
Sample records for volume fraction contiguity

  1. Absorbed fractions for electrons in ellipsoidal volumes (United States)

    Amato, E.; Lizio, D.; Baldari, S.


    We applied a Monte Carlo simulation in Geant4 in order to calculate the absorbed fractions for monoenergetic electrons in the energy interval between 10 keV and 2 MeV, uniformly distributed in ellipsoids made from soft tissue. For each volume, we simulated a spherical shape, four oblate and four prolate ellipsoids, and one scalene shape. For each energy and for every geometrical configuration, an analytical relationship between the absorbed fraction and a 'generalized radius' was found, and the dependence of the fit parameters from electron energy is discussed and fitted by proper parametric functions. With the proposed formulation, the absorbed fraction for electrons in the 10-2000 keV energy range can be calculated for all volumes and for every ellipsoidal shape of practical interest. This method can be directly applied to evaluation of the absorbed fraction from the radionuclide emission of monoenergetic electrons, such as Auger or conversion electrons. The average deposited energy per disintegration in the case of extended beta spectra can be evaluated through integration. Two examples of application to a pure beta emitter such as 90Y and to 131I, whose emission include monoenergetic and beta electrons plus gamma photons, are presented. This approach represent a generalization of our previous studies, allowing a comprehensive treatment of absorbed fractions from electron and photon sources uniformly distributed in ellipsoidal volumes of any ellipticity and volume, in the whole range of practical interest for internal dosimetry in nuclear medicine applications, as well as in radiological protection estimations of doses from an internal contamination.

  2. Lamb Wave Assessment of Fiber Volume Fraction in Composites (United States)

    Seale, Michael D.; Smith, Barry T.; Prosser, W. H.; Zalameda, Joseph N.


    Among the various techniques available, ultrasonic Lamb waves offer a convenient method of examining composite materials. Since the Lamb wave velocity depends on the elastic properties of a material, an effective tool exists to evaluate composites by measuring the velocity of these waves. Lamb waves can propagate over long distances and are sensitive to the desired in-plane elastic properties of the material. This paper discusses a study in which Lamb waves were used to examine fiber volume fraction variations of approximately 0.40-0.70 in composites. The Lamb wave measurements were compared to fiber volume fractions obtained from acid digestion tests. Additionally, a model to predict the fiber volume fraction from Lamb wave velocity values was evaluated.

  3. Perfusion systems that minimize vascular volume fraction in engineered tissues. (United States)

    Truslow, James G; Tien, Joe


    This study determines the optimal vascular designs for perfusing engineered tissues. Here, "optimal" describes a geometry that minimizes vascular volume fraction (the fractional volume of a tissue that is occupied by vessels) while maintaining oxygen concentration above a set threshold throughout the tissue. Computational modeling showed that optimal geometries depended on parameters that affected vascular fluid transport and oxygen consumption. Approximate analytical expressions predicted optima that agreed well with the results of modeling. Our results suggest one basis for comparing the effectiveness of designs for microvascular tissue engineering.

  4. Laser-induced incandescence: Towards quantitative soot volume fraction measurements

    Energy Technology Data Exchange (ETDEWEB)

    Tzannis, A.P.; Wienbeucker, F.; Beaud, P.; Frey, H.-M.; Gerber, T.; Mischler, B.; Radi, P.P. [Paul Scherrer Inst. (PSI), Villigen (Switzerland)


    Laser-Induced Incandescence has recently emerged as a versatile tool for measuring soot volume fraction in a wide range of combustion systems. In this work we investigate the essential features of the method. LII is based on the acquisition of the incandescence of soot when heated through a high power laser pulse. Initial experiments have been performed on a model laboratory flame. The behaviour of the LII signal is studied experimentally. By applying numerical calculations we investigate the possibility to obtain two-dimensional soot volume fraction distributions. For this purpose a combination of LII with other techniques is required. This part is discussed in some extent and the future work is outlined. (author) 4 figs., 3 refs.

  5. Gamma ray densitometry techniques for measuring of volume fractions

    Energy Technology Data Exchange (ETDEWEB)

    Affonso, Renato Raoni Werneck; Silva, Ademir Xavier da; Salgado, Cesar Marques, E-mail:, E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)


    Knowledge of the volume fraction in a multiphase flow is of key importance in predicting the performance of many systems and processes. It is therefore an important parameter to characterize such flows. In the context of nuclear techniques, the gamma ray densitometry is promising and this is due to its non-invasive characteristics and very reliable results. It is used in several applications for multiphase flows (water-oil-air), which are employed tools such as: computational fluid dynamics, artificial neural networks and statistical methods of radiation transport, such as the Monte Carlo method. Based on the gamma radiation techniques for measurements of volume fractions, the aim of this paper is to present several techniques developed for this purpose. (author)

  6. Estimation of liquid volume fraction using ultrasound transit time spectroscopy (United States)

    Al-Qahtani, Saeed M.; Langton, Christian M.


    It has recently been proposed that the propagation of an ultrasound wave through complex structures, consisting of two-materials of differing ultrasound velocity, may be considered as an array of parallel ‘sonic rays’, the transit time of each determined by their relative proportion; being a minimum (t min) in entire higher velocity material, and a maximum (t max) in entire lower velocity material. An ultrasound transit time spectrum (UTTS) describes the proportion of sonic rays at an individual transit time. It has previously been demonstrated that the solid volume fraction of a solid:liquid composite, specifically acrylic step-wedges immersed in water, may be reliably estimated from the UTTS. The aim of this research was to investigate the hypothesis that the volume fraction of a two-component liquid mixture, of unequal ultrasound velocity, may also be estimated by UTTS. A through-transmission technique incorporating two 1 MHz ultrasound transducers within a horizontally-aligned cylindrical tube-housing was utilised, the proportion of silicone oil to water being varied from 0% to 100%. The liquid volume fraction was estimated from the UTTS at each composition, the coefficient of determination (R 2%) being 98.9  ±  0.7%. The analysis incorporated a novel signal amplitude normalisation technique to compensate for absorption within the silicone oil. It is therefore envisaged that the parallel sonic ray concept and the derived UTTS may be further applied to the quantification of liquid mixture composition assessment.

  7. Volume Fraction of Graphene Platelets in Copper-Graphene Composites (United States)

    Jagannadham, K.


    Copper-graphene composite films were deposited on copper foil using electrochemical deposition. Four electrolyte solutions that each consist of 250 mL of graphene oxide suspension in distilled water and increasing volume of 0.2 M solution of CuSO4 in steps of 250 mL were used to deposit the composite films with and without a magnetic stirrer. Graphene oxide in the films was reduced to graphene by hydrogen treatment for 6 hours at 673 K (400 °C). The samples were characterized by X-ray diffraction for identification of phases, scanning electron microscopy for distribution of graphene, energy dispersive spectrometry for evaluation of elemental composition, electrical resistivity and temperature coefficient of electrical resistance and thermal conductivity. Effective mean field analysis (EMA) was used to determine the volume fraction and electrical conductivity of graphene and interfacial thermal conductance between graphene and copper. The electrical resistivity was reduced from 2.031 to 1.966 μΩ cm and the thermal conductivity was improved from 3.8 to 5.0 W/cm K upon addition of graphene platelets to electrolytic copper. The use of stirrer during deposition of the films increased the average size and the thickness of the graphene platelets and as a result the improvement in electrical conductivity was lower compared to the values obtained without the stirrer. Using the EMA, the volume fraction of graphene platelets that was responsible for the improvement in the electrical conductivity was found to be lower than that for the improvement in the thermal conductivity. The results of the analysis are used to determine the volume fraction of the thinner and the thicker graphene platelets in the composite films.

  8. Effect of volume fraction on granular avalanche dynamics. (United States)

    Gravish, Nick; Goldman, Daniel I


    We study the evolution and failure of a granular slope as a function of prepared volume fraction, ϕ(0). We rotated an initially horizontal layer of granular material (0.3-mm-diam glass spheres) to a 45° angle while we monitor the motion of grains from the side and top with high-speed video cameras. The dynamics of grain motion during the tilt process depended sensitively on ϕ(0)∈[0.58-0.63] and differed above or below the granular critical state, ϕ(c), defined as the onset of dilation as a function of increasing volume fraction. For ϕ(0)-ϕ(c)avalanche. Precursor compaction events began at an initial angle θ(0)=7.7±1.4° and occurred intermittently prior to the onset of an avalanche. Avalanches occurred at the maximal slope angle θ(m)=28.5±1.0°. Granular material at ϕ(0)-ϕ(c)>0 did not experience precursor compaction prior to avalanche flow, and instead experienced a single dilational motion at θ(0)=32.1±1.5° prior to the onset of an avalanche at θ(m)=35.9±0.7°. Both θ(0) and θ(m) increased with ϕ(0) and approached the same value in the limit of random close packing. The angle at which avalanching grains came to rest, θ(R)=22±2°, was independent of ϕ(0). From side-view high-speed video, we measured the velocity field of intermittent and avalanching flow. We found that flow direction, depth, and duration were affected by ϕ(0), with ϕ(0)-ϕ(c)0. Our study elucidates how initial conditions-including volume fraction-are important determinants of granular slope stability and the onset of avalanches.

  9. VOFI - A library to initialize the volume fraction scalar field (United States)

    Bnà, S.; Manservisi, S.; Scardovelli, R.; Yecko, P.; Zaleski, S.


    The VOFI library has been developed to accurately calculate the volume fraction field demarcated by implicitly-defined fluid interfaces in Cartesian grids with cubic cells. The method enlists a number of algorithms to compute the integration limits and the local height function, that is the integrand of a double Gauss-Legendre integration with a variable number of nodes. Tests in two and three dimensions are presented to demonstrate the accuracy of the method and are provided in the software distribution with C/C++ and FORTRAN interfaces.

  10. Modified algorithm for generating high volume fraction sphere packings (United States)

    Valera, Roberto Roselló; Morales, Irvin Pérez; Vanmaercke, Simon; Morfa, Carlos Recarey; Cortés, Lucía Argüelles; Casañas, Harold Díaz-Guzmán


    Advancing front packing algorithms have proven to be very efficient in 2D for obtaining high density sets of particles, especially disks. However, the extension of these algorithms to 3D is not a trivial task. In the present paper, an advancing front algorithm for obtaining highly dense sphere packings is presented. It is simpler than other advancing front packing methods in 3D and can also be used with other types of particles. Comparison with respect to other packing methods have been carried out and a significant improvement in the volume fraction (VF) has been observed. Moreover, the quality of packings was evaluated with indicators other than VF. As additional advantage, the number of generated particles with the algorithm is linear with respect to time.

  11. Determination of Acetonitrile Volume Fraction in Mobile Phase by HPLC

    Institute of Scientific and Technical Information of China (English)

    WU Yi; WANG Zhi-wu; GU Jing-kai; WANG Ying-wu


    This paper reports the development and validation of an assay for the determination of acetonitrile in the recycled mobile phase using high performance liquid chromatography(HPLC).The method is based on that the retention in reversed-phase liquid chromatography increases with decreasing concentration of organic phase in the mobile phase.The natural logarithm of the capacity ratio for a given solute is linearly related to the volume fraction of the organic modifier in the mobile phase.For dimethylphthalate and diethylphthalate,the linearity range is 30%--60%,and for biphenyl and terphenyl,the range is 60%-95%.Precision values(RSD) were both <1% and the accuracy(RE) was in the range of ±1%.The assay was successfully applied to the determination of acetonitrile concentration of recycled mobile phase after the distillation of the column eluent in our laboratory.

  12. Coarsening in high volume fraction nickel-base alloys (United States)

    Mackay, R. A.; Nathal, M. V.


    The coarsening behavior of the gamma-prime precipitate has been examined in high volume fraction nickel-base alloys aged at elevated temperatures for times of up to 5000 h. Although the cube rate law was observed during coarsening, none of the presently available coarsening theories showed complete agreement with the experimental particle size distributions (PSDs). These discrepancies were thought to be due to elastic coherency strains which were not considered by the available models. Increasing the Mo content significantly influenced the PSDs and decreased the coarsening rate of the gamma-prime cubes, as a result of increasing the magnitude of the lattice mismatch. After extended aging times, the gamma-prime cubes underwent massive coalescence into plates at a rate which was much faster than the cuboidal coarsening rate. Once the gamma-prime plates were formed, further coarsening was not observed, and this stabilization of the microstructure was attributed to the development of dislocation networks at the gamma-gamma-prime interfaces.

  13. The Effects of Fibre Volume Fraction on a Glass-Epoxy Composite Material

    Directory of Open Access Journals (Sweden)

    Ciprian LARCO


    Full Text Available This paper focuses on the analysis of the longitudinal mechanical properties of Glass Fibre Reinforce Plastic (GFRP plates with different fibre volume fraction, Vf, by considering both analytical and experimental methods. The laminate is 0/90 E-glass/epoxy woven composite material made by hand lay-up technique. Fiber volume fraction, determined by ignition loss method, has a direct influence on the ultimate strength and modulus of elasticity of the composite plate. Tensile tests on specimens with different volume fractions allow the identification of the mathematical relationship between the fibre volume fraction and the longitudinal elastic modulus.

  14. The rheology of hard sphere suspensions at arbitrary volume fractions: An improved differential viscosity model. (United States)

    Mendoza, Carlos I; Santamaría-Holek, I


    We propose a simple and general model accounting for the dependence of the viscosity of a hard sphere suspension at arbitrary volume fractions. The model constitutes a continuum-medium description based on a recursive-differential method where correlations between the spheres are introduced through an effective volume fraction. In contrast to other differential methods, the introduction of the effective volume fraction as the integration variable implicitly considers interactions between the spheres of the same recursive stage. The final expression for the viscosity scales with this effective volume fraction, which allows constructing a master curve that contains all the experimental situations considered. The agreement of our expression for the viscosity with experiments at low- and high-shear rates and in the high-frequency limit is remarkable for all volume fractions.

  15. Tutorial for Collecting and Processing Images of Composite Structures to Determine the Fiber Volume Fraction (United States)

    Conklin, Lindsey


    Fiber-reinforced composite structures have become more common in aerospace components due to their light weight and structural efficiency. In general, the strength and stiffness of a composite structure are directly related to the fiber volume fraction, which is defined as the fraction of fiber volume to total volume of the composite. The most common method to measure the fiber volume fraction is acid digestion, which is a useful method when the total weight of the composite, the fiber weight, and the total weight can easily be obtained. However, acid digestion is a destructive test, so the material will no longer be available for additional characterization. Acid digestion can also be difficult to machine out specific components of a composite structure with complex geometries. These disadvantages of acid digestion led the author to develop a method to calculate the fiber volume fraction. The developed method uses optical microscopy to calculate the fiber area fraction based on images of the cross section of the composite. The fiber area fraction and fiber volume fraction are understood to be the same, based on the assumption that the shape and size of the fibers are consistent in the depth of the composite. This tutorial explains the developed method for optically determining fiber area fraction performed at NASA Langley Research Center.

  16. Accuracy of cancellous bone volume fraction measured by micro-CT scanning

    DEFF Research Database (Denmark)

    Ding, Ming; Odgaard, A; Hvid, I


    Volume fraction, the single most important parameter in describing trabecular microstructure, can easily be calculated from three-dimensional reconstructions of micro-CT images. This study sought to quantify the accuracy of this measurement. One hundred and sixty human cancellous bone specimens...... which covered a large range of volume fraction (9.8-39.8%) were produced. The specimens were micro-CT scanned, and the volume fraction based on Archimedes' principle was determined as a reference. After scanning, all micro-CT data were segmented using individual thresholds determined by the scanner...

  17. The dependencies of phase velocity and dispersion on volume fraction in cancellous-bone-mimicking phantoms. (United States)

    Wear, Keith A


    Frequency-dependent phase velocity was measured in eight cancellous-bone-mimicking phantoms consisting of suspensions of randomly oriented nylon filaments (simulating trabeculae) in a soft-tissue-mimicking medium (simulating marrow). Trabecular thicknesses ranged from 152 to 356 mum. Volume fractions of nylon filament material ranged from 0% to 10%. Phase velocity varied approximately linearly with frequency over the range from 300 to 700 kHz. The increase in phase velocity (compared with phase velocity in a phantom containing no filaments) at 500 kHz was approximately proportional to volume fraction occupied by nylon filaments. The derivative of phase velocity with respect to frequency was negative and exhibited nonlinear, monotonically decreasing dependence on volume fraction. The dependencies of phase velocity and its derivative on volume fraction in these phantoms were similar to those reported in previous studies on (1) human cancellous bone and (2) phantoms consisting of parallel nylon wires immersed in water.

  18. Influence of fibre volume fraction and temperature on fatigue life of glass fibre reinforced plastics

    Directory of Open Access Journals (Sweden)

    Konrad Wegener


    Full Text Available The influence of fibre volume fraction and temperature on fatigue life of continuous glass fibre reinforced plastics is investigated in detail. The physical causes of the two effects on the slope of the S-N-curve in fibre direction at R = 0.1 are researched and can be explained with help of micrographs. A new phenomenological approach is presented to model both effects in fibre dominated laminates with different stacking sequences using only the static ultimate strength as an input. Static and fatigue tests of different layups and fibre volume fractions are performed at different temperatures to validate the fatigue life predictions. Additionally it is derived that there is an optimal fibre volume fraction regarding a minimum damage sum. This fibre volume fraction is dependent on a given loading spectra and can be calculated using the phenomenological model.

  19. Centrifugal Step Emulsification can Produce Water in Oil Emulsions with Extremely High Internal Volume Fractions

    Directory of Open Access Journals (Sweden)

    Friedrich Schuler


    Full Text Available The high throughput preparation of emulsions with high internal volume fractions is important for many different applications, e.g., drug delivery. However, most emulsification techniques reach only low internal volume fractions and need stable flow rates that are often difficult to control. Here, we present a centrifugal high throughput step emulsification disk for the fast and easy production of emulsions with high internal volume fractions above 95%. The disk produces droplets at generation rates of up to 3700 droplets/s and, for the first time, enables the generation of emulsions with internal volume fractions of >97%. The coefficient of variation between droplet sizes is very good (4%. We apply our system to show the in situ generation of gel emulsion. In the future, the recently introduced unit operation of centrifugal step emulsification may be used for the high throughput production of droplets as reaction compartments for clinical diagnostics or as starting material for micromaterial synthesis.

  20. Evaluating Volume Fractions of the Elements for Composite Laminates by Using Dielectric Properties

    Institute of Scientific and Technical Information of China (English)

    周胜; 储才元; 严灏景


    A series and parallel model for investigating the capacity of composite laminates and the relationship between the dielectric properties of the composites and its constituents are presented. Volume fractions of the constituents are considered in this study. The expression of the complex dielectric constants for evaluating volume fractions under discrete frequencies is established and the general solutions for the resultant linear simultaneous equations for system are also exploited.The results show that the high accuracy of proposed method is obtained.

