might be enhanced during the deformation process. Except for the pinning effect, deformation happened within γ′ phases and also γ′ phase promoted the deformation of the matrix. When the slipping was inhibited by γ′ phases, twinning acted as a deformation mechanism in fine-grained U720LI. Due to the retardation effect of γ′ phases in the early stage of the deformation process, local grain boundary migration took effect. Once grain boundaries crossed γ′ phases, it made recrystallization by strain induced boundary motion(SIBM) easier.

  13. Contrast-enhanced T1 mapping-based extracellular volume fraction independently predicts clinical outcome in patients with non-ischemic dilated cardiomyopathy: a prospective cohort study

    Energy Technology Data Exchange (ETDEWEB)

    Youn, Jong-Chan [Hallym University College of Medicine, Division of Cardiology, Dongtan Sacred Heart Hospital, Hwaseong (Korea, Republic of); Yonsei University College of Medicine, Division of Cardiology, Severance Cardiovascular Hospital, Seoul (Korea, Republic of); Hong, Yoo Jin; Lee, Hye-Jeong; Han, Kyunghwa; Suh, Young Joo; Hur, Jin; Kim, Young Jin; Choi, Byoung Wook [Yonsei University College of Medicine, Department of Radiology, Research Institute of Radiological Science, Severance Hospital, Seoul (Korea, Republic of); Shim, Chi Young; Hong, Geu-Ru; Kang, Seok-Min [Yonsei University College of Medicine, Division of Cardiology, Severance Cardiovascular Hospital, Seoul (Korea, Republic of)


    We aimed to evaluate the prognostic role of cardiac magnetic resonance imaging (CMR)-based extracellular volume fraction (ECV) in patients with non-ischemic dilated cardiomyopathy (NIDCM) and compare it with late gadolinium enhancement (LGE) parameters. This was a single-center, prospective, cohort study of 117 NIDCM patients (71 men, 51.9 ± 16.7 years) who underwent clinical 3.0-T CMR. Myocardial ECV and LGE were quantified on the left ventricular myocardium. The presence of midwall LGE was also detected. Nineteen healthy subjects served as controls. The primary end points were cardiovascular (CV) events defined by CV death, rehospitalization due to heart failure, and heart transplantation. During the follow-up period (median duration, 11.2 months; 25{sup th}-75{sup th} percentile, 7.8-21.9 months), the primary end points occurred in 19 patients (16.2%). The ECV (per 3% and 1% increase) was associated with a hazard ratio of 1.80 and 1.22 (95% confidence interval [CI], 1.48-2.20 and 1.14-1.30, respectively; p < 0.001) for the CV events. Multivariable analysis also indicated that ECV was an independent prognostic factor and had a higher prognostic value (Harrell's c statistic, 0.88) than LGE quantification values (0.77) or midwall LGE (0.80). CMR-based ECV independently predicts the clinical outcome in NIDCM patients. (orig.)

  14. 14 CFR 99.43 - Contiguous U.S. ADIZ. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Contiguous U.S. ADIZ. 99.43 Section 99.43 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIR TRAFFIC... Zones § 99.43 Contiguous U.S. ADIZ. The area bounded by a line from 43°15′N, 65°55′W; 44°21′N; 67°16′W...

  15. Auxillary system for optimizing simulation and percutaneous irradiation in cranio-caudally contiguous head-neck-mediastinum fields

    International Nuclear Information System (INIS)

    Sistermanns, J.


    Percutaneous irradiation in the head and neck region via opponing lateral fields with caudally contiguous ventral and/or dorsal fields makes very high demands on simulation, instrument adjustment and documentation. At the outer boundaries of the irradiation volumes, there is always the danger of overdosage or underdosage with the familiar consequences. Four targeting systems in one plane were inserted in a perspex frame each consisting of two concentric rings and two orthogonal crossbars. Under simulation conditions, the lateral radiation fields take up one half of the targeting systems and the ventro-dorsal fields occupy the remaining half. The corresponding targeting systems project exactly on or into each other with compensation of the beam divergence. A definitively exact irradiation via cranio-caudally contiguous fields with different incident beam direction is possible by using the four targeting systems in one plane. Compensation of divergence is aimed for by rotation of the table and gantry angle modification, errors of compensation can already be checked optically from 0,5 . Deviations of 5 mm in the simulated longitudinal arrangement of the contiguous fields can be imaged on the documentation film made with therapy activity. On the one hand, the auxillary system presented allows both recognition of undesired field overlap and gaps in contiguous fields with different incident beam direction. On the other hand, it can be unequivocally documented whether the therapy is correct. Treatment errors can thus be minimized. (orig./MG) [de

  16. Intracapillary HbO2 saturations in murine tumours and human tumour xenografts measured by cryospectrophotometry: relationship to tumour volume, tumour pH and fraction of radiobiologically hypoxic cells. (United States)

    Rofstad, E K; Fenton, B M; Sutherland, R M


    Frequency distributions for intracapillary HbO2 saturation were determined for two murine tumour lines (KHT, RIF-1) and two human ovarian carcinoma xenograft lines (MLS, OWI) using a cryospectrophotometric method. The aim was to search for possible relationships between HbO2 saturation status and tumour volume, tumour pH and fraction of radiobiologically hypoxic cells. Tumour pH was measured by 31P NMR spectroscopy. Hypoxic fractions were determined from cell survival curves for tumours irradiated in vivo and assayed in vitro. Tumours in the volume range 100-4000 mm3 were studied and the majority of the vessels were found to have HbO2 saturations below 10%. The volume-dependence of the HbO2 frequency distributions differed significantly among the four tumour lines; HbO2 saturation status decreased with increasing tumour volume for the KHT, RIF-1 and MLS lines and was independent of tumour volume for the OWI line. The data indicated that the rate of decrease in HbO2 saturation status during tumour growth was related to the rate of development of necrosis. The volume-dependence of tumour pH was very similar to that of the HbO2 saturation status for all tumour lines. Significant correlations were therefore found between HbO2 saturation status and tumour pH, both within tumour lines and across the four tumour lines, reflecting that the volume-dependence of both parameters probably was a compulsory consequence of reduced oxygen supply conditions during tumour growth. Hypoxic fraction increased during tumour growth for the KHT, RIF-1 and MLS lines and was volume-independent for the OWI line, suggesting a relationship between HbO2 saturation status and hypoxic fraction within tumour lines. However, there was no correlation between these two parameters across the four tumour lines, indicating that the hypoxic fraction of a tumour is not determined only by the oxygen supply conditions; other parameters may also be important, e.g. oxygen diffusivity, rate of oxygen

  17. Dicty_cDB: Contig-U09694-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09694-1 gap included 1129 1 4027135 4026071 MINUS 3 4 U09694 2 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09694-1 Contig ID Contig-U09694-1 Contig update 2002. 9.13 Contig sequence >Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig-U0969...TTAAATTAAAACAACAACAATTTCATAATATAAATAAT Gap gap included Contig length 1129 Chromosome number (1..6, M) 1 Chr...iklkqqqfklkqqqfhninn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig/Contig...E Sequences producing significant alignments: (bits) Value Contig-U09694-1 (Contig-U09694-1Q) /CSM_Contig

  18. Dicty_cDB: Contig-U12086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12086-1 gap included 1101 3 5710254 5711336 PLUS 1 2 U12086 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U12086-1 Contig ID Contig-U12086-1 Contig update 2002.12.18 Contig sequence >Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig-U12086...ATCGGATTA Gap gap included Contig length 1101 Chromosome number (1..6, M) 3 Chromosome length 6358359 Start ...te 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Contig...Sequences producing significant alignments: (bits) Value Contig-U12086-1 (Contig-U12086-1Q) /CSM_Contig/Conti... 404 e-113 Contig

  19. Determination of volume fraction in biphasic flows oil-gas and water-gas using artificial neural network and gamma densitometry; Determinacao de fracoes de volume em fluxos bifasicos oleo-gas e agua-gas utilizando redes neurais artificiais e densitometria gama

    Energy Technology Data Exchange (ETDEWEB)

    Peixoto, Philippe Netto Belache


    This study presents a methodology based on the principles of gamma ray attenuation to identify volume fractions in biphasic systems composed of oil-gas-water and gas which are found in the offshore oil industry. This methodology is based on the acknowledgment counts per second on the photopeak energy using a detection system composed of a NaI (Tl) detector, a source of {sup 137}Cs without collimation positioned at 180 ° relative to the detector on a smooth stratified flow regime. The mathematical modeling for computational simulation using the code MCNP-X was performed using the experimental measurements of the detector characteristics (energy resolution and efficiency), characteristics of the material water and oil (density and coefficient attenuation) and measurement of the volume fractions. To predict these fractions were used artificial neural networks (ANNs), and to obtain an adequate training the ANNs for the prediction of volume fractions were simulated a larger number of volume fractions in MCNP-X. The experimental data were used in the set data necessary for validation of ANNs and the data generated using the computer code MCNP-X were used in training and test sets of the ANNs. Were used ANNs of type feed-forward Multilayer Perceptron (MLP) and analyzed two functions of training, Levenberg-Marquardt (LM) and gradient descent with momentum (GDM), both using the Backpropagation training algorithm. The ANNs identified correctly the volume fractions of the multiphase system with mean relative errors lower than 1.21 %, enabling the application of this methodology for this purpose. (author)

  20. Development of the Contiguous-cells Transportation Problem

    Directory of Open Access Journals (Sweden)

    O. E. Charles-Owaba


    Full Text Available The issue of scheduling a long string of multi-period activities which have to be completed without interruption has always been an industrial challenge. The existing production/maintenance scheduling algorithms can only handle situations where activities can be split into two or more sets of activities carried out in non-contiguous sets of work periods. This study proposes a contiguous-periods production/maintenance scheduling approach using the Transportation Model. Relevant variables and parameters of contiguous-cells scheduling problem were taken from the literature. A scheduling optimization problem was defined and solved using a contiguous-cells transportation algorithm (CCTA which was applied in order to determine the optimal maintenance schedule of a fleet of ships at a dockyard in South-Western Nigeria. Fifteen different problems were solved. It is concluded that the contiguous-cells transportation approach to production/ maintenance scheduling is feasible. The model will be a useful decision support tool for scheduling maintenance operations.

  1. A method to estimate the fractional fat volume within a ROI of a breast biopsy for WAXS applications: Animal tissue evaluation

    International Nuclear Information System (INIS)

    Tang, Robert Y.; McDonald, Nancy; Laamanen, Curtis; LeClair, Robert J.


    Purpose: To develop a method to estimate the mean fractional volume of fat (ν ¯ fat ) within a region of interest (ROI) of a tissue sample for wide-angle x-ray scatter (WAXS) applications. A scatter signal from the ROI was obtained and use of ν ¯ fat in a WAXS fat subtraction model provided a way to estimate the differential linear scattering coefficient μ s of the remaining fatless tissue. Methods: The efficacy of the method was tested using animal tissue from a local butcher shop. Formalin fixed samples, 5 mm in diameter 4 mm thick, were prepared. The two main tissue types were fat and meat (fibrous). Pure as well as composite samples consisting of a mixture of the two tissue types were analyzed. For the latter samples, ν fat for the tissue columns of interest were extracted from corresponding pixels in CCD digital x-ray images using a calibration curve. The means ν ¯ fat were then calculated for use in a WAXS fat subtraction model. For the WAXS measurements, the samples were interrogated with a 2.7 mm diameter 50 kV beam and the 6° scattered photons were detected with a CdTe detector subtending a solid angle of 7.75 × 10 −5 sr. Using the scatter spectrum, an estimate of the incident spectrum, and a scatter model, μ s was determined for the tissue in the ROI. For the composite samples, a WAXS fat subtraction model was used to estimate the μ s of the fibrous tissue in the ROI. This signal was compared to μ s of fibrous tissue obtained using a pure fibrous sample. Results: For chicken and beef composites, ν ¯ fat =0.33±0.05 and 0.32 ± 0.05, respectively. The subtractions of these fat components from the WAXS composite signals provided estimates of μ s for chicken and beef fibrous tissue. The differences between the estimates and μ s of fibrous obtained with a pure sample were calculated as a function of the momentum transfer x. A t-test showed that the mean of the differences did not vary from zero in a statistically significant way thereby



    Maria Klimikova


    Understanding the reasons of the present financial problems lies In understanding the substance of fractional reserve banking. The substance of fractional banking is in lending more money than the bankers have. Banking of partial reserves is an alternative form which links deposit banking and credit banking. Fractional banking is causing many unfavorable economic impacts in the worldwide system, specifically an inflation.

  3. A method to estimate the fractional fat volume within a ROI of a breast biopsy for WAXS applications: Animal tissue evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Robert Y., E-mail: [Biomolecular Sciences Program, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6 (Canada); McDonald, Nancy, E-mail:; Laamanen, Curtis, E-mail: [Department of Physics, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6 (Canada); LeClair, Robert J., E-mail: [Department of Physics, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6, Canada and Biomolecular Sciences Program, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6 (Canada)


    Purpose: To develop a method to estimate the mean fractional volume of fat (ν{sup ¯}{sub fat}) within a region of interest (ROI) of a tissue sample for wide-angle x-ray scatter (WAXS) applications. A scatter signal from the ROI was obtained and use of ν{sup ¯}{sub fat} in a WAXS fat subtraction model provided a way to estimate the differential linear scattering coefficient μ{sub s} of the remaining fatless tissue. Methods: The efficacy of the method was tested using animal tissue from a local butcher shop. Formalin fixed samples, 5 mm in diameter 4 mm thick, were prepared. The two main tissue types were fat and meat (fibrous). Pure as well as composite samples consisting of a mixture of the two tissue types were analyzed. For the latter samples, ν{sub fat} for the tissue columns of interest were extracted from corresponding pixels in CCD digital x-ray images using a calibration curve. The means ν{sup ¯}{sub fat} were then calculated for use in a WAXS fat subtraction model. For the WAXS measurements, the samples were interrogated with a 2.7 mm diameter 50 kV beam and the 6° scattered photons were detected with a CdTe detector subtending a solid angle of 7.75 × 10{sup −5} sr. Using the scatter spectrum, an estimate of the incident spectrum, and a scatter model, μ{sub s} was determined for the tissue in the ROI. For the composite samples, a WAXS fat subtraction model was used to estimate the μ{sub s} of the fibrous tissue in the ROI. This signal was compared to μ{sub s} of fibrous tissue obtained using a pure fibrous sample. Results: For chicken and beef composites, ν{sup ¯}{sub fat}=0.33±0.05 and 0.32 ± 0.05, respectively. The subtractions of these fat components from the WAXS composite signals provided estimates of μ{sub s} for chicken and beef fibrous tissue. The differences between the estimates and μ{sub s} of fibrous obtained with a pure sample were calculated as a function of the momentum transfer x. A t-test showed that the mean of the

  4. Semantic Cuing and the Scale Insensitivity of Recency and Contiguity (United States)

    Polyn, Sean M.; Erlikhman, Gennady; Kahana, Michael J.


    In recalling a set of previously experienced events, people exhibit striking effects of recency, contiguity, and similarity: Recent items tend to be recalled best and first, and items that were studied in neighboring positions or that are similar to one another in some other way tend to evoke one another during recall. Effects of recency and…

  5. Semantic Cuing and the Scale Insensitivity of Recency and Contiguity (United States)

    Polyn, Sean M.; Erlikhman, Gennady; Kahana, Michael J.


    In recalling a set of previously experienced events, people exhibit striking effects of recency, contiguity, and similarity: Recent items tend to be recalled best and first, and items that were studied in neighboring positions or that are similar to one another in some other way tend to evoke one another during recall. Effects of recency and contiguity have most often been investigated in tasks that require people to recall random word lists. Similarity effects have most often been studied in tasks that require people to recall categorized word lists. Here we examine recency and contiguity effects in lists composed of items drawn from 3 distinct taxonomic categories and in which items from a given category are temporally separated from one another by items from other categories, all of which are tested for recall. We find evidence for long-term recency and for long-range contiguity, bolstering support for temporally sensitive models of memory and highlighting the importance of understanding the interaction between temporal and semantic information during memory search. PMID:21299330

  6. Mapping severe fire potential across the contiguous United States (United States)

    Brett H. Davis


    The Fire Severity Mapping System (FIRESEV) project is an effort to provide critical information and tools to fire managers that enhance their ability to assess potential ecological effects of wildland fire. A major component of FIRESEV is the development of a Severe Fire Potential Map (SFPM), a geographic dataset covering the contiguous United States (CONUS) that...

  7. 27 CFR 44.261 - To contiguous foreign countries. (United States)


    ... cleared by customs from the United States, the customs authority at the port of exit shall complete the... PAPERS AND TUBES, WITHOUT PAYMENT OF TAX, OR WITH DRAWBACK OF TAX Withdrawal of Cigars From Customs... from a customs warehouse for export to a contiguous foreign country, the customs warehouse proprietor...

  8. Chemical systems, chemical contiguity and the emergence of life

    DEFF Research Database (Denmark)

    Kee, Terrence P.; Monnard, Pierre Alain


    to complex chemical systems over specific isolated functional apparatuses. We will summarize the recent advances in system chemistry and show that chemical systems in the geochemical context imply a form of chemical contiguity in the syntheses of the various molecules that precede modern biomolecules....

  9. Fractional thermoelasticity

    CERN Document Server

    Povstenko, Yuriy


    This book is devoted to fractional thermoelasticity, i.e. thermoelasticity based on the heat conduction equation with differential operators of fractional order. Readers will discover how time-fractional differential operators describe memory effects and space-fractional differential operators deal with the long-range interaction. Fractional calculus, generalized Fourier law, axisymmetric and central symmetric problems and many relevant equations are featured in the book. The latest developments in the field are included and the reader is brought up to date with current research.  The book contains a large number of figures, to show the characteristic features of temperature and stress distributions and to represent the whole spectrum of order of fractional operators.  This work presents a picture of the state-of-the-art of fractional thermoelasticity and is suitable for specialists in applied mathematics, physics, geophysics, elasticity, thermoelasticity and engineering sciences. Corresponding sections of ...

  10. The Optimal Volume Fraction in Percutaneous Vertebroplasty Evaluated by Pain Relief, Cement Dispersion, and Cement Leakage: A Prospective Cohort Study of 130 Patients with Painful Osteoporotic Vertebral Compression Fracture in the Thoracolumbar Vertebra. (United States)

    Sun, Hai-Bo; Jing, Xiao-Shan; Liu, Yu-Zeng; Qi, Ming; Wang, Xin-Kuan; Hai, Yong


    To probe the relationship among cement volume/fraction, imaging features of cement distribution, and pain relief and then to evaluate the optimal volume during percutaneous vertebroplasty. From January 2014 to January 2017, a total of 130 patients eligible for inclusion criteria were enrolled in this prospective cohort study. According to the different degrees of pain relief, cement leakage, and cement distribution, all patients were allocated to 2 groups. Clinical and radiologic characteristics were assessed to identify independent factors influencing pain relief, cement leakage, and cement distribution, including age, sex, fracture age, bone mineral density, operation time, fracture level, fracture type, modified semiquantitative severity grade, intravertebral cleft, cortical disruption in the vertebral wall, endplate disruption, type of nutrient foramen, fractured vertebral body volume, intravertebral cement volume, and volume fraction. A receiver operating characteristic curve was used to analyze the diagnostic value of the cement volume/fraction and then to obtain the optional cut-off value. The preoperative visual analog scale scores in the responders versus nonresponders patient groups were 7.37 ± 0.61 versus 7.87 ± 0.92 and the postoperative VAS scores in the responders versus nonresponders were 2.04 ± 0.61 versus 4.33 ± 0.49 at 1 week. There were no independent factors influencing pain relief. There were 95 (73.08%) patients who experienced cement leakage, and cortical disruption in the vertebral wall and cement fraction percentage were identified as independent risk factors by binary logistic regression analysis (adjusted odds ratio [OR] 2.935, 95% confidence interval [95% CI] 1.214-7.092, P = 0.017); (adjusted OR 1.134, 95% CI 1.026-1.254, P = 0.014). The area under the receiver-operating characteristic curve of volume fraction (VF%) was 0.658 (95% CI 0.549-0.768, P = 0.006 cement leakage was 21.545%, with a sensitivity of 69.50% and a

  11. Fractional charge search

    International Nuclear Information System (INIS)

    Innes, W.; Klein, S.; Perl, M.; Price, J.C.


    A device to search for fractional charge in matter is described. The sample is coupled to a low-noise amplifier by a periodically varying capacitor and the resulting signal is synchronously detected. The varying capacitor is constructed as a rapidly spinning wheel. Samples of any material in volumes of up to 0.05 ml may be searched in less than an hour

  12. Shaping of the axial power density distribution in the core to minimize the vapor volume fraction at the outlet of the VVER-1200 fuel assemblies

    Energy Technology Data Exchange (ETDEWEB)

    Savander, V. I.; Shumskiy, B. E., E-mail: [National Research Nuclear University MEPhI (Russian Federation); Pinegin, A. A. [National Research Center Kurchatov Institute (Russian Federation)


    The possibility of decreasing the vapor fraction at the VVER-1200 fuel assembly outlet by shaping the axial power density field is considered. The power density field was shaped by axial redistribution of the concentration of the burnable gadolinium poison in the Gd-containing fuel rods. The mathematical modeling of the VVER-1200 core was performed using the NOSTRA computer code.

  13. Dicty_cDB: Contig-U09720-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09720-1 gap included 1323 2 5906974 5908260 PLUS 1 2 U09720 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09720-1 Contig ID Contig-U09720-1 Contig update 2002. 9.13 Contig sequence >Contig-U09720-1 (Contig-U09720-1Q) /CSM_Contig/Contig-U09720...ATNATTATTATAAAAATTT Gap gap included Contig length 1323 Chromosome number (1..6, ...QLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLKNQREIIAQSLKIXKKL*linqxll*kf ...AEMFDIDSRNNHAIENDGRLDDA LVCSVGIALAPQSIFQSWKSMSEHKREKYFEQLEAEDIVKQSQLVRNTLLSILNKLFSNY NNSNETTATTTIGQDQEKLSTLK

  14. Dicty_cDB: Contig-U15005-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15005-1 no gap 2023 1 1509217 1507616 MINUS 2 4 U15005 0 0 0 0 1 0 1 0 0 0 0 0 0 0 Show Contig...-U15005-1 Contig ID Contig-U15005-1 Contig update 2004. 6.11 Contig sequence >Contig-U15005-1 (Contig...-U15005-1Q) /CSM_Contig/Contig-U15005-1Q.Seq.d AATTTTCTTTTCTTTTTAAAACTTAAGTACCATATGGCAGAATATACAC...ATAATAACGATATTAA Gap no gap Contig length 2023 Chromosome number (1..6, M) 1 Chro...HMAEYTHYFIQYNLTDIFYEDVNIEKYSCSICYESVYKKEIYQCKEIHWF CKTCWAESLFKKKECMICRCIVKSISELSRNRFIEQDFLNIKVNCPNSFKYIDENKNNNN KIKDLENGCKDIITIG

  15. Dicty_cDB: Contig-U07545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07545-1 no gap 439 3 4955441 4955098 MINUS 1 1 U07545 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U07545-1 Contig ID Contig-U07545-1 Contig update 2002. 5. 9 Contig sequence >Contig-U07545-1 (Contig...-U07545-1Q) /CSM_Contig/Contig-U07545-1Q.Seq.d ATATGAAATACTTAATACTTTTAATTTTCCTTTTAATAAATTCAACTTTT...ATGTTTCAGAGTCTGGTTG Gap no gap Contig length 439 Chromosome number (1..6, M) 3 Chromosome length 6358359 Sta...e MKYLILLIFLLINSTFGNIQFSKYISNSGNDNNSCGSFTSPCKTIGYSIQQIKSYEYNQY SIEILLDSGNYYSQNPINLYGLNISISAQNSNDLVQFLVPNINGT

  16. Dicty_cDB: Contig-U15359-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15359-1 no gap 1420 6 1334613 1333192 MINUS 3 3 U15359 0 1 0 0 1 0 0 0 0 1 0 0 0 0 Show Contig...-U15359-1 Contig ID Contig-U15359-1 Contig update 2004. 6.11 Contig sequence >Contig-U15359-1 (Contig...-U15359-1Q) /CSM_Contig/Contig-U15359-1Q.Seq.d TATAGCATCATTTGCAAAGTTTAGTTTAAAGAAAAAAGAGAAAGCGGAA...A AAAAAAACTGGAAAAATTAA Gap no gap Contig length 1420 Chromosome number (1..6, M) 6 Chromosome length 3595308...SSGF DEPSLAVMYVDRALKGASAVQTIGRLSRVSKGKNACYIVDFVNTRREISDAFGQYWRETC LKGETRKTVLELKLNRVLGKLSAIEPLANGRLEESVEYILRD

  17. Dicty_cDB: Contig-U09379-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09379-1 gap included 899 2 1392012 1392912 PLUS 1 2 U09379 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09379-1 Contig ID Contig-U09379-1 Contig update 2002. 9.13 Contig sequence >Contig-U09379-1 (Contig...-U09379-1Q) /CSM_Contig/Contig-U09379-1Q.Seq.d AAAAATTTTTTAAACTAAAAAATAAAAAAAATAAATAAAAAAAAA...TTTAAAAATAATAATAAAAGTGAATATTATAATATTAT AATCTTTTTGGTATAATTGAAAAAGATCAATAATATATTAAAATTTCCAA AAAAAAAAA Gap gap included Contig...VSVCRAYATETATIENKTQIMGKMSGAQGAGFVLGPGIGFLLNFCNFTIG--- ---INNK******sn*finykl***f*kikqphfknlkiiikvniiil*sfwyn

  18. Dicty_cDB: Contig-U09581-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09581-1 gap included 1235 1 2575525 2576764 PLUS 1 2 U09581 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09581-1 Contig ID Contig-U09581-1 Contig update 2002. 9.13 Contig sequence >Contig-U09581-1 (Contig-U09581-1Q) /CSM_Contig/Contig-U09581...ATCAAAATAAATTTTTGTAACATTAATAATAAATAAN Gap gap included Contig length 1235 Chromosome number (1..6, M) 1 Chro... VFD420Z ,579,1237 Translated Amino Acid sequence KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVS...ames) Frame A: KKPGVVTIKGSSFCSQPTITIGDDSCSQPILSVGNDYDSLTCNFQSNAGLSNSTLLVSII CDTIQ

  19. Dicty_cDB: Contig-U16108-1 [Dicty_cDB

    Lifescience Database Archive (English)


  20. Dicty_cDB: Contig-U04729-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04729-1 no gap 251 5 1037629 1037880 PLUS 1 1 U04729 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04729-1 Contig ID Contig-U04729-1 Contig update 2001. 8.29 Contig sequence >Contig-U04729-1 (Contig...-U04729-1Q) /CSM_Contig/Contig-U04729-1Q.Seq.d TGGATTTATAACAGAGGTTATTGTAGGTGGTAAAACTTTTAGAGGAATCG ...CATTATCTAATGGG T Gap no gap Contig length 251 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...ITEVIVGGKTFRGIVFEDLKSSNQTNNHSQNFSPNQSGTNLNNSNSNIPSSKKIKDKN ISPSSFLPTIGSTTSTSNPLSNG Translated Amino Acid seq

  1. Dicty_cDB: Contig-U06929-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06929-1 no gap 726 5 4252576 4251850 MINUS 1 1 U06929 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06929-1 Contig ID Contig-U06929-1 Contig update 2001. 8.30 Contig sequence >Contig-U06929-1 (Contig...-U06929-1Q) /CSM_Contig/Contig-U06929-1Q.Seq.d AGTTCATTCATTTAGTCGTATGATAGTATCACCATTTATAAATCCAAAAT...TAAATTAAATAAATA Gap no gap Contig length 726 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start p...PSAISNNSNNS NNNDDNRPPILGLPFLFDYKNRITRGSRFFETIHYKIVHVTSATEFGIRRISKLYGTKWQ LEIGLKHQITQSGALQCLFTHTIGQTTIFGLSFGF

  2. Dicty_cDB: Contig-U10291-1 [Dicty_cDB

    Lifescience Database Archive (English)


  3. Dicty_cDB: Contig-U15566-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15566-1 gap included 1830 4 3730704 3729599 MINUS 4 8 U15566 0 0 1 0 1 0 0 0 2 0 0 0 0 0 Show Contig...-U15566-1 Contig ID Contig-U15566-1 Contig update 2004. 6.11 Contig sequence >Contig-U15566-1 (Contig-U15566-1Q) /CSM_Contig/Contig-U1556...CAAGATCCAA TGGAATTTTAATAATAAATAAGAATAATAAAAAAAAAAAA Gap gap included Contig length 1830 Chromosome number (1...ITLTPSEDIEKKLKEI QDENLSNSEIWFAVKSYLEDNNLKEHLYNLVFHYTMPRIDEPVTIGLDHLGNVLVSNR*c tflvvvvvytfgcriephni*qerivlqf*...asilnhirvelsqnqipilkrsfdqillphfekc iieeqqiftnekqrknflsllpisykrqdrkipltpsediekklkeiqdenlsnseiwfa vksylednnlkehlynlvfhytmpridepvtig

  4. Dicty_cDB: Contig-U15828-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15828-1 gap included 1593 1 4184040 4182448 MINUS 12 19 U15828 0 0 6 0 0 0 ...0 0 2 0 4 0 0 0 Show Contig-U15828-1 Contig ID Contig-U15828-1 Contig update 2004. 6.11 Contig sequence >Contig-U15828-1 (Contig...-U15828-1Q) /CSM_Contig/Contig-U15828-1Q.Seq.d ATAAAAAAAATTAAAAAATTAAAAAAGTTATCCACCCAAGT...ACA AATATTATAACTGGTACTGCTACTGTTTCAATCCCTCAAAAAAATTTAAT TTATATTTTACCAAATTCAAATACAATTAATCAATCAACAATTACAATTA CAA Gap gap included Contig...SFNPANSDFSFSYNINTTITQPTQIYLNQDIYYPNGFTTNIITGTATVSIPQ KNLIYILPNSNTINQSTITIT own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig

  5. Dicty_cDB: Contig-U10406-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10406-1 no gap 661 4 1621526 1620875 MINUS 1 1 U10406 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U10406-1 Contig ID Contig-U10406-1 Contig update 2002. 9.13 Contig sequence >Contig-U10406-1 (Contig...-U10406-1Q) /CSM_Contig/Contig-U10406-1Q.Seq.d NNNNNNNNNNATAAGTAAAAGAGTTATTGGTCCAAGATTAGATGATGACA...TACAAATAAGTAAAGTTG ATAAAGAACAT Gap no gap Contig length 661 Chromosome number (1....cid sequence XXXISKRVIGPRLDDDNNNNDNDKFNNNNKKAIGPSRIGPTIGPSIGPSRYNTNNNDSNH NSNNDDDDDSSEEDEEDTKSEWERVRNMIENNKN

  6. Dicty_cDB: Contig-U15525-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15525-1 gap included 3361 6 202399 204109 PLUS 34 57 U15525 0 0 7 0 7 6 0 0 4 3 7 0 0 0 Show Contig...-U15525-1 Contig ID Contig-U15525-1 Contig update 2004. 6.11 Contig sequence >Contig-U15525-1 (Contig-U15525-1Q) /CSM_Contig/Contig-U15525...ATTTAATTAAATAATAATA Gap gap included Contig length 3361 Chromosome number (1..6, M) 6 Chromosome length 3595...TEATCLILSVD ETVQNNQAEQAQAGPQINNQTRQALSRVEVFKQ--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKVLCLNIELELK...lslnsiqslpqlkqlv*ssll mkpfkiiklnklklvhklitkhvklyhg*rcss--- ---LDTIGIKKESGGGLGDSQFIAGAAFKRTFFYAGFEQQPKHIKNPKV

  7. Dicty_cDB: Contig-U04334-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04334-1 no gap 399 4 3746420 3746021 MINUS 3 3 U04334 0 0 0 0 0 0 3 0 0 0 0 0 0 0 Show Contig...-U04334-1 Contig ID Contig-U04334-1 Contig update 2001. 8.29 Contig sequence >Contig-U04334-1 (Contig...-U04334-1Q) /CSM_Contig/Contig-U04334-1Q.Seq.d CAAAAAAAAAAAAGTAAAACAATAAATTATATAAAAAAAATAAAAAAAAT...CTAATTTCA AACAATATCAATAAAATGTTATATAATTACTATTAAAATGAAAAAAAAA Gap no gap Contig len...ce QKKKSKTINYIKKIKKMSIINTISKLSLSNSLKSNITIGNLNGTTVNNYTHNETSSKFTE FFYKII*qnkrwf*kvkelnkkkrkkdyiissfcklysiyfvfs