  1. The coupled effect of fiber volume fraction and void fraction on hydraulic fluid absorption of quartz/BMI laminates (United States)

    Hurdelbrink, Keith R.; Anderson, Jacob P.; Siddique, Zahed; Altan, M. Cengiz


    Bismaleimide (BMI) resin with quartz (AQ581) fiber reinforcement is a composite material frequently used in aerospace applications, such as engine cowlings and radomes. Various composite components used in aircrafts are exposed to different types of hydraulic fluids, which may lead to anomalous absorption behavior over the service life of the composite. Accurate predictive models for absorption of liquid penetrants are particularly important as the composite components are often exposed to long-term degradation due to absorbed moisture, hydraulic fluids, or similar liquid penetrants. Microstructural features such as fiber volume fraction and void fraction can have a significant effect on the absorption behavior of fiber-reinforced composites. In this paper, hydraulic fluid absorption characteristics of quartz/BMI laminates fabricated from prepregs preconditioned at different relative humidity and subsequently cured at different pressures are presented. The composite samples are immersed into hydraulic fluid at room temperature, and were not subjected to any prior degradation. To generate process-induced microvoids, prepregs were conditioned in an environmental chamber at 2% or 99% relative humidity at room temperature for a period of 24 hours prior to laminate fabrication. To alter the fiber volume fraction, the laminates were fabricated at cure pressures of 68.9 kPa (10 psi) or 482.6 kPa (70 psi) via a hot-press. The laminates are shown to have different levels of microvoids and fiber volume fractions, which were observed to affect the absorption dynamics considerably and exhibited clear non-Fickian behavior. A one-dimensional hindered diffusion model (HDM) was shown to be successful in predicting the hydraulic fluid absorption. Model prediction indicates that as the fabrication pressure increased from 68.9 kPa to 482.6 kPa, the maximum fluid content (M∞) decreased from 8.0% wt. to 1.0% wt. The degree of non-Fickian behavior, measured by hindrance coefficient (

  2. In Situ Void Fraction and Gas Volume in Hanford Tank 241-SY-101 as Measured with the Void Fraction Instrument

    Energy Technology Data Exchange (ETDEWEB)

    CW Stewart; G Chen; JM Alzheimer; PA Meyer


    The void fraction instrument (WI) was deployed in Tank 241-SY-101 three times in 1998 to confm and locate the retained gas (void) postulated to be causing the accelerating waste level rise observed since 1995. The design, operation, and data reduction model of the WI are described along with validation testing and potential sources of uncertainty. The test plans, field observations and void measurements are described in detail, including the total gas volume calculations and the gas volume model. Based on 1998 data, the void fraction averaged 0.013 i 0.001 in the mixed slurry and 0.30 ~ 0.04 in the crust. This gives gas volumes (at standard pressure and temperature) of 87 t 9 scm in the slurry and 138 ~ 22 scm in the crust for a total retained gas volume of221 *25 scm. This represents an increase of about 74 scm in the crust and a decrease of about 34 scm in the slurry from 1994/95 results. The overall conclusion is that the gas retention is occurring mainly in the crust layer and there is very little gas in the mixed slurry and loosely settled layers below. New insights on crust behavior are also revealed.

  3. GEANT4 simulation of water volume fraction measurement in dehydrated crude oil

    Institute of Scientific and Technical Information of China (English)

    JING Chunguo; XING Guangzhong; LIU Bin


    Online measurement of water volume fraction (WVF) in dehydrated crude oil is a difficult task due to very little water in dehydrated crude oil and high precision requirements. We presents a method to measure water volume fraction in dehydrated crude oil with γ-ray densitometry. The Monte Carlo computer simulation packet GEANT4 was used to analyze the WVF measuring sensitivity of the γ-ray densitometry at different γ-ray energies, and effects of temperature, pressure, salinity and oil components on WVF measurement. The results show that the γ-ray densitome-try has high sensitivity in γ-ray energy ranges of 16~25 keV, and it can distinguish WVF changes of 0.0005. The calculated WVF decreases about 0.0002 with 1 ℃ of temperature increase and they have approximately linear relation with temperature when water volume fraction remains the same. Effects of pressure, salinity and oil components on water volume fraction can be neglected. Experiments were done to analyze sensitivity of the γ-ray densitometry. The results, as compared with simulations, demonstrate that simulation method is reliable and it is feasible to gauge low water volume fraction using low energy γ-rays.

  4. A Novel Semiautomated Fractional Limb Volume Tool for Rapid and Reproducible Fetal Soft Tissue Assessment. (United States)

    Mack, Lauren M; Kim, Sung Yoon; Lee, Sungmin; Sangi-Haghpeykar, Haleh; Lee, Wesley


    The purpose of this study was to document the reproducibility and efficiency of a semiautomated image analysis tool that rapidly provides fetal fractional limb volume measurements. Fifty pregnant women underwent 3-dimensional sonographic examinations for fractional arm and thigh volumes at a mean menstrual age of 31.3 weeks. Manual and semiautomated fractional limb volume measurements were calculated, with the semiautomated measurements calculated by novel software (5D Limb Vol; Samsung Medison, Seoul, Korea). The software applies an image transformation method based on the major axis length, minor axis length, and limb center coordinates. A transformed image is used to perform a global optimization technique for determination of an optimal limb soft tissue boundary. Bland-Altman analysis defined bias with 95% limits of agreement (LOA) between methods, and timing differences between manual versus automated methods were compared by a paired t test. Bland-Altman analysis indicated an acceptable bias with 95% LOA between the manual and semiautomated methods: mean arm volume ± SD, 1.7% ± 4.6% (95% LOA, -7.3% to 10.7%); and mean thigh volume, 0.0% ± 3.8% (95% LOA, -7.5% to 7.5%). The computer-assisted software completed measurements about 5 times faster compared to manual tracings. In conclusion, semiautomated fractional limb volume measurements are significantly faster to calculate when compared to a manual procedure. These results are reproducible and are likely to reduce operator dependency. The addition of computer-assisted fractional limb volume to standard biometry may improve the precision of estimated fetal weight by adding a soft tissue component to the weight estimation process.

  5. Effects of volume fraction condition on thermodynamic restrictions in mixture theory

    Institute of Scientific and Technical Information of China (English)

    牛永红; 苗天德


    Volume fraction condition is a true constraint that must be taken into consideration in deducing the thermodynamic restrictions of mixture theory applying the axiom of dissipation. For a process to be admissible, the constraints imposed by the volume fraction condition include not only the equation obtained by taking its material derivative with respect to the motion of a given phase, but also those by taking its spatial gradient. The thermodynamic restrictions are deduced under the complete constraints, the results obtained are consistent for the mixtures with or without a compressible phase,and in which the free energy of each phase depends on the densities of all phases.

  6. Analysis of the Microstructure and Permeability of the Laminates with Different Fiber Volume Fraction

    Institute of Scientific and Technical Information of China (English)

    MA Yue; LI Wei; LIANG Zi-qing


    Microstmctures of laminates produced by epoxy/ carbon fibers with different fiber volume fraction were studied by analyzing the composite cross-sections. The main result of the compaction of reinforcement is the flatting of bundle shape, the reducing of gap and the embedment of bundles among each layer. The void content outside the bundle decreased sharply during the compoction until it is less than that inside the bundle when the fiber volume fraction is over 60%. The resin flow velocity in the fiber tow is 102-104 times greater than the flow velocity out the fiber tow no matter the capillary pressure is taken into account or not.

  7. Vibrations of FGM thin cylindrical shells with exponential volume fraction law

    Institute of Scientific and Technical Information of China (English)

    Abdul Ghafar Shah; Tahir Mahmood; Muhammad Nawaz Naeem


    In this paper,the influence of an exponential volume fraction law on the vibration frequencies of thin functionally graded cylindrical shells is studied. Material properties in the shell thickness direction are graded in accordance with the exponential law. Expressions for the strain-displacement and curvature-displacement relationships are taken from Love's thin shell theory. The Rayleigh-Ritz approach is used to derive the shell eigenfrequency equation. Axial modal dependence is assumed in the characteristic beam functions. Natural frequencies of the shells are observed to be dependent on the constituent volume fractions. The results are compared with those available in the literature for the validity of the present methodology.

  8. Prediction of volume fractions in three-phase flows using nuclear technique and artificial neural network

    Energy Technology Data Exchange (ETDEWEB)

    Marques Salgado, Cesar [Instituto de Engenharia Nuclear, DIRA/IEN/CNEN, Rio de Janeiro, CEP.: 21945-970-Caixa Postal 68550 (Brazil)], E-mail:; Brandao, Luis E.B. [Instituto de Engenharia Nuclear, DIRA/IEN/CNEN, Rio de Janeiro, CEP.: 21945-970-Caixa Postal 68550 (Brazil); Schirru, Roberto [Universidade Federal do Rio de Janeiro, PEN/COPPE-DNC/EE-CT, Rio de Janeiro, CEP.: 21941-972-Caixa Postal 68509 (Brazil); Pereira, Claudio M.N.A. [Instituto de Engenharia Nuclear, DIRA/IEN/CNEN, Rio de Janeiro, CEP.: 21945-970-Caixa Postal 68550 (Brazil); Silva, Ademir Xavier da [Universidade Federal do Rio de Janeiro, PEN/COPPE-DNC/EE-CT, Rio de Janeiro, CEP.: 21941-972-Caixa Postal 68509 (Brazil); Ramos, Robson [Instituto de Engenharia Nuclear, DIRA/IEN/CNEN, Rio de Janeiro, CEP.: 21945-970-Caixa Postal 68550 (Brazil)


    This work presents methodology based on nuclear technique and artificial neural network for volume fraction predictions in annular, stratified and homogeneous oil-water-gas regimes. Using principles of gamma-ray absorption and scattering together with an appropriate geometry, comprised of three detectors and a dual-energy gamma-ray source, it was possible to obtain data, which could be adequately correlated to the volume fractions of each phase by means of neural network. The MCNP-X code was used in order to provide the training data for the network.

  9. Viscosity of water-in-oil emulsions. Variation with temperature and water volume fraction

    Energy Technology Data Exchange (ETDEWEB)

    Farah, Marco A.; Caldas, Jorge Navaes [Petroleo Brasileiro S.A., Rua General Canabarro, 500, Maracana, Rio, CEP 2057-900 (Brazil); Oliveira, Roberto C. [Petroleo Brasileiro S.A., Cenpes, Cidade Universitaria (Brazil); Rajagopal, Krishnaswamy [LATCA-Laboratorio de Termodinamica e Cinetica Aplicada-Escola de Quimica, Departamento de Engenharia Quimica, Universidade Federal do Rio de Janeiro, UFRJ, Cidade Universitaria, C.P. 68452, CEP 21949-900, Rio de Janeiro (Brazil)


    Water-in-oil emulsions are important in the petroleum industry in production operations, where the water content of the emulsion can be as high as 60% in volume, also in petroleum refining operations where generally the water content is low. The effective viscosity of water-in-oil emulsions depends mainly on the volume fraction of dispersed phase and temperature, along with several minor effects, such as shear rate, average droplet size, droplet size distribution, viscosity and density of oil. Using six different crude oils, the effective viscosities of several synthetic water-in-oil emulsions are measured at atmospheric pressure using a dynamic viscosimeter for different shear rates, temperatures and volume fractions of the dispersed phase. The ASTM equation, method D-341, for describing viscosity as a function of temperature is extended to include the variation of dispersed phase volume fraction. The proposed equation gives good correlation between the measured viscosities of water-in-oil emulsions as a function of temperature and the volume fraction of water.

  10. Imaging air volume fraction in sea ice using non-destructive X-ray tomography

    Directory of Open Access Journals (Sweden)

    O. Crabeck


    Full Text Available Although the presence of a gas phase in sea ice creates the potential for gas exchange with the atmosphere, the distribution of gas bubbles and transport of gases within the sea ice are still poorly understood. Currently no straightforward technique exists to measure the vertical distribution of air volume fraction in sea ice. Here, we present a new fast and non-destructive X-ray computed tomography technique to quantify the air volume fraction and produce separate 3-D images of air-volume inclusions in sea ice. The technique was performed on relatively thin (4–22 cm sea ice collected from an experimental ice tank. While most of the internal layers showed air-volume fractions 5 mm. While micro bubbles were the most abundant type of air inclusions, most of the air porosity observed resulted from the presence of large and macro bubbles. The ice microstructure (granular and columnar as well as the permeability state of ice are important factors controlling the air volume fraction. The technique developed is suited for studies related to gas transport and bubble migration and can help considerably improving parameterization of these processes in sea ice biogeochemical models.

  11. Imaging air volume fraction in sea ice using non-destructive X-ray tomography (United States)

    Crabeck, Odile; Galley, Ryan; Delille, Bruno; Else, Brent; Geilfus, Nicolas-Xavier; Lemes, Marcos; Des Roches, Mathieu; Francus, Pierre; Tison, Jean-Louis; Rysgaard, Søren


    Although the presence of a gas phase in sea ice creates the potential for gas exchange with the atmosphere, the distribution of gas bubbles and transport of gases within the sea ice are still poorly understood. Currently no straightforward technique exists to measure the vertical distribution of air volume fraction in sea ice. Here, we present a new fast and non-destructive X-ray computed tomography technique to quantify the air volume fraction and produce separate images of air volume inclusions in sea ice. The technique was performed on relatively thin (4-22 cm) sea ice collected from an experimental ice tank. While most of the internal layers showed air volume fractions bubbles (Ø bubbles (1 mm bubbles (Ø > 5 mm). While micro bubbles were the most abundant type of gas bubbles, most of the air porosity observed resulted from the presence of large and macro bubbles. The ice texture (granular and columnar) as well as the permeability state of ice are important factors controlling the air volume fraction. The technique developed is suited for studies related to gas transport and bubble migration.

  12. Effect of Sintering Temperature of Mo Skeleton on the Contiguity and Compressive Properties of Mo-Cu IPCs (United States)

    Liu, Longfei; Cao, Fuhua; Lu, Liwei; Yan, Jianhui


    Interpenetrating phase composites (IPCs) are interesting materials, in which each phase can contribute its most desirable attributes to the composite as a whole by its contiguous morphology. In the present study, molybdenum-copper (Mo-Cu) composites with interpenetrating microstructure were fabricated by open-celled porous Mo skeleton with infiltration of Cu. Effects of sintering temperature on the Mo-Mo contiguity and compressive properties of the Mo-Cu IPCs were examined. The contiguity of Mo-Mo and compressive strength increase with the sintering temperature increasing from 1473 to 1873 K, and decrease at 2073 K. Volume fraction of Cu infiltrated in Mo skeleton and failure strain of composites decrease with the sintering temperature increasing from 1473 to 1873 K and increase at 2073 K. Mutual dependency of compressive properties and contiguity of Mo-Cu IPCs are illustrated.

  13. Influence of bress laminate volume fraction on electromechanical properties of externally laminated coated conductor tapes

    Energy Technology Data Exchange (ETDEWEB)

    Bautista, Zhierwinjay M.; Shin, Hyung Seop [Dept. of Mechanical Design Engineering, Andong National University, Andong (Korea, Republic of); Lee, Jae Hun; Lee, Hun Ju; Moon, Seung Hyun [SuNAM Co Ltd., Anseong (Korea, Republic of)


    The enhancement of mechanical properties of coated conductor (CC) tapes in practical application are usually achieved by reinforcing through lamination or electroplating metal layers on either sides of the CC tape. Mechanical or electromechanical properties of the CC tapes have been largely affected by the lamination structure under various loading modes such as tension, bending or even cyclic. In this study, the influence of brass laminate volume fraction on electromechanical properties of RCE-DR processed Gadolinium-barium-copper-oxide (GdBCO) CC tapes was investigated. The samples used were composed of single-side and both-side laminate of brass layer to the Cu-stabilized CC tape and their Ic behaviors were compared to those of the Cu-stabilized CC tape without external lamination. The stress/strain dependences of Ic in laminated CC tapes under uniaxial tension were analyzed and the irreversible stress/strain limits were determined. As a result, the increase of brass laminate volume fraction initially increased the irreversible strain limit and became gradual. The corresponding irreversible stress limit, however, showed no difference even though the brass laminate volume fraction increased to 3.4. But the irreversible load limit linearly increased with the brass laminate volume fraction.

  14. Spinal cord tolerance to single-fraction partial-volume irradiation: a swine model

    NARCIS (Netherlands)

    Medin, P.M.; Foster, R.D.; Kogel, A.J. van der; Sayre, J.W.; McBride, W.H.; Solberg, T.D.


    PURPOSE: To determine the spinal cord tolerance to single-fraction, partial-volume irradiation in swine. METHODS AND MATERIALS: A 5-cm-long cervical segment was irradiated in 38-47-week-old Yucatan minipigs using a dedicated, image-guided radiosurgery linear accelerator. The radiation was delivered

  15. Determination of volume fractions of texture components with standard distributions in Euler space (United States)

    Cho, Jae-Hyung; Rollett, A. D.; Oh, K. H.


    The intensities of texture components are modeled by Gaussian distribution functions in Euler space. The multiplicities depend on the relation between the texture component and the crystal and sample symmetry elements. Higher multiplicities are associated with higher maximum values in the orientation distribution function (ODF). The ODF generated by Gaussian function shows that the S component has a multiplicity of 1, the brass and copper components, 2, and the Goss and cube components, 4 in the cubic crystal and orthorhombic sample symmetry. Typical texture components were modeled using standard distributions in Euler space to calculate a discrete ODF, and their volume fractions were collected and verified against the volume used to generate the ODF. The volume fraction of a texture component that has a standard spherical distribution can be collected using the misorientation approach. The misorientation approach means integrating the volume-weighted intensity that is located within a specified cut-off misorientation angle from the ideal orientation. The volume fraction of a sharply peaked texture component can be collected exactly with a small cut-off value, but textures with broad distributions (large full-width at half-maximum (FWHM)) need a larger cut-off value. Larger cut-off values require Euler space to be partitioned between texture components in order to avoid overlapping regions. The misorientation approach can be used for texture's volume in Euler space in a general manner. Fiber texture is also modeled with Gaussian distribution, and it is produced by rotation of a crystal located at g 0, around a sample axis. The volume of fiber texture in wire drawing or extrusion also can be calculated easily in the unit triangle with the angle distance approach.