  8. Dicty_cDB: Contig-U10335-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10335-1 no gap 1353 2 2769724 2768368 MINUS 3 6 U10335 0 0 2 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U10335-1 Contig ID Contig-U10335-1 Contig update 2002. 9.13 Contig sequence >Contig-U10335-1 (Contig...-U10335-1Q) /CSM_Contig/Contig-U10335-1Q.Seq.d ATTTTTTTTCTAAATATATAAAAAATAATAATAATAATAATAATATAAT...AAACATAATAAAACAAAAGATAAAAATAAAA ACA Gap no gap Contig length 1353 Chromosome numb...SSLATNNNINNNKRITIPDNH SNNPDKLLEIQLINKIFDISKAFDGKSNNLVSSFQNCTNNNNNNNNNTDNNNNNNISNNN NNNNVPTLQPLSFNNRNNLVNGNISSSSSSNSSNNNIGSSNSNNVTIG

  9. Dicty_cDB: Contig-U13974-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13974-1 no gap 1782 1 1265322 1267105 PLUS 29 32 U13974 0 0 0 1 2 0 22 0 4 0 0 0 0 0 Show Contig...-U13974-1 Contig ID Contig-U13974-1 Contig update 2002.12.18 Contig sequence >Contig-U13974-1 (Contig...-U13974-1Q) /CSM_Contig/Contig-U13974-1Q.Seq.d AAGAGTTAAAACAAAAATAAAAAAATAAAATAAAAAAAAAAAATTAA...TAAAACAAATAA ACATTAAAATGATATTTAGGTTTTAAATTTAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig...TTRKIYVYDNQNFFPIDNQGFD VDPAKRIYLNEKKTYHNYHFCMKMNTVFTYKGYEVFNFRGDDDVWVFINNKLVIDLGGLH SPIGTSVDTMTLGLTIG

  10. Dicty_cDB: Contig-U01750-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01750-1 no gap 811 3 3337090 3336279 MINUS 2 2 U01750 1 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U01750-1 Contig ID Contig-U01750-1 Contig update 2001. 8.29 Contig sequence >Contig-U01750-1 (Contig...-U01750-1Q) /CSM_Contig/Contig-U01750-1Q.Seq.d GGAAGTTGTAATAATAAAAAAATAAAAATAAAAATAAAAAAATAAAAAAA...GAATACCAAGGTGAAAGAATTTTTCAAAAACTTCCTCAA ATCAACACAAATTTCGAAAAATTAACAATTTGGGAAAAGAAAATCGTTTC AAATCTTTATT Gap no gap Contig...crncnciwsktl*tywiyskiinpi**i*ipr *knfsktssnqhkfrkinnlgkenrfksl own update 2004. 6. 7 Homology vs CSM-cDNA Query= Contig

  11. Dicty_cDB: Contig-U09822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09822-1 gap included 1255 3 5930658 5929418 MINUS 5 6 U09822 3 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09822-1 Contig ID Contig-U09822-1 Contig update 2002. 9.13 Contig sequence >Contig-U09822-1 (Contig-U09822-1Q) /CSM_Contig/Contig-U0982...AAAAGAAAAAAAAAAAAAAAAGATTTAATTAAATAAAAAAAAA AAAAAAAAAAAAAAA Gap gap included Contig length 1255 Chromosome n...,975 est6= VSA519Z ,780,1257 Translated Amino Acid sequence QPFYLVQSMFEPIQDSSFTSIGEIISYDTIG...rfn*ikkkkkk k Frame C: QPFYLVQSMFEPIQDSSFTSIGEIISYDTIGFDGKINTAVMSSLSPSTMYFYCVGDKS

  12. Dicty_cDB: Contig-U16457-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16457-1 no gap 1065 3 996438 997502 PLUS 6 5 U16457 0 0 1 0 1 0 2 0 0 0 0 0 1 1 Show Contig...-U16457-1 Contig ID Contig-U16457-1 Contig update 2004. 6.11 Contig sequence >Contig-U16457-1 (Contig...-U16457-1Q) /CSM_Contig/Contig-U16457-1Q.Seq.d ACAATTGGTGTTGCTGCTCTATTCGGTCTTCCAGCTATGGCACGTTCCGC A...TTTAACAAGATTGGAAGAC CAAAAAGAAAAAAAA Gap no gap Contig length 1065 Chromosome numb... Translated Amino Acid sequence TIGVAALFGLPAMARSAAMSLVFLIPFMWIVFSVHYPINSVVADICMSYNNNTGSIEQQL ANYTNPIVSEIFGTC

  13. Dicty_cDB: Contig-U04768-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04768-1 no gap 762 6 2607190 2606476 MINUS 3 3 U04768 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U04768-1 Contig ID Contig-U04768-1 Contig update 2001. 8.29 Contig sequence >Contig-U04768-1 (Contig...-U04768-1Q) /CSM_Contig/Contig-U04768-1Q.Seq.d AAAGTCTTATTTGTTTAAAAAAAAAAAAAAAAAATAAAAAACTTTATTCT...AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAA Gap no gap Contig length 762 Chromosome number (1..6, M...lknf*KMVMMHDEYISPTKLQFGFMIAVAFLG TIGVMGFCQNVFDILLGVISILSIYIGMRGVWKRKKRWLFVFMWLMMGMGFLHLVSFAVV VILHHKNPTKNTVF

  14. Dicty_cDB: Contig-U12399-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12399-1 gap included 1358 3 4712677 4711450 MINUS 1 2 U12399 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12399-1 Contig ID Contig-U12399-1 Contig update 2002.12.18 Contig sequence >Contig-U12399-1 (Contig-U12399-1Q) /CSM_Contig/Contig-U1239...GAAGATGATATTAGTCTGAGGAAGATATTCTTAAAGA ATTTAACAAATGTTAACA Gap gap included Contig ...*e iekkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMH...kkklnyl*eqkvkyqknhqkimiq*enxmks*LQIYHXFAXLIGEPIPNNDXXX--- ---XXXRHVIWKLYEEITIGLKRTISITXKRESCKSHYLANCIMHVYWRL

  15. Dicty_cDB: Contig-U11883-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11883-1 gap included 599 2 1457179 1457762 PLUS 1 2 U11883 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U11883-1 Contig ID Contig-U11883-1 Contig update 2002.12.18 Contig sequence >Contig-U11883-1 (Contig...-U11883-1Q) /CSM_Contig/Contig-U11883-1Q.Seq.d TACAAAATTTATATATATATATAATATTTTTAAATAATTATATTT...ATTTAGATGTATTTGGTATTCAAACATTA ACCGAACAACAAGCCTCTACAAAATTATTAACTTTTGTCATTTCAAAATC AGGTGAAAA Gap gap included Contig...ffkixn*kikkgfhvkxksflwfkxxx--- ---xxxx******************yprkyiniti*rn*kdil*ii*rne*rergtksc* nifs*kestpl*fnsxfktniilfstvfnttnvstig

  16. Dicty_cDB: Contig-U13326-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13326-1 no gap 240 6 1728259 1728019 MINUS 1 1 U13326 0 0 0 0 0 1 0 0 0 0 0 0 0 0 Show Contig...-U13326-1 Contig ID Contig-U13326-1 Contig update 2002.12.18 Contig sequence >Contig-U13326-1 (Contig...-U13326-1Q) /CSM_Contig/Contig-U13326-1Q.Seq.d AATGACTCAACAAATCTTGGAGAGTATGCAAAATACTTTCCAATCTATGG...CCTCGTTAAAGGTGCTGGTGC TGAATTAAGTTCTCGTGCTCATGAGTGTTTCATTAGTGCCTTGGATATTG CCTCTGATTATACCTACGAGAAAATTACCATTGGCTTGGA Gap no gap Contig...FQSMDGPTIKRLATTIQYGSKDVDEQQIHSTLVKGAGAELSSRAHECF ISALDIASDYTYEKITIGL Translated Amino Acid sequence (All Fra

  17. Dicty_cDB: Contig-U15036-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15036-1 no gap 3102 - - - - 16 24 U15036 0 5 1 2 0 1 1 2 3 1 0 0 0 0 Show Contig-U15036-1 Contig... ID Contig-U15036-1 Contig update 2004. 6.11 Contig sequence >Contig-U15036-1 (Contig-U15036-1Q) /CSM_Contig.../Contig-U15036-1Q.Seq.d ATCTTTTTAAAAAAAAAAAAAATAAAACAAATAAAGAAAGAAATTAAATA AATATTAATAAT...AATTTAAAATTAATTTTTAG AT Gap no gap Contig length 3102 Chromosome number (1..6, M) - Chromosome length - Star...RKKQTDAVAEIPVD NPTSTSTTTTTTTTSNATSILSAIHTSTINSNTSSHNNNQQQQQQQQTILPTQPTIINTP TPVRSSVSRSQSPLPSGNGSSIISQEKTPLSTFVLSTCRPSALVLPPGSTIG

  18. Dicty_cDB: Contig-U16008-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16008-1 gap included 1557 5 1711154 1712676 PLUS 5 8 U16008 0 0 0 0 1 1 1 0 1 0 0 0 1 0 Show Contig...-U16008-1 Contig ID Contig-U16008-1 Contig update 2004. 6.11 Contig sequence >Contig-U16008-1 (Contig-U16008-1Q) /CSM_Contig/Contig-U16008... TAAGGTTTATGATTTTTGATTTTAGATTTTATATTTTATTTATTTTAATA AAAAAAAAAAAAAAAAA Gap gap included Contig length 1557 Ch...F LIFVHGSSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLN...SSTIIVLGIAIINFSISRIFERSKMLPAVTWIFNLIILWTCY--- ---PFGGFGARGPPSTIGYSRHTIGGMYGGHSPGPRLHLTGYLGIEPMNGKFLNIGRTFR L

  19. Dicty_cDB: Contig-U11404-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11404-1 gap included 1618 6 1729583 1727965 MINUS 11 19 U11404 0 6 1 1 0 2 ...0 1 0 0 0 0 0 0 Show Contig-U11404-1 Contig ID Contig-U11404-1 Contig update 2002.12.18 Contig sequence >Contig-U11404-1 (Contig...-U11404-1Q) /CSM_Contig/Contig-U11404-1Q.Seq.d ATTTTAAGAGTTTTAATTTTAATAACTATACTTTTAATAAA...TTTTTCTTTTGAACCAGAAAAAAAAA Gap gap included Contig length 1618 Chromosome number ...AGARMLASLATDKLSNVIYLDVSENDFGDEGVSVICDGFVGNSTIKKLILNGNFKQ SK--- ---YEKITIGLDSVFKDLILEESQAQNEASGATPIPDSPVPTRSP

  20. Dicty_cDB: Contig-U07021-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U07021-1 no gap 601 2 3862699 3862098 MINUS 1 2 U07021 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U07021-1 Contig ID Contig-U07021-1 Contig update 2001. 8.30 Contig sequence >Contig-U07021-1 (Contig...-U07021-1Q) /CSM_Contig/Contig-U07021-1Q.Seq.d AAAAAAACAAAATGAATAAATTTAATATTACATCATTATTTATTATTTTA...TTTAATATATTCAGAAGGAAATTC TTATTTACAACAAAATTTCCCATTACTTTCTTANTTAAANTCCGTTAAAA T Gap no gap Contig length 601 C...QACCRTTQLFINYADNSFLDSAGFSPFGKVISGFNNTLNFYGGYGEEPDQSLIYSE GNSYLQQNFPLLSXLXSVK own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  1. Dicty_cDB: Contig-U13680-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13680-1 no gap 822 5 2371965 2372786 PLUS 2 2 U13680 0 2 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13680-1 Contig ID Contig-U13680-1 Contig update 2002.12.18 Contig sequence >Contig-U13680-1 (Contig...-U13680-1Q) /CSM_Contig/Contig-U13680-1Q.Seq.d AAAAAGATTCTCAAGGAATTCACCGTGTTTATACTTCTTATGGTAGAACT ...GGGAATCAATGATTTAAATATCTACCAAATTCAAAAGG AAGGTGATGTCGAGTCACATTCATTACAATCACCATCGAAATTATTATTT CATGGTTCAAGAGCATCGAATT Gap no gap Contig...**sirtinkdig*kslc*snhsidk*ffsynh*twy*ntigclingt s*kw*tcfeknqylfewynqsiisrvgeikfrifhnyst*tw*rfrcclkeyh*kfgsie

  2. Dicty_cDB: Contig-U15718-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15718-1 gap included 3735 6 2645446 2642451 MINUS 153 276 U15718 0 0 0 118 ...1 0 0 20 3 10 1 0 0 0 Show Contig-U15718-1 Contig ID Contig-U15718-1 Contig update 2004. 6.11 Contig sequence >Contig...-U15718-1 (Contig-U15718-1Q) /CSM_Contig/Contig-U15718-1Q.Seq.d AAATTATTAAATTGTTTATTAATTTTTTTTTTTAC...CCTG Gap gap included Contig length 3735 Chromosome number (1..6, M) 6 Chromosome length 3595308 Start point...ptqtppptqtpt nhsigvnecdccpegqycllifghercfiandggdgipeetigcpgvttgtptstdggtg hytesgtgnphlcdrhhcrsgmechvingipecl

  3. Dicty_cDB: Contig-U15573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15573-1 gap included 2005 4 5020093 5018210 MINUS 13 13 U15573 0 5 0 1 1 0 ...0 0 0 1 1 0 2 2 Show Contig-U15573-1 Contig ID Contig-U15573-1 Contig update 2004. 6.11 Contig sequence >Contig-U15573-1 (Contig...-U15573-1Q) /CSM_Contig/Contig-U15573-1Q.Seq.d AGTCTTGAGCTTTTATTGGGTCAACCATTGGGTGAATATAC... AGCNTTAACNGGNAA Gap gap included Contig length 2005 Chromosome number (1..6, M) ...xxlfrsnxslxxxxxxsxnxx Frame C: s*afigstig*iyiylkrfhlfl*skryyqskw*fkifpilkqttiiyen

  4. Dicty_cDB: Contig-U11342-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11342-1 gap included 2051 2 611517 609465 MINUS 4 7 U11342 0 2 1 1 0 0 0 0 0 0 0 0 0 0 Show Contig...-U11342-1 Contig ID Contig-U11342-1 Contig update 2002.12.18 Contig sequence >Contig-U11342-1 (Contig...-U11342-1Q) /CSM_Contig/Contig-U11342-1Q.Seq.d GTCAACATTAACATCATCATCATCATCATCACCATCTAGTAATAA...GAATTTGGTAATTTTAAAATCACTNATTAATATATTAAACAAAATTA TAAAAATAAAA Gap gap included Contig...EFFFIDRKSLLVNFP RGSICAQILKLIGNLYGSNDIIFKINTNNVSFFDGTIGANNSTNNSNSNQPMTPQQVVIK YLNPTARWKRREISNFEYLMTLNTIAGRTYN

  5. Dicty_cDB: Contig-U11195-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11195-1 gap included 2858 2 4308456 4311316 PLUS 16 27 U11195 0 2 0 8 1 0 0... 3 0 2 0 0 0 0 Show Contig-U11195-1 Contig ID Contig-U11195-1 Contig update 2002.12.18 Contig sequence >Contig-U11195-1 (Contig...-U11195-1Q) /CSM_Contig/Contig-U11195-1Q.Seq.d AGCATTGGAACAAATCGAATTACGTGAAAAGATACCATTGTT...TATCACCTGCTCTTTATCCTTCAAATTTAAGT AATTCAACATTGGCCCAAAGAGTTACATGGATAAATAAATTATAAATAAT GTATAAAATCATTCTCTC Gap gap included Contig... EYREKIPLLDLPWGASKPWTLVDLRDDYDEDLMVRFYNELMLPNFPVKNELEPLSNFISA LSEERRESFNPHLSEVHVLLALRWPTDSSDLQPTIGAGIIFEYFSN

  6. Dicty_cDB: Contig-U13455-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13455-1 no gap 750 2 945431 946181 PLUS 2 2 U13455 0 0 0 0 0 0 1 0 0 1 0 0 0 0 Show Contig...-U13455-1 Contig ID Contig-U13455-1 Contig update 2002.12.18 Contig sequence >Contig-U13455-1 (Contig...-U13455-1Q) /CSM_Contig/Contig-U13455-1Q.Seq.d TAATTCCAACAACATCAACAAATTCAACAACAATTACAAATGCAACAACA TA...CAATAATAATAATAATAACAATAACAATAATAATAA Gap no gap Contig length 750 Chromosome number (1..6, M) 2 Chromosome l...KMLEYIQKNPSATRPSCIQVVQQPSSKVVWKNRRLDTPFKVKVDLKAASAMA GTNLTTASVITIGIVTDHKGKLQIDSVENFTEAFNGQGLAVFQGLKMTKGTWGKE

  7. Dicty_cDB: Contig-U14400-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14400-1 no gap 1939 4 4053811 4055750 PLUS 5 7 U14400 0 0 2 0 0 1 0 0 1 1 0 0 0 0 Show Contig...-U14400-1 Contig ID Contig-U14400-1 Contig update 2002.12.18 Contig sequence >Contig-U14400-1 (Contig...-U14400-1Q) /CSM_Contig/Contig-U14400-1Q.Seq.d CATTACCAATAAATTTATCTGCTTCAACACCTATACCAATGACATCACCA...AGGTTTATAAAATATATTGAATCAATTTTTGATTAAA Gap no gap Contig length 1939 Chromosome number (1..6, M) 4 Chromosome...HQQQQSKTVTSSTTSTETTTTVESSTTSTTITTSTSTPIPTTITTTPTTPI NSDNSWTFTSFSPKVFKEIRRYYGVDEEFLKSQENSSGIVKFLEVQTIGRSGSFFY

  8. Dicty_cDB: Contig-U09569-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09569-1 gap included 1424 5 3658944 3660352 PLUS 8 14 U09569 0 0 8 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09569-1 Contig ID Contig-U09569-1 Contig update 2002. 9.13 Contig sequence >Contig-U09569-1 (Contig-U09569-1Q) /CSM_Contig/Contig-U0956...TTAAAAA TAAAATAAATATAAAATAAAATAAAAATTAACAA Gap gap included Contig length 1424 Chromosome number (1..6, M) 5...NQTFQQKYYVNDQYYNYKNGGPIILYINGEGPVSSPPYSSDDGVVIYAQA LNCMIVTLEHRFYGESSPFSELTIENLQYLSHQQALEDLATFVVDFQSKLVGAGHIVTIG...YLSHQQALEDLATFVVDFQSKLVGAGHIVTIG GSYSGALSAWFRIKYPHITVGSIASLGVVHSILDFTAFDAYVSYA---

  9. Dicty_cDB: Contig-U10709-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10709-1 gap included 1228 4 757921 759149 PLUS 2 3 U10709 0 0 0 1 1 0 0 0 0 0 0 0 0 0 Show Contig...-U10709-1 Contig ID Contig-U10709-1 Contig update 2002.12.18 Contig sequence >Contig-U10709-1 (Contig...-U10709-1Q) /CSM_Contig/Contig-U10709-1Q.Seq.d ATTAGTAACACAGACATTGGTAACACGAATTTATTACCACCATCAC...ATGTTTAGGTGATAATACTCATAGTCAA Gap gap included Contig length 1228 Chromosome number (1..6, M) 4 Chromosome le...LDIFLIQIGAAIMGSNQFIQHAINIYNLEDWFEIEPFNG SLNKSTEGTPTTTSSQPPSTPSKQTSLRNSAGTVPTTPSQSSSTIVPTLDTIGETTTTTT TTATTTT

  10. Dicty_cDB: Contig-U15306-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15306-1 no gap 2452 3 3887051 3889342 PLUS 54 91 U15306 0 0 0 49 4 1 0 0 0 0 0 0 0 0 Show Contig...-U15306-1 Contig ID Contig-U15306-1 Contig update 2004. 6.11 Contig sequence >Contig-U15306-1 (Contig...-U15306-1Q) /CSM_Contig/Contig-U15306-1Q.Seq.d AAGCATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTA...TTTTAGAACTTCAAAAAATAGTAC AAATTTTTTCAAATTAAGATAAAAAAAATAAAACAAAAATTAATTTAAAA CA Gap no gap Contig length 2452...*naagtgkgeegrt*hkslpywlapqvkgsvmprggqghygasrggrkhmgidfssivg qdivapisgkvvnfkgartkypmlqlypskkftefdylqmlyvhppvginmgasyqvsvg dtig

  11. Dicty_cDB: Contig-U01791-1 [Dicty_cDB

    Lifescience Database Archive (English)


  12. Dicty_cDB: Contig-U09412-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09412-1 gap included 873 3 3953072 3953946 PLUS 1 2 U09412 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09412-1 Contig ID Contig-U09412-1 Contig update 2002. 9.13 Contig sequence >Contig-U09412-1 (Contig...-U09412-1Q) /CSM_Contig/Contig-U09412-1Q.Seq.d ATTATCACAACTATTTTATAATAAACCAATTTTAAAGATTAAAGT...TGGTTCAATAAAAGAAATTAAATATAATTATCAATAAT AATAATAAATTAATTAATAAATTTAAATCAAAA Gap gap included Contig length 873 ...DCQCGFVSVVENNNNNNNNSDNENNENNENNENNE NNEDLEDFIPRKLLKKSSSTLQSRTYLVIYLGRRGILEIWGLKHRSREYFKTIG

  13. Dicty_cDB: Contig-U10837-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10837-1 gap included 1996 2 5280203 5282199 PLUS 8 9 U10837 0 3 0 3 1 0 0 1 0 0 0 0 0 0 Show Contig...-U10837-1 Contig ID Contig-U10837-1 Contig update 2002.12.18 Contig sequence >Contig-U10837-1 (Contig-U10837-1Q) /CSM_Contig/Contig-U10837...TCNT Gap gap included Contig length 1996 Chromosome number (1..6, M) 2 Chromosome...YSSKGYFKHLDSFLSEISVP LCESVSKSSTLVFSLLFNMLEYSTADYRYPILKILTALVKCGVNPAETKSSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIG...SSRVPEWFDTV TQFLNDHKTPHYIVSQAIRFIEITSGNSPTSLITIDNASLKPSKNTIGTKKFSNKVDRGT LLAGNYFNKVLVDTVPGVRSSVNSLTKSIYSTTQI

  14. Dicty_cDB: Contig-U12357-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12357-1 gap included 1333 1 2827305 2828232 PLUS 5 6 U12357 0 1 1 2 0 0 1 0 0 0 0 0 0 0 Show Contig...-U12357-1 Contig ID Contig-U12357-1 Contig update 2002.12.18 Contig sequence >Contig-U12357-1 (Contig-U12357-1Q) /CSM_Contig/Contig-U12357...ATAAAATAAAATTTATTAATTTTCCAACT Gap gap included Contig length 1333 Chromosome numb...RYXEKKKXXXXDSXNXXXXXPXX XXLXXXXPXX--- ---QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTL...-QYEKMKLSGEKVDPTLDASIILGNRYLEKKKVTIGDSENYTITVPFSQILKNQKPLI IQRKTKGTLYYSINLSYASLNPISKAIFNRGLNIKRTYYPVSNSNDVIY

  15. Dicty_cDB: Contig-U10996-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10996-1 gap included 3017 2 5488454 5485454 MINUS 41 76 U10996 0 3 0 24 1 0... 0 8 0 5 0 0 0 0 Show Contig-U10996-1 Contig ID Contig-U10996-1 Contig update 2002.12.18 Contig sequence >Contig-U10996-1 (Contig...-U10996-1Q) /CSM_Contig/Contig-U10996-1Q.Seq.d TGGCCTACTGGTAAAAAAAATTCTAATTTTATTAAAACCC...CTATTTATAATGTATTGTTAAG GCAAAAATAAAAAAAAAAGNAAAAAAA Gap gap included Contig length...LTTTA SSSQQQQQELGLAVLTIRQGYEFENIVKELLDEKKKIEIWSMKPNSKQQWELIKKGSPGN TQMFEDVLLNGNCEGSVMMALKVTREKGSIVFGISFGDATFKTIG

  16. Dicty_cDB: Contig-U12049-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12049-1 gap included 2563 4 3071598 3069091 MINUS 9 17 U12049 0 0 0 0 2 0 0... 1 4 1 1 0 0 0 Show Contig-U12049-1 Contig ID Contig-U12049-1 Contig update 2002.12.18 Contig sequence >Contig-U12049-1 (Contig...-U12049-1Q) /CSM_Contig/Contig-U12049-1Q.Seq.d TAATGAAGGTAGTAATAATAATATAGTTGAAGCATCAAAAGA...TATCATTTAAACTGAAAAAAGTC CAAAAGATTTATGCAATGATTGCTGCGAATATGCTGCAACTTGTTCTCAT TAAAAATAAACAAAAAAATAATA Gap gap included Contig...disngqcvyseiidcgsssienss nqesssdidittastlgstiastigstigltstttttttsqttgtpttppqtvseipisl astistspvsdegtiastiatt

  17. Dicty_cDB: Contig-U01204-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01204-1 gap included 918 2 1928287 1927368 MINUS 2 3 U01204 0 0 0 0 0 2 0 0 0 0 0 0 0 0 Show Contig...-U01204-1 Contig ID Contig-U01204-1 Contig update 2001. 8.29 Contig sequence >Contig-U01204-1 (Contig-U01204-1Q) /CSM_Contig/Contig-U01204...AAAAATAATAA Gap gap included Contig length 918 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start...LAWEVFWVGTPLFVLMASAFNQIHWALAWVLMVIILQSGFMN--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQ...fgwvlhyly*whqhsikfighwhgy*w*sfynlvl*--- ---QHSHTIGNETIIIVMDSWVVDQIPDQVSWMEQVLSDNN

  18. Dicty_cDB: Contig-U14772-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14772-1 no gap 665 1 1988279 1987624 MINUS 1 1 U14772 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14772-1 Contig ID Contig-U14772-1 Contig update 2002.12.18 Contig sequence >Contig-U14772-1 (Contig...-U14772-1Q) /CSM_Contig/Contig-U14772-1Q.Seq.d AAAAACAATAACCATCGTTTTTTATTTTTATTTTCAAAATATGGATTTAA...AAATTAATGAAGAAAAAA AAGTAANNNNNNNNN Gap no gap Contig length 665 Chromosome number...DADTTISFLSSQNLSQLSIIKNLVNGKTIG DKKVIVDFYDFKKVIPTPTPIPTPTPPTKTQEESNKKIKLTNEKPKEKKP

  19. Dicty_cDB: Contig-U11141-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U11141-1 gap included 2122 2 1113359 1111236 MINUS 6 12 U11141 0 1 0 2 0 0 0... 1 0 2 0 0 0 0 Show Contig-U11141-1 Contig ID Contig-U11141-1 Contig update 2002.12.18 Contig sequence >Contig-U11141-1 (Contig...-U11141-1Q) /CSM_Contig/Contig-U11141-1Q.Seq.d AAAAAACAATCTTAAAACACACACACACTCAACACACTATCA...AAATCAAAATCAAAATCAAA ATAATAATAATTATAATAATAGCTATAATAAT Gap gap included Contig length 2122 Chromosome number ...HNYFGKVSRGIVSLSDYKYYGYLRSVHLIGYE QHEEELIKTIKSLPVGVSTLELSGHLNKIIFKEGSL--- ---DDSTIGAILNSFSSSSSRETFPRSVESLHLNI

  20. Dicty_cDB: Contig-U12765-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12765-1 no gap 1256 6 1467819 1466563 MINUS 3 3 U12765 0 0 0 2 0 0 0 0 0 0 1 0 0 0 Show Contig...-U12765-1 Contig ID Contig-U12765-1 Contig update 2002.12.18 Contig sequence >Contig-U12765-1 (Contig...-U12765-1Q) /CSM_Contig/Contig-U12765-1Q.Seq.d CAAAAAGGAAACACTAGTCCAGTTAGAACCCCAAATACTACTACTACTA...TATCGATTGTTCAAAGGTTTCAATGGTTGATACTAAT TTCTTA Gap no gap Contig length 1256 Chromosome number (1..6, M) 6 Chr...EYQEDLTPIFEPIFLDLIKIL STTTLTGNVFPYYKVFSRLVQFKAVSDLVGTLQCWNSPNFNGKEMERNTILGSLFSPSSA SDDGSTIKQYFSNASTMNKNTIGDA

  1. Dicty_cDB: Contig-U09480-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09480-1 gap included 705 5 4277527 4276817 MINUS 1 2 U09480 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09480-1 Contig ID Contig-U09480-1 Contig update 2002. 9.13 Contig sequence >Contig-U09480-1 (Contig-U09480-1Q) /CSM_Contig/Contig-U09480...AAAAAAAAAA Gap gap included Contig length 705 Chromosome number (1..6, M) 5 Chromosome length 5062330 Start ...**********imaeinienpfhvntkidvntfvnqirgipngsrcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstig...srcdftnsvvkhf sslgynvfvchpnhavtgpyaklhcefrntkfstigydvyiiargrkvtatnfgdggydn wasggh

  2. Dicty_cDB: Contig-U12043-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12043-1 gap included 1898 6 2694437 2692539 MINUS 7 13 U12043 0 6 0 0 0 0 0... 1 0 0 0 0 0 0 Show Contig-U12043-1 Contig ID Contig-U12043-1 Contig update 2002.12.18 Contig sequence >Contig-U12043-1 (Contig...-U12043-1Q) /CSM_Contig/Contig-U12043-1Q.Seq.d GAAACCATTCGTTTAAAGAAATGAAATATTTATATATATTAA...ATAAA AATAAATT Gap gap included Contig length 1898 Chromosome number (1..6, M) 6 Chromosome length 3595308 S...VPDIVSGILASKYASITLLNSGEM DLTNGITIGLLENSTSDQLFQINPILNTSLTNILVGQRFSIPFEISIKDSTISNQL

  3. Dicty_cDB: Contig-U13202-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13202-1 no gap 1083 4 1301578 1302630 PLUS 41 45 U13202 8 0 13 0 0 2 16 0 2 0 0 0 0 0 Show Contig...-U13202-1 Contig ID Contig-U13202-1 Contig update 2002.12.18 Contig sequence >Contig-U13202-1 (Contig...-U13202-1Q) /CSM_Contig/Contig-U13202-1Q.Seq.d ACTGTTGGCCTACTGGGATTTTCTGCAGTAATAATAAAATCAAATA...TTTGTAATTTTAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap no gap Contig len...kvgqfirvprgaqpaqtskftlmih*gvkshffsmlqpnwpncttigpvq nqarcgsllgfwvlqnqlltvlcihnnekcsikfygygyl**nlitvvkvvmpslhg

  4. Dicty_cDB: Contig-U15062-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15062-1 no gap 1282 3 4759691 4758480 MINUS 5 6 U15062 0 0 0 0 0 0 1 0 1 1 1 0 1 0 Show Contig...-U15062-1 Contig ID Contig-U15062-1 Contig update 2004. 6.11 Contig sequence >Contig-U15062-1 (Contig...-U15062-1Q) /CSM_Contig/Contig-U15062-1Q.Seq.d CAAATATTTAAATAAATTTAACATTATAAAAACAAAAATTAATAAAGTA...TTTTCAATAGATAATAATAAAAAAAAAAAAAAAAAAA AAAAAAAAATTATTTTAAAAATAAAAAAAAAA Gap no gap Contig length 1282 Chromos...KMSHNHNSNNNKTTTTTTNDSGSAIANGINLEKILADVKECN YNLVNSITATEAIQKEKESLENELSTKGTIGDGKRIKKLQYNISLQTETLMKTLMKLDSL SITG

  5. Dicty_cDB: Contig-U16467-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16467-1 no gap 1261 2 7818565 7817305 MINUS 17 18 U16467 0 0 5 0 1 2 1 0 6 0 0 1 1 0 Show Contig...-U16467-1 Contig ID Contig-U16467-1 Contig update 2004. 6.11 Contig sequence >Contig-U16467-1 (Contig...-U16467-1Q) /CSM_Contig/Contig-U16467-1Q.Seq.d CAACAATTAACATTACTTAAATATAATATTATTATATTTTTTTTTTT...TTCAAATAAATAATTGTTTAGAAATTTCTAGAAAAAAAA AAAAAAAAAAA Gap no gap Contig length 1261 Chromosome number (1..6, M...LK833Z ,1005,1249 Translated Amino Acid sequence qqltllkyniiiffffyllplhlyhy**LKKKTLTIIKYFFQKMNKIALLFTIFFALFAI SFACDEFNPNTSTIG

  6. Dicty_cDB: Contig-U09345-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09345-1 gap included 1216 4 3361857 3360637 MINUS 4 5 U09345 1 0 1 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U09345-1 Contig ID Contig-U09345-1 Contig update 2002. 9.13 Contig sequence >Contig-U09345-1 (Contig-U09345-1Q) /CSM_Contig/Contig-U0934...AATGGTATTTTAAAAATAA Gap gap included Contig length 1216 Chromosome number (1..6, M) 4 Chromosome length 5430...ALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPITQKGYAYTGFEQTSS QSISDFIYSHSKI...LLALFTSSNPKYGCSGCVQLKNQIESFSLSYEPYL NSAGFLEKPIFIVILEVDYNMEVFQTIGLNTIPHLLFIPSGSKPI

  7. Dicty_cDB: Contig-U09432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09432-1 gap included 993 5 741953 740957 MINUS 1 2 U09432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U09432-1 Contig ID Contig-U09432-1 Contig update 2002. 9.13 Contig sequence >Contig-U09432-1 (Contig...-U09432-1Q) /CSM_Contig/Contig-U09432-1Q.Seq.d AGGAAATATTTTAATATTTTATTTTTTTTATTTTTTTTATTTATTA...TTTTGGTGGTAAATATAGATATGAAAATAAA CAAATCCAAATTTTAGTTGAATTAAATTTCACTGATACCACTCAAAAAAA AAA Gap gap included Contig...iy*sni*SVKFGICYNYAKYHLSICNHTIYPGSDNQSLYFKLSSIFDS PTILSGYAVIYNSLDQIITNGTYNLILDEDVPTIG

  8. Dicty_cDB: Contig-U15323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15323-1 no gap 1230 2 3760829 3759661 MINUS 76 108 U15323 2 0 21 0 9 4 0 0 22 4 13 0 1 0 Show Contig...-U15323-1 Contig ID Contig-U15323-1 Contig update 2004. 6.11 Contig sequence >Contig-U15323-1 (Contig-U15323-1Q) /CSM_Contig/Contig-U1532...TAAAATTTAAGCAATCATTCCAT Gap no gap Contig length 1230 Chromosome number (1..6, M) 2 Chromosome length 846757...VGLLVFFNILYCTPLYYILFFFKMNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQKMADG...MNSKFADELIATAKAIVAPGKGILAADESTNTIGAR FKKINLENNEENRRAYRELLIGTGNGVNEFIGGIILYEETLYQK

  9. Dicty_cDB: Contig-U14236-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14236-1 no gap 660 2 5626866 5627517 PLUS 1 1 U14236 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U14236-1 Contig ID Contig-U14236-1 Contig update 2002.12.18 Contig sequence >Contig-U14236-1 (Contig...-U14236-1Q) /CSM_Contig/Contig-U14236-1Q.Seq.d NNNNNNNNNNGAAAATCAAAAATTAAAAAGTAACATTACTCTATTATATG ...CAATCACTCCAATTAAA CCATAGTTTT Gap no gap Contig length 660 Chromosome number (1..6...MGSEKSPFNLKQYPSLVKIDDVS QCPKYKCLKRKSLNEWTIGLNIPAFCRESRYDCSLCYKYIECSFSDEF*tnlsalfv

  10. Dicty_cDB: Contig-U06822-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06822-1 no gap 468 3 438742 439211 PLUS 1 1 U06822 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06822-1 Contig ID Contig-U06822-1 Contig update 2001. 8.30 Contig sequence >Contig-U06822-1 (Contig...-U06822-1Q) /CSM_Contig/Contig-U06822-1Q.Seq.d ATATTATTCTATTCACTCGTAATAATACATATAAATTGATATCAATCAGA AA...TGCTATTAAGACTTTGGAGCAAAAAAC TAACAAATCAATTCAAAA Gap no gap Contig length 468 Chromosome number (1..6, M) 3 Ch...*mmlklkeikllvllrlwskkltnqfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06822-1 (Contig-U06822-1Q) /CSM_Contig/Contig

  11. Dicty_cDB: Contig-U13065-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13065-1 no gap 718 1 3561021 3561729 PLUS 1 1 U13065 0 0 0 0 0 0 0 0 0 1 0 0 0 0 Show Contig...-U13065-1 Contig ID Contig-U13065-1 Contig update 2002.12.18 Contig sequence >Contig-U13065-1 (Contig...-U13065-1Q) /CSM_Contig/Contig-U13065-1Q.Seq.d NNNNNNNNNNCAATCAAAGCAATCAATGGTAAATTAACTTTGTTACCATT ...TGATTCAACTCTCTCTG TTTCAAATTTACAACTTGCTTTAGATGAATCCTTTGAAGTTGATTTTGTA TTATATTAAAAATTATCA Gap no gap Contig...kny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13065-1 (Contig-U13065-1Q) /CSM_Contig

  12. Dicty_cDB: Contig-U08861-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U08861-1 gap included 1295 5 2877914 2879217 PLUS 1 2 U08861 0 0 0 0 1 0 0 0 0 0 0 0 0 0 Show Contig...-U08861-1 Contig ID Contig-U08861-1 Contig update 2002. 9.13 Contig sequence >Contig-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861...CACATTATAAAGTACCAAATAAGTTATTAATTTTAGAAAATA AATTCCAAAGAATGCAATGTCTAAAGTTAATAAAAAAGAATACTAAAATA TTTTC Gap gap included Contig...k**iwsryccnhcl*kkqkttnef*r i*nql*tkistl*stk*vinfrk*ipknamskvnkkey*nif own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U08861-1 (Contig-U08861-1Q) /CSM_Contig/Contig-U08861-1Q.Seq.d (1305 letters) Database: C

  13. Dicty_cDB: Contig-U15058-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15058-1 no gap 1987 4 4423139 4424727 PLUS 2 4 U15058 0 0 0 0 0 0 0 0 1 0 1 0 0 0 Show Contig...-U15058-1 Contig ID Contig-U15058-1 Contig update 2004. 6.11 Contig sequence >Contig-U15058-1 (Contig...-U15058-1Q) /CSM_Contig/Contig-U15058-1Q.Seq.d AAAAAAGGTTACTCACAAAGTTAAAGAAATCAATGAAAGATTTACCACCC...ACTCAAGGGGGTAGGAGAATAAAATCAACCGATTATCCAGGCNTTAAG CGACCTTTTTCCCAAAAAAAAAAGATGTTCAGAAAAT Gap no gap Contig len...srx*atffpkkkdvq k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15058-1 (Contig-U15058-1Q) /CSM_Contig/Contig

  14. Dicty_cDB: Contig-U06829-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06829-1 no gap 449 5 4394444 4394893 PLUS 1 1 U06829 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06829-1 Contig ID Contig-U06829-1 Contig update 2001. 8.30 Contig sequence >Contig-U06829-1 (Contig...-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d GTAAAAGAATGTAATGAAAATGAAAAAATTAATTTTATAATAAAATTATT ...ATGATTTAGAATTGGTACAATTAGTTTA Gap no gap Contig length 449 Chromosome number (1..6, M) 5 Chromosome length 50...04. 6.10 Homology vs CSM-cDNA Query= Contig-U06829-1 (Contig-U06829-1Q) /CSM_Contig/Contig-U06829-1Q.Seq.d (

  15. Dicty_cDB: Contig-U01997-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U01997-1 gap included 886 2 1683026 1682230 MINUS 3 4 U01997 1 0 0 0 0 0 2 0 0 0 0 0 0 0 Show Contig...-U01997-1 Contig ID Contig-U01997-1 Contig update 2001. 8.29 Contig sequence >Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig/Contig-U01997...ATTGAAATAATATTTATTTATTTTTTTAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA Gap gap included Contig...nfkvfgieiifiyffkkkkkkkkkkkkkkkkkkk own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U01997-1 (Contig-U01997-1Q) /CSM_Contig.../Contig-U01997-1Q.Seq.d (896 letters) Database: CSM 6905 sequences; 5,674,871 total l

  16. Dicty_cDB: Contig-U09640-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09640-1 gap included 1368 2 219988 218635 MINUS 4 5 U09640 0 0 2 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U09640-1 Contig ID Contig-U09640-1 Contig update 2002. 9.13 Contig sequence >Contig-U09640-1 (Contig...-U09640-1Q) /CSM_Contig/Contig-U09640-1Q.Seq.d ACTGTTGGCCTACTGGNAAAAAATAGTGTAATAATAACCAACAAT...AACAACAACAACAAAAACAAAAACAAATTTTAATT AAATAAAATAATAATATAAAATATAATA Gap gap included Contig...ate 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U09640-1 (Contig-U09640-1Q) /CSM_Contig/Contig

  17. Dicty_cDB: Contig-U14745-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U14745-1 no gap 1780 6 3063854 3065579 PLUS 2 4 U14745 1 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U14745-1 Contig ID Contig-U14745-1 Contig update 2002.12.18 Contig sequence >Contig-U14745-1 (Contig...-U14745-1Q) /CSM_Contig/Contig-U14745-1Q.Seq.d GCGTCCGGACAATTTCAATAAAACAAATTTAAAAATAAATAATTTTTAAT...AATAAAATA ATTTAAATAAAAAAATATTTATTTTATTTTAAGATTAACAAAATAAAATA ATTTAAATAAAAAAATATTTATTTTAAAGA Gap no gap Contig...k*kniyfk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14745-1 (Contig-U14745-1Q) /CSM_Contig/Contig

  18. Dicty_cDB: Contig-U13254-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13254-1 no gap 575 5 203798 203233 MINUS 1 1 U13254 0 0 0 0 0 0 0 1 0 0 0 0 0 0 Show Contig...-U13254-1 Contig ID Contig-U13254-1 Contig update 2002.12.18 Contig sequence >Contig-U13254-1 (Contig...-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d AAATAATTTATTTAATTTTAAAATTAATAGATAAAAAGATGGAAATGATA A...CATTTTAACATTATTGGATAAT GTCAATGATTGGCCAANNNNNNNNN Gap no gap Contig length 575 Chromosome number (1..6, M) 5 ...2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13254-1 (Contig-U13254-1Q) /CSM_Contig/Contig-U13254-1Q.Seq.d

  19. Dicty_cDB: Contig-U03367-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03367-1 no gap 323 - - - - 2 1 U03367 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig-U03367-1 Contig... ID Contig-U03367-1 Contig update 2001. 8.29 Contig sequence >Contig-U03367-1 (Contig-U03367-1Q) /CSM_Contig/Contig...TTGCGGGTTGGCAGGACTGTNGGNAGGCATGGNCATCGGTATNNTTGGAG ATGCTNGTGTGAGGGCGAATGCT Gap no gap Contig length 323 Chro...HLXXGLXCGLAGLXXGMXIGXXGDAXVRANA own update 2004. 6. 9 Homology vs CSM-cDNA Query= Contig-U03367-1 (Contig...-U03367-1Q) /CSM_Contig/Contig-U03367-1Q.Seq.d (323 letters) Database: CSM 6905 sequ

  20. Dicty_cDB: Contig-U13891-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13891-1 no gap 1355 6 799802 798446 MINUS 4 4 U13891 0 0 0 0 1 1 1 0 0 0 1 0 0 0 Show Contig...-U13891-1 Contig ID Contig-U13891-1 Contig update 2002.12.18 Contig sequence >Contig-U13891-1 (Contig...-U13891-1Q) /CSM_Contig/Contig-U13891-1Q.Seq.d TTTTAAAATATTTCAAAATTAGCGAGCACGCATTCGCATATAAATATATT ...ACAAATAAAAAAAAAAAATAAAAAAAATA ATTTA Gap no gap Contig length 1355 Chromosome numb...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13891-1 (Contig-U13891-1Q) /CSM_Contig/Contig-U138

  1. Dicty_cDB: Contig-U16093-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16093-1 gap included 1020 2 4899973 4899063 MINUS 29 31 U16093 7 0 0 0 0 2 ...18 0 0 0 0 0 2 0 Show Contig-U16093-1 Contig ID Contig-U16093-1 Contig update 2004. 6.11 Contig sequence >Contig-U16093-1 (Contig...-U16093-1Q) /CSM_Contig/Contig-U16093-1Q.Seq.d TTTTTTTTTTTTTTTTTAATTTTTTTTTTTCATAAAACTT...AAAATTAAATT Gap gap included Contig length 1020 Chromosome number (1..6, M) 2 Chr...pdate 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16093-1 (Contig-U16093-1Q) /CSM_Contig/Contig-U16093-1Q

  2. Dicty_cDB: Contig-U12073-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12073-1 gap included 912 2 2118980 2119867 PLUS 4 5 U12073 0 0 0 2 0 0 0 1 0 1 0 0 0 0 Show Contig...-U12073-1 Contig ID Contig-U12073-1 Contig update 2002.12.18 Contig sequence >Contig-U12073-1 (Contig...-U12073-1Q) /CSM_Contig/Contig-U12073-1Q.Seq.d CTGTTGGCCTACTGGNAATTGAAACAATTGTTTCAGCAAATATTA...AAGA Gap gap included Contig length 912 Chromosome number (1..6, M) 2 Chromosome length 8467578 Start point ...GPXSXDY*r own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U12073-1 (Contig-U12073-1Q) /CSM_Contig/Contig

  3. Dicty_cDB: Contig-U16086-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U16086-1 gap included 1018 - - - - 3 4 U16086 0 0 0 0 0 1 1 0 0 0 1 0 0 0 Show Contig-U16086-1 Contig... ID Contig-U16086-1 Contig update 2004. 6.11 Contig sequence >Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig.../Contig-U16086-1Q.Seq.d AATTTGATGAAGTAGTAGTAGAGGTAAAACATGTATCAAAACATTATAAG ATTGCAGG...ACTTGGATATAAATGAAG GTAGCTCATCAAATTTTTCAAATAATGATAATTTTAAATCGGTAGATCAA ATTACCAATGACCTTAGCCGTATTTTAT Gap gap included Contig...KSVDQI TNDLSRIL own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U16086-1 (Contig-U16086-1Q) /CSM_Contig/Contig

  4. Dicty_cDB: Contig-U06384-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06384-1 no gap 660 5 3008439 3007779 MINUS 2 2 U06384 2 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06384-1 Contig ID Contig-U06384-1 Contig update 2001. 8.30 Contig sequence >Contig-U06384-1 (Contig...-U06384-1Q) /CSM_Contig/Contig-U06384-1Q.Seq.d TGAAAAAATTAGAGACAACAAGTGGATCAGCACGTAAAGTATGGCGTTTA...AAATAAAAATTAATTTCC AAAAATAAAA Gap no gap Contig length 660 Chromosome number (1.....own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06384-1 (Contig-U06384-1Q) /CSM_Contig/Contig-U063

  5. Dicty_cDB: Contig-U13737-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13737-1 no gap 672 6 1762420 1761754 MINUS 1 1 U13737 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U13737-1 Contig ID Contig-U13737-1 Contig update 2002.12.18 Contig sequence >Contig-U13737-1 (Contig...-U13737-1Q) /CSM_Contig/Contig-U13737-1Q.Seq.d NNNNNNNNNNAAAATTAGAAAATGGTACAATTGTTTTTAGAGATATTTCA...AGAATAGAAGGAAAATAT AGATCAATGGGGTGGCACAACA Gap no gap Contig length 672 Chromosome...gwhn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13737-1 (Contig-U13737-1Q) /CSM_Contig/Contig

  6. Dicty_cDB: Contig-U06307-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U06307-1 no gap 637 6 29174 29801 PLUS 4 5 U06307 4 0 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U06307-1 Contig ID Contig-U06307-1 Contig update 2002. 9.13 Contig sequence >Contig-U06307-1 (Contig...-U06307-1Q) /CSM_Contig/Contig-U06307-1Q.Seq.d CCCGCGTCCGAATGCCTCGTATTTTACACACTATGCTCCGTGTGGGTAAT TTAG...ATAGTATTTTTATTTTATT CTTTTTCTTTTAAAAATTTTTTATATTGTCAACAATATAATCAAATAAAT GTATTTAATTATCGGGTATTAAAAAAAAAAAAAAAAA Gap no gap Contig...own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U06307-1 (Contig-U06307-1Q) /CSM_Contig/Contig-U063

  7. Dicty_cDB: Contig-U12545-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12545-1 gap included 1165 3 3275272 3276395 PLUS 1 2 U12545 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12545-1 Contig ID Contig-U12545-1 Contig update 2002.12.18 Contig sequence >Contig-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545...CGTTCTAAATCACTCATTAAAAGATTAAAAATTAAANAAGGTAATATC TCACGACNGCTNNCTCATACACACN Gap gap included Contig length 11...vliknlskrkerkis*klyqlkriqlsl vknwlklvlnhslkd*klxkvishdxxliht own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig...-U12545-1 (Contig-U12545-1Q) /CSM_Contig/Contig-U12545-1Q.Seq.d (1175 letters) Database: CSM 6905 s

  8. Dicty_cDB: Contig-U09615-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U09615-1 gap included 1134 3 4459395 4458259 MINUS 1 2 U09615 0 0 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U09615-1 Contig ID Contig-U09615-1 Contig update 2002. 9.13 Contig sequence >Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U0961...TGCAAGATTAGAAAGATTAGAAAAAGATGCTATGCTAAAAATA Gap gap included Contig length 1134 Chromosome number (1..6, M) ...*wcnlyfrcre*emgkcn iefhiintrfkiwphrcidtighnvgicw**fnfecsfisleiqyrv**mgirfkyw*ww s*c*irpyfnnhafqyydyiwwskfwh*...4. 6.10 Homology vs CSM-cDNA Query= Contig-U09615-1 (Contig-U09615-1Q) /CSM_Contig/Contig-U09615-1Q.Seq.d (1

  9. Dicty_cDB: Contig-U10823-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U10823-1 gap included 1750 1 3559501 3561234 PLUS 85 124 U10823 0 5 0 30 1 0... 0 20 0 29 0 0 0 0 Show Contig-U10823-1 Contig ID Contig-U10823-1 Contig update 2002.12.18 Contig sequence >Contig-U10823-1 (Contig...-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d ACTGTTGGCCTACTGGTATTTTTGGTAGTGTGTTAAAA...CAACAAATAAAATTAAAATTA GTTATATTTTTTTTAAATTAAAAAAAAAAATAAAAAAAATAAATTATTTA TTAAATTTTT Gap gap included Contig ...4. 6.10 Homology vs CSM-cDNA Query= Contig-U10823-1 (Contig-U10823-1Q) /CSM_Contig/Contig-U10823-1Q.Seq.d (1

  10. Dicty_cDB: Contig-U15541-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15541-1 gap included 2750 - - - - 634 1127 U15541 1 129 1 375 19 0 2 32 4 69 1 0 1 0 Show Contig...-U15541-1 Contig ID Contig-U15541-1 Contig update 2004. 6.11 Contig sequence >Contig-U15541-1 (Contig...-U15541-1Q) /CSM_Contig/Contig-U15541-1Q.Seq.d ATAATAAACGGTGAATACCTCGACTCCTAAATCGATGAAGACCGTAG...AAAAAT AAAAATAAAAATAAATAAATAATCATTTCATATTAATATTTTTTTTTATT TTTAAAAAAA Gap gap included Contig...ffyf*k own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15541-1 (Contig-U15541-1Q) /CSM_Contig/Contig

  11. The magnitude and course of exercise-induced stroke volume changes determine the exercise tolerance in heart transplant recipients with heart failure and normal ejection fraction

    Czech Academy of Sciences Publication Activity Database

    Meluzín, J.; Hude, P.; Leinveber, P.; Jurák, Pavel; Soukup, L.; Viščor, Ivo; Špinarová, L.; Štěpánová, R.; Podroužková, H.; Vondra, Vlastimil; Langer, P.; Němec, P.


    Roč. 20, č. 1 (2014), s. 674-687 ISSN 1205-6626 R&D Projects: GA MŠk(CZ) LO1212 Keywords : heart failure * stroke volume index * exercise tolerance * bioimpedance Subject RIV: FA - Cardiovascular Diseases incl. Cardiotharic Surgery Impact factor: 0.758, year: 2013

  12. Mean nuclear volume

    DEFF Research Database (Denmark)

    Mogensen, O.; Sørensen, Flemming Brandt; Bichel, P.


    We evaluated the following nine parameters with respect to their prognostic value in females with endometrial cancer: four stereologic parameters [mean nuclear volume (MNV), nuclear volume fraction, nuclear index and mitotic index], the immunohistochemical expression of cancer antigen (CA125...

  13. Fractional charges

    International Nuclear Information System (INIS)

    Saminadayar, L.


    20 years ago fractional charges were imagined to explain values of conductivity in some materials. Recent experiments have proved the existence of charges whose value is the third of the electron charge. This article presents the experimental facts that have led theorists to predict the existence of fractional charges from the motion of quasi-particles in a linear chain of poly-acetylene to the quantum Hall effect. According to the latest theories, fractional charges are neither bosons nor fermions but anyons, they are submitted to an exclusive principle that is less stringent than that for fermions. (A.C.)

  14. Fractional fermions

    International Nuclear Information System (INIS)

    Jackiw, R.; Massachusetts Inst. of Tech., Cambridge; Massachusetts Inst. of Tech., Cambridge


    The theory of fermion fractionization due to topologically generated fermion ground states is presented. Applications to one-dimensional conductors, to the MIT bag, and to the Hall effect are reviewed. (author)

  15. Dicty_cDB: Contig-U04432-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U04432-1 no gap 600 1 1520578 1521098 PLUS 1 1 U04432 0 0 0 0 0 0 1 0 0 0 0 0 0 0 Show Contig...-U04432-1 Contig ID Contig-U04432-1 Contig update 2001. 8.29 Contig sequence >Contig-U04432-1 (Contig...-U04432-1Q) /CSM_Contig/Contig-U04432-1Q.Seq.d AATTATAATCAAAACAAATTAATAAAAAAAATGATTAATAGTTTTGTCTC ...TCAACAATATGAAATTGCAAGAT TAAATGGTTATGATAATGCCCATAATTTACCAAGAGATATTAGTCAAATA Gap no gap Contig length 600**fkgrnsnknyfsrymgtiessti*n ckikwl**cp*ftkry*sn own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U04432-1 (Contig

  16. Dicty_cDB: Contig-U13894-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U13894-1 no gap 1550 2 2081463 2079913 MINUS 30 31 U13894 1 0 15 0 9 1 1 0 1 1 1 0 0 0 Show Contig...-U13894-1 Contig ID Contig-U13894-1 Contig update 2002.12.18 Contig sequence >Contig-U13894-1 (Contig...-U13894-1Q) /CSM_Contig/Contig-U13894-1Q.Seq.d CTTTTTGATTGTATAATTGAAAAAAAAAAAAAAAAAAAAAAAAAAA...TAAATTAAATAATTAAAAAAAACAAAAAAATTAAGTGAAAATCAAAAAA Gap no gap Contig length 1550 Chromosome number (1..6, M) ...V*kkkkikk*k*sk*fklnn*kkqkn*vkikk own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U13894-1 (Contig

  17. Dicty_cDB: Contig-U15462-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15462-1 no gap 546 4 3384206 3383661 MINUS 2 2 U15462 0 0 2 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U15462-1 Contig ID Contig-U15462-1 Contig update 2004. 6.11 Contig sequence >Contig-U15462-1 (Contig...-U15462-1Q) /CSM_Contig/Contig-U15462-1Q.Seq.d CTTTAGATTGGGGNTCAAGAAAAATATTGAAGTATTTGGTGGTGATAAGA...ATTCGATTCACTATCTTATA Gap no gap Contig length 546 Chromosome number (1..6, M) 4 Chromosome length 5430582 St...VMKLGFEVKDLITNDPKCDLFDSLS Y own update 2004. 6.23 Homology vs CSM-cDNA Query= Contig-U15462-1 (Contig

  18. Study of the influence of volume fraction of ceramic inclusions in NiCr-TiC composite with columnar structure on its mechanical behavior (United States)

    Eremina, Galina M.; Smolin, Alexey Yu.; Shilko, Evgeny V.


    Metal-ceramic materials are characterized by high mechanical and tribological properties. The surface treatment of the composite by an electron beam in inert gas plasma leads to a qualitative and quantitative change in its microstructure as well as to a change in mechanical properties of the components: a columnar structure forms in the modified layer. Different treatment regimes result in different concentrations of inclusions in the surface layer. In this paper, the effect of the volume concentration of inclusions on the integral mechanical properties of a dispersion-strengthened NiCr-TiC composite is studied on the basis of 3D numerical simulation. The results of computer simulation show that the change in concentration significantly affects the integral mechanical characteristics of the composite material as well as the nature of the nucleation and development of damages in it.

  19. 46 CFR 154.182 - Contiguous hull structure: Production weld test. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Production weld test. 154.182... Equipment Hull Structure § 154.182 Contiguous hull structure: Production weld test. If a portion of the contiguous hull structure is designed for a temperature colder than −34 °C (−30 °F) and is not part of the...

  20. Method for the detection of flaws in a tube proximate a contiguous member

    International Nuclear Information System (INIS)

    Holt, A.E.; Wehrmeister, A.E.; Whaley, H.L.


    A method for deriving the eddy current signature of a flaw in a tube proximate a contiguous member which is obscured in a composite signature of the flaw and contiguous member comprises subtracting from the composite signature a reference eddy current signature generated by scanning a reference or facsimile tube and contiguous member. The method is particularly applicable to detecting flaws in the tubes of heat exchangers of fossil fuel and nuclear power plants to enable the detection of flaws which would otherwise be obscured by contiguous members such as support plates supporting the tubes. (U.K.)

  1. Mystery Fractions (United States)

    Bhattacharyya, Sonalee; Namakshi, Nama; Zunker, Christina; Warshauer, Hiroko K.; Warshauer, Max


    Making math more engaging for students is a challenge that every teacher faces on a daily basis. These authors write that they are constantly searching for rich problem-solving tasks that cover the necessary content, develop critical-thinking skills, and engage student interest. The Mystery Fraction activity provided here focuses on a key number…

  2. Real-time three-dimensional echocardiographic left ventricular ejection fraction and volumes assessment: comparison with cardiac computed tomography; Comparacao entre a afericao da fracao de ejecao e dos volumes do ventriculo esquerdo, medidos com ecocardiografia tridimensional em tempo real e com tomografia computadorizada ultra-rapida

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Marcelo L.C.; Nomura, Cesar H.; Tranchesi Junior, Bernardino; Oliveira, Wercules A. de; Naccarato, Gustavo; Serpa, Bruna S.; Cury, Alexandre; Passos, Rodrigo B.D.; Nobrega, Marcel V. da; Funari, Marcelo B.G.; Pfefermam, Abhaham; Makdisse, Marcia; Fischer, Claudio H.; Morhy, Samira S., E-mail: [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil)


    Background and objective: Few studies addressed the comparison between real-time 3D echocardiography (RT3DE) and cardiac computed tomography (CCT) concerning left ventricular ejection fraction and volumes assessment. We sought to compare both techniques regarding left ventricle (LV) ejection fraction function and volumes analysis. Methods: we studied by RT3DE (Philips IE 33, And, MA, USA) and by CCT (Toshiba, 64-slice, Otawara, Japan) 41 consecutive patients (29 males, 58 ± 11 yrs). We analysed by both techniques LVEF, LVEDV, LVESV. RT3DE and CCT data were compared by coefficients of determination (r: Pearson), Bland and Altman test and linear regression, 95% CI. Results: RT3DE data: LVEF ranged from 56.7 to 78.9 % (65.3 + 5.7 ); LVEDV ranged from 49.6 to 178.2 (88 + 27.5) mL; LVESV from 11.4 to 78 ( 33.9 + 13.7) mL. CCT data: LVEF ranged from 53 to 86 % (67.3 + 7.9 ); LVEDV ranged from 51 to 186 (106.4 + 30.7) mL; LVESV from 7 to 72 ( 35.1 + 13.8) mL. Correlations relative to RT3DE and CCT were: LVEF (r: 0. 7877, p<0.0001, 95 % CI 0.6327 to 0.8853 ); LVEDV (r:0.7671, p<0.0001, 95 % CI 0.5974 to 0.8745); LVESV (r: 0.8121, p<0.0001, 95 % CI 0.6659 to 0.8957). Conclusions: it was observed adequate correlation between real-time 3D echocardiography and cardiac computed tomography concerning ejection fraction and volumes assessment. (author)

  3. An 'attachment kinetics-based' volume of fraction method for organic crystallization: a fluid-dynamic approach to macromolecular-crystal engineering

    International Nuclear Information System (INIS)

    Lappa, Marcello


    This analysis exhibits a strong interdisciplinary nature and deals with advances in protein (crystal) engineering models and computational methods as well as with novel results on the relative importance of 'controlling forces' in macromolecular crystal growth. The attention is focused in particular on microgravity fluid-dynamic aspects. From a numerical point of view, the growing crystal gives rise to a moving boundary problem. A 'kinetic-coefficient-based' volume tracking method is specifically and carefully developed according to the complex properties and mechanisms of macromolecular protein crystal growth taking into account the possibility of anisotropic (faceted) surface-orientation-dependent growth. The method is used to shed some light on the interplay of surface attachment kinetics and mass transport (diffusive or convective) in liquid phase and on several mechanisms still poorly understood. It is shown that the size of a growing crystal plays a 'critical role' in the relative importance of surface effects and in determining the intensity of convection. Convective effects, in turn, are found to impact growth rates, macroscopic structures of precipitates, particle size and morphology as well as the mechanisms driving growth. The paper introduces a novel computational method (that simulates the growth due to the slow addition of solute molecules to a lattice and can handle the shape of organic growing crystals under the influence of natural convection) and, at the same time, represents a quite exhaustive attempt to help organic crystal growers to discern the complex interrelations among the various parameters under one's control (that are not independent of one another) and to elaborate rational guidelines relating to physical factors that can influence the probability of success in crystallizing protein substances

  4. Method for prefetching non-contiguous data structures (United States)

    Blumrich, Matthias A [Ridgefield, CT; Chen, Dong [Croton On Hudson, NY; Coteus, Paul W [Yorktown Heights, NY; Gara, Alan G [Mount Kisco, NY; Giampapa, Mark E [Irvington, NY; Heidelberger, Philip [Cortlandt Manor, NY; Hoenicke, Dirk [Ossining, NY; Ohmacht, Martin [Brewster, NY; Steinmacher-Burow, Burkhard D [Mount Kisco, NY; Takken, Todd E [Mount Kisco, NY; Vranas, Pavlos M [Bedford Hills, NY


    A low latency memory system access is provided in association with a weakly-ordered multiprocessor system. Each processor in the multiprocessor shares resources, and each shared resource has an associated lock within a locking device that provides support for synchronization between the multiple processors in the multiprocessor and the orderly sharing of the resources. A processor only has permission to access a resource when it owns the lock associated with that resource, and an attempt by a processor to own a lock requires only a single load operation, rather than a traditional atomic load followed by store, such that the processor only performs a read operation and the hardware locking device performs a subsequent write operation rather than the processor. A simple perfecting for non-contiguous data structures is also disclosed. A memory line is redefined so that in addition to the normal physical memory data, every line includes a pointer that is large enough to point to any other line in the memory, wherein the pointers to determine which memory line to prefect rather than some other predictive algorithm. This enables hardware to effectively prefect memory access patterns that are non-contiguous, but repetitive.