  16. Determination of volume fractions in two-phase flows from sound speed measurement

    Energy Technology Data Exchange (ETDEWEB)

    Chaudhuri, Anirban [Los Alamos National Laboratory; Sinha, Dipen N. [Los Alamos National Laboratory; Osterhoudt, Curtis F. [University of Alaska


    Accurate measurement of the composition of oil-water emulsions within the process environment is a challenging problem in the oil industry. Ultrasonic techniques are promising because they are non-invasive and can penetrate optically opaque mixtures. This paper presents a method of determining the volume fractions of two immiscible fluids in a homogenized two-phase flow by measuring the speed of sound through the composite fluid along with the instantaneous temperature. Two separate algorithms are developed by representing the composite density as (i) a linear combination of the two densities, and (ii) a non-linear fractional formulation. Both methods lead to a quadratic equation with temperature dependent coefficients, the root of which yields the volume fraction. The densities and sound speeds are calibrated at various temperatures for each fluid component, and the fitted polynomial is used in the final algorithm. We present results when the new algorithm is applied to mixtures of crude oil and process water from two different oil fields, and a comparison of our results with a Coriolis meter; the difference between mean values is less than 1%. Analytical and numerical studies of sensitivity of the calculated volume fraction to temperature changes and calibration errors are also presented.

  17. Tumor classification using perfusion volume fractions in breast DCE-MRI (United States)

    Lee, Sang Ho; Kim, Jong Hyo; Park, Jeong Seon; Park, Sang Joon; Jung, Yun Sub; Song, Jung Joo; Moon, Woo Kyung


    This study was designed to classify contrast enhancement curves using both three-time-points (3TP) method and clustering approach at full-time points, and to introduce a novel evaluation method using perfusion volume fractions for differentiation of malignant and benign lesions. DCE-MRI was applied to 24 lesions (12 malignant, 12 benign). After region growing segmentation for each lesion, hole-filling and 3D morphological erosion and dilation were performed for extracting final lesion volume. 3TP method and k-means clustering at full-time points were applied for classifying kinetic curves into six classes. Intratumoral volume fraction for each class was calculated. ROC and linear discriminant analyses were performed with distributions of the volume fractions for each class, pairwise and whole classes, respectively. The best performance in each class showed accuracy (ACC), 84.7% (sensitivity (SE), 100%; specificity (SP), 66.7% to a single class) to 3TP method, whereas ACC, 73.6% (SE, 41.7%; SP, 100% to a single class) to k-means clustering. The best performance in pairwise classes showed ACC, 75% (SE, 83.3%; SP, 66.7% to four class pairs and SE, 58.3%; SP, 91.7% to a single class pair) to 3TP method and ACC, 75% (SE, 75%; SP, 75% to a single class pair and SE, 66.7%; SP, 83.3% to three class pairs) to k-means clustering. The performance in whole classes showed ACC, 75% (SE, 83.3%; SP, 66.7%) to 3TP method and ACC, 75% (SE, 91.7%; 58.3%) to k-means clustering. The results indicate that tumor classification using perfusion volume fractions is helpful in selecting meaningful kinetic patterns for differentiation of malignant and benign lesions, and that two different classification methods are complementary to each other.

  18. The equivalent electrical permittivity of gas-solid mixtures at intermediate solid volume fractions.

    Energy Technology Data Exchange (ETDEWEB)

    Torczynski, John Robert; Ceccio, Steven Louis; Tortora, Paul Richard


    Several mixture models are evaluated for their suitability in predicting the equivalent permittivity of dielectric particles in a dielectric medium for intermediate solid volume fractions (0.4 to 0.6). Predictions of the Maxwell, Rayleigh, Bottcher and Bruggeman models are compared to computational simulations of several arrangements of solid particles in a gas and to the experimentally determined permittivity of a static particle bed. The experiment uses spherical glass beads in air, so air and glass permittivity values (1 and 7, respectively) are used with all of the models and simulations. The experimental system used to measure the permittivity of the static particle bed and its calibration are described. The Rayleigh model is found to be suitable for predicting permittivity over the entire range of solid volume fractions (0-0.6).

  19. Volume fraction prediction in biphasic flow using nuclear technique and artificial neural network

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, Cesar M.; Brandao, Luis E.B., E-mail:, E-mail: [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil)


    The volume fraction is one of the most important parameters used to characterize air-liquid two-phase flows. It is a physical value to determine other parameters, such as the phase's densities and to determine the flow rate of each phase. These parameters are important to predict the flow pattern and to determine a mathematical model for the system. To study, for example, heat transfer and pressure drop. This work presents a methodology for volume fractions prediction in water-gas stratified flow regime using the nuclear technique and artificial intelligence. The volume fractions calculate in biphasic flow systems is complex and the analysis by means of analytical equations becomes very difficult. The approach is based on gamma-ray pulse height distributions pattern recognition by means of the artificial neural network. The detection system uses appropriate broad beam geometry, comprised of a ({sup 137}Cs) energy gamma-ray source and a NaI(Tl) scintillation detector in order measure transmitted beam whose the counts rates are influenced by the phases composition. These distributions are directly used by the network without any parameterization of the measured signal. The ideal and static theoretical models for stratified regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the network. The detector also was modeled with this code and the results were compared to experimental photopeak efficiency measurements of radiation sources. The proposed network could obtain with satisfactory prediction of the volume fraction in water-gas system, demonstrating to be a promising approach for this purpose. (author)

  20. Modeling the Effect of Glass Microballoon (GMB) Volume Fraction on Behavior of Sylgard/GMB Composites.

    Energy Technology Data Exchange (ETDEWEB)

    Brown, Judith Alice [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Long, Kevin Nicholas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)


    This work was done to support customer questions about whether a Sylgard/Glass Microballoon (GMB) potting material in current use could be replaced with pure Sylgard and if this would significantly change stresses imparted to internal components under thermal cycling conditions. To address these questions, we provide micromechanics analysis of Sylgard/GMB materials using both analytic composite theory and finite element simulations to better understand the role of the GMB volume fraction in determining thermal expansion coefficient, elastic constants, and behavior in both confined and unconfined compression boundary value problems. A key finding is that damage accumulation in the material from breakage of GMBs significantly limits the global stress magnitude and results in a plateau stress behavior over large ranges of compressive strain. The magnitude of this plateau stress is reduced with higher volume fractions of GMBs. This effect is particularly pronounced in confined compression, which we estimate bears the most similarity to the application of interest. This stress-limiting damage mechanism is not present in pure Sylgard, however, and the result is much higher stresses under confined compression. Thus, we recommend that some volume fraction greater than 10% GMBs be used for confined deformation applications.

  1. Fiber Volume Fraction Influence on Fiber Compaction in Tapered Resin Injection Pultrusion Manufacturing (United States)

    Masuram, N. B.; Roux, J. A.; Jeswani, A. L.


    Liquid resin is injected into the tapered injection chamber through the injection slots to completely wetout the fiber reinforcements in a resin injection pultrusion process. As the resin penetrates through the fibers, the resin also pushes the fibers away from the wall towards the centerline causing compaction of the fiber reinforcements. The fibers are squeezed together due to compaction, making resin penetration more difficult; thus higher resin injection pressures are required to effectively penetrate through the fibers and achieve complete wetout. Fiber volume fraction in the final pultruded composite is a key to decide the mechanical and/or chemical properties of the composite. If the fiber volume fraction is too high, more fibers are squeezed together creating a fiber lean region near the wall and fiber rich region away from the wall. Also, the design of the injection chamber significantly affects the minimum injection pressure required to completely wet the fibers. A tapered injection chamber is considered such that wetout occurs at lower injection pressures due to the taper angle of the injection chamber. In this study, the effect of fiber volume fraction on the fiber reinforcement compaction and complete fiber wetout for a tapered injection chamber is investigated.

  2. Salinity independent volume fraction prediction in water-gas-oil multiphase flows using artificial neural networks

    Energy Technology Data Exchange (ETDEWEB)

    Salgado, C.M.; Pereira, Claudio M.N.A.; Brandao, Luis E.B., E-mail:, E-mail:, E-mail: [Instituto de Engenharia Nuclear (DIRA/IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Div. de Radiofarmacos


    This work investigates the response of a volume fraction prediction system for water-gas-oil multiphase flows considering variations on water salinity. The approach is based on gamma-ray pulse height distributions pattern recognition by means the artificial neural networks (ANNs). The detection system uses appropriate fan beam geometry, comprised of a dual-energy gamma-ray source and two NaI(Tl) detectors adequately positioned outside the pipe in order measure transmitted and scattered beams. An ideal and static theoretical model for annular flow regime have been developed using MCNP-X code, which was used to provide training, test and validation data for the ANN. More than 500 simulations have been done, in which water salinity have been ranged from 0 to 16% in order to cover a most practical situations. Validation tests have included values of volume fractions and water salinity different from those used in ANN training phase. The results presented here show that the proposed approach may be successfully applied to material volume fraction prediction on watergas- oil multiphase flows considering practical (real) levels of variations in water salinity. (author)

  3. Stereological evaluation of the volume and volume fraction of newborns' brain compartment and brain in magnetic resonance images. (United States)

    Nisari, Mehtap; Ertekin, Tolga; Ozçelik, Ozlem; Cınar, Serife; Doğanay, Selim; Acer, Niyazi


    Brain development in early life is thought to be critical period in neurodevelopmental disorder. Knowledge relating to this period is currently quite limited. This study aimed to evaluate the volume relation of total brain (TB), cerebrum, cerebellum and bulbus+pons by the use of Archimedes' principle and stereological (point-counting) method and after that to compare these approaches with each other in newborns. This study was carried out on five newborn cadavers mean weighing 2.220 ± 1.056 g with no signs of neuropathology. The mean (±SD) age of the subjects was 39.7 (±1.5) weeks. The volume and volume fraction of the total brain, cerebrum, cerebellum and bulbus+pons were determined on magnetic resonance (MR) images using the point-counting approach of stereological methods and by the use of fluid displacement technique. The mean (±SD) TB, cerebrum, cerebellum and bulbus+pons volumes by fluid displacement were 271.48 ± 78.3, 256.6 ± 71.8, 12.16 ± 6.1 and 2.72 ± 1.6 cm3, respectively. By the Cavalieri principle (point-counting) using sagittal MRIs, they were 262.01 ± 74.9, 248.11 ± 68.03, 11.68 ± 6.1 and 2.21 ± 1.13 cm3, respectively. The mean (± SD) volumes by point-counting technique using axial MR images were 288.06 ± 88.5, 275.2 ± 83.1, 19.75 ± 5.3 and 2.11 ± 0.7 cm3, respectively. There were no differences between the fluid displacement and point-counting (using axial and sagittal images) for all structures (p > 0.05). This study presents the basic data for studies relative to newborn's brain volume fractions according to two methods. Stereological (point-counting) estimation may be accepted a beneficial and new tool for neurological evaluation in vivo research of the brain. Based on these techniques we introduce here, the clinician may evaluate the growth of the brain in a more efficient and precise manner.

  4. White matter microstructure asymmetry: effects of volume asymmetry on fractional anisotropy asymmetry. (United States)

    Takao, H; Hayashi, N; Ohtomo, K


    Diffusion tensor imaging (DTI) provides information regarding white matter microstructure; however, macroscopic fiber architectures can affect DTI measures. A larger brain (fiber tract) has a 'relatively' smaller voxel size, and the voxels are less likely to contain more than one fiber orientation and more likely to have higher fractional anisotropy (FA). Previous DTI studies report left-to-right differences in the white matter; however, these may reflect true microscopic differences or be caused purely by volume differences. Using tract-based spatial statistics, we investigated left-to-right differences in white matter microstructure across the whole brain. Voxel-wise analysis revealed a large number of white matter volume asymmetries, including leftward asymmetry of the arcuate fasciculus and cingulum. In many white matter regions, FA asymmetry was positively correlated with volume asymmetry. Voxel-wise analysis with adjustment for volume asymmetry revealed many white matter FA asymmetries, including leftward asymmetry of the arcuate fasciculus and cingulum. The voxel-wise analysis showed a reduced number of regions with significant FA asymmetry compared with analysis performed without adjustment for volume asymmetry; however, the overall trend of the results was unchanged. The results of the present study suggest that these FA asymmetries are not caused by volume differences and reflect microscopic differences in the white matter.

  5. Physical aging and structural recovery in a colloidal glass subjected to volume-fraction jump conditions (United States)

    Peng, Xiaoguang; McKenna, Gregory B.


    Three important kinetic phenomena have been cataloged by Kovacs in the investigation of molecular glasses during structural recovery or physical aging. These are responses to temperature-jump histories referred to as intrinsic isotherms, asymmetry of approach, and memory effect. Here we use a thermosensitive polystyrene-poly (N -isopropylacrylamide)-poly (acrylic acid) core-shell particle-based dispersion as a colloidal model and by working at a constant number concentration of particles we use temperature changes to create volume-fraction changes. This imposes conditions similar to those defined by Kovacs on the colloidal system. We use creep experiments to probe the physical aging and structural recovery behavior of colloidal glasses in the Kovacs-type histories and compare the results with those seen in molecular glasses. We find that there are similarities in aging dynamics between molecular glasses and colloidal glasses, but differences also persist. For the intrinsic isotherms, the times teq needed for relaxing or evolving into the equilibrium (or stationary) state are relatively insensitive to the volume fraction and the values of teq are longer than the α -relaxation time τα at the same volume fraction. On the other hand, both of these times grow at least exponentially with decreasing temperature in molecular glasses. For the asymmetry of approach, similar nonlinear behavior is observed for both colloidal and molecular glasses. However, the equilibration time teq is the same for both volume-fraction up-jump and down-jump experiments, different from the finding in molecular glasses that it takes longer for the structure to evolve into equilibrium for the temperature up-jump condition than for the temperature down-jump condition. For the two-step volume-fraction jumps, a memory response is observed that is different from observations of structural recovery in two-step temperature histories in molecular glasses. The concentration dependence of the dynamics

  6. Effect of volume fraction of Polypropylene Fiber on Mechanical Properties of Concrete

    Directory of Open Access Journals (Sweden)

    R. S. Rajguru,


    Full Text Available In this study, the result of polypropylene fiber on mechanical properties of concrete is studied. Polypropylene fibers of 12mm cut length and 6 denier were added at volume fraction of 0%, 0.25%, 0.50%, 0.75% & 1 %.The cube, cylinder and beams wear tested under two point loads on UTM. The results showed that the addition of polypropylene fiber significantly improved the compressive strength, split tensile strength, flexural strength, reserve strength and ductility of fiber reinforced concrete.

  7. Study of the free volume fraction in polylactic acid (PLA) by thermal analysis (United States)

    Abdallah, A.; Benrekaa, N.


    The poly (lactic acid) or polylactide (PLA) is a biodegradable polymer with high modulus, strength and thermoplastic properties. In this work, the evolution of various properties of PLA is studied, such as glass transition temperature, mechanical modules and elongation percentage with the aim of investigating the free volume fraction. To do so, two thermal techniques have been used: the dynamic mechanical analysis (DMA) and dilatometry. The results obtained by these techniques are combined to go back to the structural properties of the studied material.

  8. A randomized trial comparing bladder volume consistency during fractionated prostate radiation therapy

    LENUS (Irish Health Repository)

    Mullaney, L.


    Organ motion is a contributory factor to the variation in location of the prostate and organs at risk during a course of fractionated prostate radiation therapy (RT). A prospective randomized controlled trial was designed with the primary endpoint to provide evidence-based bladder-filling instructions to achieve a consistent bladder volume (BV) and thus reduce the bladder-related organ motion. The secondary endpoints were to assess the incidence of acute and late genitourinary (GU) and gastrointestinal (GI) toxicity for patients and patients’ satisfaction with the bladder-filling instructions.

  9. Experimental investigation of temperature and volume fraction variations on the effective thermal conductivity of nanoparticle suspensions (nanofluids) (United States)

    Li, Calvin H.; Peterson, G. P.


    An experimental investigation was conducted to examine the effects of variations in the temperature and volume fraction on the steady-state effective thermal conductivity of two different nanoparticle suspensions. Copper and aluminum oxide, CuO and Al2O3, nanoparticles with area weighted diameters of 29 and 36 nm, respectively, were blended with distilled water at 2%, 4%, 6%, and 10% volume fractions and the resulting suspensions were evaluated at temperatures ranging from 27.5 to 34.7 °C. The results indicate that the nanoparticle material, diameter, volume fraction, and bulk temperature, all have a significant impact on the effective thermal conductivity of these suspensions. The 6% volume fraction of CuO nanoparticle/distilled water suspension resulted in an increase in the effective thermal conductivity of 1.52 times that of pure distilled water and the 10% Al2O3 nanoparticle/distilled water suspension increased the effective thermal conductivity by a factor of 1.3, at a temperature of 34 °C. A two-factor linear regression analysis based on the temperature and volume fraction was applied and indicated that the experimental results are in stark contrast to the trends predicted by the traditional theoretical models with respect to both temperature and volume fraction. The available models are reviewed and the possible reasons for the unusually high effective thermal conductivity of nanofluids are analyzed and discussed.

  10. Solid volume fraction estimation of bone:marrow replica models using ultrasound transit time spectroscopy. (United States)

    Wille, Marie-Luise; Langton, Christian M


    The acceptance of broadband ultrasound attenuation (BUA) for the assessment of osteoporosis suffers from a limited understanding of both ultrasound wave propagation through cancellous bone and its exact dependence upon the material and structural properties. It has recently been proposed that ultrasound wave propagation in cancellous bone may be described by a concept of parallel sonic rays; the transit time of each ray defined by the proportion of bone and marrow propagated. A Transit Time Spectrum (TTS) describes the proportion of sonic rays having a particular transit time, effectively describing the lateral inhomogeneity of transit times over the surface aperture of the receive ultrasound transducer. The aim of this study was to test the hypothesis that the solid volume fraction (SVF) of simplified bone:marrow replica models may be reliably estimated from the corresponding ultrasound transit time spectrum. Transit time spectra were derived via digital deconvolution of the experimentally measured input and output ultrasonic signals, and compared to predicted TTS based on the parallel sonic ray concept, demonstrating agreement in both position and amplitude of spectral peaks. Solid volume fraction was calculated from the TTS; agreement between true (geometric calculation) with predicted (computer simulation) and experimentally-derived values were R(2)=99.9% and R(2)=97.3% respectively. It is therefore envisaged that ultrasound transit time spectroscopy (UTTS) offers the potential to reliably estimate bone mineral density and hence the established T-score parameter for clinical osteoporosis assessment.

  11. Prediction of Shrinkage Pore Volume Fraction Using a Dimensionless Niyama Criterion (United States)

    Carlson, Kent D.; Beckermann, Christoph


    A method is presented to use a dimensionless form of the well-known Niyama criterion to directly predict the amount of shrinkage porosity that forms during solidification of metal alloy castings. The main advancement offered by this method is that it avoids the need to know the threshold Niyama value below which shrinkage porosity forms; such threshold values are generally unknown and alloy dependent. The dimensionless criterion accounts for both the local thermal conditions (as in the original Niyama criterion) and the properties and solidification characteristics of the alloy. Once a dimensionless Niyama criterion value is obtained from casting simulation results, the corresponding shrinkage pore volume fraction can be determined knowing only the solid fraction-temperature curve and the total solidification shrinkage of the alloy. Curves providing the shrinkage pore volume percentage as a function of the dimensionless Niyama criterion are given for WCB steel, aluminum alloy A356, and magnesium alloy AZ91D. The present method is used in a general-purpose casting simulation software package to predict shrinkage porosity in three-dimensional (3-D) castings. Comparisons between simulated and experimental shrinkage porosity results for a WCB steel plate casting demonstrate that this method can reasonably predict shrinkage. Additional simulations for magnesium alloy AZ91D illustrate that this method is applicable to a wide variety of alloys and casting conditions.