  5. Chimeric mitochondrial peptides from contiguous regular and swinger RNA. (United States)

    Seligmann, Hervé


    Previous mass spectrometry analyses described human mitochondrial peptides entirely translated from swinger RNAs, RNAs where polymerization systematically exchanged nucleotides. Exchanges follow one among 23 bijective transformation rules, nine symmetric exchanges (X ↔ Y, e.g. A ↔ C) and fourteen asymmetric exchanges (X → Y → Z → X, e.g. A → C → G → A), multiplying by 24 DNA's protein coding potential. Abrupt switches from regular to swinger polymerization produce chimeric RNAs. Here, human mitochondrial proteomic analyses assuming abrupt switches between regular and swinger transcriptions, detect chimeric peptides, encoded by part regular, part swinger RNA. Contiguous regular- and swinger-encoded residues within single peptides are stronger evidence for translation of swinger RNA than previously detected, entirely swinger-encoded peptides: regular parts are positive controls matched with contiguous swinger parts, increasing confidence in results. Chimeric peptides are 200 × rarer than swinger peptides (3/100,000 versus 6/1000). Among 186 peptides with > 8 residues for each regular and swinger parts, regular parts of eleven chimeric peptides correspond to six among the thirteen recognized, mitochondrial protein-coding genes. Chimeric peptides matching partly regular proteins are rarer and less expressed than chimeric peptides matching non-coding sequences, suggesting targeted degradation of misfolded proteins. Present results strengthen hypotheses that the short mitogenome encodes far more proteins than hitherto assumed. Entirely swinger-encoded proteins could exist.

  6. Fraction Reduction through Continued Fractions (United States)

    Carley, Holly


    This article presents a method of reducing fractions without factoring. The ideas presented may be useful as a project for motivated students in an undergraduate number theory course. The discussion is related to the Euclidean Algorithm and its variations may lead to projects or early examples involving efficiency of an algorithm.

  7. Dicty_cDB: Contig-U03323-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U03323-1 no gap 533 2 4820223 4820756 PLUS 2 1 U03323 0 0 0 0 0 0 0 0 0 0 0 0 1 1 Show Contig...-U03323-1 Contig ID Contig-U03323-1 Contig update 2001. 8.29 Contig sequence >Contig-U03323-1 (Contig...-U03323-1Q) /CSM_Contig/Contig-U03323-1Q.Seq.d ACATGTGACATTACTATTGGTAAATGTCAATGTTTAAAAAATACATGGTC ...TCAATAATGGTGGTGGTGGTGGTTTAGGT GAAACCCCCAATAGTAATAGTAATAGTGGTGAACTAGTTATCCCACCAAA ATCAAATACTACATTAAATGAAGAAACAGGTGG Gap no gap Contig... Link to clone list U03323 List of clone(s) est1= FC-IC0176F ,1,534 Translated Amino Acid sequence TCDITIGKC

  8. Dicty_cDB: Contig-U15069-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U15069-1 no gap 1241 1 2719927 2720886 PLUS 37 43 U15069 16 2 0 0 0 5 8 0 0 1 1 0 4 0 Show Contig...-U15069-1 Contig ID Contig-U15069-1 Contig update 2004. 6.11 Contig sequence >Contig-U15069-1 (Contig...-U15069-1Q) /CSM_Contig/Contig-U15069-1Q.Seq.d TTTCAAACCAAAACATAAAATAATTAAAAATGACAACTGTTAAACCA...AAAAATAAAATAAATAAAAATAGTTTTAAA Gap no gap Contig length 1241 Chromosome number (1..6, M) 1 Chromosome length...07Z ,263,623 est42= VSJ431Z ,390,646 est43= CHB363Z ,460,1187 Translated Amino Acid sequence snqnik*lkmttvkptspenprvffditig

  9. Dicty_cDB: Contig-U12316-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12316-1 gap included 1238 4 1925901 1927143 PLUS 5 6 U12316 0 4 1 0 0 0 0 0 0 0 0 0 0 0 Show Contig...-U12316-1 Contig ID Contig-U12316-1 Contig update 2002.12.18 Contig sequence >Contig-U12316-1 (Contig-U12316-1Q) /CSM_Contig/Contig-U12316...GAGTTGAAGATTTAGTTTTATCAGNANGAANAAATAAGAT Gap gap included Contig length 1238 Chromosome number (1..6, M) 4 C...,915,1174 Translated Amino Acid sequence lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig...lip*r*rtrkttn*kiknny*itketkiqs*t*rvmmmi*vedlvls xxxnk Frame B: lvqhhyh*liscvivllksmv*isqvhivvhlfmfvn*qyileih*iptlknlskiftig

  10. Dicty_cDB: Contig-U12682-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Contig-U12682-1 no gap 1408 4 4961739 4963050 PLUS 47 48 U12682 0 0 0 5 0 0 2 30 0 10 0 0 0 0 Show Contig...-U12682-1 Contig ID Contig-U12682-1 Contig update 2002.12.18 Contig sequence >Contig-U12682-1 (Contig...-U12682-1Q) /CSM_Contig/Contig-U12682-1Q.Seq.d AAACACATCATCCCGTTCGATCTGATAAGTAAATCGACCTCAGGCC...ATGA AACTACTG Gap no gap Contig length 1408 Chromosome number (1..6, M) 4 Chromosome length 5430582 Start po... kwniikwysyinwykswyn**fihsiklqwsy*qcke*si*yiir*ny own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig

  11. Differentiation between focal malignant marrow-replacing lesions and benign red marrow deposition of the spine with T2*-corrected fat-signal fraction map using a three -echo volume interpolated breath-hold gradient echo dixon sequence

    International Nuclear Information System (INIS)

    Kim, Yong Pyo; Kim, Sung Jun; Chung, Tae Sub; Yoo, Yeon Hwa; Yoon, Choon Sik; Kanneengiesser, Stephan; Paek, Moon Young; Song, Ho Taek; Lee, Young Han; Suh, Jin Suck


    To assess the feasibility of T2 * -corrected fat-signal fraction (FF) map by using the three-echo volume interpolated breath-hold gradient echo (VIBE) Dixon sequence to differentiate between malignant marrow-replacing lesions and benign red marrow deposition of vertebrae. We assessed 32 lesions from 32 patients who underwent magnetic resonance imaging after being referred for assessment of a known or possible vertebral marrow abnormality. The lesions were divided into 21 malignant marrow-replacing lesions and 11 benign red marrow depositions. Three sequences for the parameter measurements were obtained by using a 1.5-T MR imaging scanner as follows: three-echo VIBE Dixon sequence for FF; conventional T1-weighted imaging for the lesion-disc ratio (LDR); pre- and post-gadolinium enhanced fat-suppressed T1-weighted images for the contrast-enhancement ratio (CER). A region of interest was drawn for each lesion for parameter measurements. The areas under the curve (AUC) of the parameters and their sensitivities and specificities at the most ideal cutoff values from receiver operating characteristic curve analysis were obtained. AUC, sensitivity, and specificity were respectively compared between FF and CER. The AUCs of FF, LDR, and CER were 0.96, 0.80, and 0.72, respectively. In the comparison of diagnostic performance between the FF and CER, the FF showed a significantly larger AUC as compared to the CER (p = 0.030), although the difference of sensitivity (p = 0.157) and specificity (p = 0.157) were not significant. Fat-signal fraction measurement using T2 * -corrected three-echo VIBE Dixon sequence is feasible and has a more accurate diagnostic performance, than the CER, in distinguishing benign red marrow deposition from malignant bone marrow-replacing lesions.

  12. Mechanochemical Polarization of Contiguous Cell Walls Shapes Plant Pavement Cells. (United States)

    Majda, Mateusz; Grones, Peter; Sintorn, Ida-Maria; Vain, Thomas; Milani, Pascale; Krupinski, Pawel; Zagórska-Marek, Beata; Viotti, Corrado; Jönsson, Henrik; Mellerowicz, Ewa J; Hamant, Olivier; Robert, Stéphanie


    The epidermis of aerial plant organs is thought to be limiting for growth, because it acts as a continuous load-bearing layer, resisting tension. Leaf epidermis contains jigsaw puzzle piece-shaped pavement cells whose shape has been proposed to be a result of subcellular variations in expansion rate that induce local buckling events. Paradoxically, such local compressive buckling should not occur given the tensile stresses across the epidermis. Using computational modeling, we show that the simplest scenario to explain pavement cell shapes within an epidermis under tension must involve mechanical wall heterogeneities across and along the anticlinal pavement cell walls between adjacent cells. Combining genetics, atomic force microscopy, and immunolabeling, we demonstrate that contiguous cell walls indeed exhibit hybrid mechanochemical properties. Such biochemical wall heterogeneities precede wall bending. Altogether, this provides a possible mechanism for the generation of complex plant cell shapes. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. Chemical systems, chemical contiguity and the emergence of life

    Directory of Open Access Journals (Sweden)

    Terrence P. Kee


    Full Text Available Charting the emergence of living cells from inanimate matter remains an intensely challenging scientific problem. The complexity of the biochemical machinery of cells with its exquisite intricacies hints at cells being the product of a long evolutionary process. Research on the emergence of life has long been focusing on specific, well-defined problems related to one aspect of cellular make-up, such as the formation of membranes or the build-up of information/catalytic apparatus. This approach is being gradually replaced by a more “systemic” approach that privileges processes inherent to complex chemical systems over specific isolated functional apparatuses. We will summarize the recent advances in system chemistry and show that chemical systems in the geochemical context imply a form of chemical contiguity in the syntheses of the various molecules that precede modern biomolecules.

  14. Non-contiguous multifocal vertebral osteomyelitis caused by Serratia marcescens. (United States)

    Lau, Jen Xin; Li, Jordan Yuanzhi; Yong, Tuck Yean


    Serratia marcescens is a common nosocomial infection but a rare cause of osteomyelitis and more so of vertebral osteomyelitis. Vertebral osteomyelitis caused by this organism has been reported in few studies. We report a case of S. marcescens vertebral discitis and osteomyelitis affecting multiple non-contiguous vertebras. Although Staphylococcus aureus is the most common cause of vertebral osteomyelitis, rare causes, such as S. marcescens, need to be considered, especially when risk factors such as intravenous heroin use, post-spinal surgery and immunosuppression are present. Therefore, blood culture and where necessary biopsy of the infected region should be undertaken to establish the causative organism and determine appropriate antibiotic susceptibility. Prompt diagnosis of S. marcescens vertebral osteomyelitis followed by the appropriate treatment can achieve successful outcomes.

  15. The fractionation of adipose tissue procedure to obtain stromal vascular fractions for regenerative purposes

    NARCIS (Netherlands)

    van Dongen, Joris A.; Stevens, Hieronymus P.; Parvizi, Mojtaba; van der Lei, Berend; Harmsen, Martin C.


    Autologous adipose tissue transplantation is clinically used to reduce dermal scarring and to restore volume loss. The therapeutic benefit on tissue damage more likely depends on the stromal vascular fraction of adipose tissue than on the adipocyte fraction. This stromal vascular fraction can be

  16. Effect of the Volume Fraction of Jute Fiber on the Interlaminar Shear Stress and Tensile Behavior Characteristics of Hybrid Glass/Jute Fiber Reinforced Polymer Composite Bar for Concrete Structures

    Directory of Open Access Journals (Sweden)

    Chan-Gi Park


    Full Text Available Hybrid glass/jute fiber reinforced polymer (HGJFRP composite bars were manufactured for concrete structures, and their interlaminar shear stress and tensile performance were evaluated. HGJFRP composite bars were manufactured using a combination of pultrusion and braiding processes. Jute fiber was surface-treated with a silane coupling agent. The mixing ratio of the fiber to the vinyl ester used in the HGJFRP composite bars was 7 : 3. Jute fiber was used to replace glass fiber in proportions of 0, 30, 50, 70, and 100%. The interlaminar shear stress decreased as the proportion of jute fiber increased. Fractures appeared due to delamination between the surface-treated component and the main part of the HGJFRP composite bar. Tensile load-strain curves with 50% jute fiber exhibited linear behavior. With a jute fiber volume fraction of 70%, some plastic deformation occurred. A jute fiber mixing ratio of 100% resulted in a display of linear elastic brittle behavior from the fiber; however, when the surface of the fiber was coated with poly(vinyl acetate, following failure, the jute fiber exhibited partial load resistance. The tensile strength decreased as the jute fiber content increased; however, the tensile strength did not vary linearly with jute fiber content.

  17. The influence of buoyant forces and volume fraction of particles on the particle pushing/entrapment transition during directional solidification of Al/SiC and Al/graphite composites (United States)

    Stefanescu, Doru M.; Moitra, Avijit; Kacar, A. Sedat; Dhindaw, Brij K.


    Directional solidification experiments in a Bridgman-type furnace were used to study particle behavior at the liquid/solid interface in aluminum metal matrix composites. Graphite or siliconcarbide particles were first dispersed in aluminum-base alloys via a mechanically stirred vortex. Then, 100-mm-diameter and 120-mm-long samples were cast in steel dies and used for directional solidification. The processing variables controlled were the direction and velocity of solidification and the temperature gradient at the interface. The material variables monitored were the interface energy, the liquid/particle density difference, the particle/liquid thermal conductivity ratio, and the volume fraction of particles. These properties were changed by selecting combinations of particles (graphite or silicon carbide) and alloys (Al-Cu, Al-Mg, Al-Ni). A model which considers process thermodynamics, process kinetics (including the role of buoyant forces), and thermophysical properties was developed. Based on solidification direction and velocity, and on materials properties, four types of behavior were predicted. Sessile drop experiments were also used to determine some of the interface energies required in calculation with the proposed model. Experimental results compared favorably with model predictions.

  18. Influence of size and volume fraction of SiC particulates on properties of ex situ reinforced Al-4.5Cu-3Mg metal matrix composite prepared by direct metal laser sintering process

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Subrata Kumar [Department of Mechanical Engineering, Indian Institute of Technology Kharagpur, Midnapore (West), Kharagpur 721302, West Bengal (India); Saha, Partha, E-mail: [Department of Mechanical Engineering, Indian Institute of Technology Kharagpur, Midnapore (West), Kharagpur 721302, West Bengal (India); Kishore, Shyam [Department of Mechanical Engineering, Indian Institute of Technology Kharagpur, Midnapore (West), Kharagpur 721302, West Bengal (India)


    Direct metal laser sintering (DMLS) process has a great potential to prepare metal matrix composites (MMCs) in fabrication of arbitrary shaped jobs through rapid manufacturing. In the present work, silicon carbide particulates reinforced aluminium based metal matrix composite was developed by direct metal laser sintering process. Influences of SiC particulate (SiCp) on density, porosity and microhardness of the composite were investigated. It shows that SiCp having 300 mesh size provides higher density and lower porosity because of lower clustering effect. Higher microhardness was achieved at 1200 mesh of reinforcement because of lower grain size. Microhardness increases with increase of volume fraction of SiCp and higher value was achieved at high reinforcement content of 30 vol.%. Microstructure was studied through scanning electron microscopy (SEM) and X-ray elemental mapping. Interfacial microstructure was also investigated and cracks were found in number of cases due to difference between co-efficient of thermal expansion of matrix alloy and SiCp.

  19. Influence of size and volume fraction of SiC particulates on properties of ex situ reinforced Al-4.5Cu-3Mg metal matrix composite prepared by direct metal laser sintering process

    International Nuclear Information System (INIS)

    Ghosh, Subrata Kumar; Saha, Partha; Kishore, Shyam


    Direct metal laser sintering (DMLS) process has a great potential to prepare metal matrix composites (MMCs) in fabrication of arbitrary shaped jobs through rapid manufacturing. In the present work, silicon carbide particulates reinforced aluminium based metal matrix composite was developed by direct metal laser sintering process. Influences of SiC particulate (SiCp) on density, porosity and microhardness of the composite were investigated. It shows that SiCp having 300 mesh size provides higher density and lower porosity because of lower clustering effect. Higher microhardness was achieved at 1200 mesh of reinforcement because of lower grain size. Microhardness increases with increase of volume fraction of SiCp and higher value was achieved at high reinforcement content of 30 vol.%. Microstructure was studied through scanning electron microscopy (SEM) and X-ray elemental mapping. Interfacial microstructure was also investigated and cracks were found in number of cases due to difference between co-efficient of thermal expansion of matrix alloy and SiCp.

  20. Fractional vector calculus for fractional advection dispersion (United States)

    Meerschaert, Mark M.; Mortensen, Jeff; Wheatcraft, Stephen W.


    We develop the basic tools of fractional vector calculus including a fractional derivative version of the gradient, divergence, and curl, and a fractional divergence theorem and Stokes theorem. These basic tools are then applied to provide a physical explanation for the fractional advection-dispersion equation for flow in heterogeneous porous media.

  1. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  2. Change in Total Snowfall in the Contiguous 48 States, 1930-2007 (United States)

    U.S. Environmental Protection Agency — This map shows the average rate of change in total snowfall from 1930 to 2007 at 419 weather stations in the contiguous 48 states. Blue circles represent increased...

  3. Hebbian Learning is about contingency, not contiguity, and explains the emergence of predictive mirror neurons

    NARCIS (Netherlands)

    Keysers, C.; Perrett, David I; Gazzola, Valeria

    Hebbian Learning should not be reduced to contiguity, as it detects contingency and causality. Hebbian Learning accounts of mirror neurons make predictions that differ from associative learning: Through Hebbian Learning, mirror neurons become dynamic networks that calculate predictions and

  4. Common-User Land Transportation Management in the Layered, Non-Linear, Non-Contiguous Battlefield

    National Research Council Canada - National Science Library

    Strobel, Lawrence E


    .... Current multinational counterinsurgency warfare occurs in a layered, non-linear, non-contiguous battle space, making management of ground transportation assets even more critical than in conventional warfare...

  5. Dicty_cDB: Contig-U16279-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( AB254080 |pid:none) Streptomyces kanamyceticus kanam... 47 0.002 CP000964_3229( CP000964 |pid:none) Klebsiella pneumoni...nkkmtkpvasyeldekrfltllgkligetenlqnrppalipiednag rhviealtpylkanggvleleqvhcdpvnypkrgniiie... letters Score E Sequences producing significant alignments: (bits) Value Contig-U16279-1 (Contig-U16279-1Q....................................................done Score E Sequences producing significant alignments: (bits) Val....................................done Score E Sequences producing significant alignments: (bits) Val

  6. Fractional Schroedinger equation

    International Nuclear Information System (INIS)

    Laskin, Nick


    Some properties of the fractional Schroedinger equation are studied. We prove the Hermiticity of the fractional Hamilton operator and establish the parity conservation law for fractional quantum mechanics. As physical applications of the fractional Schroedinger equation we find the energy spectra of a hydrogenlike atom (fractional 'Bohr atom') and of a fractional oscillator in the semiclassical approximation. An equation for the fractional probability current density is developed and discussed. We also discuss the relationships between the fractional and standard Schroedinger equations

  7. Meadow based Fraction Theory


    Bergstra, Jan A.


    In the context of an involutive meadow a precise definition of fractions is formulated and on that basis formal definitions of various classes of fractions are given. The definitions follow the fractions as terms paradigm. That paradigm is compared with two competing paradigms for storytelling on fractions: fractions as values and fractions as pairs.

  8. Auxillary system for optimizing simulation and percutaneous irradiation in cranio-caudally contiguous head-neck-mediastinum fields. Hilfssystem zur Optimierung von Simulation und perkutaner Radiatio bei kranial-kaudal aneinandergrenzenden Kopf-Hals-Mediastinum-Feldern

    Energy Technology Data Exchange (ETDEWEB)

    Sistermanns, J. (Radiologische Klinik, Abt. fuer Strahlentherapie und Radiologische Onkologie, Krankenhaus ' Maria Hilf GmbH' , Moenchengladbach (Germany))


    Percutaneous irradiation in the head and neck region via opponing lateral fields with caudally contiguous ventral and/or dorsal fields makes very high demands on simulation, instrument adjustment and documentation. At the outer boundaries of the irradiation volumes, there is always the danger of overdosage or underdosage with the familiar consequences. Four targeting systems in one plane were inserted in a perspex frame each consisting of two concentric rings and two orthogonal crossbars. Under simulation conditions, the lateral radiation fields take up one half of the targeting systems and the ventro-dorsal fields occupy the remaining half. The corresponding targeting systems project exactly on or into each other with compensation of the beam divergence. A definitively exact irradiation via cranio-caudally contiguous fields with different incident beam direction is possible by using the four targeting systems in one plane. Compensation of divergence is aimed for by rotation of the table and gantry angle modification, errors of compensation can already be checked optically from 0,5 . Deviations of 5 mm in the simulated longitudinal arrangement of the contiguous fields can be imaged on the documentation film made with therapy activity. On the one hand, the auxillary system presented allows both recognition of undesired field overlap and gaps in contiguous fields with different incident beam direction. On the other hand, it can be unequivocally documented whether the therapy is correct. Treatment errors can thus be minimized. (orig./MG)

  9. Adaptive partial volume classification of MRI data

    International Nuclear Information System (INIS)

    Chiverton, John P; Wells, Kevin


    Tomographic biomedical images are commonly affected by an imaging artefact known as the partial volume (PV) effect. The PV effect produces voxels composed of a mixture of tissues in anatomical magnetic resonance imaging (MRI) data resulting in a continuity of these tissue classes. Anatomical MRI data typically consist of a number of contiguous regions of tissues or even contiguous regions of PV voxels. Furthermore discontinuities exist between the boundaries of these contiguous image regions. The work presented here probabilistically models the PV effect using spatial regularization in the form of continuous Markov random fields (MRFs) to classify anatomical MRI brain data, simulated and real. A unique approach is used to adaptively control the amount of spatial regularization imposed by the MRF. Spatially derived image gradient magnitude is used to identify the discontinuities between image regions of contiguous tissue voxels and PV voxels, imposing variable amounts of regularization determined by simulation. Markov chain Monte Carlo (MCMC) is used to simulate the posterior distribution of the probabilistic image model. Promising quantitative results are presented for PV classification of simulated and real MRI data of the human brain.

  10. Evaluation of Projected Agricultural Climate Risk over the Contiguous US (United States)

    Zhu, X.; Troy, T. J.; Devineni, N.


    Food demands are rising due to an increasing population with changing food preferences, which places pressure on agricultural production. Additionally, climate extremes have recently highlighted the vulnerability of our agricultural system to climate variability. This study seeks to fill two important gaps in current knowledge: how does the widespread response of irrigated crops differ from rainfed and how can we best account for uncertainty in yield responses. We developed a stochastic approach to evaluate climate risk quantitatively to better understand the historical impacts of climate change and estimate the future impacts it may bring about to agricultural system. Our model consists of Bayesian regression, distribution fitting, and Monte Carlo simulation to simulate rainfed and irrigated crop yields at the US county level. The model was fit using historical data for 1970-2010 and was then applied over different climate regions in the contiguous US using the CMIP5 climate projections. The relative importance of many major growing season climate indices, such as consecutive dry days without rainfall or heavy precipitation, was evaluated to determine what climate indices play a role in affecting future crop yields. The statistical modeling framework also evaluated the impact of irrigation by using county-level irrigated and rainfed yields separately. Furthermore, the projected years with negative yield anomalies were specifically evaluated in terms of magnitude, trend and potential climate drivers. This framework provides estimates of the agricultural climate risk for the 21st century that account for the full uncertainty of climate occurrences, range of crop response, and spatial correlation in climate. The results of this study can contribute to decision making about crop choice and water use in an uncertain future climate.

  11. Climatic and physiographic controls of spatial variability in surface water balance over the contiguous United States using the Budyko relationship (United States)

    Abatzoglou, John T.; Ficklin, Darren L.


    The geographic variability in the partitioning of precipitation into surface runoff (Q) and evapotranspiration (ET) is fundamental to understanding regional water availability. The Budyko equation suggests this partitioning is strictly a function of aridity, yet observed deviations from this relationship for individual watersheds impede using the framework to model surface water balance in ungauged catchments and under future climate and land use scenarios. A set of climatic, physiographic, and vegetation metrics were used to model the spatial variability in the partitioning of precipitation for 211 watersheds across the contiguous United States (CONUS) within Budyko's framework through the free parameter ω. A generalized additive model found that four widely available variables, precipitation seasonality, the ratio of soil water holding capacity to precipitation, topographic slope, and the fraction of precipitation falling as snow, explained 81.2% of the variability in ω. The ω model applied to the Budyko equation explained 97% of the spatial variability in long-term Q for an independent set of watersheds. The ω model was also applied to estimate the long-term water balance across the CONUS for both contemporary and mid-21st century conditions. The modeled partitioning of observed precipitation to Q and ET compared favorably across the CONUS with estimates from more sophisticated land-surface modeling efforts. For mid-21st century conditions, the model simulated an increase in the fraction of precipitation used by ET across the CONUS with declines in Q for much of the eastern CONUS and mountainous watersheds across the western United States.

  12. Fractional Vector Calculus and Fractional Special Function


    Li, Ming-Fan; Ren, Ji-Rong; Zhu, Tao


    Fractional vector calculus is discussed in the spherical coordinate framework. A variation of the Legendre equation and fractional Bessel equation are solved by series expansion and numerically. Finally, we generalize the hypergeometric functions.

  13. Bone volume fraction and structural parameters for estimation of mechanical stiffness and failure load of human cancellous bone samples; in-vitro comparison of ultrasound transit time spectroscopy and X-ray μCT. (United States)

    Alomari, Ali Hamed; Wille, Marie-Luise; Langton, Christian M


    Conventional mechanical testing is the 'gold standard' for assessing the stiffness (N mm -1 ) and strength (MPa) of bone, although it is not applicable in-vivo since it is inherently invasive and destructive. The mechanical integrity of a bone is determined by its quantity and quality; being related primarily to bone density and structure respectively. Several non-destructive, non-invasive, in-vivo techniques have been developed and clinically implemented to estimate bone density, both areal (dual-energy X-ray absorptiometry (DXA)) and volumetric (quantitative computed tomography (QCT)). Quantitative ultrasound (QUS) parameters of velocity and attenuation are dependent upon both bone quantity and bone quality, although it has not been possible to date to transpose one particular QUS parameter into separate estimates of quantity and quality. It has recently been shown that ultrasound transit time spectroscopy (UTTS) may provide an accurate estimate of bone density and hence quantity. We hypothesised that UTTS also has the potential to provide an estimate of bone structure and hence quality. In this in-vitro study, 16 human femoral bone samples were tested utilising three techniques; UTTS, micro computed tomography (μCT), and mechanical testing. UTTS was utilised to estimate bone volume fraction (BV/TV) and two novel structural parameters, inter-quartile range of the derived transit time (UTTS-IQR) and the transit time of maximum proportion of sonic-rays (TTMP). μCT was utilised to derive BV/TV along with several bone structure parameters. A destructive mechanical test was utilised to measure the stiffness and strength (failure load) of the bone samples. BV/TV was calculated from the derived transit time spectrum (TTS); the correlation coefficient (R 2 ) with μCT-BV/TV was 0.885. For predicting mechanical stiffness and strength, BV/TV derived by both μCT and UTTS provided the strongest correlation with mechanical stiffness (R 2 =0.567 and 0.618 respectively) and

  14. The economic efficiency of investment in the development of reserves of small groups of geographically contiguous gold deposits

    Directory of Open Access Journals (Sweden)

    Evdokimov S.I.


    Full Text Available The object of the research is a group of geographically contiguous low volume gold deposits. The subject of the study is an economic justification for a way to involve economic turnover to get a positive commercial result on a specially formed group of gold deposits, in which individual field development is unprofitable. A small production volume, combined with high capital and operating costs are objective reasons for the reduction in investment attractiveness of the deposits which have reserves of gold of 50%, equipped with a mobile processing complex with deep processing technology on highly liquid commodity products on site. An economic-mathematical model was devised to determine the rational placement of the processing capacity of the group.A simulation was conducted and an economic evaluation was performed on the effectiveness of investments in individual and group mining projects. The simulation results show that the joint exploitation of the reserves of the group of deposits, the internal rate of return on investments exceed the rate of return of funds to the bank deposit, the return on investment is above the level of inflation. The group project complies with the strategic line of small mining companies in terms of cost recovery terms, availability of financial sources to cover expenses, provision of stable means of income and obtaining competitive advantage.

  15. Fractional quantum mechanics

    CERN Document Server

    Laskin, Nick


    Fractional quantum mechanics is a recently emerged and rapidly developing field of quantum physics. This is the first monograph on fundamentals and physical applications of fractional quantum mechanics, written by its founder. The fractional Schrödinger equation and the fractional path integral are new fundamental physical concepts introduced and elaborated in the book. The fractional Schrödinger equation is a manifestation of fractional quantum mechanics. The fractional path integral is a new mathematical tool based on integration over Lévy flights. The fractional path integral method enhances the well-known Feynman path integral framework. Related topics covered in the text include time fractional quantum mechanics, fractional statistical mechanics, fractional classical mechanics and the α-stable Lévy random process. The book is well-suited for theorists, pure and applied mathematicians, solid-state physicists, chemists, and others working with the Schrödinger equation, the path integral technique...

  16. Application of a non-contiguous grid generation method to complex configurations

    International Nuclear Information System (INIS)

    Chen, S.; McIlwain, S.; Khalid, M.


    An economical non-contiguous grid generation method was developed to efficiently generate structured grids for complex 3D problems. Compared with traditional contiguous grids, this new approach generated grids for different block clusters independently and was able to distribute the grid points more economically according to the user's specific topology design. The method was evaluated by applying it to a Navier-Stokes computation of flow past a hypersonic projectile. Both the flow velocity and the heat transfer characteristics of the projectile agreed qualitatively with other numerical data in the literature and with available field data. Detailed grid topology designs for 3D geometries were addressed, and the advantages of this approach were analysed and compared with traditional contiguous grid generation methods. (author)

  17. An Efficient Approach to Mining Maximal Contiguous Frequent Patterns from Large DNA Sequence Databases

    Directory of Open Access Journals (Sweden)

    Md. Rezaul Karim


    Full Text Available Mining interesting patterns from DNA sequences is one of the most challenging tasks in bioinformatics and computational biology. Maximal contiguous frequent patterns are preferable for expressing the function and structure of DNA sequences and hence can capture the common data characteristics among related sequences. Biologists are interested in finding frequent orderly arrangements of motifs that are responsible for similar expression of a group of genes. In order to reduce mining time and complexity, however, most existing sequence mining algorithms either focus on finding short DNA sequences or require explicit specification of sequence lengths in advance. The challenge is to find longer sequences without specifying sequence lengths in advance. In this paper, we propose an efficient approach to mining maximal contiguous frequent patterns from large DNA sequence datasets. The experimental results show that our proposed approach is memory-efficient and mines maximal contiguous frequent patterns within a reasonable time.

  18. Fractional vector calculus and fractional Maxwell's equations

    International Nuclear Information System (INIS)

    Tarasov, Vasily E.


    The theory of derivatives and integrals of non-integer order goes back to Leibniz, Liouville, Grunwald, Letnikov and Riemann. The history of fractional vector calculus (FVC) has only 10 years. The main approaches to formulate a FVC, which are used in the physics during the past few years, will be briefly described in this paper. We solve some problems of consistent formulations of FVC by using a fractional generalization of the Fundamental Theorem of Calculus. We define the differential and integral vector operations. The fractional Green's, Stokes' and Gauss's theorems are formulated. The proofs of these theorems are realized for simplest regions. A fractional generalization of exterior differential calculus of differential forms is discussed. Fractional nonlocal Maxwell's equations and the corresponding fractional wave equations are considered

  19. Fractional statistics and fractional quantized Hall effect

    International Nuclear Information System (INIS)

    Tao, R.; Wu, Y.S.


    The authors suggest that the origin of the odd-denominator rule observed in the fractional quantized Hall effect (FQHE) may lie in fractional statistics which govern quasiparticles in FQHE. A theorem concerning statistics of clusters of quasiparticles implies that fractional statistics do not allow coexistence of a large number of quasiparticles at fillings with an even denominator. Thus, no Hall plateau can be formed at these fillings, regardless of the presence of an energy gap. 15 references

  20. Dicty_cDB: Contig-U03802-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available T-2KB Trichosurus... 48 3e-11 4 ( DY894715 ) CeleSEQ14351 Cunninghamella elegans pBluescript (... 58 4e-11 3... letters Score E Sequences producing significant alignments: (bits) Value Contig-U03802-1 (Contig-U... letters Searching..................................................done Score E Sequences producing significant al...1... 62 4e-05 1 ( EJ306703 ) 1095390099376 Global-Ocean-Sampling_GS-27-01-01-1... 62 4e-05 1 ( CP000238 ) Baumannia cicadellinicola... AY241394 |pid:none) Melopsittacus undulatus Mn superox... 244 2e-63 AF329270_1( AF329270 |pid:none) Gallus gallus manganes

  1. Synthetic Strategies toward Natural Products Containing Contiguous Stereogenic Quaternary Carbon Atoms. (United States)

    Büschleb, Martin; Dorich, Stéphane; Hanessian, Stephen; Tao, Daniel; Schenthal, Kyle B; Overman, Larry E


    Strategies for the total synthesis of complex natural products that contain two or more contiguous stereogenic quaternary carbon atoms in their intricate structures are reviewed with 12 representative examples. Emphasis has been put on methods to create quaternary carbon stereocenters, including syntheses of the same natural product by different groups, thereby showcasing the diversity of thought and individual creativity. A compendium of selected natural products containing two or more contiguous stereogenic quaternary carbon atoms and key reactions in their total or partial syntheses is provided in the Supporting Information. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. Initialized Fractional Calculus (United States)

    Lorenzo, Carl F.; Hartley, Tom T.


    This paper demonstrates the need for a nonconstant initialization for the fractional calculus and establishes a basic definition set for the initialized fractional differintegral. This definition set allows the formalization of an initialized fractional calculus. Two basis calculi are considered; the Riemann-Liouville and the Grunwald fractional calculi. Two forms of initialization, terminal and side are developed.

  3. Tempered fractional calculus

    Energy Technology Data Exchange (ETDEWEB)

    Sabzikar, Farzad, E-mail: [Department of Statistics and Probability, Michigan State University, East Lansing, MI 48823 (United States); Meerschaert, Mark M., E-mail: [Department of Statistics and Probability, Michigan State University, East Lansing, MI 48823 (United States); Chen, Jinghua, E-mail: [School of Sciences, Jimei University, Xiamen, Fujian, 361021 (China)


    Fractional derivatives and integrals are convolutions with a power law. Multiplying by an exponential factor leads to tempered fractional derivatives and integrals. Tempered fractional diffusion equations, where the usual second derivative in space is replaced by a tempered fractional derivative, govern the limits of random walk models with an exponentially tempered power law jump distribution. The limiting tempered stable probability densities exhibit semi-heavy tails, which are commonly observed in finance. Tempered power law waiting times lead to tempered fractional time derivatives, which have proven useful in geophysics. The tempered fractional derivative or integral of a Brownian motion, called a tempered fractional Brownian motion, can exhibit semi-long range dependence. The increments of this process, called tempered fractional Gaussian noise, provide a useful new stochastic model for wind speed data. A tempered fractional difference forms the basis for numerical methods to solve tempered fractional diffusion equations, and it also provides a useful new correlation model in time series.

  4. Tempered fractional calculus (United States)

    Sabzikar, Farzad; Meerschaert, Mark M.; Chen, Jinghua


    Fractional derivatives and integrals are convolutions with a power law. Multiplying by an exponential factor leads to tempered fractional derivatives and integrals. Tempered fractional diffusion equations, where the usual second derivative in space is replaced by a tempered fractional derivative, govern the limits of random walk models with an exponentially tempered power law jump distribution. The limiting tempered stable probability densities exhibit semi-heavy tails, which are commonly observed in finance. Tempered power law waiting times lead to tempered fractional time derivatives, which have proven useful in geophysics. The tempered fractional derivative or integral of a Brownian motion, called a tempered fractional Brownian motion, can exhibit semi-long range dependence. The increments of this process, called tempered fractional Gaussian noise, provide a useful new stochastic model for wind speed data. A tempered fractional difference forms the basis for numerical methods to solve tempered fractional diffusion equations, and it also provides a useful new correlation model in time series.

  5. Tempered fractional calculus

    International Nuclear Information System (INIS)

    Sabzikar, Farzad; Meerschaert, Mark M.; Chen, Jinghua


    Fractional derivatives and integrals are convolutions with a power law. Multiplying by an exponential factor leads to tempered fractional derivatives and integrals. Tempered fractional diffusion equations, where the usual second derivative in space is replaced by a tempered fractional derivative, govern the limits of random walk models with an exponentially tempered power law jump distribution. The limiting tempered stable probability densities exhibit semi-heavy tails, which are commonly observed in finance. Tempered power law waiting times lead to tempered fractional time derivatives, which have proven useful in geophysics. The tempered fractional derivative or integral of a Brownian motion, called a tempered fractional Brownian motion, can exhibit semi-long range dependence. The increments of this process, called tempered fractional Gaussian noise, provide a useful new stochastic model for wind speed data. A tempered fractional difference forms the basis for numerical methods to solve tempered fractional diffusion equations, and it also provides a useful new correlation model in time series

  6. Higher fractions theory of fractional hall effect

    International Nuclear Information System (INIS)

    Kostadinov, I.Z.; Popov, V.N.


    A theory of fractional quantum Hall effect is generalized to higher fractions. N-particle model interaction is used and the gap is expressed through n-particles wave function. The excitation spectrum in general and the mean field critical behaviour are determined. The Hall conductivity is calculated from first principles. (author)

  7. Integrated Common Radio Resource Management with Spectrum Aggregation over Non-Contiguous Frequency Bands

    DEFF Research Database (Denmark)

    Cabral, Orlando; Meucci, Filippo; Mihovska, Albena D.


    This paper proposes an integrated Common Radio Resource Management (iCRRM). The iCRRM performs classic CRRM functionalities jointly with Spectrum Aggregation (SA), being able to switch users between non-contiguous frequency bands. The SA scheduling is obtained with an optimised General Multi...

  8. Hebbian Learning is about contingency, not contiguity, and explains the emergence of predictive mirror neurons. (United States)

    Keysers, Christian; Perrett, David I; Gazzola, Valeria


    Hebbian Learning should not be reduced to contiguity, as it detects contingency and causality. Hebbian Learning accounts of mirror neurons make predictions that differ from associative learning: Through Hebbian Learning, mirror neurons become dynamic networks that calculate predictions and prediction errors and relate to ideomotor theories. The social force of imitation is important for mirror neuron emergence and suggests canalization.

  9. Hebbian Learning is about contingency, not contiguity, and explains the emergence of predictive mirror neurons


    Keysers, C.; Perrett, D.I.; Gazzola, V.


    Hebbian Learning should not be reduced to contiguity, as it detects contingency and causality. Hebbian Learning accounts of mirror neurons make predictions that differ from associative learning: Through Hebbian Learning, mirror neurons become dynamic networks that calculate predictions and prediction errors and relate to ideomotor theories. The social force of imitation is important for mirror neuron emergence and suggests canalization. Publisher PDF Peer reviewed

  10. When Spatial and Temporal Contiguities Help the Integration in Working Memory: "A Multimedia Learning" Approach (United States)

    Mammarella, Nicola; Fairfield, Beth; Di Domenico, Alberto


    Two experiments examined the effects of spatial and temporal contiguities in a working memory binding task that required participants to remember coloured objects. In Experiment 1, a black and white drawing and a corresponding phrase that indicated its colour perceptually were either near or far (spatial study condition), while in Experiment 2,…

  11. Intra-fraction motion of larynx radiotherapy (United States)

    Durmus, Ismail Faruk; Tas, Bora


    In early stage laryngeal radiotherapy, movement is an important factor. Thyroid cartilage can move from swallowing, breathing, sound and reflexes. The effects of this motion on the target volume (PTV) during treatment were examined. In our study, the target volume movement during the treatment for this purpose was examined. Thus, setup margins are re-evaluated and patient-based PTV margins are determined. Intrafraction CBCT was scanned in 246 fractions for 14 patients. During the treatment, the amount of deviation which could be lateral, vertical and longitudinal axis was determined. ≤ ± 0.1cm deviation; 237 fractions in the lateral direction, 202 fractions in the longitudinal direction, 185 fractions in the vertical direction. The maximum deviation values were found in the longitudinal direction. Intrafraction guide in laryngeal radiotherapy; we are sure of the correctness of the treatment, the target volume is to adjust the margin and dose more precisely, we control the maximum deviation of the target volume for each fraction. Although the image quality of intrafraction-CBCT scans was lower than the image quality of planning CT, they showed sufficient contrast for this work.

  12. Non-contiguous spinal injury in cervical spinal trauma: evaluation with cervical spine MRI

    International Nuclear Information System (INIS)

    Choi, Soo Jung; Shin, Myung Jin; Kim, Sung Moon; Bae, Sang Jin


    We wished to evaluate the incidence of non-contiguous spinal injury in the cervicothoracic junction (CTJ) or the upper thoracic spines on cervical spinal MR images in the patients with cervical spinal injuries. Seventy-five cervical spine MR imagings for acute cervical spinal injury were retrospectively reviewed (58 men and 17 women, mean age: 35.3, range: 18-81 years). They were divided into three groups based on the mechanism of injury; axial compression, hyperflexion or hyperextension injury, according to the findings on the MR and CT images. On cervical spine MR images, we evaluated the presence of non-contiguous spinal injury in the CTJ or upper thoracic spine with regard to the presence of marrow contusion or fracture, ligament injury, traumatic disc herniation and spinal cord injury. Twenty-one cases (28%) showed CTJ or upper thoracic spinal injuries (C7-T5) on cervical spinal MR images that were separated from the cervical spinal injuries. Seven of 21 cases revealed overt fractures in the CTJs or upper thoracic spines. Ligament injury in these regions was found in three cases. Traumatic disc herniation and spinal cord injury in these regions were shown in one and two cases, respectively. The incidence of the non-contiguous spinal injuries in CTJ or upper thoracic spines was higher in the axial compression injury group (35.5%) than in the hyperflexion injury group (26.9%) or the hyperextension (25%) injury group. However, there was no statistical significance (ρ > 0.05). Cervical spinal MR revealed non-contiguous CTJ or upper thoracic spinal injuries in 28% of the patients with cervical spinal injury. The mechanism of cervical spinal injury did not significantly affect the incidence of the non-contiguous CTJ or upper thoracic spinal injury

  13. Non-contiguous spinal injury in cervical spinal trauma: evaluation with cervical spine MRI

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Soo Jung; Shin, Myung Jin; Kim, Sung Moon [University of Ulsan College of Medicine, Seoul (Korea, Republic of); Bae, Sang Jin [Sanggyepaik Hospital, Inje University, Seoul (Korea, Republic of)


    We wished to evaluate the incidence of non-contiguous spinal injury in the cervicothoracic junction (CTJ) or the upper thoracic spines on cervical spinal MR images in the patients with cervical spinal injuries. Seventy-five cervical spine MR imagings for acute cervical spinal injury were retrospectively reviewed (58 men and 17 women, mean age: 35.3, range: 18-81 years). They were divided into three groups based on the mechanism of injury; axial compression, hyperflexion or hyperextension injury, according to the findings on the MR and CT images. On cervical spine MR images, we evaluated the presence of non-contiguous spinal injury in the CTJ or upper thoracic spine with regard to the presence of marrow contusion or fracture, ligament injury, traumatic disc herniation and spinal cord injury. Twenty-one cases (28%) showed CTJ or upper thoracic spinal injuries (C7-T5) on cervical spinal MR images that were separated from the cervical spinal injuries. Seven of 21 cases revealed overt fractures in the CTJs or upper thoracic spines. Ligament injury in these regions was found in three cases. Traumatic disc herniation and spinal cord injury in these regions were shown in one and two cases, respectively. The incidence of the non-contiguous spinal injuries in CTJ or upper thoracic spines was higher in the axial compression injury group (35.5%) than in the hyperflexion injury group (26.9%) or the hyperextension (25%) injury group. However, there was no statistical significance ({rho} > 0.05). Cervical spinal MR revealed non-contiguous CTJ or upper thoracic spinal injuries in 28% of the patients with cervical spinal injury. The mechanism of cervical spinal injury did not significantly affect the incidence of the non-contiguous CTJ or upper thoracic spinal injury.

  14. Asphalt chemical fractionation

    International Nuclear Information System (INIS)

    Obando P, Klever N.


    Asphalt fractionation were carried out in the Esmeraldas Oil Refinery using n-pentane, SiO 2 and different mixture of benzene- methane. The fractions obtained were analyzed by Fourier's Transformed Infrared Spectrophotometry (FTIR)

  15. Applications of fractional calculus in physics

    CERN Document Server


    Fractional calculus is a collection of relatively little-known mathematical results concerning generalizations of differentiation and integration to noninteger orders. While these results have been accumulated over centuries in various branches of mathematics, they have until recently found little appreciation or application in physics and other mathematically oriented sciences. This situation is beginning to change, and there are now a growing number of research areas in physics which employ fractional calculus.This volume provides an introduction to fractional calculus for physicists, and co

  16. Smarandache Continued Fractions


    Ibstedt, H.


    The theory of general continued fractions is developed to the extent required in order to calculate Smarandache continued fractions to a given number of decimal places. Proof is given for the fact that Smarandache general continued fractions built with positive integer Smarandache sequences baving only a finite number of terms equal to 1 is convergent. A few numerical results are given.

  17. Fractional smith chart theory

    KAUST Repository

    Shamim, Atif


    For the first time, a generalized Smith chart is introduced here to represent fractional order circuit elements. It is shown that the standard Smith chart is a special case of the generalized fractional order Smith chart. With illustrations drawn for both the conventional integer based lumped elements and the fractional elements, a graphical technique supported by the analytical method is presented to plot impedances on the fractional Smith chart. The concept is then applied towards impedance matching networks, where the fractional approach proves to be much more versatile and results in a single element matching network for a complex load as compared to the two elements in the conventional approach. © 2010 IEEE.

  18. Fractional factorial plans

    CERN Document Server

    Dey, Aloke


    A one-stop reference to fractional factorials and related orthogonal arrays.Presenting one of the most dynamic areas of statistical research, this book offers a systematic, rigorous, and up-to-date treatment of fractional factorial designs and related combinatorial mathematics. Leading statisticians Aloke Dey and Rahul Mukerjee consolidate vast amounts of material from the professional literature--expertly weaving fractional replication, orthogonal arrays, and optimality aspects. They develop the basic theory of fractional factorials using the calculus of factorial arrangements, thereby providing a unified approach to the study of fractional factorial plans. An indispensable guide for statisticians in research and industry as well as for graduate students, Fractional Factorial Plans features: * Construction procedures of symmetric and asymmetric orthogonal arrays. * Many up-to-date research results on nonexistence. * A chapter on optimal fractional factorials not based on orthogonal arrays. * Trend-free plans...

  19. Fractional Dynamics and Control

    CERN Document Server

    Machado, José; Luo, Albert


    Fractional Dynamics and Control provides a comprehensive overview of recent advances in the areas of nonlinear dynamics, vibration and control with analytical, numerical, and experimental results. This book provides an overview of recent discoveries in fractional control, delves into fractional variational principles and differential equations, and applies advanced techniques in fractional calculus to solving complicated mathematical and physical problems.Finally, this book also discusses the role that fractional order modeling can play in complex systems for engineering and science. Discusses how fractional dynamics and control can be used to solve nonlinear science and complexity issues Shows how fractional differential equations and models can be used to solve turbulence and wave equations in mechanics and gravity theories and Schrodinger’s equation  Presents factional relaxation modeling of dielectric materials and wave equations for dielectrics  Develops new methods for control and synchronization of...

  20. Dividing Fractions: A Pedagogical Technique (United States)

    Lewis, Robert


    When dividing one fraction by a second fraction, invert, that is, flip the second fraction, then multiply it by the first fraction. To multiply fractions, simply multiply across the denominators, and multiply across the numerators to get the resultant fraction. So by inverting the division of fractions it is turned into an easy multiplication of…

  1. EnviroAtlas - Percent of Each 12-Digit HUC in the Contiguous U.S. with Potentially Restorable Wetlands (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset shows the percent of each 12-digit Hydrologic Unit (HUC) subwatershed in the contiguous U.S. with potentially restorable wetlands. Beginning...

  2. Contiguous gene deletion of ELOVL7, ERCC8 and NDUFAF2 in a patient with a fatal multisystem disorder

    DEFF Research Database (Denmark)

    Janssen, Rolf J R J; Distelmaier, Felix; Smeets, Roel


    Contiguous gene syndromes affecting the mitochondrial oxidative phosphorylation system have been rarely reported. Here, we describe a patient with apparent mitochondrial encephalomyopathy accompanied by several unusual features, including dysmorphism and hepatopathy, caused by a homozygous triple...

  3. Fractional graph theory a rational approach to the theory of graphs

    CERN Document Server

    Scheinerman, Edward R


    A unified treatment of the most important results in the study of fractional graph concepts, this volume explores the various ways in which integer-valued concepts can be modified to derive nonintegral values. It begins with the general fractional theory of hypergraphs and presents in-depth coverage of fundamental and advanced topics. Subjects include fractional matching, fractional coloring, fractional edge coloring, fractional arboricity via matroid methods, and fractional isomorphism. The final chapter examines additional topics such as fractional domination, fractional intersection numbers

  4. Electric power supply and demand for the contiguous United States, 1980-1989

    Energy Technology Data Exchange (ETDEWEB)



    A limited review is presented of the outlook for the electric power supply and demand during the period 1980 to 1989. Only the adequacy and reliability aspects of bulk electric power supply in the contiguous US are considered. The economic, financial and environmental aspects of electric power system planning and the distribution of electricity (below the transmission level) are topics of prime importance, but they are outside the scope of this report.

  5. The Effect of Signal Quality and Contiguous Word of Mouth on Customer Acquisition for a Video-on-Demand Service


    Sungjoon Nam; Puneet Manchanda; Pradeep K. Chintagunta


    This paper documents the existence and magnitude of contiguous word-of-mouth effects of signal quality of a video-on-demand (VOD) service on customer acquisition. We operationalize contiguous word-of-mouth effect based on geographic proximity and use behavioral data to quantify the effect. The signal quality for this VOD service is exogenously determined, objectively measured, and spatially uncorrelated. Furthermore, it is unobserved to the potential subscriber and is revealed postadoption. F...

  6. Impact of Expanded North Slope of Alaska Crude Oil Production on Crude Oil Flows in the Contiguous United States

    Energy Technology Data Exchange (ETDEWEB)

    DeRosa, Sean E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flanagan, Tatiana Paz [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)


    The National Transportation Fuels Model was used to simulate a hypothetical increase in North Slope of Alaska crude oil production. The results show that the magnitude of production utilized depends in part on the ability of crude oil and refined products infrastructure in the contiguous United States to absorb and adjust to the additional supply. Decisions about expanding North Slope production can use the National Transportation Fuels Model take into account the effects on crude oil flows in the contiguous United States.

  7. Modulation of early cortical processing during divided attention to non-contiguous locations. (United States)

    Frey, Hans-Peter; Schmid, Anita M; Murphy, Jeremy W; Molholm, Sophie; Lalor, Edmund C; Foxe, John J


    We often face the challenge of simultaneously attending to multiple non-contiguous regions of space. There is ongoing debate as to how spatial attention is divided under these situations. Whereas, for several years, the predominant view was that humans could divide the attentional spotlight, several recent studies argue in favor of a unitary spotlight that rhythmically samples relevant locations. Here, this issue was addressed by the use of high-density electrophysiology in concert with the multifocal m-sequence technique to examine visual evoked responses to multiple simultaneous streams of stimulation. Concurrently, we assayed the topographic distribution of alpha-band oscillatory mechanisms, a measure of attentional suppression. Participants performed a difficult detection task that required simultaneous attention to two stimuli in contiguous (undivided) or non-contiguous parts of space. In the undivided condition, the classic pattern of attentional modulation was observed, with increased amplitude of the early visual evoked response and increased alpha amplitude ipsilateral to the attended hemifield. For the divided condition, early visual responses to attended stimuli were also enhanced, and the observed multifocal topographic distribution of alpha suppression was in line with the divided attention hypothesis. These results support the existence of divided attentional spotlights, providing evidence that the corresponding modulation occurs during initial sensory processing time-frames in hierarchically early visual regions, and that suppressive mechanisms of visual attention selectively target distracter locations during divided spatial attention. © 2014 Federation of European Neuroscience Societies and John Wiley & Sons Ltd.

  8. Projected 21st century climate change for wolverine habitats within the contiguous United States

    Energy Technology Data Exchange (ETDEWEB)

    Peacock, Synte, E-mail: [National Center for Atmospheric Research, 1850 Table Mesa Drive, Boulder, CO 80305 (United States)


    Ensembles of 21st century climate projections made using a state of the art global climate model are analyzed to explore possible changes in spring snow cover and summer air temperature in present-day wolverine habitats in the contiguous United States (US). Projected changes in both snow cover and temperature are presented for a range of future emissions scenarios, and implications for the continued survival of the wolverine in the contiguous US are discussed. It is shown that under a high or medium-low emissions scenario there are likely to be dramatic reductions in spring snow cover in present-day wolverine habitats. Under these scenarios there is also likely to be a concomitant increase in summer-time temperatures, with projected maximum daily August temperatures far above those currently tolerated by the wolverine. It is likely that the wolverine, with its many adaptations for cold weather and deep snow pack, would have great difficulty adapting to such changes. The results of the simulations presented here suggest that the very low numbers of wolverines currently living in the contiguous US will likely further decline in response to the deterioration of their habitat in coming decades.

  9. Projected 21st century climate change for wolverine habitats within the contiguous United States

    International Nuclear Information System (INIS)

    Peacock, Synte


    Ensembles of 21st century climate projections made using a state of the art global climate model are analyzed to explore possible changes in spring snow cover and summer air temperature in present-day wolverine habitats in the contiguous United States (US). Projected changes in both snow cover and temperature are presented for a range of future emissions scenarios, and implications for the continued survival of the wolverine in the contiguous US are discussed. It is shown that under a high or medium-low emissions scenario there are likely to be dramatic reductions in spring snow cover in present-day wolverine habitats. Under these scenarios there is also likely to be a concomitant increase in summer-time temperatures, with projected maximum daily August temperatures far above those currently tolerated by the wolverine. It is likely that the wolverine, with its many adaptations for cold weather and deep snow pack, would have great difficulty adapting to such changes. The results of the simulations presented here suggest that the very low numbers of wolverines currently living in the contiguous US will likely further decline in response to the deterioration of their habitat in coming decades.

  10. Fractional distillation of oil

    Energy Technology Data Exchange (ETDEWEB)

    Jones, L D


    A method of dividing oil into lubricating oil fractions without substantial cracking by introducing the oil in a heated state into a fractionating column from which oil fractions having different boiling points are withdrawn at different levels, while reflux liquid is supplied to the top of the column, and additional heat is introduced into the column by contacting with the oil therein a heated fluid of higher monlecular weight than water and less susceptible to thermal decomposition than is the highest boiling oil fraction resulting from the distillation, or of which any products produced by thermal decomposition will not occur in the highest boiling distillate withdrawn from the column.

  11. Analytical solutions of time–space fractional, advection–dispersion

    Indian Academy of Sciences (India)

    Home; Journals; Pramana – Journal of Physics; Volume 83; Issue 6 ... In this article, we study time–space fractional advection–dispersion (FADE) equation and ... Lahore University of Management Sciences, Lahore Cantt 54792, Pakistan ...

  12. Contiguous polarisation spectra of the Earth from 300-850 nm measured by GOME-2 onboard MetOp-A (United States)

    Tilstra, L. G.; Lang, R.; Munro, R.; Aben, I.; Stammes, P.


    In this paper we present the first contiguous high-resolution spectra of the Earth's polarisation observed by a satellite instrument. The measurements of the Stokes fraction Q/I are performed by the spectrometer GOME-2 onboard the MetOp-A satellite. Polarisation measurements by GOME-2 are performed by onboard polarisation measurement devices (PMDs) and the high-resolution measurements discussed in this paper are taken in the special "PMD RAW" mode of operation. The spectral resolution of these PMD RAW polarisation measurements varies from 3 nm in the ultraviolet (UV) to 35 nm in the near-infrared wavelength range. We first compare measurements of the polarisation from cloud-free scenes with radiative transfer calculations for a number of cases. We find good agreement but also a spectral discrepancy at 800 nm, which we attribute to remaining imperfections in the calibration key data. Secondly, we study the polarisation of scenes with special scattering geometries that normally lead to near-zero Q/I. The GOME-2 polarisation spectra indeed show this behaviour and confirm the existence of the small discrepancy found earlier. Thirdly, we study the Earth polarisation for a variety of scenes. This provides a blueprint of Q/I over land and sea surfaces for various degrees of cloud cover. Fourthly, we compare the spectral dependence of measurements of Q/I in the UV with the generalised distribution function that was proposed in the past (Schutgens and Stammes, 2002) to describe the shape of the UV polarisation spectrum. The GOME-2 data confirm that these functions match the spectral behaviour captured by the GOME-2 PMD RAW mode.

  13. Contiguous polarisation spectra of the Earth from 300 to 850 nm measured by GOME-2 onboard MetOp-A (United States)

    Tilstra, L. G.; Lang, R.; Munro, R.; Aben, I.; Stammes, P.


    In this paper we present the first contiguous high-resolution spectra of the Earth's polarisation observed by a satellite instrument. The measurements of the Stokes fraction Q/I are performed by the spectrometer GOME-2 onboard the MetOp-A satellite. Polarisation measurements by GOME-2 are performed by onboard polarisation measurement devices (PMDs) and the high-resolution measurements discussed in this paper are taken in the special "PMD RAW" mode of operation. The spectral resolution of these PMD RAW polarisation measurements varies from 3 nm in the ultraviolet (UV) to 35 nm in the near-infrared wavelength range. We first compare measurements of the polarisation from cloud-free scenes with radiative transfer calculations for a number of cases. We find good agreement but also a spectral discrepancy at 800 nm, which we attribute to remaining imperfections in the calibration key data. Secondly, we study the polarisation of scenes with special scattering geometries that normally lead to near-zero Q/I. The GOME-2 polarisation spectra indeed show this behaviour and confirm the existence of the small discrepancy found earlier. Thirdly, we study the Earth polarisation for a variety of scenes. This provides a blueprint of Q/I over land and sea surfaces for various degrees of cloud cover. Fourthly, we compare the spectral dependence of measurements of Q/I in the UV with the generalised distribution function proposed by Schutgens and Stammes (2002) to describe the shape of the UV polarisation spectrum. The GOME-2 data confirm that these functions match the spectral behaviour captured by the GOME-2 PMD RAW mode.

  14. Software quality assurance plan for void fraction instrument

    International Nuclear Information System (INIS)

    Gimera, M.


    Waste Tank SY-101 has been the focus of extensive characterization work over the past few years. The waste continually generates gases, most notably hydrogen, which are periodically released from the waste. Gas can be trapped in tank waste in three forms: as void gas (bubbles), dissolved gas, or absorbed gas. Void fraction is the volume percentage of a given sample that is comprised of void gas. The void fraction instrument (VFI) acquires the data necessary to calculate void fraction. This document covers the product, Void Fraction Data Acquisition Software. The void fraction software being developed will have the ability to control the void fraction instrument hardware and acquire data necessary to calculate the void fraction in samples. This document provides the software quality assurance plan, verification and validation plan, and configuration management plan for developing the software for the instrumentation that will be used to obtain void fraction data from Tank SY-101

  15. Fractional Poisson process (II)

    International Nuclear Information System (INIS)

    Wang Xiaotian; Wen Zhixiong; Zhang Shiying


    In this paper, we propose a stochastic process W H (t)(H-bar (12,1)) which we call fractional Poisson process. The process W H (t) is self-similar in wide sense, displays long range dependence, and has more fatter tail than Gaussian process. In addition, it converges to fractional Brownian motion in distribution

  16. An Appetite for Fractions (United States)

    Wilkerson, Trena L.; Bryan, Tommy; Curry, Jane


    This article describes how using candy bars as models gives sixth-grade students a taste for learning to represent fractions whose denominators are factors of twelve. Using paper models of the candy bars, students explored and compared fractions. They noticed fewer different representations for one-third than for one-half. The authors conclude…

  17. Can Kindergartners Do Fractions? (United States)

    Cwikla, Julie


    Mathematics professor Julie Cwikla decided that she needed to investigate young children's understandings and see what precurricular partitioning notions young minds bring to the fraction table. Cwikla realized that only a handful of studies have examined how preschool-age and early elementary school-age students solve fraction problems (Empson…

  18. Fractional bosonic strings (United States)

    Diaz, Victor Alfonzo; Giusti, Andrea


    The aim of this paper is to present a simple generalization of bosonic string theory in the framework of the theory of fractional variational problems. Specifically, we present a fractional extension of the Polyakov action, for which we compute the general form of the equations of motion and discuss the connection between the new fractional action and a generalization the Nambu-Goto action. Consequently, we analyze the symmetries of the modified Polyakov action and try to fix the gauge, following the classical procedures. Then we solve the equations of motion in a simplified setting. Finally, we present a Hamiltonian description of the classical fractional bosonic string and introduce the fractional light-cone gauge. It is important to remark that, throughout the whole paper, we thoroughly discuss how to recover the known results as an "integer" limit of the presented model.

  19. Fractional Order Generalized Information

    Directory of Open Access Journals (Sweden)

    José Tenreiro Machado


    Full Text Available This paper formulates a novel expression for entropy inspired in the properties of Fractional Calculus. The characteristics of the generalized fractional entropy are tested both in standard probability distributions and real world data series. The results reveal that tuning the fractional order allow an high sensitivity to the signal evolution, which is useful in describing the dynamics of complex systems. The concepts are also extended to relative distances and tested with several sets of data, confirming the goodness of the generalization.

  20. Fractional finite Fourier transform. (United States)

    Khare, Kedar; George, Nicholas


    We show that a fractional version of the finite Fourier transform may be defined by using prolate spheroidal wave functions of order zero. The transform is linear and additive in its index and asymptotically goes over to Namias's definition of the fractional Fourier transform. As a special case of this definition, it is shown that the finite Fourier transform may be inverted by using information over a finite range of frequencies in Fourier space, the inversion being sensitive to noise. Numerical illustrations for both forward (fractional) and inverse finite transforms are provided.

  1. Social Trust and Fractionalization:

    DEFF Research Database (Denmark)

    Bjørnskov, Christian


    This paper takes a closer look at the importance of fractionalization for the creation of social trust. It first argues that the determinants of trust can be divided into two categories: those affecting individuals' trust radii and those affecting social polarization. A series of estimates using...... a much larger country sample than in previous literature confirms that fractionalization in the form of income inequality and political diversity adversely affects social trust while ethnic diversity does not. However, these effects differ systematically across countries, questioning standard...... interpretations of the influence of fractionalization on trust....


    Directory of Open Access Journals (Sweden)

    Sead Rešić


    Full Text Available Fractions represent the manner of writing parts of whole numbers (integers. Rules for operations with fractions differ from rules for operations with integers. Students face difficulties in understanding fractions, especially operations with fractions. These difficulties are well known in didactics of Mathematics throughout the world and there is a lot of research regarding problems in learning about fractions. Methods for facilitating understanding fractions have been discovered, which are essentially related to visualizing operations with fractions.

  3. Fractional Stochastic Field Theory (United States)

    Honkonen, Juha


    Models describing evolution of physical, chemical, biological, social and financial processes are often formulated as differential equations with the understanding that they are large-scale equations for averages of quantities describing intrinsically random processes. Explicit account of randomness may lead to significant changes in the asymptotic behaviour (anomalous scaling) in such models especially in low spatial dimensions, which in many cases may be captured with the use of the renormalization group. Anomalous scaling and memory effects may also be introduced with the use of fractional derivatives and fractional noise. Construction of renormalized stochastic field theory with fractional derivatives and fractional noise in the underlying stochastic differential equations and master equations and the interplay between fluctuation-induced and built-in anomalous scaling behaviour is reviewed and discussed.

  4. Discrete fractional calculus

    CERN Document Server

    Goodrich, Christopher


    This text provides the first comprehensive treatment of the discrete fractional calculus. Experienced researchers will find the text useful as a reference for discrete fractional calculus and topics of current interest. Students who are interested in learning about discrete fractional calculus will find this text to provide a useful starting point. Several exercises are offered at the end of each chapter and select answers have been provided at the end of the book. The presentation of the content is designed to give ample flexibility for potential use in a myriad of courses and for independent study. The novel approach taken by the authors includes a simultaneous treatment of the fractional- and integer-order difference calculus (on a variety of time scales, including both the usual forward and backwards difference operators). The reader will acquire a solid foundation in the classical topics of the discrete calculus while being introduced to exciting recent developments, bringing them to the frontiers of the...