  12. Fractionated Mercury Isotopes in Fish: The Effects of Nuclear Mass, Spin, and Volume (United States)

    Das, R.; Odom, A. L.


    .3, and thus more than one mass-independent isotope effect is inferred. MIF of mercury can be caused by the nuclear volume effect. Schauble, 2007 has calculated nuclear volume fractionation scaling factors for a number of common mercury chemical species in equilibrium with Hg° vapor. From his calculations the nuclear field shift effect is larger in Δ199Hg than in Δ201Hg by approximately a factor of two. The predominant mercury chemical species in fish is methylmercury cysteine. From the experimental studies of Buchachenko and others (2004) on the reaction of methylmercury chloride with creatine kinase it seems reasonable to predicted that the thiol functional groups of cysteine gets enriched in 199Hg and 201Hg. Here the magnetic isotope effect (MIE) produces a kinetic partial separation of isotopes with non-zero nuclear spin quantum numbers from the even-N isotopes. The ratio of enrichment of Δ201Hg /Δ199Hg is predicted from theory to be 1.11, which is the ratio of the magnetic moments of 199Hg and 201Hg. Because mercury possesses two odd-N isotopes, it is possible to detect and evaluate the effects of two distinct, mass-independent isotope fractionating processes. From the data obtained on fish samples, we can deconvolute the contributions of the isotope effects of nuclear mass, spin and volume. For these samples the role of spin or the magnetic isotope effect is the most dominant.

  13. Microchemostat array with small-volume fraction replenishment for steady-state microbial culture. (United States)

    Park, Jaewon; Wu, Jianzhang; Polymenis, Michael; Han, Arum


    A chemostat is a bioreactor in which microorganisms can be cultured at steady-state by controlling the rate of culture medium inflow and waste outflow, thus maintaining media composition over time. Even though many microbial studies could greatly benefit from studying microbes in steady-state conditions, high instrument cost, complexity, and large reagent consumption hamper the routine use of chemostats. Microfluidic-based chemostats (i.e. microchemostats) can operate with significantly smaller reagent consumption while providing accurate chemostatic conditions at orders of magnitude lower cost compared to conventional chemostats. Also, microchemostats have the potential to significantly increase the throughput by integrating arrays of microchemostats. We present a microchemostat array with a unique two-depth culture chamber design that enables small-volume fraction replenishment of culture medium as low as 1% per replenishment cycle in a 250 nl volume. A system having an array of 8 microchemostats on a 40 × 60 mm(2) footprint could be automatically operated in parallel by a single controller unit as a demonstration for potential high throughput microbial studies. The model organism, Saccharomyces cerevisiae, successfully reached a stable steady-state of different cell densities as a demonstration of the chemostatic functionality by programming the dilution rates. Chemostatic functionality of the system was further confirmed by quantifying the budding index as a function of dilution rate, a strong indicator of growth-dependent cell division. In addition, the small-volume fraction replenishment feature minimized the cell density fluctuation during the culture. The developed system provides a robust, low-cost, and higher throughput solution to furthering studies in microbial physiology.

  14. A transient method for measuring the gas volume fraction in a mixed gas-liquid flow using acoustic resonance spectroscopy

    Institute of Scientific and Technical Information of China (English)


    In this paper, the feasibility of measuring the gas volume fraction in a mixed gas-liquid flow by using an acoustic resonant spectroscopy (ARS) method in a transient way is studied theoretically and experimentally. Firstly, the effects of sizes and locations of a single air bubble in a cylindrical cavity with two open ends on resonant frequencies are investigated numerically. Then, a transient measurement system for ARS is established, and the trends of the resonant frequencies (RFs) and resonant amplitudes (RAs) in the cylindrical cavity with gas flux inside are investigated experimentally. The measurement results by the proposed transient method are compared with those by steady-state ones and numerical ones. The numerical results show that the RFs of the cavity are highly sensitive to the volume of the single air bubble. A tiny bubble volume perturbation may cause a prominent RF shift even though the volume of the air bubble is smaller than 0.1% of that of the cavity. When the small air bubble moves, the RF shift will change and reach its maximum value as it is located at the middle of the cavity. As the gas volume fraction of the two-phase flow is low, both the RFs and RAs from the measurement results decrease dramatically with the increasing gas volume, and this decreasing trend gradually becomes even as the gas volume fraction increases further. These experimental results agree with the theoretical ones qualitatively. In addition, the transient method for ARS is more suitable for measuring the gas volume fraction with randomness and instantaneity than the steady-state one, because the latter could not reflect the random and instant characteristics of the mixed fluid due to the time consumption for frequency sweeping. This study will play a very important role in the quantitative measurement of the gas volume fraction of multiphase flows.

  15. MHD flow of dusty nanofluid over a stretching surface with volume fraction of dust particles

    Directory of Open Access Journals (Sweden)

    Sandeep Naramgari


    Full Text Available In this study we analyzed the momentum and heat transfer behavior of MHD nanofluid embedded with conducting dust particles past a stretching surface in the presence of volume fraction of dust particles. The governing equations of the flow and heat transfer are transformed into nonlinear ordinary differential equations by using similarity transformation and then solved numerically using Runge–Kutta based shooting technique. The effect of non-dimensional governing parameters on velocity and temperature profiles of the flow are discussed and presented through graphs. Additionally friction factor and the Nusselt number have also been computed. Under some special conditions, numerical results obtained by the present study were compared with the existed studies. The result of the present study proves to be highly satisfactory. The results indicate that an increase in the interaction between the fluid and particle phase enhances the heat transfer rate and reduces the friction factor.

  16. Volume fraction instability in an oscillating non-Brownian iso-dense suspension. (United States)

    Roht, Y. L.; Gauthier, G.; Hulin, J. P.; Salin, D.; Chertcoff, R.; Auradou, H.; Ippolito, I.


    The instability of an iso-dense non-Brownian suspension of polystyrene beads of diameter 40 μm dispersed in a water-glycerol mixture submitted to a periodic square wave oscillating flow in a Hele-Shaw cell is studied experimentally. The instability gives rise to stationary bead concentration waves transverse to the flow. It has been observed for average particle volume fractions between 0.25 and 0.4, for periods of the square wave flow variation between 0.4 and 10 s and in finite intervals of the amplitude of the fluid displacement. The study shows that the wavelength λ increases roughly linearly with the amplitude of the oscillatory flow; on the other hand, λ is independent of the particle concentration and of the period of oscillation of the flow although the minimum threshold amplitude for observing the instability increases with the period.

  17. In situ synthesis of calcium phosphate-polycaprolactone nanocomposites with high ceramic volume fractions. (United States)

    Makarov, C; Gotman, I; Jiang, X; Fuchs, S; Kirkpatrick, C J; Gutmanas, E Y


    Biodegradable calcium phosphate-PCL nanocomposite powders with unusually high ceramic volume fractions (80-95%) and uniform PCL distribution were synthesized by a non-aqueous chemical reaction in the presence of the dissolved polymer. No visible polymer separation occurred during processing. Depending on the reagents combination, either dicalcium phosphate (DCP) or Ca-deficient HA (CDHA) was obtained. CDHA-PCL composite powders were high pressure consolidated at room temperature yielding dense materials with high compressive strengths. Such densification route provides the possibility of incorporating drug and proteins without damaging their biological activity. The CDHA-PCL composites were tested in osteoblastic and endothelial cell line cultures and were found to support the attachment and proliferation of both cell types.

  18. Mechanical behavior of LC4 alloy in semisolid state at high volume fractions of solid

    Institute of Scientific and Technical Information of China (English)


    The mechanical behavior of LC4 alloy in the semisolid state at high volume fractions of solid has been studied through unconstrictive compressing test. The results show that peak stress mainly depends on grain boundary's cohesion and instantaneous strain rate sensitivity in the semisolid state, which is similar to that in the solid state. Analyses on microstructures and status of compressive stress of specimen demonstrate that segregation of liquid-solid phase is mainly affected by strain rate and deformation temperature. There are mainly two kinds of flow in liquid phase: either from the region with relatively large hydrostatic compressive stress to the region with relatively small hydrostatic compressive stress or from the grain boundaries perpendicular to the compression axis to the grain boundaries with a certain directional angle to the compression direction. Based on the above results, compressive deformation mechanism mainly depends on deformation temperature, strain rate and stress state.

  19. Diffusion characteristics and extracellular volume fraction during normoxia and hypoxia in slices of rat neostriatum. (United States)

    Rice, M E; Nicholson, C


    1. Diffusion properties of submerged, superfused slices from the rat neostriatum were measured by quantitative analysis of concentration-time profiles of tetramethylammonium (TMA+) introduced by iontophoresis. TMA+ was sensed at an ion-selective microelectrode (ISM) positioned 100-150 microns from the source pipette. Slice viability was assessed from the extracellular field potentials evoked by intrastriatal electrical stimulation. 2. Under normoxic conditions the extracellular volume fraction (alpha) was 0.21 (range 0.18-0.24), and the tortuosity (lambda) was 1.54, in slices with good field potentials. In slices with poor field potentials, alpha was 0.09-0.16. Extraction of correct alpha and lambda in the slice required evaluation of nonspecific uptake, k', which was 1 x 10(-2) s-1. 3. Slices were made hypoxic by superfusing physiological saline equilibrated with 95% N2-5% CO2 for 10-30 min. Synaptic components of field potentials were inhibited after 3-4 min in hypoxic media. In some experiments extracellular K+ concentration [( K+]o) was monitored with ISMs. During hypoxia, [K+]o rose from an average baseline of 5.1 mM to 7-10 mM. After reoxygenation, [K+]o transiently fell below the original level. 4. The average value for alpha during hypoxia was 0.13 (a 38% decrease), which was significantly different from control (P less than 0.001) and increased progressively during hypoxic exposure. In contrast, tortuosity and k' were unchanged by this treatment. 5. These data represent the first characterization of the diffusion properties of the rat striatal slice and of changes in extracellular volume fraction during hypoxia in a brain slice preparation.(ABSTRACT TRUNCATED AT 250 WORDS)

  20. Dependence of microwave absorption properties on ferrite volume fraction in MnZn ferrite/rubber radar absorbing materials

    Energy Technology Data Exchange (ETDEWEB)

    Gama, Adriana M., E-mail: [Divisao de Materiais (AMR), Instituto de Aeronautica e Espaco (IAE), Departamento de Ciencia e Tecnologia Aeroespacial - DCTA (Brazil); Rezende, Mirabel C., E-mail: [Divisao de Materiais (AMR), Instituto de Aeronautica e Espaco (IAE), Departamento de Ciencia e Tecnologia Aeroespacial - DCTA (Brazil); Dantas, Christine C., E-mail: [Divisao de Materiais (AMR), Instituto de Aeronautica e Espaco (IAE), Departamento de Ciencia e Tecnologia Aeroespacial - DCTA (Brazil)


    We report the analysis of measurements of the complex magnetic permeability ({mu}{sub r}) and dielectric permittivity ({epsilon}{sub r}) spectra of a rubber radar absorbing material (RAM) with various MnZn ferrite volume fractions. The transmission/reflection measurements were carried out in a vector network analyzer. Optimum conditions for the maximum microwave absorption were determined by substituting the complex permeability and permittivity in the impedance matching equation. Both the MnZn ferrite content and the RAM thickness effects on the microwave absorption properties, in the frequency range of 2-18 GHz, were evaluated. The results show that the complex permeability and permittivity spectra of the RAM increase directly with the ferrite volume fraction. Reflection loss calculations by the impedance matching degree (reflection coefficient) show the dependence of this parameter on both thickness and composition of RAM. - Highlights: > Permeability and permittivity spectra of a MnZn ferrite RAM (2-18 GHz) are given. > Higher MnZn volume fraction favors increase of RAM/'s permeability and permittivity. > Minimum RL as a function of frequency, thickness and MnZn volume fraction given. > Higher thicknesses imply better absorption; optimum band shifts to lower frequencies. > For higher volume fractions, smaller thickness might offer better absorption (>10 GHz).

  1. Studying the Effect of Volume Fraction of Glass Fiberson the Thermal Conductivity of the Polymer Composite Materials

    Directory of Open Access Journals (Sweden)

    Mohammed Sellab Hamza


    Full Text Available In this study the effect of fiber volume fraction of the glass fiber on the thermal conductivity of the polymer composite material was studied. Different fiber volume fraction of glass fibers were used (3%, 6%, 9%, 12%, and 15%. Specimens were made from polyester which reinforced with glass fibers .The fibers had two arrangements according to the direction of the thermal flow. In the first arrangement the fibers were parallel to the direction of the thermal flow, while the second arrangement was perpendicular; Lee's disk method was used for testing the specimens. The experimental results proved that the values of the thermal conductivity of the specimens was higher when the fibers arranged in parallel direction than that when the fibers arranged in the perpendicular direction. The percentage of increasing of experimental thermal conductivity was 96.91% for parallel arrangement and 13.33% for perpendicular arrangement comparison with its original value before the using of glass fibers. Also the experimental results indicated that the thermal conductivity increases with the increasing of the fiber volume fraction. Minimum value was (0.172 W/m.C for perpendicular arrangement at fiber volume fraction 3% and maximum value was (0.327 W/m.C for parallel arrangement at fiber volume fraction 15%.

  2. RESOLVE Survey Photometry and Volume-limited Calibration of the Photometric Gas Fractions Technique

    CERN Document Server

    Eckert, Kathleen D; Stark, David V; Moffett, Amanda J; Norris, Mark A; Snyder, Elaine M; Hoversten, Erik A


    We present custom-processed UV, optical, and near-IR photometry for the RESOLVE survey, a volume-limited census of stellar, gas, and dynamical mass within two subvolumes of the nearby universe (RESOLVE-A and -B), complete down to baryonic mass ~10^9.1-9.3 Msun. In contrast to standard pipeline photometry (e.g., SDSS), our photometry uses optimal background subtraction, avoids suppressing color gradients, and includes systematic errors. With these improvements, we measure brighter magnitudes, larger radii, bluer colors, and a real increase in scatter around the red sequence. Combining stellar masses from our photometry with the RESOLVE-A HI mass census, we create volume-limited calibrations of the photometric gas fractions (PGF) technique, which predicts gas-to-stellar mass ratios (G/S) from galaxy colors and optional additional parameters. We analyze G/S-color residuals vs. potential third parameters, finding that axial ratio is the best independent and physically meaningful third parameter. We define a "modi...

  3. Elastic modulus of Al-Si/SiC metal matrix composites as a function of volume fraction

    Energy Technology Data Exchange (ETDEWEB)

    Santhosh Kumar, S; Rajasekharan, T [Powder Metallurgy Group, Defence Metallurgical Research Laboratory, Kanchanbagh PO, Hyderabad-500 058 (India); Seshu Bai, V [School of Physics, University of Hyderabad, Central University PO, Hyderabad-500 046 (India); Rajkumar, K V; Sharma, G K; Jayakumar, T, E-mail: [Non-Destructive Evaluation Division, Indira Gandhi Center for Atomic Research, Kalpakkam, Chennai-603 102 (India)


    Aluminum alloy matrix composites have emerged as candidate materials for electronic packaging applications in the field of aerospace semiconductor electronics. Composites prepared by the pressureless infiltration technique with high volume fractions in the range 0.41-0.70 were studied using ultrasonic velocity measurements. For different volume fractions of SiC, the longitudinal velocity and shear velocity were found to be in the range of 7600-9300 m s{sup -1} and 4400-5500 m s{sup -1}, respectively. The elastic moduli of the composites were determined from ultrasonic velocities and were analysed as a function of the volume fraction of the reinforcement. The observed variation is discussed in the context of existing theoretical models for the effective elastic moduli of two-phase systems.

  4. Three-dimensional simulations of microstructural evolution in polycrystalline dual-phase materials with constant volume fractions

    DEFF Research Database (Denmark)

    Poulsen, Stefan Othmar; Voorhees, P.W.; Lauridsen, Erik Mejdal


    The microstructural evolution of a polycrystalline dual-phase material with a constant volume fraction of the phases was investigated using large-scale three-dimensional phase-field simulations. All materials parameters are taken to be isotropic, and microstructures with volume fractions of 50....../50 and 40/60 were examined. After an initial transient, the number of grains decrease from ∼2600 to ∼500. It was found that the mean grain size of grains of both phases obeyed a power law with an exponent of 3, and the microstructural evolution was found to be controlled by diffusion. Steady...... with the topology of single-phase grain structures as determined by experiment and simulation. The evolution of size and number of faces for the minority and majority phase grains in the 40/60 volume fraction simulation is presented and discussed. Non-constant curvature across some interphase boundaries...

  5. Effect of volume fraction of ramie cloth on physical and mechanical properties of ramie cloth/UP resin composite

    Institute of Scientific and Technical Information of China (English)

    LEI Wen-guang; REN Chao


    Ramie cloth/UP resin composite was formed at 0.2 MPa and cured at room temperature for 24 h and treated at 80 ℃ for2 h. The physical and mechanical properties of the composites with different volume fractions of ramie cloth were studied. The results show that,with the increase of the volume fraction of the ramie cloth,densities of the composites become greater and greater,though all lower than the theoretical values,the linear shrinkage during the formation decreases from 1.20% of the original UP resin to 0.18% of the composite with 30% of ramie cloth in volume,all the composites also absorb more water than UP resin casting,greater volume fraction of the fiber,more water will be absorbed,but the increase in water absorption becomes smaller and smaller with time. As regards some mechanical properties,the tensile strength,flexural strength,flexural modulus and impact strength are all improved when more ramie fiber is added. Compared with those of pure UP resin casting,the mechanical properties are increased by 93.93%,76.20%,190.18% and 227.26% respectively when the volume fraction of the ramie cloth in the composite is 30%. The differential scanning calorimetry results show that only one peak will appear for the sample without or with less ramie fiber while two peaks will appear when more ramie cloth is added.