  5. Fractional smith chart theory

    KAUST Repository

    Shamim, Atif; Radwan, Ahmed Gomaa; Salama, Khaled N.


    matching networks, where the fractional approach proves to be much more versatile and results in a single element matching network for a complex load as compared to the two elements in the conventional approach. © 2010 IEEE.

  6. Quantitative analysis of cardiac function: Comparison of electrocardiogram dual gated single photon emission tomography, planar radionuclide ventriculogram and contrast ventriculography in the determination of LV volume and ejection fraction

    Energy Technology Data Exchange (ETDEWEB)

    Ziada, G.; Abdel-Dayem, H.M.; Higazy, E.; Mohamed, M.M.; Bahar, R.; Hayat, N.; Yousof, A.M.


    A dual gated tomography (DGT) program for end systolic and end diastolic acquisition and subsequent processing for calculation of LVEF, end diastolic and end systolic volumes (EDV, ESV) has been evaluated in 20 healthy volunteers (25 years-40 years) and 45 patients (25 years-60 years): 20 with ischaemic heart disease and 25 with valvular heart disease (VHD). All had biplane multigated blood pool (MUGA) studies in the 40/sup 0/ LAO projection using in vivo /sup 99m/Tc-R BCs, immediately followed by DG. The results in the patients group were correlated with contrast ventriculography (CV). In the volunteer group, the normal values for LVEF, EDV and ESV measured with DGT were found to be 63%+10%, 91 ml + 6 ml and 30 ml + 6ml and r value for the LVEF=0.91 compared with MUGA. In the IHD group, r values compared with CV were 0.915 and 0.97 for the EDV and ESV and 0.934 for the LVEF. Compared with the MUGA, the r value for LVEF was 0.883. In the VHD group, r values were 0.98 for both the EDV and ESV and 0.948 for the LVEF (P<0.002) compared with CV and 0.789 for the LVEF compared with the MUGA. We feel that DGT is an accurate and reproducible technique for LV function measurements.

  7. Intracellular Cadmium Isotope Fractionation (United States)

    Horner, T. J.; Lee, R. B.; Henderson, G. M.; Rickaby, R. E.


    Recent stable isotope studies into the biological utilization of transition metals (e.g. Cu, Fe, Zn, Cd) suggest several stepwise cellular processes can fractionate isotopes in both culture and nature. However, the determination of fractionation factors is often unsatisfactory, as significant variability can exist - even between different organisms with the same cellular functions. Thus, it has not been possible to adequately understand the source and mechanisms of metal isotopic fractionation. In order to address this problem, we investigated the biological fractionation of Cd isotopes within genetically-modified bacteria (E. coli). There is currently only one known biological use or requirement of Cd, a Cd/Zn carbonic anhydrase (CdCA, from the marine diatom T. weissfloggii), which we introduce into the E. coli genome. We have also developed a cleaning procedure that allows for the treating of bacteria so as to study the isotopic composition of different cellular components. We find that whole cells always exhibit a preference for uptake of the lighter isotopes of Cd. Notably, whole cells appear to have a similar Cd isotopic composition regardless of the expression of CdCA within the E. coli. However, isotopic fractionation can occur within the genetically modified E. coli during Cd use, such that Cd bound in CdCA can display a distinct isotopic composition compared to the cell as a whole. Thus, the externally observed fractionation is independent of the internal uses of Cd, with the largest Cd isotope fractionation occurring during cross-membrane transport. A general implication of these experiments is that trace metal isotopic fractionation most likely reflects metal transport into biological cells (either actively or passively), rather than relating to expression of specific physiological function and genetic expression of different metalloenzymes.

  8. Semi solid metal processing: The fraction solid dilemma

    International Nuclear Information System (INIS)

    Nafisi, S.; Emadi, D.; Ghomashchi, R.


    One of the most challenging aspects in semi solid metal (SSM) processing is to determine the actual volume fraction of the solid at the processing temperature. The fraction has great impact on the SSM slurry viscosity and the subsequent filling of the mold in the casting stage. Three methods, namely quantitative metallography, thermodynamic calculation, and thermal analysis are employed to investigate and clarify the contradictory open literature reports about the real value of the volume fraction of primary particles. It is reported that the discrepancies between the results obtained by different methods are caused mainly by variations in cooling rates and by coarsening of the primaries during the quenching process

  9. Semi solid metal processing: The fraction solid dilemma

    Energy Technology Data Exchange (ETDEWEB)

    Nafisi, S. [EVRAZ Inc. NA 100 Armour Road, Regina, SK, S4P 3C7 (Canada)], E-mail:; Emadi, D. [CEPG, CanmetENERGY, Natural Resources Canada, Ottawa, ON, K1A 1M1 (Canada); Ghomashchi, R. [Advanced Materials and Processing Research Institute, Suite 122, A7-1390 Major MacKenzie, ON, L4S 0A1 (Canada)


    One of the most challenging aspects in semi solid metal (SSM) processing is to determine the actual volume fraction of the solid at the processing temperature. The fraction has great impact on the SSM slurry viscosity and the subsequent filling of the mold in the casting stage. Three methods, namely quantitative metallography, thermodynamic calculation, and thermal analysis are employed to investigate and clarify the contradictory open literature reports about the real value of the volume fraction of primary particles. It is reported that the discrepancies between the results obtained by different methods are caused mainly by variations in cooling rates and by coarsening of the primaries during the quenching process.

  10. Fractional laser skin resurfacing. (United States)

    Alexiades-Armenakas, Macrene R; Dover, Jeffrey S; Arndt, Kenneth A


    Laser skin resurfacing (LSR) has evolved over the past 2 decades from traditional ablative to fractional nonablative and fractional ablative resurfacing. Traditional ablative LSR was highly effective in reducing rhytides, photoaging, and acne scarring but was associated with significant side effects and complications. In contrast, nonablative LSR was very safe but failed to deliver consistent clinical improvement. Fractional LSR has achieved the middle ground; it combined the efficacy of traditional LSR with the safety of nonablative modalities. The first fractional laser was a nonablative erbium-doped yttrium aluminum garnet (Er:YAG) laser that produced microscopic columns of thermal injury in the epidermis and upper dermis. Heralding an entirely new concept of laser energy delivery, it delivered the laser beam in microarrays. It resulted in microscopic columns of treated tissue and intervening areas of untreated skin, which yielded rapid reepithelialization. Fractional delivery was quickly applied to ablative wavelengths such as carbon dioxide, Er:YAG, and yttrium scandium gallium garnet (2,790 nm), providing more significant clinical outcomes. Adjustable laser parameters, including power, pitch, dwell time, and spot density, allowed for precise determination of percent surface area, affected penetration depth, and clinical recovery time and efficacy. Fractional LSR has been a significant advance to the laser field, striking the balance between safety and efficacy.

  11. Unusual presentation of Kallmannn syndrome with contiguous gene deletion in three siblings of a family

    Directory of Open Access Journals (Sweden)

    Sri Venkat Madhu


    Full Text Available We report the case of 3 brothers aged 34, 24, and 22 years, unmarried, who presented to our endocrinology clinic with absence of secondary sexual characters. There was no such history in other siblings, but their maternal uncle had similar complaints. On examination, all 3 had pre-pubertal appearance, voice, and genitalia along with anosmia and bimanual synkinesia. Cryptorchidism was noticed in 2 while third person had small hypoplastic testes. It was also noted that all 3 patients had icthyosis mainly involving trunk, back, and limbs. The hormonal assays were consistent with isolated hypogonadotrophic hypogonadism. IQ testing revealed mental retardation in the 2 patients. Ultrasound showed ectopic right kidney in one patient, atrophic right kidney in the second patient while the third patient had normal kidneys. MRI brain of all the patients showed poorly visualized olfactory tract and bulb. Kallmann syndrome (KS was diagnosed based on hormonal evaluation and MRI results. Of the four types of KS: Synkinesia, renal anomaly, and X-linked pedigree pattern in our patients pointed towards X-linked type 1 KS as the possible cause. But, icthyosis and mental retardation are not usual presentation of type 1 KS. They are usually seen as a result of contiguous gene deletion of KAL1, steroid sulfatase (STS, and mental retardation (MRX gene on X chromosome. Hence, the possible gene defect in our cases is inherited defect in contiguous gene deletion. The contiguous gene deletion as the cause of KS in 3 patients of same family is very rare and worth reporting. Also, the significance of phenotype-genotypic association in Kallmann syndrome is discussed

  12. Two-Phase Contiguous Supported Lipid Bilayer Model for Membrane Rafts via Polymer Blotting and Stenciling. (United States)

    Richards, Mark J; Daniel, Susan


    The supported lipid bilayer has been portrayed as a useful model of the cell membrane compatible with many biophysical tools and techniques that demonstrate its appeal in learning about the basic features of the plasma membrane. However, some of its potential has yet to be realized, particularly in the area of bilayer patterning and phase/composition heterogeneity. In this work, we generate contiguous bilayer patterns as a model system that captures the general features of membrane domains and lipid rafts. Micropatterned polymer templates of two types are investigated for generating patterned bilayer formation: polymer blotting and polymer lift-off stenciling. While these approaches have been used previously to create bilayer arrays by corralling bilayers patches with various types of boundaries impenetrable to bilayer diffusion, unique to the methods presented here, there are no physical barriers to diffusion. In this work, interfaces between contiguous lipid phases define the pattern shapes, with continuity between them allowing transfer of membrane-bound biomolecules between the phases. We examine effectors of membrane domain stability including temperature and cholesterol content to investigate domain dynamics. Contiguous patterning of supported bilayers as a model of lipid rafts expands the application of the SLB to an area with current appeal and brings with it a useful toolset for characterization and analysis. These combined tools should be helpful to researchers investigating lipid raft dynamics and function and biomolecule partitioning studies. Additionally, this patterning technique may be useful for applications such as bioseparations that exploit differences in lipid phase partitioning or creation of membranes that bind species like viruses preferentially at lipid phase boundaries, to name a few.

  13. TRMM-3B43 Bias Correction over the High Elevations of the Contiguous United States (United States)

    Hashemi, H.; Nordin, K. M.; Lakshmi, V.; Knight, R. J.


    Precipitation can be quantified using a rain gauge network, or a remotely sensed precipitation product. Ultimately, the choice of dataset depends on the particular application, the catchment size, climate and the time period of study. In a region with a long record and a dense rain gauge network, the elevation-modified ground-based precipitation product, PRISM, has been found to work well. However, in poorly gauged regions the use of remotely sensed precipitation products is an absolute necessity. The Tropical Rainfall Measuring Mission (TRMM) has provided valuable precipitation datasets for hydrometeorological studies over the past two decades (1998-2015). One concern regarding the usage of TRMM data is the accuracy of the precipitation estimates, when compared to those obtained using PRISM. The reason for this concern is that TRMM and PRISM do not always agree and, typically, TRMM underestimates PRISM over the mountainous regions of the United States. In this study, we develop a correction function to improve the accuracy of the TRMM monthly product (TRMM-3B43) by estimating and removing the bias in the satellite data using the ground-based precipitation product, PRISM. We observe a strong relationship between the bias and land surface elevation; TRMM-3B43 tends to underestimate the PRISM product at altitudes greater than 1500 m above mean sea level (m.amsl) in the contiguous United States. A relationship is developed between TRMM-PRISM bias and elevation. The correction function is used to adjust the TRMM monthly precipitation using PRISM and elevation data. The model is calibrated using 25% of the available time period and the remaining 75% of the time period is used for validation. The corrected TRMM-3B43 product is verified for the high elevations over the contiguous United States and two local regions in the mountainous areas of the western United States. The results show a significant improvement in the accuracy of the TRMM product in the high elevations of

  14. Human Episodic Memory Retrieval Is Accompanied by a Neural Contiguity Effect. (United States)

    Folkerts, Sarah; Rutishauser, Ueli; Howard, Marc W


    Cognitive psychologists have long hypothesized that experiences are encoded in a temporal context that changes gradually over time. When an episodic memory is retrieved, the state of context is recovered-a jump back in time. We recorded from single units in the medial temporal lobe of epilepsy patients performing an item recognition task. The population vector changed gradually over minutes during presentation of the list. When a probe from the list was remembered with high confidence, the population vector reinstated the temporal context of the original presentation of that probe during study, a neural contiguity effect that provides a possible mechanism for behavioral contiguity effects. This pattern was only observed for well remembered probes; old probes that were not well remembered showed an anti-contiguity effect. These results constitute the first direct evidence that recovery of an episodic memory in humans is associated with retrieval of a gradually changing state of temporal context, a neural "jump back in time" that parallels the act of remembering. SIGNIFICANCE STATEMENT Episodic memory is the ability to relive a specific experience from one's life. For decades, researchers have hypothesized that, unlike other forms of memory that can be described as simple associations between stimuli, episodic memory depends on the recovery of a neural representation of spatiotemporal context. During study of a sequence of stimuli, the brain state of epilepsy patients changed slowly over at least a minute. When the participant remembered a particular event from the list, this gradually changing state was recovered. This provides direct confirmation of the prediction from computational models of episodic memory. The resolution of this point means that the study of episodic memory can focus on the mechanisms by which this representation of spatiotemporal context is maintained and sometimes recovered. Copyright © 2018 the authors 0270-6474/18/384200-12$15.00/0.

  15. Quantifying the risk of spread of bovine viral diarrhoea virus (BVDV) between contiguous herds in Ireland. (United States)

    Graham, D A; Clegg, T A; Thulke, H-H; O'Sullivan, P; McGrath, G; More, S J


    The control of bovine viral diarrhoea virus (BVDV) mainly focuses on the identification and restriction of persistently infected (PI) animals. However, other transmission pathways can also result in new breakdowns, including the movement of animals pregnant with PI calves (Trojan animals) and the spread of infection between contiguous farms. Contiguous spread is likely an important problem in the BVD eradication programme in Ireland, given the spatial distribution of residual infection, and the highly fragmented nature of land holdings on many Irish farms. In this study, we seek to quantify the risk of BVD spread between contiguous herds in Ireland. Multivariable logistic models were used to estimate the risk of a herd having BVD positive calves in January to June 2014 (the study period) when contiguous to a herd that had at least one BVD positive calf born in 2013. The models included risk factors relating to the study herd and to neighbouring herds. Separate multivariable models were built for each of four "PI-neighbour" factors relating to the presence of BVD+ animals and/or the presence of offspring of PI breeding animals. In total, 58,483 study herds were enrolled. The final model contained the province, the log of the number of calf births born during the study period, the number of cattle purchased between January 2013 and January 2014, and with a two-way interaction between the number of animals of unknown BVD status in the study herd and the PI-neighbour risk factor. When the number of PI-neighbour herds was used as the PI-neighbour risk factor, the odds ratio (OR) associated with the number of PI-neighbour herds ranged from 1.07 to 3.02, depending on the number of unknown animals present. To further explore the risk associated with PI-neighbour factors, the models were repeated using a subset of the study herds (n=7440) that contained no animals of unknown status. The best fitting model including "any PI-neighbour" as the PI-neighbour factor and also

  16. Series expansion in fractional calculus and fractional differential equations


    Li, Ming-Fan; Ren, Ji-Rong; Zhu, Tao


    Fractional calculus is the calculus of differentiation and integration of non-integer orders. In a recently paper (Annals of Physics 323 (2008) 2756-2778), the Fundamental Theorem of Fractional Calculus is highlighted. Based on this theorem, in this paper we introduce fractional series expansion method to fractional calculus. We define a kind of fractional Taylor series of an infinitely fractionally-differentiable function. Further, based on our definition we generalize hypergeometric functio...

  17. Spatiotemporal Fractionation Schemes for Irradiating Large Cerebral Arteriovenous Malformations

    Energy Technology Data Exchange (ETDEWEB)

    Unkelbach, Jan, E-mail: [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Bussière, Marc R. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States); Chapman, Paul H. [Department of Neurosurgery, Massachusetts General Hospital, Boston, Massachusetts (United States); Loeffler, Jay S.; Shih, Helen A. [Department of Radiation Oncology, Massachusetts General Hospital, Boston, Massachusetts (United States)


    Purpose: To optimally exploit fractionation effects in the context of radiosurgery treatments of large cerebral arteriovenous malformations (AVMs). In current practice, fractionated treatments divide the dose evenly into several fractions, which generally leads to low obliteration rates. In this work, we investigate the potential benefit of delivering distinct dose distributions in different fractions. Methods and Materials: Five patients with large cerebral AVMs were reviewed and replanned for intensity modulated arc therapy delivered with conventional photon beams. Treatment plans allowing for different dose distributions in all fractions were obtained by performing treatment plan optimization based on the cumulative biologically effective dose delivered at the end of treatment. Results: We show that distinct treatment plans can be designed for different fractions, such that high single-fraction doses are delivered to complementary parts of the AVM. All plans create a similar dose bath in the surrounding normal brain and thereby exploit the fractionation effect. This partial hypofractionation in the AVM along with fractionation in normal brain achieves a net improvement of the therapeutic ratio. We show that a biological dose reduction of approximately 10% in the healthy brain can be achieved compared with reference treatment schedules that deliver the same dose distribution in all fractions. Conclusions: Boosting complementary parts of the target volume in different fractions may provide a therapeutic advantage in fractionated radiosurgery treatments of large cerebral AVMs. The strategy allows for a mean dose reduction in normal brain that may be valuable for a patient population with an otherwise normal life expectancy.

  18. Water dynamics in different biochar fractions. (United States)

    Conte, Pellegrino; Nestle, Nikolaus


    Biochar is a carbonaceous porous material deliberately applied to soil to improve its fertility. The mechanisms through which biochar acts on fertility are still poorly understood. The effect of biochar texture size on water dynamics was investigated here in order to provide information to address future research on nutrient mobility towards plant roots as biochar is applied as soil amendment. A poplar biochar has been stainless steel fractionated in three different textured fractions (1.0-2.0 mm, 0.3-1.0 mm and <0.3 mm, respectively). Water-saturated fractions were analyzed by fast field cycling (FFC) NMR relaxometry. Results proved that 3D exchange between bound and bulk water predominantly occurred in the coarsest fraction. However, as porosity decreased, water motion was mainly associated to a restricted 2D diffusion among the surface-site pores and the bulk-site ones. The X-ray μ-CT imaging analyses on the dry fractions revealed the lowest surface/volume ratio for the coarsest fraction, thereby corroborating the 3D water exchange mechanism hypothesized by FFC NMR relaxometry. However, multi-micrometer porosity was evidenced in all the samples. The latter finding suggested that the 3D exchange mechanism cannot even be neglected in the finest fraction as previously excluded only on the basis of NMR relaxometry results. X-ray μ-CT imaging showed heterogeneous distribution of inorganic materials inside all the fractions. The mineral components may contribute to the water relaxation mechanisms by FFC NMR relaxometry. Further studies are needed to understand the role of the inorganic particles on water dynamics. Copyright © 2015 John Wiley & Sons, Ltd.

  19. Novel Handover Optimization with a Coordinated Contiguous Carrier Aggregation Deployment Scenario in LTE-Advanced Systems

    Directory of Open Access Journals (Sweden)

    Ibraheem Shayea


    Full Text Available The carrier aggregation (CA technique and Handover Parameters Optimization (HPO function have been introduced in LTE-Advanced systems to enhance system performance in terms of throughput, coverage area, and connection stability and to reduce management complexity. Although LTE-Advanced has benefited from the CA technique, the low spectral efficiency and high ping-pong effect with high outage probabilities in conventional Carrier Aggregation Deployment Scenarios (CADSs have become major challenges for cell edge User Equipment (UE. Also, the existing HPO algorithms are not optimal for selecting the appropriate handover control parameters (HCPs. This paper proposes two solutions by deploying a Coordinated Contiguous-CADS (CC-CADS and a Novel Handover Parameters Optimization algorithm that is based on the Weight Performance Function (NHPO-WPF. The CC-CADS uses two contiguous component carriers (CCs that have two different beam directions. The NHPO-WPF automatically adjusts the HCPs based on the Weight Performance Function (WPF, which is evaluated as a function of the Signal-to-Interference Noise Ratio (SINR, cell load, and UE’s velocity. Simulation results show that the CC-CADS and the NHPO-WPF algorithm provide significant enhancements in system performance over that of conventional CADSs and HPO algorithms from the literature, respectively. The integration of both solutions achieves even better performance than scenarios in which each solution is considered independently.

  20. Application of Spatial Regression Models to Income Poverty Ratios in Middle Delta Contiguous Counties in Egypt

    Directory of Open Access Journals (Sweden)

    Sohair F Higazi


    Full Text Available Regression analysis depends on several assumptions that have to be satisfied. A major assumption that is never satisfied when variables are from contiguous observations is the independence of error terms. Spatial analysis treated the violation of that assumption by two derived models that put contiguity of observations into consideration. Data used are from Egypt's 2006 latest census, for 93 counties in middle delta seven adjacent Governorates. The dependent variable used is the percent of individuals classified as poor (those who make less than 1$ daily. Predictors are some demographic indicators. Explanatory Spatial Data Analysis (ESDA is performed to examine the existence of spatial clustering and spatial autocorrelation between neighboring counties. The ESDA revealed spatial clusters and spatial correlation between locations. Three statistical models are applied to the data, the Ordinary Least Square regression model (OLS, the Spatial Error Model (SEM and the Spatial Lag Model (SLM.The Likelihood Ratio test and some information criterions are used to compare SLM and SEM to OLS. The SEM model proved to be better than the SLM model. Recommendations are drawn regarding the two spatial models used.

  1. Xp21 contiguous gene syndromes: Deletion quantitation with bivariate flow karyotyping allows mapping of patient breakpoints

    Energy Technology Data Exchange (ETDEWEB)

    McCabe, E.R.B.; Towbin, J.A. (Baylor College of Medicine, Houston, TX (United States)); Engh, G. van den; Trask, B.J. (Lawrence Livermore National Lab., CA (United States))


    Bivariate flow karyotyping was used to estimate the deletion sizes for a series of patients with Xp21 contiguous gene syndromes. The deletion estimates were used to develop an approximate scale for the genomic map in Xp21. The bivariate flow karyotype results were compared with clinical and molecular genetic information on the extent of the patients' deletions, and these various types of data were consistent. The resulting map spans >15 Mb, from the telomeric interval between DXS41 (99-6) and DXS68 (1-4) to a position centromeric to the ornithine transcarbamylase locus. The deletion sizing was considered to be accurate to [plus minus]1 Mb. The map provides information on the relative localization of genes and markers within this region. For example, the map suggests that the adrenal hypoplasia congenita and glycerol kinase genes are physically close to each other, are within 1-2 Mb of the telomeric end of the Duchenne muscular dystrophy (DMD) gene, and are nearer to the DMD locus than to the more distal marker DXS28 (C7). Information of this type is useful in developing genomic strategies for positional cloning in Xp21. These investigations demonstrate that the DNA from patients with Xp21 contiguous gene syndromes can be valuable reagents, not only for ordering loci and markers but also for providing an approximate scale to the map of the Xp21 region surrounding DMD. 44 refs., 3 figs.

  2. Duchenne muscular dystrophy in a female with compound heterozygous contiguous exon deletions. (United States)

    Takeshita, Eri; Minami, Narihiro; Minami, Kumiko; Suzuki, Mikiya; Awashima, Takeya; Ishiyama, Akihiko; Komaki, Hirofumi; Nishino, Ichizo; Sasaki, Masayuki


    Females with Duchenne muscular dystrophy (DMD) and Becker muscular dystrophy (BMD) mutations rarely exhibit clinical symptoms from childhood, although potential mechanisms for symptoms associated with DMD and BMD in females have been reported. We report the case of a female DMD patient with a clinical course indistinguishable from that of a male DMD patient, and who possessed compound heterozygous contiguous exon deletions in the dystrophin gene. She exhibited Gowers' sign, calf muscle hypertrophy, and a high serum creatine kinase level at 2 years. Her muscle pathology showed most of the fibers were negative for dystrophin immunohistochemical staining. She lost ambulation at 11 years. Multiplex ligation-dependent probe amplification analysis of this gene detected one copy of exons 48-53; she was found to be a BMD carrier with an in-frame deletion. Messenger RNA from her muscle demonstrated out-of-frame deletions of exons 48-50 and 51-53 occurring on separate alleles. Genomic DNA from her lymphocytes demonstrated the accurate deletion region on each allele. To our knowledge, this is the first report on a female patient possessing compound heterozygous contiguous exon deletions in the dystrophin gene, leading to DMD. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Airborne 3D Imaging Lidar for Contiguous Decimeter Resolution Terrain Mapping and Shallow Water Bathymetry (United States)

    Degnan, J. J.; Wells, D. N.; Huet, H.; Chauvet, N.; Lawrence, D. W.; Mitchell, S. E.; Eklund, W. D.


    A 3D imaging lidar system, developed for the University of Florida at Gainesville and operating at the water transmissive wavelength of 532 nm, is designed to contiguously map underlying terrain and/or perform shallow water bathymetry on a single overflight from an altitude of 600 m with a swath width of 225 m and a horizontal spatial resolution of 20 cm. Each 600 psec pulse from a frequency-doubled, low power (~3 microjoules @ 8 kHz = 24 mW), passively Q-switched Nd:YAG microchip laser is passed through a holographic element which projects a 10x10 array of spots onto a 2m x 2m target area. The individual ground spots are then imaged onto individual anodes within a 10x10 segmented anode photomultiplier. The latter is followed by a 100 channel multistop ranging receiver with a range resolution of about 4 cm. The multistop feature permits single photon detection in daylight with wide range gates as well as multiple single photon returns per pixel per laser fire from volumetric scatterers such as tree canopies or turbid water columns. The individual single pulse 3D images are contiguously mosaiced together through the combined action of the platform velocity and a counter-rotating dual wedge optical scanner whose rotations are synchronized to the laser pulse train. The paper provides an overview of the lidar opto-mechanical design, the synchronized dual wedge scanner and servo controller, and the experimental results obtained to date.



    Sead Rešić; Ismet Botonjić; Maid Omerović


    Fractions represent the manner of writing parts of whole numbers (integers). Rules for operations with fractions differ from rules for operations with integers. Students face difficulties in understanding fractions, especially operations with fractions. These difficulties are well known in didactics of Mathematics throughout the world and there is a lot of research regarding problems in learning about fractions. Methods for facilitating understanding fractions have been discovered...

  5. Fractional Brownian motion and motion governed by the fractional Langevin equation in confined geometries. (United States)

    Jeon, Jae-Hyung; Metzler, Ralf


    Motivated by subdiffusive motion of biomolecules observed in living cells, we study the stochastic properties of a non-Brownian particle whose motion is governed by either fractional Brownian motion or the fractional Langevin equation and restricted to a finite domain. We investigate by analytic calculations and simulations how time-averaged observables (e.g., the time-averaged mean-squared displacement and displacement correlation) are affected by spatial confinement and dimensionality. In particular, we study the degree of weak ergodicity breaking and scatter between different single trajectories for this confined motion in the subdiffusive domain. The general trend is that deviations from ergodicity are decreased with decreasing size of the movement volume and with increasing dimensionality. We define the displacement correlation function and find that this quantity shows distinct features for fractional Brownian motion, fractional Langevin equation, and continuous time subdiffusion, such that it appears an efficient measure to distinguish these different processes based on single-particle trajectory data.

  6. Fractional-order devices

    CERN Document Server

    Biswas, Karabi; Caponetto, Riccardo; Mendes Lopes, António; Tenreiro Machado, José António


    This book focuses on two specific areas related to fractional order systems – the realization of physical devices characterized by non-integer order impedance, usually called fractional-order elements (FOEs); and the characterization of vegetable tissues via electrical impedance spectroscopy (EIS) – and provides readers with new tools for designing new types of integrated circuits. The majority of the book addresses FOEs. The interest in these topics is related to the need to produce “analogue” electronic devices characterized by non-integer order impedance, and to the characterization of natural phenomena, which are systems with memory or aftereffects and for which the fractional-order calculus tool is the ideal choice for analysis. FOEs represent the building blocks for designing and realizing analogue integrated electronic circuits, which the authors believe hold the potential for a wealth of mass-market applications. The freedom to choose either an integer- or non-integer-order analogue integrator...

  7. Coal dust contiguity-induced changes in the concentration of TNF- and NF- B p65 on the ocular surface

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Z.Y.; Hong, J.; Liu, Z.Y.; Jin, X.D.; Gu, C.H. [China Medical University, Shenyang (China)


    To observe the influence of coal dust on ocular surface of coal miners and rabbits with coal dust contiguity on expression TNF- and NF- Bp65 and dry eye occurrence. Expression TNF- and NF- Bp65 in ocular surface were determined. Results showed tear production, BUT and lysozyme decreased for coal miners and rabbits with coal dust contiguity. Coal dust exposure was linked to development of xerophthalmia, and induced a higher expression of NF- B p65 and TNF- perhaps as a mechanism to resist coal dust ocular surface injury.

  8. Fractional gradient and its application to the fractional advection equation


    D'Ovidio, M.; Garra, R.


    In this paper we provide a definition of fractional gradient operators, related to directional derivatives. We develop a fractional vector calculus, providing a probabilistic interpretation and mathematical tools to treat multidimensional fractional differential equations. A first application is discussed in relation to the d-dimensional fractional advection-dispersion equation. We also study the connection with multidimensional L\\'evy processes.

  9. Sweet Work with Fractions (United States)

    Vinogradova, Natalya; Blaine, Larry


    Almost everyone loves chocolate. However, the same cannot be said about fractions, which are loved by markedly fewer. Middle school students tend to view them with wary respect, but little affection. The authors attempt to sweeten the subject by describing a type of game involving division of chocolate bars. The activity they describe provides a…

  10. Fermion Number Fractionization

    Indian Academy of Sciences (India)


    1 . In tro d u ctio n. T he N obel P rize in C hem istry for the year 2000 w as aw arded to A lan J H ... soliton, the ground state of the ferm ion-soliton system can have ..... probability density,in a heuristic w ay that a fractional ferm ion num ber m ay ...

  11. Momentum fractionation on superstrata

    International Nuclear Information System (INIS)

    Bena, Iosif; Martinec, Emil; Turton, David; Warner, Nicholas P.


    Superstrata are bound states in string theory that carry D1, D5, and momentum charges, and whose supergravity descriptions are parameterized by arbitrary functions of (at least) two variables. In the D1-D5 CFT, typical three-charge states reside in high-degree twisted sectors, and their momentum charge is carried by modes that individually have fractional momentum. Understanding this momentum fractionation holographically is crucial for understanding typical black-hole microstates in this system. We use solution-generating techniques to add momentum to a multi-wound supertube and thereby construct the first examples of asymptotically-flat superstrata. The resulting supergravity solutions are horizonless and smooth up to well-understood orbifold singularities. Upon taking the AdS_3 decoupling limit, our solutions are dual to CFT states with momentum fractionation. We give a precise proposal for these dual CFT states. Our construction establishes the very nontrivial fact that large classes of CFT states with momentum fractionation can be realized in the bulk as smooth horizonless supergravity solutions.

  12. Fractional Differential Equation

    Directory of Open Access Journals (Sweden)

    Moustafa El-Shahed


    where 2<α<3 is a real number and D0+α is the standard Riemann-Liouville fractional derivative. Our analysis relies on Krasnoselskiis fixed point theorem of cone preserving operators. An example is also given to illustrate the main results.

  13. Vapor liquid fraction determination

    International Nuclear Information System (INIS)


    This invention describes a method of measuring liquid and vapor fractions in a non-homogeneous fluid flowing through an elongate conduit, such as may be required with boiling water, non-boiling turbulent flows, fluidized bed experiments, water-gas mixing analysis, and nuclear plant cooling. (UK)

  14. Brewing with fractionated barley

    NARCIS (Netherlands)

    Donkelaar, van L.H.G.


    Brewing with fractionated barley

    Beer is a globally consumed beverage, which is produced from malted barley, water, hops and yeast. In recent years, the use of unmalted barley and exogenous enzymes have become more popular because they enable simpler processing and reduced environmental

  15. Fractionation and rectification apparatus

    Energy Technology Data Exchange (ETDEWEB)

    Sauerwald, A


    Fractionation and rectifying apparatus with a distillation vessel and a stirring tube, drainage tubes leading from its coils to a central collecting tube, the drainage tubes being somewhat parallel and attached to the outer half of the stirring tube and partly on the inner half of the central collecting tube, whereby distillation and rectification can be effected in a single apparatus.