  6. A Method for Out-of-autoclave Fabrication of High Fiber Volume Fraction Fiber Reinforced Polymer Composites (United States)


    increasing the fiber-volume fraction by vacuum-assisted resin transfer molding ( VARTM ) in order to produce composite structures with aerospace-grade...processed composites. Using a combination of viscosity control, ARL- based VARTM techniques, and a pressure control system, we increased the fiber-volume...content from 50% (ARL’s normal processing range for a particular material system and VARTM process) to over 60%. Future work will focus on

  7. The effect of graphene nanoplatelet volume fraction on water graphene nanofluid thermal conductivity and viscosity (United States)

    Bahaya, Bernard

    The aim of this thesis is to study the improvement of heat transfer in graphene-water nanofluids. Experiments were conducted with graphene nanoplatelets (GNP) to study the relative benefit of the thermal conductivity improvement in relationship to the potential detriment when considering the effect that more GNP dispersed in the water increases the viscosity of the resulting suspension relative to that of the water. A maximum enhancement ratio for GNP nanofluid thermal conductivity over water was 1.43 at a volume fraction of 0.014. Based upon GNP aspect ratios confirmed in sizing measurements, the DEM model presented by Chu et al., (2012) appears to describe the experimental results of this study when using a fitted interfacial resistance value of 6.25 E -8 m2 K W-1. The well-known Einstein viscosity model for spheres dispersed in fluids was shown to under predict the experimental data. Adjusting the intrinsic model term for spheres from a value of 2.5 to a fitted value of 1938 representative for the GNP of this study provided much closer agreement between measured and predicted values. Heat transfer is a nonlinear function of viscosity and thermal conductivity and heat transfer is predicted to decrease for GNP nanofluids when compared to water alone. Hence the use of nanofluids to enhance heat transfer processes appears not to be viable.

  8. Properties of High Volume Fraction Fly Ash/Al Alloy Composites Produced by Infiltration Process (United States)

    Kountouras, D. T.; Stergioudi, F.; Tsouknidas, A.; Vogiatzis, C. A.; Skolianos, S. M.


    In the present study, pressure infiltration is employed to synthesize aluminum alloy 7075-fly ash composites. The microstructure and chemical composition of the fly ash and the produced composite material was examined using optical and scanning electron microscopy, as well as x-ray diffraction. Several properties of the produced composite material were examined and evaluated including macro-hardness, wear, thermal expansion, and corrosion behavior. The wear characteristics of the composite, in the as-cast conditions, were studied by dry sliding wear tests. The corrosion behavior of composite material was evaluated by means of potentiodynamic corrosion experiments in a 3.5 wt.% NaCl solution. The composite specimens exhibit a homogeneous distribution of fly ash particles and present enhanced hardness values, compared to the matrix material. The high volume fraction of the fly ash reinforcement (>40%) in the composite material led to increased wear rates, attributed to the fragmentation of the fly ash particles. However, the presence of fly ash particles in the Al alloy matrix considerably decreased the coefficiency of thermal expansion, while resulting in an altered corrosion mechanism of the composite material with respect to the matrix alloy.

  9. Mapping Bone Mineral Density Obtained by Quantitative Computed Tomography to Bone Volume Fraction (United States)

    Pennline, James A.; Mulugeta, Lealem


    Methods for relating or mapping estimates of volumetric Bone Mineral Density (vBMD) obtained by Quantitative Computed Tomography to Bone Volume Fraction (BVF) are outlined mathematically. The methods are based on definitions of bone properties, cited experimental studies and regression relations derived from them for trabecular bone in the proximal femur. Using an experimental range of values in the intertrochanteric region obtained from male and female human subjects, age 18 to 49, the BVF values calculated from four different methods were compared to the experimental average and numerical range. The BVF values computed from the conversion method used data from two sources. One source provided pre bed rest vBMD values in the intertrochanteric region from 24 bed rest subject who participated in a 70 day study. Another source contained preflight vBMD values from 18 astronauts who spent 4 to 6 months on the ISS. To aid the use of a mapping from BMD to BVF, the discussion includes how to formulate them for purpose of computational modeling. An application of the conversions would be used to aid in modeling of time varying changes in vBMD as it relates to changes in BVF via bone remodeling and/or modeling.

  10. Left ventricular ejection fraction and left ventricular end-diastolic volume in patients with diastolic dysfunction. (United States)

    Jovin, Ion S; Ebisu, Keita; Liu, Yi-Hwa; Finta, Laurie A; Oprea, Adriana D; Brandt, Cynthia A; Dziura, James; Wackers, Frans J


    Diastolic dysfunction can be diagnosed on equilibrium radionuclide angiocardiography (ERNA) by a low peak filling rate (PFR) in the setting of a normal left ventricular ejection fraction (LVEF). The authors evaluated the relationship between diastolic dysfunction, LVEF, and end-diastolic volume (EDV). A total of 408 predominantly asymptomatic patients with an LVEF ≥50% by ERNA were studied. LVEF of patients with a low PFR was compared with the LVEF of patients with a normal PFR. Correlation analyses to evaluate the association between PFR and EDV were also performed. The LVEF of patients with a low PFR was lower than the LVEF of patients with normal PFR (59±7 vs 63%±7%; PPFR (r=-0.04; P=.32). The results did not change when the EDV indices were used. In patients who had repeat scans, there was no correlation between the change in EDV and the change in PFR (r=0.16; P=.2). In asymptomatic patients undergoing ERNA who have normal systolic function, a low PFR can be associated with a lower LVEF, but it is not associated with changes in EDV. This suggests that diastolic dysfunction is associated with mild systolic dysfunction.

  11. A framework of whole heart extracellular volume fraction estimation for low-dose cardiac CT images. (United States)

    Chen, Xinjian; Nacif, Marcelo S; Liu, Songtao; Sibley, Christopher; Summers, Ronald M; Bluemke, David A; Yao, Jianhua


    Cardiac CT (CCT) is widely available and has been validated for the detection of focal myocardial scar using a delayed enhancement technique in this paper. CCT, however, has not been previously evaluated for quantification of diffuse myocardial fibrosis. In our investigation, we sought to evaluate the potential of low-dose CCT for the measurement of myocardial whole heart extracellular volume (ECV) fraction. ECV is altered under conditions of increased myocardial fibrosis. A framework consisting of three main steps was proposed for CCT whole heart ECV estimation. First, a shape-constrained graph cut (GC) method was proposed for myocardium and blood pool segmentation on postcontrast image. Second, the symmetric demons deformable registration method was applied to register precontrast to postcontrast images. So the correspondences between the voxels from precontrast to postcontrast images were established. Finally, the whole heart ECV value was computed. The proposed method was tested on 20 clinical low-dose CCT datasets with precontrast and postcontrast images. The preliminary results demonstrated the feasibility and efficiency of the proposed method.

  12. Surface area and volume fraction of random open-pore systems (United States)

    Hermann, H.; Elsner, A.; Stoyan, D.


    For the first time, explicit approximate formulas are presented for the volume fraction and specific surface area of random open-pore systems with poly-disperse pore size distributions. It is shown that the formulas are valid for broad classes of models for porous media characterized by tunable pore size distributions and a variable degree of inter-penetrability of pores. The formulas for the poly-disperse case are based on expressions derived previously for mono-disperse penetrable-sphere models. The results are obtained by analysis of a series of open-pore models, which are prepared by computer simulation of systems of randomly packed partially penetrable spheres with various poly-disperse size distributions such as gamma, lognormal, and Gaussian. The formulas are applied in a study of atomic layer deposition processes on open-pore systems, and the effective Young's modulus and the effective thermal conductivity of Al2O3 coated porous polypropylene electrodes for lithium ion batteries are predicted.

  13. Role of cardiac CTA in estimating left ventricular volumes and ejection fraction

    Institute of Scientific and Technical Information of China (English)

    Robin; Man; Singh; Balkrishna; Man; Singh; Jawahar; Lal; Mehta


    Left ventricular ejection fraction(LVEF)is an impor-tant predictor of cardiac outcome and helps in makingimportant diagnostic and therapeutic decisions suchas the treatment of different types of congestive heartfailure or implantation of devices like cardiac resynchro-nization therapy-defibrillator.LVEF can be measuredby various techniques such as transthoracic echo-cardiography,contrast ventriculography,radionuclidetechniques,cardiac magnetic resonance imaging andcardiac computed tomographic angiography(CTA).Thedevelopment of cardiac CTA using multi-detector rowCT(MDCT)has seen a very rapid improvement in thetechnology for identifying coronary artery stenosis andcoronary artery disease in the last decade.During theacquisition,processing and analysis of data to studycoronary anatomy,MDCT provides a unique opportunityto measure left ventricular volumes and LVEF simulta-neously with the same data set without the need foradditional contrast or radiation exposure.The develop-ment of semi-automated and automated software to measure LVEF has now added uniformity,efficiency and reproducibility of practical value in clinical practice rather than just being a research tool.This article will address the feasibility,the accuracy and the limitations of MDCT in measuring LVEF.

  14. Considerations regarding the volume fraction influence on the wear behavior of the fiber reinforced composite systems (United States)

    Caliman, R.


    This paper contains an analysis of the factors that have an influence on the tribological characteristics of the composite material sintered with metal matrix reinforced with carbon fibers. These composites are used generally if it’s needed the wear resistant materials, whereas these composites have high specific strength in conjunction with a good corrosion resistance at low densities and some self-lubricating properties. Through the knowledge of the better tribological properties of the materials and their behavior to wear, can be generated by dry and the wet friction. Thus, where necessary the use of high temperature resistant material with low friction between the elements, carbon fiber composite materials are very suitable because they have: mechanical strength and good ductility, melting temperature on the higher values, higher electrical and thermal conductivity, lower wear speed and lower friction forces. For this purpose, this paper also contains an experimental program based on the evidence of formaldehyde resin made from fiber reinforced Cu-carbon with the aim to specifically determine the volume of fibers fraction for the consolidation of the composite material. In order to determine the friction coefficient and the wear rates of the various fiber reinforced polymer mixtures of carbon have been used special devices with needle-type with steel disc. These tests were conducted in the atmosphere at the room temperature without external lubrication study taking into consideration the sliding different speeds with constant loading task.

  15. Non-monotonic dependence of Pickering emulsion gel rheology on particle volume fraction. (United States)

    Kaganyuk, M; Mohraz, A


    The microstructure of Pickering emulsion gels features a tenuous network of faceted droplets, bridged together by shared monolayers of particles. In this investigation, we use standard oscillatory rheometry in conjunction with confocal microscopy to gain a more comprehensive understanding of the role particle bridged interfaces have on the rheology of Pickering emulsion gels. The zero-shear elastic modulus of Pickering emulsion gels shows a non-monotonic dependence on particle loading, with three separate regimes of power-law and linear gel strengthening, and subsequent gel weakening. The transition from power-law to linear scaling is found to coincide with a peak in the volume fraction of particles that participate in bridging, which we indirectly calculate using measureable quantities, and the transition to gel weakening is shown to result from a loss in network connectivity at high particle loadings. These observations are explained via a simple representation of how Pickering emulsion gels arise from an initial population of partially-covered droplets. Based on these considerations, we propose a combined variable related to the initial droplet coverage, to be used in reporting and rationalizing the rheology of Pickering emulsion gels. We demonstrate the applicability of this variable with Pickering emulsions prepared at variable fluid ratios and with different-sized colloidal particles. The results of our investigation have important implications for many technological applications that utilize solid stabilized multi-phase emulsions and require a priori knowledge or engineering of their flow characteristics.

  16. A framework of whole heart extracellular volume fraction estimation for low dose cardiac CT images (United States)

    Chen, Xinjian; Summers, Ronald M.; Nacif, Marcelo Souto; Liu, Songtao; Bluemke, David A.; Yao, Jianhua


    Cardiac magnetic resonance imaging (CMRI) has been well validated and allows quantification of myocardial fibrosis in comparison to overall mass of the myocardium. Unfortunately, CMRI is relatively expensive and is contraindicated in patients with intracardiac devices. Cardiac CT (CCT) is widely available and has been validated for detection of scar and myocardial stress/rest perfusion. In this paper, we sought to evaluate the potential of low dose CCT for the measurement of myocardial whole heart extracellular volume (ECV) fraction. A novel framework was proposed for CCT whole heart ECV estimation, which consists of three main steps. First, a shape constrained graph cut (GC) method was proposed for myocardium and blood pool segmentation for post-contrast image. Second, the symmetric Demons deformable registrations method was applied to register pre-contrast to post-contrast images. Finally, the whole heart ECV value was computed. The proposed method was tested on 7 clinical low dose CCT datasets with pre-contrast and post-contrast images. The preliminary results demonstrated the feasibility and efficiency of the proposed method.

  17. The Effect of Type and Volume Fraction (Vf) of Steel Fiber on the Mechanical Properties of Self-Compacting Concrete

    DEFF Research Database (Denmark)

    Ghanbarpour, S.; Mazaheripour, H.; Mirmoradi, S. H.;


    is to investigate the effects of type and volume fraction of steel fiber on the compressive strength, split tensile strength, flexural strength and modulus of elasticity of steel fiber reinforced self-compacting concrete (SFRSCC). Design/methodology/approach – For this purpose, Micro wire and Wave type steel fibers...

  18. Effect of particle volume fraction on the settling velocity of volcanic ash particles: implications for ash dispersion models (United States)

    Del Bello, E.; Taddeucci, J.; De'Michieli Vitturi, M.; Scarlato, P.; Andronico, D.; Scollo, S.; Kueppers, U.


    We present the first report of experimental measurements of the enhanced settling velocity of volcanic particles as function of particle volume fraction. In order to investigate the differences in the aerodynamic behavior of ash particles when settling individually or in mass, we performed systematic large-scale ash settling experiments using natural basaltic and phonolitic ash. By releasing ash particles at different, controlled volumetric flow rates, in an unconstrained open space and at minimal air movement, we measured their terminal velocity, size, and particle volume fraction with a high-speed camera at 2000 fps. Enhanced settling velocities of individual particles increase with increasing particle volume fraction. This suggests that particle clustering during fallout may be one reason explaining larger than theoretical depletion rates of fine particles from volcanic ash clouds. We provide a quantitative empirical model that allows to calculate, from a given particle size and density, the enhanced velocity resulting from a given particle volume fraction. The proposed model has the potential to serve as a simple tool for the prediction of the terminal velocity of ash of an hypothetical distribution of ash of known particle size and volume fraction. This is of particular importance for advection-diffusion transport model of ash where generally a one-way coupling is adopted, considering only the flow effects on particles. To better quantify the importance of the enhanced settling velocity in ash dispersal, we finally introduced the new formulation in a Lagrangian model calculating for realistic eruptive conditions the resulting ash concentration in the atmosphere and on the ground.

  19. Effects of diluents on soot surface temperature and volume fraction in diluted ethylene diffusion flames at pressure

    KAUST Repository

    Kailasanathan, Ranjith Kumar Abhinavam


    Soot surface temperature and volume fraction are measured in ethylene/air coflowing laminar diffusion flames at high pressures, diluted with one of four diluents (argon, helium, nitrogen, and carbon dioxide) using a two-color technique. Both temperature and soot measurements presented are line-of-sight averages. The results aid in understanding the kinetic and thermodynamic behavior of the soot formation and oxidation chemistry with changes in diluents, ultimately leading to possible methods of reducing soot emission from practical combustion hardware. The diluted fuel and coflow exit velocities (top-hat profiles) were matched at all pressures to minimize shear effects. In addition to the velocity-matched flow rates, the mass fluxes were held constant for all pressures. Addition of a diluent has a pronounced effect on both the soot surface temperature and volume fraction, with the helium diluted flame yielding the maximum and carbon dioxide diluted flame yielding minimum soot surface temperature and volume fraction. At low pressures, peak soot volume fraction exists at the tip of the flame, and with an increase in pressure, the location shifts lower to the wings of the flame. Due to the very high diffusivity of helium, significantly higher temperature and volume fraction are measured and explained. Carbon dioxide has the most dramatic soot suppression effect. By comparing the soot yield with previously measured soot precursor concentrations in the same flame, it is clear that the lower soot yield is a result of enhanced oxidation rates rather than a reduction in precursor formation. Copyright © 2014 Taylor & Francis Group, LLC.

  20. Specimen Preparation for Metal Matrix Composites with a High Volume Fraction of Reinforcing Particles for EBSD Analysis (United States)

    Smirnov, A. S.; Belozerov, G. A.; Smirnova, E. O.; Konovalov, A. V.; Shveikin, V. P.; Muizemnek, O. Yu.


    The paper deals with a procedure of preparing a specimen surface for the EBSD analysis of a metal matrix composite (MMC) with a high volume fraction of reinforcing particles. Unlike standard procedures of preparing a specimen surface for the EBSD analysis, the proposed procedure is iterative with consecutive application of mechanical and electrochemical polishing. This procedure significantly improves the results of an indexed MMC matrix in comparison with the standard procedure of specimen preparation. The procedure was verified on a MMC with pure aluminum (99.8% Al) as the matrix, SiC particles being used as reinforcing elements. The average size of the SiC particles is 14 μm, and their volume fraction amounts to 50% of the total volume of the composite. It has been experimentally found that, for making the EBSD analysis of a material matrix near reinforcing particles, the difference in height between the particles and the matrix should not exceed 2 µm.

  1. In vivo gastroprotective effect of nanoparticles: influence of chemical composition and volume fraction. (United States)

    Bueno, Kelly; Adorne, Marcia D; Jornada, Denise S; da Fonseca, Francisco Noé; Guterres, Sílvia S; Pohlmann, Adriana R


    In nanomedicine, different nanomaterials and nanoparticles have been proposed as therapeutic agents or adjuvants, as well as diagnosis devices. Considering that the principal cause of the ulcerations is the imbalance among the gastric juice secretion and the protection provided by the mucosal barrier and the neutralization of the gastric acid, as well as that nanoparticles are able to accumulate in the gastro-intestinal tissues, we proposed a 2(2) factorial design to evaluate the influence of the chemical composition and the volume fraction of the dispersed phase on the gastric protective effect against ulceration induced by ethanol. Cocoa-theospheres (CT) and lipid-core nanocapsules (LNC) (two different kinds of surfaces: lipid and polymeric, respectively) prepared at two different concentrations of soft materials: 4% and 12% (w/v) were produced by high pressure homogenization and solvent displacement methods, respectively. Laser diffraction showed volume-weighted mean diameters ranging from 133 to 207 nm, number median diameters lower than 100 nm and specific surfaces between 41.2 and 51.2 m(2) g(-1). The formulations had pH ranging from 4.7 to 6.3; and zeta potential close to -9 mV due to their coating with polysorbate 80. The ulcer indexes were 0.40 (LNC(4)) and 0.48 (CT(4)) for the lower total administered areas (3.3 and 4.1 m(2)g(-1), respectively), and 0.09 (LNC(12) and CT(12)) for the higher administered areas (10.0 and 12.0 m(2) g(-1), respectively). LNC(4), LNC(12) and CT(12) showed lower levels in the lipid peroxidation assay when compared either to the negative control (saline) or to CT(4). LNC(12) and CT(12) showed similar TBARS levels, as well as CT(4) was similar to the negative control. SEM analysis of the stomach mucosa showed coatings more homogenous and cohesive when LNC formulations were administered compared to the correspondent CT formulations. The higher total area of administered nanoparticles showed film formation. Moreover, LNC(12

  2. Extracellular volume fraction mapping in the myocardium, part 2: initial clinical experience

    Directory of Open Access Journals (Sweden)

    Kellman Peter


    Full Text Available Abstract Background Diffuse myocardial fibrosis, and to a lesser extent global myocardial edema, are important processes in heart disease which are difficult to assess or quantify with cardiovascular magnetic resonance (CMR using conventional late gadolinium enhancement (LGE or T1-mapping. Measurement of the myocardial extracellular volume fraction (ECV circumvents factors that confound T1-weighted images or T1-maps. We hypothesized that quantitative assessment of myocardial ECV would be clinically useful for detecting both focal and diffuse myocardial abnormalities in a variety of common and uncommon heart diseases. Methods A total of 156 subjects were imaged including 62 with normal findings, 33 patients with chronic myocardial infarction (MI, 33 with hypertrophic cardiomyopathy (HCM, 15 with non-ischemic dilated cardiomyopathy (DCM, 7 with acute myocarditis, 4 with cardiac amyloidosis, and 2 with systemic capillary leak syndrome (SCLS. Motion corrected ECV maps were generated automatically from T1-maps acquired pre- and post-contrast calibrated by blood hematocrit. Abnormally-elevated ECV was defined as >2SD from the mean ECV in individuals with normal findings. In HCM the size of regions of LGE was quantified as the region >2 SD from remote. Results Mean ECV of 62 normal individuals was 25.4 ± 2.5% (m ± SD, normal range 20.4%-30.4%. Mean ECV within the core of chronic myocardial infarctions (without MVO (N = 33 measured 68.5 ± 8.6% (p  Conclusions ECV mapping appears promising to complement LGE imaging in cases of more homogenously diffuse disease. The ability to display ECV maps in units that are physiologically intuitive and may be interpreted on an absolute scale offers the potential for detection of diffuse disease and measurement of the extent and severity of abnormal regions.


    Institute of Scientific and Technical Information of China (English)


    A phase transformation model was presented for predicting the phase fraction transformed and the carbon concentration in austenite for austenite to ferrite transformation during laminar cooling on run-out table in hot rolling strip mill. In this model, the parameter k in Avrami equation was developed for carbon steels. The wide range of chemical composition, the primary austenite grain size, and the retained strain were taken into account. It can be used to predict the ferrite volume fraction and the carbon concentration in austenite of hot-rolled steel strip during laminar cooling on run-out table. The coiling temperature controlling model was also presented to calculate the temperature of steel strip. The transformation kinetics of austenite to ferrite and the evolution of carbon concentration in austenite at different temperatures during cooling were investigated in the hot rolled Q235B strip for thickness of 9.35, 6.4, and 3.2mm. The ferrite volume fraction along the length of the strip was also calculated. The calculated ferrite volume fraction was compared with the log data from hot strip mill and the calculated results were in agreement with the experimental ones. The present study is a part of the prediction of the mechanical properties of hot-rolled steel strip, and it has already been used on-line and off-line in the hot strip mill.

  4. Measurement of Soot Volume Fraction and Temperature for Oxygen-Enriched Ethylene Combustion Based on Flame Image Processing

    Directory of Open Access Journals (Sweden)

    Weijie Yan


    Full Text Available A method for simultaneously visualizing the two-dimensional distributions of temperature and soot volume fraction in an ethylene flame was presented. A single-color charge-coupled device (CCD camera was used to capture the flame image in the visible spectrum considering the broad-response spectrum of the R and G bands of the camera. The directional emissive power of the R and G bands were calibrated and used for measurement. Slightly increased temperatures and reduced soot concentration were predicted in the central flame without self-absorption effects considered, an iterative algorithm was used for eliminating the effect of self-absorption. Nine different cases were presented in the experiment to demonstrate the effects of fuel mass flow rate and oxygen concentration on temperature and soot concentration in three different atmospheres. For ethylene combustion in pure-air atmosphere, as the fuel mass flow rate increased, the maximum temperature slightly decreased, and the maximum soot volume fraction slightly increased. For oxygen fractions of 30%, 40%, and 50% combustion in O2/N2 oxygen-enhanced atmospheres, the maximum flame temperatures were 2276, 2451, and 2678 K, whereas combustion in O2/CO2 atmospheres were 1916, 2322, and 2535 K. The maximum soot volume fractions were 4.5, 7.0, and 9.5 ppm in oxygen-enriched O2/N2 atmosphere and 13.6, 15.3, and 14.8 ppm in oxygen-enriched O2/CO2 atmosphere. Compared with the O2/CO2 atmosphere, combustion in the oxygen-enriched O2/N2 atmosphere produced higher flame temperature and larger soot volume fraction. Preliminary results indicated that this technique is reliable and can be used for combustion diagnosis.

  5. Mechanical behaviors of the dispersion nuclear fuel plates induced by fuel particle swelling and thermal effect I: Effects of variations of the fuel particle volume fractions (United States)

    Wang, Qiming; Yan, Xiaoqing; Ding, Shurong; Huo, Yongzhong


    A new method of modeling the in-pile mechanical behaviors of dispersion nuclear fuel elements is proposed. Considering the irradiation swelling together with the thermal effect, numerical simulations of the in-pile mechanical behaviors are performed with the developed finite element models for different fuel particle volume fractions of the fuel meat. The effects of the particle volume fractions on the mechanical performances of the fuel element are studied. The research results indicate that: (1) the maximum Mises stresses and equivalent plastic strains at the matrix increase with the particle volume fractions at each burnup; the locations of the maximum first principal stresses shift with increasing burnup; at low burnups, the maximum first principal stresses increase with the particle volume fractions; while at high burnups, the 20% volume fraction case holds the lowest value; (2) at the cladding, the maximum equivalent plastic strains and the tensile principal stresses increase with the particle volume fractions; while the maximum Mises stresses do not follow this order at high burnups; (3) the maximum Mises stresses at the fuel particles increase with the particle volume fractions, and the particles will engender plastic strains until the particle volume fraction reaches high enough.

  6. Quantitative grain-scale ferroic domain volume fractions and domain switching strains from three-dimensional X-ray diffraction data

    DEFF Research Database (Denmark)

    Oddershede, Jette; Majkut, Marta; Caosyd, Qinghua


    A method for the extension of the three-dimensional X-ray diffraction technique to allow the extraction of domain volume fractions in polycrystalline ferroic materials is presented. This method gives access to quantitative domain volume fractions of hundreds of independent embedded grains within...

  7. Theoretical and experimental analysis of a multiphase screw pump, handling gas-liquid mixtures with very high gas volume fractions

    Energy Technology Data Exchange (ETDEWEB)

    Raebiger, K. [LEISTRITZ Pumpen GmbH, Nuremberg (Germany); Faculty of Advanced Technology, University of Glamorgan, Pontypridd, Wales (United Kingdom); Maksoud, T.M.A.; Ward, J. [Faculty of Advanced Technology, University of Glamorgan, Pontypridd, Wales (United Kingdom); Hausmann, G. [Department of Mechanical Engineering and Building Services Engineering, University of Applied Sciences, Nuremberg (Germany)


    In the investigation of the pumping behaviour of multiphase screw pumps, handling gas-liquid mixtures with very high gas volume fractions, theoretical and experimental analyses were performed. A new theoretical screw pump model was developed, which calculates the time-dependent conditions inside the several chambers of a screw pump as well as the exchange of mass and energy between these chambers. By means of the performed experimental analysis, the screw pump model was verified, especially at very high gas volume fractions from 90% to 99%. The experiments, which were conducted with the reference fluids water and air, can be divided mainly into the determination of the steady state pumping behaviour on the one hand and into the analysis of selected transient operating conditions on the other hand, whereas the visualisation of the leakage flows through the circumferential gaps was rounded off the experimental analysis. (author)

  8. Research on Cellular Instabilities of Lean Premixed Syngas Flames under Various Hydrogen Fractions Using a Constant Volume Vessel

    Directory of Open Access Journals (Sweden)

    Hong-Meng Li


    Full Text Available An experimental study of the intrinsic instabilities of H2/CO lean (φ = 0.4 to φ = 1.0 premixed flames at different hydrogen fractions ranging from 0% to 100% at elevated pressure and room temperature was performed in a constant volume vessel using a Schlieren system. The unstretched laminar burning velocities were compared with data from the previous literature and simulated results. The results indicate that excellent agreements are obtained. The cellular instabilities of syngas-air flames were discussed and critical flame radii were measured. When hydrogen fractions are above 50%, the flame tends to be more stable as the equivalence ratio increases; however, the instability increases for flames of lower hydrogen fractions. For the premixed syngas flame with hydrogen fractions greater than 50%, the decline in cellular instabilities induced by the increase in equivalence ratio can be attributed to a reduction of diffusive-thermal instabilities rather than increased hydrodynamic instabilities. For premixed syngas flames with hydrogen fractions lower than 50%, as the equivalence ratio increases, the cellular instabilities become more evident because the enhanced hydrodynamic instabilities become the dominant effect. For premixed syngas flames, the enhancement of cellular instabilities induced by the increase in hydrogen fraction is the result of both increasing diffusive-thermal and hydrodynamic instabilities.

  9. Influence of bone volume fraction and architecture on computed large-deformation failure mechanisms in human trabecular bone. (United States)

    Bevill, Grant; Eswaran, Senthil K; Gupta, Atul; Papadopoulos, Panayiotis; Keaveny, Tony M


    Large-deformation bending and buckling have long been proposed as failure mechanisms by which the strength of trabecular bone can be affected disproportionately to changes in bone density, and thus may represent an important aspect of bone quality. We sought here to quantify the contribution of large-deformation failure mechanisms on strength, to determine the dependence of these effects on bone volume fraction and architecture, and to confirm that the inclusion of large-deformation effects in high-resolution finite element models improves predictions of strength versus experiment. Micro-CT-based finite element models having uniform hard tissue material properties were created from 54 cores of human trabecular bone taken from four anatomic sites (age = 70+/-11; 24 male, 27 female donors), which were subsequently biomechanically tested to failure. Strength predictions were made from the models first including, then excluding, large-deformation failure mechanisms, both for compressive and tensile load cases. As expected, strength predictions versus experimental data for the large-deformation finite element models were significantly improved (p deformation models in both tension and compression. Below a volume fraction of about 0.20, large-deformation failure mechanisms decreased trabecular strength from 5-80% for compressive loading, while effects were negligible above this volume fraction. Step-wise nonlinear multiple regression revealed that structure model index (SMI) and volume fraction (BV/TV) were significant predictors of these reductions in strength (R2 = 0.83, p deformation failure mechanisms on trabecular bone strength is highly heterogeneous and is not well explained by standard architectural metrics.

  10. Determination of the steam volume fraction in the event of loss of cooling of the spent fuel storage pool (United States)

    Sledkov, R. M.; Galkin, I. Yu.; Stepanov, O. E.; Strebnev, N. A.


    When one solves engineering problems related to the cooling of fuel assemblies (FAs) in a spent fuel storage pool (SFSP) and the assessment of nuclear safety of FA storage in an SFSP in the initial event of loss of SFSP cooling, it is essential to determine the coolant density and, consequently, steam volume fractions φ in bundles of fuel elements at a pressure of 0.1-0.5 MPa. Such formulas for calculating φ that remain valid in a wide range of operating parameters and geometric shapes of channels and take the conditions of loss of SFSP cooling into account are currently almost lacking. The results of systematization and analysis of the available formulas for φ are reported in the present study. The calculated values were compared with the experimental data obtained in the process of simulating the conditions of FA cooling in an SFSP in the event of loss of its cooling. Six formulas for calculating the steam volume fraction, which were used in this comparison, were chosen from a total of 11 considered relations. As a result, the formulas producing the most accurate values of φ in the conditions of loss of SFSP cooling were selected. In addition, a relation that allows one to perform more accurate calculations of steam volume fractions in the conditions of loss of SFSP cooling was derived based on the Fedorov formula in the two-group approximation.

  11. Rheological Characterisation of the Flow Behaviour of Wood Plastic Composites in Consideration of Different Volume Fractions of Wood (United States)

    Laufer, N.; Hansmann, H.; Koch, M.


    In this study, the rheological properties of wood plastic composites (WPC) with different polymeric matrices (LDPE, low-density polyethylene and PP, polypropylene) and with different types of wood filler (hardwood flour and softwood flour) have been investigated by means of high pressure capillary rheometry. The volume fraction of wood was varied between 0 and 60 %. The shear thinning behaviour of the WPC melts can be well described by the Ostwald - de Waele power law relationship. The flow consistency index K of the power law shows a good correlation with the volume fraction of wood. Interparticular interaction effects of wood particles can be mathematically taken into account by implementation of an interaction exponent (defined as the ratio between flow exponent of WPC and flow exponent of polymeric matrix). The interaction exponent shows a good correlation with the flow consistency index. On the basis of these relationships the concept of shear-stress-equivalent inner shear rate has been modified. Thus, the flow behaviour of the investigated wood filled polymer melts could be well described mathematically by the modified concept of shear-stress-equivalent inner shear rate. On this basis, the shear thinning behaviour of WPC can now be estimated with good accuracy, taking into account the volume fraction of wood.

  12. [Automatic calculation of left ventricular volume and ejection fraction from gated myocardial perfusion SPECT--basic evaluation using phantom]. (United States)

    Kinoshita, Y; Nanbu, I; Tohyama, J; Ooba, S


    We evaluated accuracy of Quantitative Gated SPECT Program that enabled calculation of the left ventricular (LV) volume and ejection fraction by automatically tracing the contour of the cardiac surface. Cardiac phantoms filled with 99mTc-solution were used. Data acquisition was made by 180-degree projection in L type and 360-degree projection in opposed type. Automatic calculation could be done in all processes, which required 3-4 minutes. Reproducibility was sufficient. The adequate cut off value of a prefilter was 0.45. At this value LV volume was 93% of the actual volume in L type acquisition and 95.9% in opposed type acquisition. The LV volume obtained in L type was smaller than that obtained in opposed type (p defects was fair, on the cardiac phantoms with all of 90-degree defects and 180-degree defects of the septal and lateral wall. The LV volume was estimated to be larger on the phantom with 180-degree defect of the anterior wall, and to be smaller on the phantom of 180-degree defect of the inferoposterior wall. Because tracing was deviated anteriorly at the defects. In the patients with similar conditions to 180-degree defect of the anterior wall or inferoposterior wall, the LV volume should be carefully evaluated.

  13. Automatic calculation of left ventricular volume and ejection fraction from gated myocardial perfusion SPECT. Basic evaluation using phantom

    Energy Technology Data Exchange (ETDEWEB)

    Kinoshita, Yoshimi; Nanbu, Ichirou [Nagoya Daini Red Cross Hospital (Japan); Tohyama, Junko; Ooba, Satoru


    We evaluated accuracy of Quantitative Gated SPECT Program that enabled calculation of the left ventricular (LV) volume and ejection fraction by automatically tracing the contour of the cardiac surface. Cardiac phantoms filled with {sup 99m}Tc-solution were used. Data acquisition was made by 180-degree projection in L type and 360-degree projection in opposed type. Automatic calculation could be done in all processes, which required 3-4 minutes. Reproducibility was sufficient. The adequate cut off value of a prefilter was 0.45. At this value LV volume was 93% of the actual volume in L type acquisition and 95.9% in opposed type acquisition. The LV volume obtained in L type was smaller than that obtained in opposed type (p<0.05). The tracing of the defects was fair, on the cardiac phantoms with all of 90-degree defects and 180-degree defects of the septal and lateral wall. The LV volume was estimated to be larger on the phantom with 180-degree defect of the anterior wall, and to be smaller on the phantom of 180-degree defect of the inferoposterior wall. Because tracing was deviated anteriorly at the defects. In the patients with similar conditions to 180-degree defect of the anterior wall or inferoposterior wall, the LV volume should be carefully evaluated. (author)

  14. Correlation between Cohesive Energy Density, Fractional Free Volume, and Gas Transport Properties of Poly(ethylene-co-vinyl acetate Materials

    Directory of Open Access Journals (Sweden)

    Piotr Kubica


    Full Text Available The transport properties of the poly(ethylene-co-vinyl acetate (EVA materials to He, N2, O2, and CO2 are correlated with two polymer molecular structure parameters, that is, cohesive energy density (CED and fractional free volume (FFV, determined by the group contribution method. In our preceding paper, the attempt was made to approximate EVA permeability using a linear function of 1/FFV as predicted by the free volume theory. However, the deviations from this relationship appeared to be significant. In this paper, it is shown that permeation of gas molecules is controlled not only by free volume but also by the polymer cohesive energy. Moreover, the behavior of CO2 was found to differ significantly from that of other gases. In this instance, the correlation is much better when diffusivity instead of permeability is taken into account in a modified transport model.

  15. Effective thermal conductivity of metal and non-metal particulate composites with interfacial thermal resistance at high volume fraction of nano to macro-sized spheres

    Energy Technology Data Exchange (ETDEWEB)

    Faroughi, Salah Aldin, E-mail: [School of Civil and Environmental Engineering, Georgia Institute of Technology, Atlanta 30332-0340 (United States); Huber, Christian [School of Earth and Atmospheric Sciences, Georgia Institute of Technology, Atlanta 30332-0340 (United States)


    In this study, we propose a theoretical model to compute the effective thermal conductivity of metal and dielectric spherical particle reinforced composites with interfacial thermal resistance. We consider a wide range of filler volume fraction with sizes ranging from nano- to macro-scale. The model, based on the differential effective medium theory, accounts for particle interactions through two sets of volume fraction corrections. The first correction accounts for a finite volume of composite and the second correction introduces a self-crowding factor that allows us to develop an accurate model for particle interaction even for high volume fraction of fillers. The model is examined to other published models, experiments, and numerical simulations for different types of composites. We observe an excellent agreement between the model and published datasets over a wide range of particle volume fractions and material properties of the composite constituents.