  16. Quality assurance in fractionated stereotactic radiotherapy

    International Nuclear Information System (INIS)

    Warrington, A.P.; Laing, R.W.; Brada, M.


    The recent development of fractionated stereotactic radiotherapy (SRT), which utilises the relocatable Gill-Thomas-Cosman frame (GTC 'repeat localiser'), requires comprehensive quality assurance (QA). This paper focuses on those QA procedures particularly relevant to fractionated SRT treatments, and which have been derived from the technique used at the Royal Marsden Hospital. They primarily relate to the following: (i) GTC frame fitting, initially in the mould room, and then at each imaging session and treatment fraction; (ii) checking of the linear accelerator beam geometry and alignment lasers; and (iii) setting up of the patient for each fraction of treatment. The precision of the fractionated technique therefore depends on monitoring the GTC frame relocation at each fitting, checking the accuracy of the radiation isocentre of the treatment unit, its coincidence with the patient alignment lasers and the adjustments required to set the patient up accurately. The results of our quality control checks show that setting up to a mean radiation isocentre using precisely set-up alignment lasers can be achievable to within 1 mm accuracy. When this is combined with a mean GTC frame relocatability of 1 mm on the patient, a 2-mm allowance between the prescribed isodose surface and the defined target volume is a realistic safety margin for this technique

  17. Dependence of stability of metastable superconductors on copper fraction

    International Nuclear Information System (INIS)

    Elrod, S.A.; Lue, J.W.; Miller, J.R.; Dresner, L.


    The stability of composite superconductors operating in the metastable regime depends upon such factors as matrix resistivity, cooled surface dimensions, fraction of critical current, and volume fraction of stabilizer. By assuming constant thermophysical properties, we developed analytic expressions for the energy and voltage of the minimum propagating zone (MPZ). With other factors held constant, these expressions have been used to predict composite superconductor stability as a function of copper fraction: lower copper fractions lead to higher MPZ energies. MPZ voltages have been measured for three NbTi/Cu composites having different copper fractions and different critical current densities for several magnetic fields and transport currents. Experimental MPZ voltages have been used to calculate an effective heat transfer coefficient, which is subsequently used to calculate the MPZ energy. The experimental MPZ energies support the theoretical expectation that lower copper fractions lead to higher stability in the metastable regime

  18. Evaluation of left atrial linear ablation using contiguous and optimized radiofrequency lesions: the ALINE study. (United States)

    Wolf, Michael; El Haddad, Milad; Fedida, Joël; Taghji, Philippe; Van Beeumen, Katarina; Strisciuglio, Teresa; De Pooter, Jan; Lepièce, Caroline; Vandekerckhove, Yves; Tavernier, René; Duytschaever, Mattias; Knecht, Sébastien


    Achieving block across linear lesions is challenging. We prospectively evaluated radiofrequency (RF) linear ablation at the roof and mitral isthmus (MI) using point-by-point contiguous and optimized RF lesions. Forty-one consecutive patients with symptomatic persistent AF underwent stepwise contact force (CF)-guided catheter ablation during ongoing AF. A single linear set of RF lesions was delivered at the roof and posterior MI according to the 'Atrial LINEar' (ALINE) criteria, i.e. point-by-point RF delivery (up to 35 W) respecting strict criteria of contiguity (inter-lesion distance ≤ 6 mm) and indirect lesion depth assessment (ablation index ≥550). We assessed the incidence of bidirectional block across both lines only after restoration of sinus rhythm. After a median RF time of 7 min [interquartile range (IQR) 5-9], first-pass block across roof lines was observed in 38 of 41 (93%) patients. Final bidirectional roof block was achieved in 40 of 41 (98%) patients. First-pass block was observed in 8 of 35 (23%) MI lines, after a median RF time of 8 min (IQR 7-12). Additional endo- and epicardial (54% of patients) RF applications resulted in final bidirectional MI block in 28 of 35 (80%) patients. During a median follow-up of 396 (IQR 310-442) days, 12 patients underwent repeat procedures, with conduction recovery in 4 of 12 and 5 of 10 previously blocked roof lines and MI lines, respectively. No complications occurred. Anatomical linear ablation using contiguous and optimized RF lesions results in a high rate of first-pass block at the roof but not at the MI. Due to its complex 3D architecture, the MI frequently requires additional endo- and epicardial RF lesions to be blocked. Published on behalf of the European Society of Cardiology. All rights reserved. © The Author(s) 2018. For permissions, please email:

  19. -Dimensional Fractional Lagrange's Inversion Theorem

    Directory of Open Access Journals (Sweden)

    F. A. Abd El-Salam


    Full Text Available Using Riemann-Liouville fractional differential operator, a fractional extension of the Lagrange inversion theorem and related formulas are developed. The required basic definitions, lemmas, and theorems in the fractional calculus are presented. A fractional form of Lagrange's expansion for one implicitly defined independent variable is obtained. Then, a fractional version of Lagrange's expansion in more than one unknown function is generalized. For extending the treatment in higher dimensions, some relevant vectors and tensors definitions and notations are presented. A fractional Taylor expansion of a function of -dimensional polyadics is derived. A fractional -dimensional Lagrange inversion theorem is proved.

  20. Gauge invariant fractional electromagnetic fields

    International Nuclear Information System (INIS)

    Lazo, Matheus Jatkoske


    Fractional derivatives and integrations of non-integers orders was introduced more than three centuries ago but only recently gained more attention due to its application on nonlocal phenomenas. In this context, several formulations of fractional electromagnetic fields was proposed, but all these theories suffer from the absence of an effective fractional vector calculus, and in general are non-causal or spatially asymmetric. In order to deal with these difficulties, we propose a spatially symmetric and causal gauge invariant fractional electromagnetic field from a Lagrangian formulation. From our fractional Maxwell's fields arose a definition for the fractional gradient, divergent and curl operators. -- Highlights: → We propose a fractional Lagrangian formulation for fractional Maxwell's fields. → We obtain gauge invariant fractional electromagnetic fields. → Our generalized fractional Maxwell's field is spatially symmetrical. → We discuss the non-causality of the theory.

  1. Gauge invariant fractional electromagnetic fields

    Energy Technology Data Exchange (ETDEWEB)

    Lazo, Matheus Jatkoske, E-mail: [Instituto de Matematica, Estatistica e Fisica - FURG, Rio Grande, RS (Brazil)


    Fractional derivatives and integrations of non-integers orders was introduced more than three centuries ago but only recently gained more attention due to its application on nonlocal phenomenas. In this context, several formulations of fractional electromagnetic fields was proposed, but all these theories suffer from the absence of an effective fractional vector calculus, and in general are non-causal or spatially asymmetric. In order to deal with these difficulties, we propose a spatially symmetric and causal gauge invariant fractional electromagnetic field from a Lagrangian formulation. From our fractional Maxwell's fields arose a definition for the fractional gradient, divergent and curl operators. -- Highlights: → We propose a fractional Lagrangian formulation for fractional Maxwell's fields. → We obtain gauge invariant fractional electromagnetic fields. → Our generalized fractional Maxwell's field is spatially symmetrical. → We discuss the non-causality of the theory.

  2. On matrix fractional differential equations

    Directory of Open Access Journals (Sweden)

    Adem Kılıçman


    Full Text Available The aim of this article is to study the matrix fractional differential equations and to find the exact solution for system of matrix fractional differential equations in terms of Riemann–Liouville using Laplace transform method and convolution product to the Riemann–Liouville fractional of matrices. Also, we show the theorem of non-homogeneous matrix fractional partial differential equation with some illustrative examples to demonstrate the effectiveness of the new methodology. The main objective of this article is to discuss the Laplace transform method based on operational matrices of fractional derivatives for solving several kinds of linear fractional differential equations. Moreover, we present the operational matrices of fractional derivatives with Laplace transform in many applications of various engineering systems as control system. We present the analytical technique for solving fractional-order, multi-term fractional differential equation. In other words, we propose an efficient algorithm for solving fractional matrix equation.

  3. 33 CFR 334.635 - Hillsborough Bay and waters contiguous to MacDill Air Force Base, Fla.; restricted area. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Hillsborough Bay and waters... Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.635 Hillsborough Bay and waters contiguous to MacDill Air Force Base, Fla.; restricted area...

  4. 33 CFR 334.778 - Pensacola Bay and waters contiguous to the Naval Air Station, Pensacola, FL; restricted area. (United States)


    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Pensacola Bay and waters... Navigable Waters CORPS OF ENGINEERS, DEPARTMENT OF THE ARMY, DEPARTMENT OF DEFENSE DANGER ZONE AND RESTRICTED AREA REGULATIONS § 334.778 Pensacola Bay and waters contiguous to the Naval Air Station, Pensacola...

  5. Reserve selection with minimum contiguous area restrictions: An application to open space protection planning in suburban Chicago (United States)

    Sandor F. Toth; Robert Haight; Stephanie A. Snyder; Sonney George; James R. Miller; Mark S. Gregory; Adam M. Skibbe


    Conservation efforts often require site or parcel selection strategies that lead to spatially cohesive reserves. Although habitat contiguity is thought to be conducive to the persistence of many sensitive species, availability of funding and suitable land may restrict the extent to which this spatial attribute can be pursued in land management or conservation. Using...

  6. The Local Fractional Bootstrap

    DEFF Research Database (Denmark)

    Bennedsen, Mikkel; Hounyo, Ulrich; Lunde, Asger

    We introduce a bootstrap procedure for high-frequency statistics of Brownian semistationary processes. More specifically, we focus on a hypothesis test on the roughness of sample paths of Brownian semistationary processes, which uses an estimator based on a ratio of realized power variations. Our...... new resampling method, the local fractional bootstrap, relies on simulating an auxiliary fractional Brownian motion that mimics the fine properties of high frequency differences of the Brownian semistationary process under the null hypothesis. We prove the first order validity of the bootstrap method...... and in simulations we observe that the bootstrap-based hypothesis test provides considerable finite-sample improvements over an existing test that is based on a central limit theorem. This is important when studying the roughness properties of time series data; we illustrate this by applying the bootstrap method...

  7. Fractionalization and Entrepreneurial Activities


    Awaworyi Churchill, Sefa


    The vast majority of the literature on ethnicity and entrepreneurship focuses on the construct of ethnic entrepreneurship. However, very little is known about how ethnic heterogeneity affects entrepreneurship. This study attempts to fill the gap, and thus examines the effect of ethnic heterogeneity on entrepreneurial activities in a cross-section of 90 countries. Using indices of ethnic and linguistic fractionalization, we show that ethnic heterogeneity negatively influences entrepreneurship....

  8. GPC light shaper for speckle-free one- and two-photon contiguous pattern excitation

    DEFF Research Database (Denmark)

    Bañas, Andrew Rafael; Palima, Darwin; Villangca, Mark Jayson


    Generalized Phase Contrast (GPC) is an efficient method for generating speckle-free contiguous optical distributions useful in diverse applications such as static beam shaping, optical manipulation and recently, for excitation in two-photon optogenetics. To fully utilize typical Gaussian lasers...... in such applications, we analytically derive conditions for photon efficient light shaping with GPC. When combined with the conditions for optimal contrast developed in previous works, our analysis further simplifies GPCx2019;s implementation. The results of our analysis are applied to practical illumination shapes......, such as a circle and different rectangles commonly used in industrial or commercial applications. We also show simple and efficient beam shaping of arbitrary shapes geared towards biophotonics research and other contemporary applications. Optimized GPC configurations consistently give ~84% efficiency and ~3x...

  9. First contiguous gene deletion causing biotinidase deficiency: The enzyme deficiency in three Sri Lankan children

    Directory of Open Access Journals (Sweden)

    Danika Nadeen Senanayake


    Full Text Available We report three symptomatic children with profound biotinidase deficiency from Sri Lanka. All three children presented with typical clinical features of the disorder. The first is homozygous for a missense mutation in the BTD gene (c.98_104 del7insTCC; p.Cys33PhefsX36 that is commonly seen in the western countries, the second is homozygous for a novel missense mutation (p.Ala439Asp, and the third is the first reported instance of a contiguous gene deletion causing the enzyme deficiency. In addition, this latter finding exemplifies the importance of considering a deletion within the BTD gene for reconciling enzymatic activity with genotype, which can occur in asymptomatic children who are identified by newborn screening.

  10. Case Presentation of Concomitant and Contiguous Adenomatoid Odontogenic Tumor and Focal Cemento-Ossifying Dysplasia. (United States)

    Rezvani, Gita; Donoghue, Mandana; Reichart, Peter A; Pazuhi, Neda


    A 24 year-old male was presented for the diagnosis of an asymptomatic bony expansion in relation to the right maxillary canine and first premolar. The unilocular radiolucent lesion with central foci of calcification had caused divergence of canine and first premolar roots without any resorption. This case report details a diagnosis of two distinct disease processes of different cellular origin namely, focal cemento-ossifying dysplasia and adenomatoid odontogenic tumor in a previously unreported concomitant and contiguous relationship. The diagnosis was determined by a combination of clinical, radiographic, histopathological and surgical evidence. This case highlights two points, first the need to examine all mixed radiolucent-radiopaque lesions with advanced imaging techniques to assess the number and extent of the lesions prior to treatment planning. Second a likely role of periodontal ligament as the tissue source for odontogenic epithelial cells and mesenchymal stem cells required for the development of odontogenic tumors and cemento-osseous dysplasias.

  11. Enhancing clinical decision making: development of a contiguous definition and conceptual framework. (United States)

    Tiffen, Jennifer; Corbridge, Susan J; Slimmer, Lynda


    Clinical decision making is a term frequently used to describe the fundamental role of the nurse practitioner; however, other terms have been used interchangeably. The purpose of this article is to begin the process of developing a definition and framework of clinical decision making. The developed definition was "Clinical decision making is a contextual, continuous, and evolving process, where data are gathered, interpreted, and evaluated in order to select an evidence-based choice of action." A contiguous framework for clinical decision making specific for nurse practitioners is also proposed. Having a clear and unique understanding of clinical decision making will allow for consistent use of the term, which is relevant given the changing educational requirements for nurse practitioners and broadening scope of practice. Copyright © 2014 Elsevier Inc. All rights reserved.

  12. Unusual contiguous soft tissue spread of advanced malignant mesothelioma detected by FDG PET/CT

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yu Yang; Edwards, Jamie; Williams, Hadyn; Hao, Zhong Lin; Khleif, Samir; Pucar, Darko [Medical College of Georgia at Augusta UniversityAugusta (United States)


    Malignant pleural mesothelioma (MPM) is a tumor of mesodermal origin that arises from the serosa of the pleura, peritoneum, pericardium or tunica vaginalis. MPM is well known to have a poor prognosis with a median survival time of 12 months. Accurate diagnosis, staging and restaging of MPM are crucial with [18F] flurodeoxy-D-glucose positron emission tomography (FDG PET/CT) playing an increasingly important role. Here we report a case of MPM with unusual contiguous soft tissue spread of the tumor along the dermal and fascial planes characterized by PET/CT. Given that the loco-regional tumor in the thorax was under control on PET/CT, the death of the patient was most likely associated with physiologic or metabolic causes associated with an extra-thoracic tumor.

  13. Study of the interaction of the rupture zones of contiguous anchor plates in analogical medium

    Directory of Open Access Journals (Sweden)

    Abbad H.


    Full Text Available Knowing what occurs above anchor plates is certainly instructive. In this general vision of the interaction soil-anchor plates that our work was directed. An experimental study which required the design and implantation of a model containing plastic granules powder to similate a natural environment, is presented. The latter is subjected to the removal of anchor paltes. For each test, digital photographs are taken to materialize different deformed configurations during the pullout process. These photos processed in couples by the 7D software (image correlation giving the evolution of the displacement field and plane strain analogical environment. Particular attention is paid to the discussion of the interference of rupture zones of contiguous anchors by reducing the distance between plates.

  14. POLARIS: A 30-meter probabilistic soil series map of the contiguous United States (United States)

    Chaney, Nathaniel W; Wood, Eric F; McBratney, Alexander B; Hempel, Jonathan W; Nauman, Travis; Brungard, Colby W.; Odgers, Nathan P


    A new complete map of soil series probabilities has been produced for the contiguous United States at a 30 m spatial resolution. This innovative database, named POLARIS, is constructed using available high-resolution geospatial environmental data and a state-of-the-art machine learning algorithm (DSMART-HPC) to remap the Soil Survey Geographic (SSURGO) database. This 9 billion grid cell database is possible using available high performance computing resources. POLARIS provides a spatially continuous, internally consistent, quantitative prediction of soil series. It offers potential solutions to the primary weaknesses in SSURGO: 1) unmapped areas are gap-filled using survey data from the surrounding regions, 2) the artificial discontinuities at political boundaries are removed, and 3) the use of high resolution environmental covariate data leads to a spatial disaggregation of the coarse polygons. The geospatial environmental covariates that have the largest role in assembling POLARIS over the contiguous United States (CONUS) are fine-scale (30 m) elevation data and coarse-scale (~ 2 km) estimates of the geographic distribution of uranium, thorium, and potassium. A preliminary validation of POLARIS using the NRCS National Soil Information System (NASIS) database shows variable performance over CONUS. In general, the best performance is obtained at grid cells where DSMART-HPC is most able to reduce the chance of misclassification. The important role of environmental covariates in limiting prediction uncertainty suggests including additional covariates is pivotal to improving POLARIS' accuracy. This database has the potential to improve the modeling of biogeochemical, water, and energy cycles in environmental models; enhance availability of data for precision agriculture; and assist hydrologic monitoring and forecasting to ensure food and water security.

  15. Advancing marine conservation in European and contiguous seas with the MarCons Action

    Directory of Open Access Journals (Sweden)

    Stelios Katsanevakis


    Full Text Available Cumulative human impacts have led to the degradation of marine ecosystems and the decline of biodiversity in the European and contiguous seas. Effective conservation measures are urgently needed to reverse these trends. Conservation must entail societal choices, underpinned by human values and worldviews that differ between the countries bordering these seas. Social, economic and political heterogeneity adds to the challenge of balancing conservation with sustainable use of the seas. Comprehensive macro-regional coordination is needed to ensure effective conservation of marine ecosystems and biodiversity of this region. Under the European Union Horizon 2020 framework programme, the MarCons COST action aims to promote collaborative research to support marine management, conservation planning and policy development. This will be achieved by developing novel methods and tools to close knowledge gaps and advance marine conservation science. This action will provide support for the development of macro-regional and national policies through six key actions: to develop tools to analyse cumulative human impacts; to identify critical scientific and technical gaps in conservation efforts; to improve the resilience of the marine environment to global change and biological invasions; to develop frameworks for integrated conservation planning across terrestrial, freshwater, and marine environments; to coordinate marine conservation policy across national boundaries; and to identify effective governance approaches for marine protected area management. Achieving the objectives of these actions will facilitate the integration of marine conservation policy into macro-regional maritime spatial planning agendas for the European and contiguous seas, thereby offsetting the loss of biodiversity and ecosystem services in this region.

  16. Fractional Number Operator and Associated Fractional Diffusion Equations (United States)

    Rguigui, Hafedh


    In this paper, we study the fractional number operator as an analog of the finite-dimensional fractional Laplacian. An important relation with the Ornstein-Uhlenbeck process is given. Using a semigroup approach, the solution of the Cauchy problem associated to the fractional number operator is presented. By means of the Mittag-Leffler function and the Laplace transform, we give the solution of the Caputo time fractional diffusion equation and Riemann-Liouville time fractional diffusion equation in infinite dimensions associated to the fractional number operator.

  17. Historical nitrogen fertilizer use in agricultural ecosystems of the contiguous United States during 1850-2015: application rate, timing, and fertilizer types (United States)

    Cao, Peiyu; Lu, Chaoqun; Yu, Zhen


    A tremendous amount of anthropogenic nitrogen (N) fertilizer has been applied to agricultural lands to promote crop production in the US since the 1850s. However, inappropriate N management practices have caused numerous ecological and environmental problems which are difficult to quantify due to the paucity of spatially explicit time-series fertilizer use maps. Understanding and assessing N fertilizer management history could provide important implications for enhancing N use efficiency and reducing N loss. In this study, we therefore developed long-term gridded maps to depict crop-specific N fertilizer use rates, application timing, and the fractions of ammonium N (NH4+-N) and nitrate N (NO3--N) used across the contiguous US at a resolution of 5 km × 5 km during the period from 1850 to 2015. We found that N use rates in the US increased from 0.22 g N m-2 yr-1 in 1940 to 9.04 g N m-2 yr-1 in 2015. Geospatial analysis revealed that hotspots for N fertilizer use have shifted from the southeastern and eastern US to the Midwest, the Great Plains, and the Northwest over the past century. Specifically, corn in the Corn Belt region received the most intensive N input in spring, followed by the application of a large amount of N in fall, implying a high N loss risk in this region. Moreover, spatial-temporal fraction of NH4+-N and NO3--N varied largely among regions. Generally, farmers have increasingly favored ammonia N fertilizers over nitrate N fertilizers since the 1940s. The N fertilizer use data developed in this study could serve as an essential input for modeling communities to fully assess N addition impacts, and improve N management to alleviate environmental problems. Datasets used in this study are available at" target="_blank">

  18. Acoustic neuromas: single dose vs fractionated therapy

    Energy Technology Data Exchange (ETDEWEB)

    Fuss, M; Debus, J; Lohr, F; Engenhart-Cabillic, R; Wannenmacher, M


    Purpose: Radiosurgical treatment (RS) of acoustic neuromas is a well established treatment. However, few data are available concerning conformal fractionated radiotherapy (FT) of this tumor entity. We evaluated treatment outcome and toxicity for both treatment modalities in 41 patients treated at our institution between 1984 and 1997. Material and Methods: All treatments were performed using a specially adapted linear accelerator and circular collimators for convergent beam RS or multi-leaf collimators (leaf thickness 1 or 3mm) for multi-field RS or fractionated treatment. 22 patients (7 male, 15 female, median age 60 years, range 20-83 years) were treated radiosurgically with single doses between 7 and 28 Gray (median 15 Gy) prescribed to the 80% isodose line. Tumor volumes ranged from 0.7 to 10.5 ccm with a median volume of 3.4 ccm. The median number of isocenters was 2 (1-4 isocenters). One patient was treated by a multi-field technique (14 isocentric irregularly shaped noncoplanar fields). 19 patients (5 male, 14 female, median age 55 years, range 20-81 years) were treated with stereotactic conformal radiotherapy. Median dose was 60 Gray with a median daily fraction size of 2 Gy and a median of 3 (1-4) irregularly shaped isocentric fields. Tumor volumes ranged from 0.7 to 32.4 ccm (median 15 ccm). Median follow-up was 30 months (7-149 months) for radiosurgical and 30 months (2-88 months) for fractionated treatment. Seven patients who underwent fractionated treatment had previously undergone neurosurgical resection on the contralateral side. One had undergone radiosurgery on the opposite side before. Results: All tumors were locally controlled. A volume reduction of more than 20% was seen in 16% after RS and 18% following FT. Typical posttherapeutic central reduction of contrast media enhancement was found in 73% following RS after a median of 8 (3-12) months and in 63% following FT after a median of 6 (1-12) months. Temporary brainstem edema was diagnosed in 4

  19. Fractional derivatives for physicists and engineers background and theory

    CERN Document Server

    Uchaikin, Vladimir V


    The first derivative of a particle coordinate means its velocity, the second means its acceleration, but what does a fractional order derivative mean? Where does it come from, how does it work, where does it lead to? The two-volume book written on high didactic level answers these questions. Fractional Derivatives for Physicists and Engineers— The first volume contains a clear introduction into such a modern branch of analysis as the fractional calculus. The second develops a wide panorama of applications of the fractional calculus to various physical problems. This book recovers new perspectives in front of the reader dealing with turbulence and semiconductors, plasma and thermodynamics, mechanics and quantum optics, nanophysics and astrophysics.  The book is addressed to students, engineers and physicists, specialists in theory of probability and statistics, in mathematical modeling and numerical simulations, to everybody who doesn't wish to stay apart from the new mathematical methods becoming more and ...

  20. Effect of reinforcement volume fraction on the density & elastic ...

    African Journals Online (AJOL)

    صﺧﻟﻣ. ق. ﻲﻧدﻌﻣﻟا جﺎﺟزﻟا نﻣ سﮐﯾرﺗﺎﻣ وﻧ طﯾﻟﺧﻟﻟ ﺔﯾﻟوطﻟا ﺔﻧورﻣﻟا تﺑاوﺛ و ﺔﻓﺎﺛﮐﻟا ﯽﻟﻋ ﺔﯾوﻘﻣﻟا فﺎﯾﻟﻷا ﺔﺑﺳﻧ رﯾﻐﺗ رﯾﺛﺄﺗ ﺔﺳاردﺑ ﺎﻧﻣ. ) Zr41.2Ti13.8Cu12.5Ni10Be22.5. (. نﻣ فﺎﯾﻟﺄﺑ ﺔﻣﻋدﻣﻟا. : glass E. ,. Fe.

  1. High Volume Fraction Carbon Nanotube Composites for Aerospace Applications (United States)

    Siochi, E. J.; Kim, J.-W.; Sauti, G.; Cano, R. J.; Wincheski, R. A.; Ratcliffe, J. G.; Czabaj, M.


    Reported mechanical properties of carbon nanotubes (CNTs) at the nanoscale suggest their potential to enable significantly lighter structures of interest for space applications. However, their utility depends on the retention of these properties in bulk material formats that permit practical fabrication of large structures. This presentation summarizes recent progress made to produce carbon nanotube composites with specific tensile properties that begin to rival those of carbon fiber reinforced polymer composites. CNT content in these nanocomposites was greater than 70% by weight. Tested nanocomposite specimens were fabricated from kilometers or tens of square meters of CNT, depending on the starting material format. Processing methods to yield these results, and characterization and testing to evaluate the performance of these composites will be discussed. The final objective is the demonstration of a CNT composite overwrapped pressure vessel to be flight tested in the Fall of 2016.

  2. Gauge invariant fractional electromagnetic fields (United States)

    Lazo, Matheus Jatkoske


    Fractional derivatives and integrations of non-integers orders was introduced more than three centuries ago but only recently gained more attention due to its application on nonlocal phenomenas. In this context, several formulations of fractional electromagnetic fields was proposed, but all these theories suffer from the absence of an effective fractional vector calculus, and in general are non-causal or spatially asymmetric. In order to deal with these difficulties, we propose a spatially symmetric and causal gauge invariant fractional electromagnetic field from a Lagrangian formulation. From our fractional Maxwell's fields arose a definition for the fractional gradient, divergent and curl operators.

  3. The Extended Fractional Subequation Method for Nonlinear Fractional Differential Equations


    Zhao, Jianping; Tang, Bo; Kumar, Sunil; Hou, Yanren


    An extended fractional subequation method is proposed for solving fractional differential equations by introducing a new general ansätz and Bäcklund transformation of the fractional Riccati equation with known solutions. Being concise and straightforward, this method is applied to the space-time fractional coupled Burgers’ equations and coupled MKdV equations. As a result, many exact solutions are obtained. It is shown that the considered method provides a very effective, convenient, and powe...

  4. Functional Fractional Calculus

    CERN Document Server

    Das, Shantanu


    When a new extraordinary and outstanding theory is stated, it has to face criticism and skeptism, because it is beyond the usual concept. The fractional calculus though not new, was not discussed or developed for a long time, particularly for lack of its application to real life problems. It is extraordinary because it does not deal with 'ordinary' differential calculus. It is outstanding because it can now be applied to situations where existing theories fail to give satisfactory results. In this book not only mathematical abstractions are discussed in a lucid manner, with physical mathematic

  5. Fractional Reserve Banking


    Andreasen, Niels; Bjerregaard, Mads; Lund, Jonas; Olsen, Ove Bitsch; Rasmussen, Andreas Dalgas


    Projektet er bygget op omkring kritisk realisme, som er det gennemgående videnskabelige fundament til undersøgelsen af hvilke strukturelle grunde der er til finansiel ustabilitet i Danmark. Projektet går i dybden med Fractional Reserve Banking og incitamentsstrukturen i banksystemet. Vi bevæger os både på det makro- og mikroøkonomiske niveau i analysen. På makro niveau bruger vi den østrigske skole om konjunktur teori (The Positive Theory of the Cycle). På mikro niveau arbejder vi med princip...

  6. Plasma fractionation issues. (United States)

    Farrugia, Albert; Evers, Theo; Falcou, Pierre-Francois; Burnouf, Thierry; Amorim, Luiz; Thomas, Sylvia


    Procurement and processing of human plasma for fractionation of therapeutic proteins or biological medicines used in clinical practice is a multi-billion dollar international trade. Together the private sector and public sector (non-profit) provide large amounts of safe and effective therapeutic plasma proteins needed worldwide. The principal therapeutic proteins produced by the dichotomous industry include gamma globulins or immunoglobulins (including pathogen-specific hyperimmune globulins, such as hepatitis B immune globulins) albumin, factor VIII and Factor IX concentrates. Viral inactivation, principally by solvent detergent and other processes, has proven highly effective in preventing transmission of enveloped viruses, viz. HBV, HIV, and HCV.

  7. Multicomponent diffusivities from the free volume theory

    NARCIS (Netherlands)

    Wesselingh, J.A; Bollen, A.M

    In this paper the free volume theory of diffusion is extended to multicomponent mixtures. The free volume is taken to be accessible for any component according to its surface. fraction. The resulting equations predict multicomponent (Maxwell-Stefan) diffusivities in simple liquid mixtures from pure

  8. Tcp and NTCP radiobiological models: conventional and hypo fractionated treatments in radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Astudillo V, A.; Paredes G, L. [ININ, Carretera Mexico-Toluca s/n, Ocoyoacac 52750, Estado de Mexico (Mexico); Resendiz G, G.; Posadas V, A. [Hospital Angeles Lomas, Av. Vialidad de la Barranca s/n, Col. Valle de las Palmas, 52763 Huixquilucan de Degallado, Estado de Mexico (Mexico); Mitsoura, E. [Universidad Autonoma del Estado de Mexico, Facultad de Medicina, Paseo Tollocan, Esq. Jesus Carranza s/n, Col. Moderna de la Cruz, 50180 Toluca, Estado de Mexico (Mexico); Rodriguez L, A.; Flores C, J. M., E-mail: [Hospital Medica Sur, Puente de Piedra 150, Col. Toriello Guerra, 14050 Tlalpan, Mexico D. F. (Mexico)


    The hypo and conventional fractionated schedules performance were compared in terms of the tumor control and the normal tissue complications. From the records of ten patients, treated for adenocarcinoma and without mastectomy, the dose-volume histogram was used. Using radiobiological models the probabilities for tumor control and normal tissue complications were calculated. For both schedules the tumor control was approximately the same. However, the damage in the normal tissue was larger in conventional fractionated schedule. This is important because patients assistance time to their fractions (15 fractions/25 fractions) can be optimized. Thus, the hypo fractionated schedule has suitable characteristics to be implemented. (Author)

  9. Tcp and NTCP radiobiological models: conventional and hypo fractionated treatments in radiotherapy

    International Nuclear Information System (INIS)

    Astudillo V, A.; Paredes G, L.; Resendiz G, G.; Posadas V, A.; Mitsoura, E.; Rodriguez L, A.; Flores C, J. M.


    The hypo and conventional fractionated schedules performance were compared in terms of the tumor control and the normal tissue complications. From the records of ten patients, treated for adenocarcinoma and without mastectomy, the dose-volume histogram was used. Using radiobiological models the probabilities for tumor control and normal tissue complications were calculated. For both schedules the tumor control was approximately the same. However, the damage in the normal tissue was larger in conventional fractionated schedule. This is important because patients assistance time to their fractions (15 fractions/25 fractions) can be optimized. Thus, the hypo fractionated schedule has suitable characteristics to be implemented. (Author)

  10. Advances in robust fractional control

    CERN Document Server

    Padula, Fabrizio


    This monograph presents design methodologies for (robust) fractional control systems. It shows the reader how to take advantage of the superior flexibility of fractional control systems compared with integer-order systems in achieving more challenging control requirements. There is a high degree of current interest in fractional systems and fractional control arising from both academia and industry and readers from both milieux are catered to in the text. Different design approaches having in common a trade-off between robustness and performance of the control system are considered explicitly. The text generalizes methodologies, techniques and theoretical results that have been successfully applied in classical (integer) control to the fractional case. The first part of Advances in Robust Fractional Control is the more industrially-oriented. It focuses on the design of fractional controllers for integer processes. In particular, it considers fractional-order proportional-integral-derivative controllers, becau...