  16. Optimization of the fractionated irradiation scheme considering physical doses to tumor and organ at risk based on dose–volume histograms

    Energy Technology Data Exchange (ETDEWEB)

    Sugano, Yasutaka [Graduate School of Health Sciences, Hokkaido University, Kita-12, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-0812 (Japan); Mizuta, Masahiro [Laboratory of Advanced Data Science, Information Initiative Center, Hokkaido University, Kita-11, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-0811 (Japan); Takao, Seishin; Shirato, Hiroki; Sutherland, Kenneth L. [Department of Radiation Medicine, Graduate School of Medicine, Hokkaido University, Kita-15, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-8638 (Japan); Date, Hiroyuki, E-mail: [Faculty of Health Sciences, Hokkaido University, Kita-12, Nishi-5, Kita-ku, Sapporo, Hokkaido 060-0812 (Japan)


    Purpose: Radiotherapy of solid tumors has been performed with various fractionation regimens such as multi- and hypofractionations. However, the ability to optimize the fractionation regimen considering the physical dose distribution remains insufficient. This study aims to optimize the fractionation regimen, in which the authors propose a graphical method for selecting the optimal number of fractions (n) and dose per fraction (d) based on dose–volume histograms for tumor and normal tissues of organs around the tumor. Methods: Modified linear-quadratic models were employed to estimate the radiation effects on the tumor and an organ at risk (OAR), where the repopulation of the tumor cells and the linearity of the dose-response curve in the high dose range of the surviving fraction were considered. The minimization problem for the damage effect on the OAR was solved under the constraint that the radiation effect on the tumor is fixed by a graphical method. Here, the damage effect on the OAR was estimated based on the dose–volume histogram. Results: It was found that the optimization of fractionation scheme incorporating the dose–volume histogram is possible by employing appropriate cell surviving models. The graphical method considering the repopulation of tumor cells and a rectilinear response in the high dose range enables them to derive the optimal number of fractions and dose per fraction. For example, in the treatment of prostate cancer, the optimal fractionation was suggested to lie in the range of 8–32 fractions with a daily dose of 2.2–6.3 Gy. Conclusions: It is possible to optimize the number of fractions and dose per fraction based on the physical dose distribution (i.e., dose–volume histogram) by the graphical method considering the effects on tumor and OARs around the tumor. This method may stipulate a new guideline to optimize the fractionation regimen for physics-guided fractionation.

  17. Fractional watt Vuillemier cryogenic refrigerator program engineering notebook. Volume 1: Thermal analysis (United States)

    Miller, W. S.


    The cryogenic refrigerator thermal design calculations establish design approach and basic sizing of the machine's elements. After the basic design is defined, effort concentrates on matching the thermodynamic design with that of the heat transfer devices (heat exchangers and regenerators). Typically, the heat transfer device configurations and volumes are adjusted to improve their heat transfer and pressure drop characteristics. These adjustments imply that changes be made to the active displaced volumes, compensating for the influence of the heat transfer devices on the thermodynamic processes of the working fluid. Then, once the active volumes are changed, the heat transfer devices require adjustment to account for the variations in flows, pressure levels, and heat loads. This iterative process is continued until the thermodynamic cycle parameters match the design of the heat transfer devices. By examing several matched designs, a near-optimum refrigerator is selected.

  18. Effects of porosity distribution and porosity volume fraction on the electromechanical properties of 3-3 piezoelectric foams (United States)

    Nguyen, B. V.; Challagulla, K. S.; Venkatesh, T. A.; Hadjiloizi, D. A.; Georgiades, A. V.


    Unit-cell based finite element models are developed to completely characterize the role of porosity distribution and porosity volume fraction in determining the elastic, dielectric and piezoelectric properties as well as relevant figures of merit of 3-3 type piezoelectric foam structures. Eight classes of foam structures which represent structures with different types and degrees of uniformity of porosity distribution are identified; a Base structure (Class I), two H-type foam structures (Classes II, and III), a Cross-type foam structure (Class IV) and four Line-type foam structures (Classes V, VI, VII, and VIII). Three geometric factors that influence the electromechanical properties are identified: (i) the number of pores per face, pore size and the distance between the pores; (ii) pore orientation with respect to poling direction; (iii) the overall symmetry of the pore distribution with respect to the center of the face of the unit cell. To assess the suitability of these structures for such applications as hydrophones, bone implants, medical imaging and diagnostic devices, five figures of merit are determined via the developed finite element model; the piezoelectric coupling constant (K t ), the acoustic impedance (Z), the piezoelectric charge coefficient (d h ), the hydrostatic voltage coefficient (g h ), and the hydrostatic figure of merit (d h g h ). At high material volume fractions, foams with non-uniform Line-type porosity (Classes V and VII) where the pores are preferentially distributed perpendicular to poling direction, are found to exhibit the best combination of desirable piezoelectric figures of merit. For example, at about 50% volume fraction, the d h , g h , and d h g h figures of merit are 55%, 1600% and 2500% higher, respectively, for Classes V and VII of Line-like foam structures compared with the Base structure.

  19. Determination of respirable mass concentration using a high volume air sampler and a sedimentation method for fractionation

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, J.


    A preliminary study of a new method for determining respirable mass concentration is described. This method uses a high volume air sampler and subsequent fractionation of the collected mass using a particle sedimentation technique. Side-by-side comparisons of this method with cyclones were made in the field and in the laboratory. There was good agreement among the samplers in the laboratory, but poor agreement in the field. The effect of wind on the samplers` capture efficiencies is the primary hypothesized source of error among the field results. The field test took place at the construction site of a hazardous waste landfill located on the Hanford Reservation.

  20. Theoretical Model for Volume Fraction of UC, 235U Enrichment, and Effective Density of Final U 10Mo Alloy

    Energy Technology Data Exchange (ETDEWEB)

    Devaraj, Arun [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Prabhakaran, Ramprashad [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Joshi, Vineet V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Hu, Shenyang Y. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); McGarrah, Eric J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL); Lavender, Curt A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States). Environmental Molecular Sciences Lab. (EMSL)


    The purpose of this document is to provide a theoretical framework for (1) estimating uranium carbide (UC) volume fraction in a final alloy of uranium with 10 weight percent molybdenum (U 10Mo) as a function of final alloy carbon concentration, and (2) estimating effective 235U enrichment in the U 10Mo matrix after accounting for loss of 235U in forming UC. This report will also serve as a theoretical baseline for effective density of as-cast low-enriched U 10Mo alloy. Therefore, this report will serve as the baseline for quality control of final alloy carbon content

  1. Effect of heat treatment on the distribution and volume fraction of Mg2Si in structural aluminum alloy 6063 (United States)

    Al-Marahleh, G.


    The structure and properties of an aluminum alloy after extrusion in cast and homogenized states are studied. Commercial billets are melted in a horizontal continuous casting installation. After homogenizing the billets are used for fabricating shapes of specified form in an extrusion press. The shapes are subjected to final aging. The volume fraction and the distribution of the second Mg2Si phase are determined after different kinds of treatment. The structure and mechanical properties of shapes obtained from cast and homogenized billets are compared after aging and without aging. The effect of homogenizing on the properties of the alloy after extrusion is analyzed.

  2. Non-invasive measurement of stroke volume and left ventricular ejection fraction. Radionuclide cardiography compared with left ventricular cardioangiography

    DEFF Research Database (Denmark)

    Kelbaek, H; Svendsen, Jesper Hastrup; Aldershvile, J;


    The stroke volume (SV) was determined by first passage radionuclide cardiography and the left ventricular ejection fraction (LVEF) by multigated radionuclide cardiography in 20 patients with ischemic heart disease. The results were evaluated against those obtained by the invasive dye dilution...... or thermodilution and left ventricular cardioangiographic techniques. In a paired comparison the mean difference between the invasive and radionuclide SV was -1 ml (SED 3.1) with a correlation coefficient of 0.83 (p less than 0.01). Radionuclide LVEF values also correlated well with cardioangiographic measurements...

  3. Prediction of the Soil Water Characteristic from Soil Particle Volume Fractions

    DEFF Research Database (Denmark)

    Naveed, Muhammad; Møldrup, Per; Tuller, Markus


    Modelling water distribution and flow in partially saturated soils requires knowledge of the soil-water characteristic (SWC). However, measurement of the SWC is challenging and time-consuming, and in some cases not feasible. This study introduces two predictive models (Xw-model and Xw......*-model) for the SWC, derived from readily available soil properties such as texture and bulk density. A total of 46 soils from different horizons at 15 locations across Denmark were used for models evaluation. The Xw-model predicts the volumetric water content as a function of volumetric fines content (organic matter...... (organic matter, clay, silt, fine and coarse sand), variably included in the model depending on the pF value. The volumetric content of a particular soil particle size fraction was included in the model if it was assumed to contribute to the pore size fraction still occupied with water at the given p...

  4. A glimpse beneath Antarctic sea ice: observation of platelet-layer thickness and ice-volume fraction with multifrequency EM (United States)

    Hoppmann, Mario; Hunkeler, Priska A.; Hendricks, Stefan; Kalscheuer, Thomas; Gerdes, Rüdiger


    In Antarctica, ice crystals (platelets) form and grow in supercooled waters below ice shelves. These platelets rise, accumulate beneath nearby sea ice, and subsequently form a several meter thick, porous sub-ice platelet layer. This special ice type is a unique habitat, influences sea-ice mass and energy balance, and its volume can be interpreted as an indicator of the health of an ice shelf. Although progress has been made in determining and understanding its spatio-temporal variability based on point measurements, an investigation of this phenomenon on a larger scale remains a challenge due to logistical constraints and a lack of suitable methodology. In the present study, we applied a lateral constrained Marquardt-Levenberg inversion to a unique multi-frequency electromagnetic (EM) induction sounding dataset obtained on the ice-shelf influenced fast-ice regime of Atka Bay, eastern Weddell Sea. We adapted the inversion algorithm to incorporate a sensor specific signal bias, and confirmed the reliability of the algorithm by performing a sensitivity study using synthetic data. We inverted the field data for sea-ice and platelet-layer thickness and electrical conductivity, and calculated ice-volume fractions within the platelet layer using Archie's Law. The thickness results agreed well with drillhole validation datasets within the uncertainty range, and the ice-volume fraction yielded results comparable to other studies. Both parameters together enable an estimation of the total ice volume within the platelet layer, which was found to be comparable to the volume of landfast sea ice in this region, and corresponded to more than a quarter of the annual basal melt volume of the nearby Ekström Ice Shelf. Our findings show that multi-frequency EM induction sounding is a suitable approach to efficiently map sea-ice and platelet-layer properties, with important implications for research into ocean/ice-shelf/sea-ice interactions. However, a successful application of this

  5. Comparative study of bulk metallic glass composites with high-volume-fractioned dendritic and spherical b. c. c. phase precipitates

    Directory of Open Access Journals (Sweden)

    Guo-yuan Sun


    Full Text Available A dendritic β-phase reinforced bulk metallic glass (BMG composite named as D2 was prepared by rapid quenching of a homogenous Zr60Ti14.67Nb5.33Cu5.56Ni4.44Be10 melt, and characterized by means of X-ray diffraction (XRD, scanning electron microscopy (SEM observation and room-temperature compression test. The microstructure and mechanical properties were compared with those of the spherical β-phase reinforced composite named as composite S2. It was found that the composite D2 contains β-phase dendrites up to 56% in volume-fraction, and exhibits a ductile compressive behavior with plastic strain of 12.7%. As the high-volume-fractioned β-phase dendrites transferred to coarse spherical particles of about 20 μm in diameter in the composite S2, a much improved plastic strain up to 20.4% can be achieved. Micrographs of the fractured samples reveal different interaction modes of the propagating shear bands with the dendritic and spherical β phase inclusions, resulting in different shear strains in the composite samples. The matrix of composite S2 undergoes a significantly larger shear strain than that of the composite D2 before ultimate failure, which is thought to be mainly responsible for the greatly increased global plastic strain of the S2 relative to D2.

  6. Rheological Properties of Nanoparticle Silica-Surfactant Stabilized Crude Oil Emulsions: Influence of Temperature, Nanoparticle Concentration and Water Volume Fraction" (United States)

    Kinsey, Erin; Pales, Ashley; Li, Chunyan; Mu, Linlin; Bai, Lingyun; Clifford, Heather; Darnault, Christophe


    Oil in water emulsions occur during oil extraction due to the presence of water, naturally-occurring surface-active agents and mechanical mixing in pipelines or from oil spillage. Emulsions present difficulties for use of oil in fuel and their rheological properties are important to treat environmental impacts of spills. The objective of this study is to assess the rheological characteristics of oil in water emulsions stabilized by 5% NaCl brine, Tween 20 surfactant and silica nanoparticles to gain knowledge about the behavior of oil flow in pipelines and characterize them for environmental applications. Rheological behaviors such as shear rate, shear stress, and viscosity of Prudhoe Bay crude oil emulsions were analyzed with varying percent of water volume fractions (12.5, 25 and 50%), varying weight percent of silica nanoparticles (0.001, 0.01 and 0.1 weight %), with and without 2 CMC Tween 20 nonionic surfactant. Emulsions with varying water volume fractions were analyzed at 20, 40 and 60 degrees Celsius. Flow curve analysis of the emulsions was performed using an Anton-Paar rheometer. Preliminary findings indicate that increased temperature and increasing the concentration of nanoparticles both produced lower shear stress and that the addition of surfactant decreased the viscosity and shear stress of the emulsions.

  7. Agreement of left ventricular ejection fraction and volumes between adenosine stress TL-201 gated SPECT and echocardiography

    Energy Technology Data Exchange (ETDEWEB)

    Pai, M. S. [College of Medicine, Univ. of Ewha, Seoul (Korea, Republic of); Moon, D. H.; Kim, H. M.; Yang, Y. J.; Kang, D. H. [Asan Medical Center, Seoul (Korea, Republic of)


    Electrocardiogram-gated TI-201 SPECT measurements of left ventricular ejection fraction (EF), end-diastolic volume (EDV), and end-systolic volume (ESV) have shown high correlation with conventional methods. However, how much these parameters measured by TI-201 gated SPECT differ from those by echocardiography has not been assessed. Adenosine stress (Ad-G) and redistribution TI-201 gated SPECT (Re-G) and resting echocardiography were conducted in 337 patients (184 male, 153 female). EDV, ESV and LVEF measured by QGS software were compared with the results by echocardiography. Patients with arrhythmia (atrial fibrillation or frequent premature contractions) or evidence of fixed or reversible perfusion defects on TI-201 SPECT were excluded. EF, EDV and ESV measured by Ad-G (63.3{+-}9.8,73.8{+-}30.2,29.1{+-}20.1) and Re-G (65.2{+-}11.6,69.1{+-}30.1,26.5{+-}20.3) correlated well with those by Echo (61.4{+-}7.9,78.3{+-}2.7, 30.7{+-} 17.5 ; r of Ad-G=0.547, 0.850, 0.827, p<0.001 ; r of Re-G=0.585, 0.838, 0.819, p<0.001). However the difference (mean, SD, SEE of Echo - gated SPECT) was statistically significant (EF: Ad-G=1.71, 8.92, 0.48, Re-G=3.59, 10.39, 0.56, p<0.001 ; EDV: Ad-G=4.75, 16.21, 0.88, Re-G=9.53, 16.77, 0.91, p<0.001 ; ESV: Ad-G=1.75, 11.35, 0.61, p<0.05, Re-G=4.29, 11.7, 0.63, p<0.001). Bland-Altman plots showed that the difference of EDV and ESV did not vary in any systematic way over the range of measurement, whereas the difference of EF increased with increasing average EF by Echo and gated-SPECT. The difference of EF, EDV, and ESV between Ad-G and Echo was significantly smaller than those between Re-G and Echo (p<0.001). Gated TI-201 SPECT underestimates EDV and ESV over a wide range of volume. As a result, EF by gated TI-201 SPECT is overestimated especially in patients with small LV volume. Ad-G is preferable to Re-G in assessing left ventricular ejection fraction and volume in place of Echo because of smaller bias.

  8. Quantitative sodium MRI of the human brain at 9.4 T provides assessment of tissue sodium concentration and cell volume fraction during normal aging. (United States)

    Thulborn, Keith; Lui, Elaine; Guntin, Jonathan; Jamil, Saad; Sun, Ziqi; Claiborne, Theodore C; Atkinson, Ian C


    Sodium ion homeostasis is a fundamental property of viable tissue, allowing the tissue sodium concentration to be modeled as the tissue cell volume fraction. The modern neuropathology literature using ex vivo tissue from selected brain regions indicates that human brain cell density remains constant during normal aging and attributes the volume loss that occurs with advancing age to changes in neuronal size and dendritic arborization. Quantitative sodium MRI performed with the enhanced sensitivity of ultrahigh-field 9.4 T has been used to investigate tissue cell volume fraction during normal aging. This cross-sectional study (n = 49; 21-80 years) finds that the in vivo tissue cell volume fraction remains constant in all regions of the brain with advancing age in individuals who remain cognitively normal, extending the ex vivo literature reporting constant neuronal cell density across the normal adult age range. Cell volume fraction, as measured by quantitative sodium MRI, is decreased in diseases of cell loss, such as stroke, on a time scale of minutes to hours, and in response to treatment of brain tumors on a time scale of days to weeks. Neurodegenerative diseases often have prodromal periods of decades in which regional neuronal cell loss occurs prior to clinical presentation. If tissue cell volume fraction can detect such early pathology, this quantitative parameter may permit the objective measurement of preclinical disease progression. This current study in cognitively normal aging individuals provides the basis for the pursuance of investigations directed towards such neurodegenerative diseases.

  9. 2D and 3D milled surface roughness of high volume fraction SiCp/Al composites

    Directory of Open Access Journals (Sweden)

    Tao Wang


    Full Text Available This paper presents a study on surface roughness generated by high speed milling of high volume fraction (65% silicon carbide particle-reinforced aluminum matrix (SiCp/Al composites. Typical 2D (Ra and Rz and 3D (Sa and Sq surface roughness parameters were selected to evaluate the influence of the milling parameters on the surface quality in comparison with aluminum alloy. The 3D topography of the milled surface was studied as well. The results indicate that 3D parameters (Sa and Sq are more capable to describe the influence of the milling parameters on the surface quality, and among them Sq is preferable due to its good sensitivity. Sq decreases with milling speed and increases with feed rate. The influence of axial depth of cut (ADOC is negligible.

  10. The effect of strain path change on subgrain volume fraction determined from in situ X-ray measurements

    DEFF Research Database (Denmark)

    Wejdemann, Christian; Poulsen, Henning Friis; Lienert, U.


    The evolution of dislocation structures in individual bulk grains in copper during strain path changes is studied with a new in situ synchrotron technique which combines high angular resolution with fast three-dimensional reciprocal space mapping. Deformed copper contains regions with vanishing...... dislocation density called subgrains bounded by dislocation rich walls. With the new technique reciprocal space maps, consisting of sharp peaks arising from the subgrains superimposed on a cloud of lower intensity arising from the dislocation walls, are obtained, which allows properties such as subgrain...... volume fraction to be quantified. The studied strain path changes are tension-tension sequences. Polycrystalline copper sheets are pre-deformed in tension to 5% strain, and tensile samples are cut with varying angles between the first and second loading axis. The second tensile deformation up...