  11. Search for fractional charge

    International Nuclear Information System (INIS)

    Turner, R.E.


    A search was made for fractional charges of the form Z plus two-thirds e, where Z is an integer. It was assumed that the charges exist in natural form bound with other fractional charges in neutral molecules. It was further assumed that these neutral molecules are present in air. Two concentration schemes were employed. One sample was derived from the waste gases from a xenon distillation plant. This assumes that high mass, low vapor pressure components of air are concentrated along with the xenon. The second sample involved ionizing air, allowing a brief recombination period, and then collecting residual ions on the surface of titanium discs. Both samples were analyzed at the University of Rochester in a system using a tandem Van de Graff to accelerate particles through an essentially electrostatic beam handling system. The detector system employed both a Time of Flight and an energy-sensitive gas ionization detector. In the most sensitive mode of analysis, a gas absorber was inserted in the beam path to block the intense background. The presence of an absorber limited the search to highly penetrating particles. Effectively, this limited the search to particles with low Z and masses greater than roughly fifty GeV. The final sensitivities attained were on the order of 1 x 10 -20 for the ionized air sample and 1 x 10 -21 for the gas sample. A discussion of the caveats that could reduce the actual level of sensitivity is included

  12. Methane productivity of manure, straw and solid fractions of manure

    DEFF Research Database (Denmark)

    Møller, H.B.; Sommer, S.G.; Ahring, Birgitte Kiær


    are in the same range (282-301 m(3) CH4 LU-1). Pre-treatment of manure by separation is a way of making fractions of the manure that have a higher gas potential per volume. Theoretical methane potential and biodegradability of three types of fractions deriving from manure separation were tested. The volumetric...... methane yield of straw was found to be higher than the yield from total manure and the solid fractions of manure, due to the higher VS content, and hence the use of straw as bedding material will increase the volumetric as well as the livestock-based methane productivity....

  13. Fractional Reserve in Banking System


    Valkonen, Maria


    This thesis is aimed to provide understanding of the role of the fractional reserve in the mod-ern banking system worldwide and particularly in Finland. The fractional reserve banking is used worldwide, but the benefits of this system are very disputable. On the one hand, experts say that the fractional reserve is a necessary instrument for the normal business and profit making. On the other hand, sceptics openly criticize the fractional reserve system and blame it for fiat money (money n...

  14. On matrix fractional differential equations


    Adem Kılıçman; Wasan Ajeel Ahmood


    The aim of this article is to study the matrix fractional differential equations and to find the exact solution for system of matrix fractional differential equations in terms of Riemann–Liouville using Laplace transform method and convolution product to the Riemann–Liouville fractional of matrices. Also, we show the theorem of non-homogeneous matrix fractional partial differential equation with some illustrative examples to demonstrate the effectiveness of the new methodology. The main objec...

  15. Digestion kinetics of carbohydrate fractions of citrus by-products

    DEFF Research Database (Denmark)

    Lashkari, Saman; Taghizadeh, Akbar


    The present experiment was carried out to determine the digestion kinetics of carbohydrate fractions of citrus by-products. Grapefruit pulp (GP), lemon pulp (LE), lime pulp (LI) and orange pulp (OP) were the test feed. Digestion kinetic of whole citrus by-products and neutral detergent fiber (NDF......) fraction and acid detergent fiber (ADF) fractions of citrus by-products were measured using the in vitro gas production technique. Fermentation kinetics of the neutral detergent soluble carbohydrates (NDSC) fraction and hemicelluloses were calculated using a curve subtraction. The fermentation rate...... of whole was the highest for the LE (p by-products lag time was longer for hemicellulose than other carbohydrate fractions. There was no significant difference among potential gas production (A) volumes of whole test feeds (p

  16. Fractional Hopfield Neural Networks: Fractional Dynamic Associative Recurrent Neural Networks. (United States)

    Pu, Yi-Fei; Yi, Zhang; Zhou, Ji-Liu


    This paper mainly discusses a novel conceptual framework: fractional Hopfield neural networks (FHNN). As is commonly known, fractional calculus has been incorporated into artificial neural networks, mainly because of its long-term memory and nonlocality. Some researchers have made interesting attempts at fractional neural networks and gained competitive advantages over integer-order neural networks. Therefore, it is naturally makes one ponder how to generalize the first-order Hopfield neural networks to the fractional-order ones, and how to implement FHNN by means of fractional calculus. We propose to introduce a novel mathematical method: fractional calculus to implement FHNN. First, we implement fractor in the form of an analog circuit. Second, we implement FHNN by utilizing fractor and the fractional steepest descent approach, construct its Lyapunov function, and further analyze its attractors. Third, we perform experiments to analyze the stability and convergence of FHNN, and further discuss its applications to the defense against chip cloning attacks for anticounterfeiting. The main contribution of our work is to propose FHNN in the form of an analog circuit by utilizing a fractor and the fractional steepest descent approach, construct its Lyapunov function, prove its Lyapunov stability, analyze its attractors, and apply FHNN to the defense against chip cloning attacks for anticounterfeiting. A significant advantage of FHNN is that its attractors essentially relate to the neuron's fractional order. FHNN possesses the fractional-order-stability and fractional-order-sensitivity characteristics.

  17. The random continued fraction transformation (United States)

    Kalle, Charlene; Kempton, Tom; Verbitskiy, Evgeny


    We introduce a random dynamical system related to continued fraction expansions. It uses random combinations of the Gauss map and the Rényi (or backwards) continued fraction map. We explore the continued fraction expansions that this system produces, as well as the dynamical properties of the system.

  18. How Weird Are Weird Fractions? (United States)

    Stuffelbeam, Ryan


    A positive rational is a weird fraction if its value is unchanged by an illegitimate, digit-based reduction. In this article, we prove that each weird fraction is uniquely weird and initiate a discussion of the prevalence of weird fractions.

  19. Do Children Understand Fraction Addition? (United States)

    Braithwaite, David W.; Tian, Jing; Siegler, Robert S.


    Many children fail to master fraction arithmetic even after years of instruction. A recent theory of fraction arithmetic (Braithwaite, Pyke, & Siegler, in press) hypothesized that this poor learning of fraction arithmetic procedures reflects poor conceptual understanding of them. To test this hypothesis, we performed three experiments…

  20. On fractional Fourier transform moments

    NARCIS (Netherlands)

    Alieva, T.; Bastiaans, M.J.


    Based on the relation between the ambiguity function represented in a quasi-polar coordinate system and the fractional power spectra, the fractional Fourier transform moments are introduced. Important equalities for the global second-order fractional Fourier transform moments are derived and their

  1. Fractional dynamic calculus and fractional dynamic equations on time scales

    CERN Document Server

    Georgiev, Svetlin G


    Pedagogically organized, this monograph introduces fractional calculus and fractional dynamic equations on time scales in relation to mathematical physics applications and problems. Beginning with the definitions of forward and backward jump operators, the book builds from Stefan Hilger’s basic theories on time scales and examines recent developments within the field of fractional calculus and fractional equations. Useful tools are provided for solving differential and integral equations as well as various problems involving special functions of mathematical physics and their extensions and generalizations in one and more variables. Much discussion is devoted to Riemann-Liouville fractional dynamic equations and Caputo fractional dynamic equations.  Intended for use in the field and designed for students without an extensive mathematical background, this book is suitable for graduate courses and researchers looking for an introduction to fractional dynamic calculus and equations on time scales. .

  2. The True Ultracool Binary Fraction Using Spectral Binaries (United States)

    Bardalez Gagliuffi, Daniella; Burgasser, Adam J.; Schmidt, Sarah J.; Gagné, Jonathan; Faherty, Jacqueline K.; Cruz, Kelle; Gelino, Chris


    Brown dwarfs bridge the gap between stars and giant planets. While the essential mechanisms governing their formation are not well constrained, binary statistics are a direct outcome of the formation process, and thus provide a means to test formation theories. Observational constraints on the brown dwarf binary fraction place it at 10 ‑ 20%, dominated by imaging studies (85% of systems) with the most common separation at 4 AU. This coincides with the resolution limit of state-of-the-art imaging techniques, suggesting that the binary fraction is underestimated. We have developed a separation-independent method to identify and characterize tightly-separated (dwarfs as spectral binaries by identifying traces of methane in the spectra of late-M and early-L dwarfs. Imaging follow-up of 17 spectral binaries yielded 3 (18%) resolved systems, corroborating the observed binary fraction, but 5 (29%) known binaries were missed, reinforcing the hypothesis that the short-separation systems are undercounted. In order to find the true binary fraction of brown dwarfs, we have compiled a volume-limited, spectroscopic sample of M7-L5 dwarfs and searched for T dwarf companions. In the 25 pc volume, 4 candidates were found, three of which are already confirmed, leading to a spectral binary fraction of 0.95 ± 0.50%, albeit for a specific combination of spectral types. To extract the true binary fraction and determine the biases of the spectral binary method, we have produced a binary population simulation based on different assumptions of the mass function, age distribution, evolutionary models and mass ratio distribution. Applying the correction fraction resulting from this method to the observed spectral binary fraction yields a true binary fraction of 27 ± 4%, which is roughly within 1σ of the binary fraction obtained from high resolution imaging studies, radial velocity and astrometric monitoring. This method can be extended to identify giant planet companions to young brown

  3. Lithospheric Layering beneath the Contiguous United States Constrained by S-to-P Receiver Functions (United States)

    Liu, L.; Liu, K. H.; Kong, F.; Gao, S. S.


    The greatly-improved spatial coverage of broadband seismic stations as a result of the deployment of the EarthScope Transportable Array (TA) stations and the diversity of tectonic environments in the contiguous United States provide a unique opportunity to investigate the depth variation and nature of intra-lithospheric interfaces in different tectonic regimes. A total of 284,121 high-quality S-to-P receiver functions (SRFs) are obtained from 3,809 broadband seismic stations in the TA and other permanent and temporary deployments in the contiguous United States. The SRFs are computed using frequency domain deconvolution, and are stacked in consecutive circles with a radius of 2°. They are converted to depth series after move-out corrections using the IASP91 Earth model. Similar to previous SRF studies, a robust negative arrival, representing a sharp discontinuity of velocity reduction with depth, is visible in virtually all the stacked traces in the depth range of 30-110 km. Beneath the western US, the depth of this discontinuity is 69±17 km, and beneath the eastern US, it ranges from 75 to 90 km, both of which are comparable to the depth of the tomographically-determined lithosphere-asthenosphere boundary (LAB). In contrast, the depth of the discontinuity beneath the central US is 83±10 km which is significantly smaller than the 250 km LAB depth determined by seismic surface wave tomography. Based on previous seismic tomography, shear-wave splitting and mantle xenolith studies, we interpret this discontinuity as the top of a frozen-in layer of volatile-rich melt beneath the central US. The observations and the discrepancy between the SRF and seismic tomography results for the central US as well as the amplitude of the corresponding arrival on the SRFs may be explained by spatial variations of the thickness of the transitional layer between the "pure" lithosphere and the "pure" asthenosphere. Under this hypothesis, the consistency between the results from the

  4. Nonhomogeneous fractional Poisson processes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Xiaotian [School of Management, Tianjin University, Tianjin 300072 (China)]. E-mail:; Zhang Shiying [School of Management, Tianjin University, Tianjin 300072 (China); Fan Shen [Computer and Information School, Zhejiang Wanli University, Ningbo 315100 (China)


    In this paper, we propose a class of non-Gaussian stationary increment processes, named nonhomogeneous fractional Poisson processes W{sub H}{sup (j)}(t), which permit the study of the effects of long-range dependance in a large number of fields including quantum physics and finance. The processes W{sub H}{sup (j)}(t) are self-similar in a wide sense, exhibit more fatter tail than Gaussian processes, and converge to the Gaussian processes in distribution in some cases. In addition, we also show that the intensity function {lambda}(t) strongly influences the existence of the highest finite moment of W{sub H}{sup (j)}(t) and the behaviour of the tail probability of W{sub H}{sup (j)}(t)

  5. Nonhomogeneous fractional Poisson processes

    International Nuclear Information System (INIS)

    Wang Xiaotian; Zhang Shiying; Fan Shen


    In this paper, we propose a class of non-Gaussian stationary increment processes, named nonhomogeneous fractional Poisson processes W H (j) (t), which permit the study of the effects of long-range dependance in a large number of fields including quantum physics and finance. The processes W H (j) (t) are self-similar in a wide sense, exhibit more fatter tail than Gaussian processes, and converge to the Gaussian processes in distribution in some cases. In addition, we also show that the intensity function λ(t) strongly influences the existence of the highest finite moment of W H (j) (t) and the behaviour of the tail probability of W H (j) (t)

  6. Membrane Assisted Enzyme Fractionation

    DEFF Research Database (Denmark)

    Yuan, Linfeng

    to the variation in size of the proteins and a reasonable separation factor can be observed only when the size difference is in the order of 10 or more. This is partly caused by concentration polarization and membrane fouling which hinders an effective separation of the proteins. Application of an electric field...... across the porous membrane has been demonstrated to be an effective way to reduce concentration polarization and membrane fouling. In addition, this technique can also be used to separate the proteins based on difference in charge, which to some extent overcome the limitations of size difference...... of proteins on the basis of their charge, degree of hydrophobicity, affinity or size. Adequate purity is often not achieved unless several purification steps are combined thereby increasing cost and reducing product yield. Conventional fractionation of proteins using ultrafiltration membranes is limited...

  7. Fraction Reduction in Membrane Systems

    Directory of Open Access Journals (Sweden)

    Ping Guo


    Full Text Available Fraction reduction is a basic computation for rational numbers. P system is a new computing model, while the current methods for fraction reductions are not available in these systems. In this paper, we propose a method of fraction reduction and discuss how to carry it out in cell-like P systems with the membrane structure and the rules with priority designed. During the application of fraction reduction rules, synchronization is guaranteed by arranging some special objects in these rules. Our work contributes to performing the rational computation in P systems since the rational operands can be given in the form of fraction.

  8. Thermochemical transformations of anthracite fractions

    Energy Technology Data Exchange (ETDEWEB)

    Belkina, T.V.; Privalov, V.E.; Stepanenko, atM.A.


    Research on the nature of thermochemical transformations of anthracite fractions and the possibility of increasing their activity and identifying conditions for their use in the electrode pitch process is described. From research done on different anthracite fractions processed at varying temperatures it was concluded that accumulations of condensates from heating anthracite fractions occur significantly slower in comparison with pitch. As a result the electrode pitch process is prolonged. Thermal treatment of an anthracite fraction causes the formation and accumulation of condensates and promotes thermochemical transformations. Lastly, the use of thermally treated anthracite fractions apparently intensifies the electrode pitch process and improves its quality. (16 refs.) (In Russian)

  9. Toward lattice fractional vector calculus (United States)

    Tarasov, Vasily E.


    An analog of fractional vector calculus for physical lattice models is suggested. We use an approach based on the models of three-dimensional lattices with long-range inter-particle interactions. The lattice analogs of fractional partial derivatives are represented by kernels of lattice long-range interactions, where the Fourier series transformations of these kernels have a power-law form with respect to wave vector components. In the continuum limit, these lattice partial derivatives give derivatives of non-integer order with respect to coordinates. In the three-dimensional description of the non-local continuum, the fractional differential operators have the form of fractional partial derivatives of the Riesz type. As examples of the applications of the suggested lattice fractional vector calculus, we give lattice models with long-range interactions for the fractional Maxwell equations of non-local continuous media and for the fractional generalization of the Mindlin and Aifantis continuum models of gradient elasticity.

  10. Imaging features of tuberous sclerosis complex with autosomal-dominant polycystic kidney disease: a contiguous gene syndrome

    International Nuclear Information System (INIS)

    Back, Susan J.; Andronikou, Savvas; Kilborn, Tracy; Kaplan, Bernard S.; Darge, Kassa


    Genes for tuberous sclerosis complex (TSC) type 2 and autosomal-dominant polycystic kidney disease (ADPKD) type 1 are both encoded over a short segment of chromosome 16. When deletions involve both genes, an entity known as the TSC2/ADPKD1 contiguous gene syndrome, variable phenotypes of TSC and ADPKD are exhibited. This syndrome has not been reviewed in the radiology literature. Unlike renal cysts in TSC, cystic disease in TSC2/ADPKD1 contiguous gene syndrome results in hypertension and renal failure. A radiologist might demonstrate polycystic kidney disease before the patient develops other stigmata of TSC. Conversely, in patients with known TSC, enlarged and polycystic kidneys should signal the possibility of the TSC2/ADPKD1 contiguous gene syndrome and not simply TSC. Distinguishing these diagnoses has implications in prognosis, treatment and genetic counseling. To describe the clinical and imaging findings of tuberous sclerosis complex and polycystic kidney disease in seven pediatric patients. We retrospectively reviewed renal and brain imaging of children and young adults with genetically proven or high clinical suspicion for TSC2/ADPKD1 contiguous gene syndrome. We included seven pediatric patients from two referral institutions. Ages ranged from birth to 21 years over the course of imaging. The mean follow-up period was 9 years 8 months (4 years 6 months to 20 years 6 months). No child progressed to end-stage renal disease during this period. Three patients were initially imaged for stigmata of TSC, three for abdominal distension and one for elevated serum creatinine concentration. All patients developed enlarged, polycystic kidneys. The latest available imaging studies demonstrated that in 12 of the 14 kidneys 50% or more of the parenchyma was ultimately replaced by >15 cysts, resulting in significant cortical thinning. The largest cysts in each kidney ranged from 2.4 cm to 9.3 cm. Echogenic lesions were present in 13 of the 14 kidneys, in keeping with

  11. Imaging features of tuberous sclerosis complex with autosomal-dominant polycystic kidney disease: a contiguous gene syndrome

    Energy Technology Data Exchange (ETDEWEB)

    Back, Susan J. [The Children' s Hospital of Philadelphia, Department of Radiology, Philadelphia, PA (United States); Andronikou, Savvas [University of the Witwatersrand, Radiology Department, Faculty of Health Sciences, Johannesburg (South Africa); Kilborn, Tracy [University of Cape Town, Red Cross War Memorial Children' s Hospital, Cape Town (South Africa); Kaplan, Bernard S. [The Children' s Hospital of Philadelphia, Division of Nephrology, Philadelphia, PA (United States); University of Pennsylvania, Perelman School of Medicine, Philadelphia, PA (United States); Darge, Kassa [The Children' s Hospital of Philadelphia, Department of Radiology, Philadelphia, PA (United States); University of Pennsylvania, Perelman School of Medicine, Philadelphia, PA (United States)


    Genes for tuberous sclerosis complex (TSC) type 2 and autosomal-dominant polycystic kidney disease (ADPKD) type 1 are both encoded over a short segment of chromosome 16. When deletions involve both genes, an entity known as the TSC2/ADPKD1 contiguous gene syndrome, variable phenotypes of TSC and ADPKD are exhibited. This syndrome has not been reviewed in the radiology literature. Unlike renal cysts in TSC, cystic disease in TSC2/ADPKD1 contiguous gene syndrome results in hypertension and renal failure. A radiologist might demonstrate polycystic kidney disease before the patient develops other stigmata of TSC. Conversely, in patients with known TSC, enlarged and polycystic kidneys should signal the possibility of the TSC2/ADPKD1 contiguous gene syndrome and not simply TSC. Distinguishing these diagnoses has implications in prognosis, treatment and genetic counseling. To describe the clinical and imaging findings of tuberous sclerosis complex and polycystic kidney disease in seven pediatric patients. We retrospectively reviewed renal and brain imaging of children and young adults with genetically proven or high clinical suspicion for TSC2/ADPKD1 contiguous gene syndrome. We included seven pediatric patients from two referral institutions. Ages ranged from birth to 21 years over the course of imaging. The mean follow-up period was 9 years 8 months (4 years 6 months to 20 years 6 months). No child progressed to end-stage renal disease during this period. Three patients were initially imaged for stigmata of TSC, three for abdominal distension and one for elevated serum creatinine concentration. All patients developed enlarged, polycystic kidneys. The latest available imaging studies demonstrated that in 12 of the 14 kidneys 50% or more of the parenchyma was ultimately replaced by >15 cysts, resulting in significant cortical thinning. The largest cysts in each kidney ranged from 2.4 cm to 9.3 cm. Echogenic lesions were present in 13 of the 14 kidneys, in keeping with

  12. The effect of unemployment, aggregate wages, and spatial contiguity on local wages: An investigation with German district level data


    Thiess Buettner


    Despite spatial rigidity of collectively negotiated wages the local unemployment rate is found to have a significant negative impact on wages. This impact is shown to be consistent with both the wage-curve hypothesis and modern Phillips-curve modelling. Spatial contiguity effects are found in wages and unemployment and their neglect leads to an underestimation of the effect of local unemployment. Yet, the impact of local unemployment on wages turns out to be quite low as compared to studies f...

  13. Misonidazole in fractionated radiotherapy: are many small fractions best

    International Nuclear Information System (INIS)

    Denekamp, J.; McNally, N.J.; Fowler, J.F.; Joiner, M.C.


    The largest sensitizing effect is always demonstrated with six fractions, each given with 2 g/m 2 of misonidazole. In the absence of reoxygenation a sensitizer enhancement ratio of 1.7 is predicted, but this falls to 1.1-1.2 if extensive reoxygenation occurs. Less sensitization is observed with 30 fractions, each with 0.4 g/m 2 of drug. However, for clinical use, the important question is which treatment kills the maximum number of tumour cells. Many of the simulations predict a marked disadvantage of reducing the fraction number for X rays alone. The circumstances in which this disadvantage is offset by the large Sensitizer enhancement ratio values with a six-fraction schedule are few. The model calculations suggest that many small fractions, each with a low drug dose, are safest unless the clinician has some prior knowledge that a change in fraction number is not disadvantageous. (author)

  14. Anthrax and the Geochemistry of Soils in the Contiguous United States

    Directory of Open Access Journals (Sweden)

    Dale W. Griffin


    Full Text Available Soil geochemical data from sample sites in counties that reported occurrences of anthrax in wildlife and livestock since 2000 were evaluated against counties within the same states (MN, MT, ND, NV, OR, SD and TX that did not report occurrences. These data identified the elements, calcium (Ca, manganese (Mn, phosphorus (P and strontium (Sr, as having statistically significant differences in concentrations between county type (anthrax occurrence versus no occurrence. Tentative threshold values of the lowest concentrations of each of these elements (Ca = 0.43 wt %, Mn = 142 mg/kg, P = 180 mg/kg and Sr = 51 mg/kg and average concentrations (Ca = 1.3 wt %, Mn = 463 mg/kg, P = 580 mg/kg and Sr = 170 mg/kg were identified from anthrax-positive counties as prospective investigative tools in determining whether an outbreak had “potential” or was “likely” at any given geographic location in the contiguous United States.


    Directory of Open Access Journals (Sweden)

    W. Xian


    Full Text Available According to the overall requirements of ecological construction and environmental protection, rely on the national key ecological engineering, strengthen ecological environmental restoration and protection, improve forest cover, control soil erosion, construct important ecological security barrier in poor areas, inhibit poverty alleviation through ecological security in this area from environmental damage to the vicious cycle of poverty. Obviously, the dynamic monitoring of ecological security in contiguous destitute areas of Sichuan province has a policy sense of urgency and practical significance. This paper adopts RS technology and GIS technology to select the Luhe region of Jinchuan county and Ganzi prefecture as the research area, combined with the characteristics of ecological environment in poor areas, the impact factors of ecological environment are determined as land use type, terrain slope, vegetation cover, surface water, soil moisture and other factors. Using the ecological environmental safety assessment model, the ecological environment safety index is calculated. According to the index, the ecological environment safety of the research area is divided into four levels. The ecological environment safety classification map of 1990 in 2009 is obtained. It can be seen that with the human modern life and improve their economic level, the surrounding environment will be destroyed, because the research area ecological environment is now in good, the ecological environment generally tends to be stable. We should keep its ecological security good and improve local economic income. The relationship between ecological environmental security and economic coordinated development in poor areas has very important strategic significance.

  16. Understanding Flood Seasonality and Its Temporal Shifts within the Contiguous United States

    Energy Technology Data Exchange (ETDEWEB)

    Ye, Sheng [Institute of Hydrology and Water Resources, School of Civil Engineering, Zhejiang University, Hangzhou, China; Li, Hong-Yi [Pacific Northwest National Laboratory, Richland, Washington; Leung, L. Ruby [Pacific Northwest National Laboratory, Richland, Washington; Guo, Jiali [College of Civil and Hydropower Engineering, China Three Gorges University, Yichang, China; State Key Laboratory of Water Resources and Hydropower Engineering Science, Wuhan University, Wuhan, China; Ran, Qihua [Institute of Hydrology and Water Resources, School of Civil Engineering, Zhejiang University, Hangzhou, China; Demissie, Yonas [Department of Civil and Environmental Engineering, Washington State University Tri-Cities, Richland, Washington; Sivapalan, Murugesu [Department of Geography and Geographic Information Science, University of Illinois at Urbana–Champaign, Champaign, Illinois; Department of Civil and Environmental Engineering, University of Illinois at Urbana–Champaign, Urbana, Illinois


    Understanding the causes of flood seasonality is critical for better flood management. This study examines the seasonality of annual maximum floods (AMF) and its changes before and after 1980 at over 250 natural catchments across the contiguous United States. Using circular statistics to define a seasonality index, our analysis focuses on the variability of the flood occurrence date. Generally, catchments with more synchronized seasonal water and energy cycles largely inherit their seasonality of AMF from that of annual maximum rainfall (AMR). In contrast, the seasonality of AMF in catchments with loosely synchronized water and energy cycles are more influenced by high antecedent storage, which is responsible for the amplification of the seasonality of AMF over that of AMR. This understanding then effectively explains a statistically significant shift of flood seasonality detected in some catchments in the recent decades. Catchments where the antecedent soil water storage has increased since 1980 exhibit increasing flood seasonality while catchments that have experienced increases in storm rainfall before the floods have shifted towards floods occurring more variably across the seasons. In the eastern catchments, a concurrent widespread increase in event rainfall magnitude and reduced soil water storage have led to a more variable timing of floods. Our findings of the role of antecedent storage and event rainfall on the flood seasonality provide useful insights for understanding future changes in flood seasonality as climate models projected changes in extreme precipitation and aridity over land.

  17. Simulating Groundwater Dynamics across the Contiguous United States Using MODFLOW-OWHM (United States)

    Alattar, M.; Troy, T. J.; Russo, T. A.


    Groundwater is a critical water resource for irrigation, industry, and domestic water supply. Because of the importance of groundwater, especially for agriculture water supply, many regional studies have been implemented to understand groundwater dynamics, to protect groundwater resources, and to support more efficient management of surface and groundwater supplies to meet the water demands. While these regional studies provide invaluable insights into local problems, it is difficult to understand the state of America's water supplies holistically to understand how irrigation, pumping, and climate determine groundwater availability. To fill this gap, we use MODFLOW-OWHM to simulate and analyze groundwater flow across the United States from 1950 through 2010 at a monthly resolution. The model estimates the irrigation demand by crop type, pumping rates from groundwater wells, and groundwater availability and water levels. This allows us to analyze the impact of crop choices and on groundwater pumping as well as surface water withdrawals. The model is calibrated and validated across the contiguous United States with parameter sensitivity analysis. Because of the study region size, climate conditions vary temporally and spatially based on the mean climate and phenomena such as El Niño and La Niña. We do model experiments to analyze how this climate variability can affect recharge and water table depths and how irrigated crop choices impact surface and ground water sustainability. These model simulations have the potential to inform water resources management at a range of spatial scales.

  18. Benign pulmonary nodule. Morphological features and contrast enhancement evaluated with contiguous thin-section CT

    Energy Technology Data Exchange (ETDEWEB)

    Matsuo, Hisayasu; Murata, Kiyoshi; Takahashi, Masashi; Morita, Rikushi [Shiga Univ. of Medical Science, Otsu (Japan)


    The morphological changes in 54 benign lung nodules, including 8 histologically proven nodules of tuberculoma, 10 of focal organizing pneumonia (FOP), 1 of lung abscess and 35 other benign nodules, were evaluated with contiguous thin-section (3 mm) CT. In addition, incremental dynamic studies were carried out in 25 of these nodules. The three-dimensional shapes of the nodules were found to be quite varied and were classified into four types: round mass (n=18), polygonal mass with concave or straight margins (n=20), oval or band-like mass extending along the bronchovascular bundle (n=7), and oval mass attached to the pleura with broad contact (n=9). Forty-two (78%) of the 54 nodules were located along the bronchovascular bundle. The maximum increments in CT values over 20 HU were observed after contrast enhancement in 18 (72%) of the 25 benign nodules, among which all tuberculomas showed little or no contrast enhancement. The number of small vessels quantified microscopically in the center of the nodules were minimal in tuberculomas with little enhancement and plentiful in lesions of FOP and abscess which showed marked enhancement. Our results suggest that the differentiation between benign and malignant pulmonary nodules is not possible simply on the basis of the degree of contrast enhancement. Therefore, morphological features and the anatomical relation to the bronchovascular bundles should also be taken into consideration in the diagnosis of pulmonary nodules. (author)

  19. Benign pulmonary nodule. Morphological features and contrast enhancement evaluated with contiguous thin-section CT

    International Nuclear Information System (INIS)

    Matsuo, Hisayasu; Murata, Kiyoshi; Takahashi, Masashi; Morita, Rikushi


    The morphological changes in 54 benign lung nodules, including 8 histologically proven nodules of tuberculoma, 10 of focal organizing pneumonia (FOP), 1 of lung abscess and 35 other benign nodules, were evaluated with contiguous thin-section (3 mm) CT. In addition, incremental dynamic studies were carried out in 25 of these nodules. The three-dimensional shapes of the nodules were found to be quite varied and were classified into four types: round mass (n=18), polygonal mass with concave or straight margins (n=20), oval or band-like mass extending along the bronchovascular bundle (n=7), and oval mass attached to the pleura with broad contact (n=9). Forty-two (78%) of the 54 nodules were located along the bronchovascular bundle. The maximum increments in CT values over 20 HU were observed after contrast enhancement in 18 (72%) of the 25 benign nodules, among which all tuberculomas showed little or no contrast enhancement. The number of small vessels quantified microscopically in the center of the nodules were minimal in tuberculomas with little enhancement and plentiful in lesions of FOP and abscess which showed marked enhancement. Our results suggest that the differentiation between benign and malignant pulmonary nodules is not possible simply on the basis of the degree of contrast enhancement. Therefore, morphological features and the anatomical relation to the bronchovascular bundles should also be taken into consideration in the diagnosis of pulmonary nodules. (author)

  20. Epigastric hernia contiguous with the laparoscopic port site after endoscopic robotic total prostatectomy. (United States)

    Moriwaki, Yoshihiro; Otani, Jun; Okuda, Junzo; Maemoto, Ryo


    Both laparoscopic and endoscopic robotic surgery are widely accepted for many abdominal surgeries. However, the port site for the laparoscope cannot be easily sutured without defect, particularly in the cranial end; this can result in a port-site incisional hernia and trigger the progressive thinning and stretching of the linea alba, leading to epigastric hernia. In the present case, we encountered an epigastric hernia contiguous with an incisional scar at the port site from a previous endoscopic robotic total prostatectomy. Abdominal ultrasound and CT revealed that the width of the linea alba was 30-48 mm. Previous CT images prepared before endoscopic robotic prostatectomy had shown a thinning of the linea alba. We should be aware of the possibility of epigastric hernia after laparoscopic and endoscopic robotic surgery. In laparoscopic and endoscopic robotic surgery for a high-risk patient for epigastric hernia, we should consider additional sutures cranial to the port-site incision to prevent of an epigastric hernia. © 2018 Japan Society for Endoscopic Surgery, Asia Endosurgery Task Force and John Wiley & Sons Australia, Ltd.