  11. Measurements of γ/γ' Lattice Misfit and γ' Volume Fraction for a Ru-containing Nickel-based Single Crystal Superalloy

    Institute of Scientific and Technical Information of China (English)

    X.P. Tan; J.L. Liu; X P Song; T. Jin; X.F. Sun; Z.Q. Hu


    A conventional X-ray difFractometer has been used to determine the -y/y' lattice misfit and γ' volume fraction for a Ru-containing nickel-based single crystal superalloy at room temperature. The rocking curve was used to characterize the distribution of subgrains. The diffraction peaks obtained by w-20 scan were used to determine the γ/γ' lattice misfit and γ' volume fraction. A three peaks fitting model was proposed. The peak fitting results are in good agreement with the model. The X-ray diffraction results indicate that the nickel-based single crystal superalloy was not a perfect monocrystalline material, which is comprised of many subgrains; and each subgrain also consists of large numbers of mosaic structures. In addition, two anomalous reflection phenomena were found during the experiment and discussed with respect to their occurrence and impact on the measurement. The experimental results show that the γ/γ' lattice misfit and ~/r volume fraction will be various at the different regions of its dendritic microstructure. The average γ/γ' lattice misfit and γ' volume fraction of the experimental alloy are approximately-0.2% and 70%, respectively. Furthermore, the γ' volume fraction calculated by atom microprobe (AP) data is also basically consistent with the experimental results.

  12. Effect of oral alcohol on left ventricular ejection fraction, volumes, and segmental wall motion in normals and in patients with recent myocardial infarction. (United States)

    Gould, L; Gopalaswamy, C; Yang, D; Patel, D; Kim, B S; Patel, C; Becker, W H


    A first-pass nuclear angiogram and a multiple-gated acquisition study were obtained in 10 normal physicians and in 10 patients with a 7-to-10 day old transmural myocardial infarction. After the scan the subjects drank 2 oz. of whiskey. After 60 minutes, the multiple-gated acquisition study was repeated. In the normal group the left ventricular ejection fraction was 68% before and 72% after alcohol. The left ventricular end-diastolic volume increased from 89 to 97 ml while the left ventricular end-systolic volume decreased from 29 to 27 ml. The stroke volume rose from 61 to 70 ml/beat (p less than 0.05). The cardiac output increased from 4.0 to 5.0 l/min (p less than 0.05). In the infarction group, the left ventricular ejection fraction was 58% before and 56% after alcohol administration. The left ventricular end-diastolic volume fell from 111 to 96 ml, while the left ventricular end-systolic volume declined from 50 to 44 ml. The stroke volume fell from 61 to 52 ml/beat, while the cardiac output fell from 4.5 to 3.8 l/min. In the left ventricular infarction zones, alcohol produced in 9 of the 10 cardiac patients a decline in the left ventricular regional ejection fraction. In the normal group, alcohol produced no significant changes in the regional ejection fraction. The normal and the postinfarction patients responded differently to alcohol.

  13. A fractional transient model for the viscoplastic response of polymers based on a micro-mechanism of free volume distribution (United States)

    Spathis, G.; Kontou, E.


    In the present work, the nonlinear viscoelastic/viscoplastic response of polymeric materials is described by introducing essential modifications on a model developed in previous works. A constitutive equation of viscoelasticity, based on the transient network theory, is introduced in a more generalized form, which takes into account volume changes during deformation. This time-dependent equation accounts for the nonlinearity and viscoplasticity at small elastic and finite plastic strain regime. The present description was proved to be more flexible, given that it contains a relaxation function that has been derived by considering instead of first order kinetics a fractional derivative that controls the rate of molecular chain detachment from their junctions. Therefore, the new equation has a more global character, appropriate for cases where heavy tails are expected. On the basis of the distributed nature of free volume, a new functional form of the rate of plastic deformation is developed, which is combined with a proper kinematic formulation and leads to the separation of the total strain into the elastic and plastic part. A three-dimensional constitutive equation is then derived for an isotropic, compressible medium. This analysis was proved to be capable of capturing the main aspects of inelastic response as well as the instability stage taking place at the tertiary creep, related to the creep failure.

  14. Dynamic contrast-enhanced MRI assessment of hyperemic fractional microvascular blood plasma volume in peripheral arterial disease: initial findings.

    Directory of Open Access Journals (Sweden)

    Bas Versluis

    Full Text Available OBJECTIVES: The aim of the current study was to describe a method that assesses the hyperemic microvascular blood plasma volume of the calf musculature. The reversibly albumin binding contrast agent gadofosveset was used in dynamic contrast-enhanced magnetic resonance imaging (DCE MRI to assess the microvascular status in patients with peripheral arterial disease (PAD and healthy controls. In addition, the reproducibility of this method in healthy controls was determined. MATERIALS AND METHODS: Ten PAD patients with intermittent claudication and 10 healthy control subjects were included. Patients underwent contrast-enhanced MR angiography of the peripheral arteries, followed by one DCE MRI examination of the musculature of the calf. Healthy control subjects were examined twice on different days to determine normative values and the interreader and interscan reproducibility of the technique. The MRI protocol comprised dynamic imaging of contrast agent wash-in under reactive hyperemia conditions of the calf musculature. Using pharmacokinetic modeling the hyperemic fractional microvascular blood plasma volume (V(p, unit: % of the anterior tibial, gastrocnemius and soleus muscles was calculated. RESULTS: V(p was significantly lower for all muscle groups in PAD patients (4.3±1.6%, 5.0±3.3% and 6.1±3.6% for anterior tibial, gastrocnemius and soleus muscles, respectively compared to healthy control subjects (9.1±2.0%, 8.9±1.9% and 9.3±2.1%. Differences in V(p between muscle groups were not significant. The coefficient of variation of V(p varied from 10-14% and 11-16% at interscan and interreader level, respectively. CONCLUSIONS: Using DCE MRI after contrast-enhanced MR angiography with gadofosveset enables reproducible assessment of hyperemic fractional microvascular blood plasma volume of the calf musculature. V(p was lower in PAD patients than in healthy controls, which reflects a promising functional (hemodynamic biomarker for the

  15. Validation of Interstitial Fractional Volume Quantification by Using Dynamic Contrast-Enhanced Magnetic Resonance Imaging in Porcine Skeletal Muscles. (United States)

    Hindel, Stefan; Söhner, Anika; Maa, Marc; Sauerwein, Wolfgang; Baba, Hideo Andreas; Kramer, Martin; Lüdemann, Lutz


    The aim of our study was to assess the accuracy of fractional interstitial volume determination in low perfused and low vascularized tissue by using dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). The fractional interstitial volume (ve) was determined in the medial thigh muscle of 12 female pigs by using a 3-dimensional gradient echo sequence with k-space sharing and administering gadolinium-based contrast agent (gadoterate meglumine). Analysis was performed using 3 pharmacokinetic models: the simple Tofts model (TM), the extended TM (ETM), and the 2-compartment exchange model (2CXM). We investigated the effect of varying acquisition durations (ADs) on the model parameter estimates of the 3 models and compared the ve values with the results of histological examinations of muscle sections of the medial thigh muscle. Histological measurements yielded a median value (25%-75% quartile) of 4.8% (3.7%-6.2%) for ve. The interstitial fractional volume determined by DCE-MRI was comparable to the histological results but varied strongly with AD for the TM and ETM. For the TM and the ETM, the results were virtually the same. Choosing arterial hematocrit to Hcta = 0.4, the lowest median ve value determined by DCE-MRI was 5.2% (3.3%-6.1%) for the ETM at a 6-minute AD. The maximum ve value determined with the ETM at a 15-minute AD was 7.7% (4.5%-9.0%). The variation with AD of median ve values obtained with the 2CXM was much smaller: 6.2% (3.1%-9.2%) for the 6-minute AD and 6.3% (4.3%-9.8%) for the 15-minute AD. The best fit for the 2CXM was found at the 10-minute AD with ve values of 6.6% (3.7%-8.2%). No significant correlation between the histological and any DCE-MRI modeling results was found. Considering the expected accuracy of histological measurements, the medians of the MR modeling results were in good agreement with the histological prediction. A parameter determination uncertainty was identified with the use of the TMs. This is due to underfitting and

  16. Research Update for: A Method for Out-of-autoclave Fabrication of High Fiber Volume Fraction Fiber Reinforced Polymer Composites (ARL-TR-6057) (United States)


    increasing the fiber-volume fraction by Vacuum Assisted Resin Transfer Molding ( VARTM ) in order to produce composite structures with aerospace grade...processed composites. Using a combination of viscosity control, U.S. Army Research Laboratory (ARL) based VARTM techniques, and a pressure control...system, we have shown an increase in fiber-volume content from 50% (ARL’s normal processing range for a particular material system and VARTM process) to

  17. Dose fractionated gamma knife radiosurgery for large arteriovenous malformations on daily or alternate day schedule outside the linear quadratic model: Proof of concept and early results. A substitute to volume fractionation. (United States)

    Mukherjee, Kanchan Kumar; Kumar, Narendra; Tripathi, Manjul; Oinam, Arun S; Ahuja, Chirag K; Dhandapani, Sivashanmugam; Kapoor, Rakesh; Ghoshal, Sushmita; Kaur, Rupinder; Bhatt, Sandeep


    To evaluate the feasibility, safety and efficacy of dose fractionated gamma knife radiosurgery (DFGKRS) on a daily schedule beyond the linear quadratic (LQ) model, for large volume arteriovenous malformations (AVMs). Between 2012-16, 14 patients of large AVMs (median volume 26.5 cc) unsuitable for surgery or embolization were treated in 2-3 of DFGKRS sessions. The Leksell G frame was kept in situ during the whole procedure. 86% (n = 12) patients had radiologic evidence of bleed, and 43% (n = 6) had presented with a history of seizures. 57% (n = 8) patients received a daily treatment for 3 days and 43% (n = 6) were on an alternate day (2 fractions) regimen. The marginal dose was split into 2 or 3 fractions of the ideal prescription dose of a single fraction of 23-25 Gy. The median follow up period was 35.6 months (8-57 months). In the three-fraction scheme, the marginal dose ranged from 8.9-11.5 Gy, while in the two-fraction scheme, the marginal dose ranged from 11.3-15 Gy at 50% per fraction. Headache (43%, n = 6) was the most common early postoperative complication, which was controlled with short course steroids. Follow up evaluation of at least three years was achieved in seven patients, who have shown complete nidus obliteration in 43% patients while the obliteration has been in the range of 50-99% in rest of the patients. Overall, there was a 67.8% reduction in the AVM volume at 3 years. Nidus obliteration at 3 years showed a significant rank order correlation with the cumulative prescription dose (p 0.95, P value 0.01), with attainment of near-total (more than 95%) obliteration rates beyond 29 Gy of the cumulative prescription dose. No patient receiving a cumulative prescription dose of less than 31 Gy had any severe adverse reaction. In co-variate adjusted ordinal regression, only the cumulative prescription dose had a significant correlation with common terminology criteria for adverse events (CTCAE) severity (P value 0.04), independent of age, AVM volume

  18. Imaging water velocity and volume fraction distributions in water continuous multiphase flows using inductive flow tomography and electrical resistance tomography (United States)

    Meng, Yiqing; Lucas, Gary P.


    This paper presents the design and implementation of an inductive flow tomography (IFT) system, employing a multi-electrode electromagnetic flow meter (EMFM) and novel reconstruction techniques, for measuring the local water velocity distribution in water continuous single and multiphase flows. A series of experiments were carried out in vertical-upward and upward-inclined single phase water flows and ‘water continuous’ gas-water and oil-gas-water flows in which the velocity profiles ranged from axisymmetric (single phase and vertical-upward multiphase flows) to highly asymmetric (upward-inclined multiphase flows). Using potential difference measurements obtained from the electrode array of the EMFM, local axial velocity distributions of the continuous water phase were reconstructed using two different IFT reconstruction algorithms denoted RT#1, which assumes that the overall water velocity profile comprises the sum of a series of polynomial velocity components, and RT#2, which is similar to RT#1 but which assumes that the zero’th order velocity component may be replaced by an axisymmetric ‘power law’ velocity distribution. During each experiment, measurement of the local water volume fraction distribution was also made using the well-established technique of electrical resistance tomography (ERT). By integrating the product of the local axial water velocity and the local water volume fraction in the cross section an estimate of the water volumetric flow rate was made which was compared with a reference measurement of the water volumetric flow rate. In vertical upward flows RT#2 was found to give rise to water velocity profiles which are consistent with the previous literature although the profiles obtained in the multiphase flows had relatively higher central velocity peaks than was observed for the single phase profiles. This observation was almost certainly a result of the transfer of axial momentum from the less dense dispersed phases to the water

  19. Effect of particle volume fraction on the settling velocity of volcanic ash particles: insights from joint experimental and numerical simulations (United States)

    Del Bello, Elisabetta; Taddeucci, Jacopo; de’ Michieli Vitturi, Mattia; Scarlato, Piergiorgio; Andronico, Daniele; Scollo, Simona; Kueppers, Ulrich; Ricci, Tullio


    Most of the current ash transport and dispersion models neglect particle-fluid (two-way) and particle-fluid plus particle-particle (four-way) reciprocal interactions during particle fallout from volcanic plumes. These interactions, a function of particle concentration in the plume, could play an important role, explaining, for example, discrepancies between observed and modelled ash deposits. Aiming at a more accurate prediction of volcanic ash dispersal and sedimentation, the settling of ash particles at particle volume fractions (ϕp) ranging 10‑7-10‑3 was performed in laboratory experiments and reproduced by numerical simulations that take into account first the two-way and then the four-way coupling. Results show that the velocity of particles settling together can exceed the velocity of particles settling individually by up to 4 times for ϕp ~ 10‑3. Comparisons between experimental and simulation results reveal that, during the sedimentation process, the settling velocity is largely enhanced by particle-fluid interactions but partly hindered by particle-particle interactions with increasing ϕp. Combining the experimental and numerical results, we provide an empirical model allowing correction of the settling velocity of particles of any size, density, and shape, as a function of ϕp. These corrections will impact volcanic plume modelling results as well as remote sensing retrieval techniques for plume parameters.

  20. Effect of particle volume fraction on the settling velocity of volcanic ash particles: insights from joint experimental and numerical simulations (United States)

    Del Bello, Elisabetta; Taddeucci, Jacopo; de’ Michieli Vitturi, Mattia; Scarlato, Piergiorgio; Andronico, Daniele; Scollo, Simona; Kueppers, Ulrich; Ricci, Tullio


    Most of the current ash transport and dispersion models neglect particle-fluid (two-way) and particle-fluid plus particle-particle (four-way) reciprocal interactions during particle fallout from volcanic plumes. These interactions, a function of particle concentration in the plume, could play an important role, explaining, for example, discrepancies between observed and modelled ash deposits. Aiming at a more accurate prediction of volcanic ash dispersal and sedimentation, the settling of ash particles at particle volume fractions (ϕp) ranging 10−7-10−3 was performed in laboratory experiments and reproduced by numerical simulations that take into account first the two-way and then the four-way coupling. Results show that the velocity of particles settling together can exceed the velocity of particles settling individually by up to 4 times for ϕp ~ 10−3. Comparisons between experimental and simulation results reveal that, during the sedimentation process, the settling velocity is largely enhanced by particle-fluid interactions but partly hindered by particle-particle interactions with increasing ϕp. Combining the experimental and numerical results, we provide an empirical model allowing correction of the settling velocity of particles of any size, density, and shape, as a function of ϕp. These corrections will impact volcanic plume modelling results as well as remote sensing retrieval techniques for plume parameters. PMID:28045056

  1. DNS of horizontal open channel flow with finite-size, heavy particles at low solid volume fraction

    CERN Document Server

    Kidanemariam, Aman G; Doychev, Todor; Uhlmann, Markus


    We have performed direct numerical simulation of turbulent open channel flow over a smooth horizontal wall in the presence of finite-size, heavy particles. The spherical particles have a diameter of approximately 7 wall units, a density of 1.7 times the fluid density and a solid volume fraction of 0.0005. The value of the Galileo number is set to 16.5, while the Shields parameter measures approximately 0.2. Under these conditions, the particles are predominantly located in the vicinity of the bottom wall, where they exhibit strong preferential concentration which we quantify by means of Voronoi analysis and by computing the particle-conditioned concentration field. As observed in previous studies with similar parameter values, the mean streamwise particle velocity is smaller than that of the fluid. We propose a new definition of the fluid velocity "seen" by finite-size particles based on an average over a spherical surface segment, from which we deduce in the present case that the particles are instantaneousl...

  2. The flow past a circular patch of vegetation with a low submergence depth and low solid volume fractions (United States)

    Kirkil, Gokhan


    The effect of the Solid Volume Fraction (SVF) on the flow structure within and past a circular array of surface-mounted cylinders that extends over 75% of the water depth, h is investigated using Detached Eddy Simulation (DES). This set up mimics the case of a submerged patch of rigid vegetation in a channel. The diameter of the cylinders in the array is d = 0.02D, where D is the diameter of the circular array. The channel Reynolds number is close to 20,000 and the Reynolds number defined with D is around 24,000. DES is conducted for SVF = 10% and 25%. It is found that as the SVF increases, fairly strong horseshoe vortex system forms around the upstream face of the vegetation patch, the strength of the separated shear layers on the sides of the vegetation patch increases and the length of the recirculation region behind the patch decreases. While an increase of the SVF results in a large increase of the turbulent kinetic energy in the wake, the opposite is observed within the porous vegetation patch.

  3. A mathematical model for the effects of volume fraction and fiber aspect ratio of biomass mixture during enzymatic hydrolysis (United States)

    Jamil, Norazaliza Mohd; Wang, Qi


    Renewable energy or biofuel from lignocellulosic biomass is an alternative way to replace the depleting fossil fuels. The production cost can be reduced by increasing the concentration of biomass particles. However, lignocellulosic biomass is a suspension of natural fibres, and processing at high solid concentration is a challenging task. Thus, understanding the factors that affect the rheology of biomass suspension is crucial in order to maximize the production at a minimum cost. Our aim was to develop a mathematical model for enzymatic hydrolysis of cellulose by combining three scales: the macroscopic flow field, the mesoscopic particle orientation, and the microscopic reactive kinetics. The governing equations for the flow field, particle stress, kinetic equations, and particle orientation were coupled and were simultaneously solved using a finite element method based software, COMSOL. One of the main results was the changes in rheology of biomass suspension were not only due to the decrease in volume fraction of particles, but also due the types of fibres. The results from the simulation model agreed qualitatively with the experimental findings. This approach has enables us to obtain better predictive capabilities, hence increasing our understanding on the behaviour of biomass suspension.


    Directory of Open Access Journals (Sweden)

    Willy Schuwarten Júnior


    Full Text Available A thermomechanical and a microstructure caracterization and a mathematical model of the evolution of the recrystallized volume fraction of ferrite in hot rolling in a Steckel mill have been carried out here. The proposed model is able to reasonably predict the observed in hot rolling, that is, there is 100% recrystallization of ferrite after roughing and partial recrystallization only after finishing

  5. Pre-chemotherapy values for left and right ventricular volumes and ejection fraction by gated tomographic radionuclide angiography using a cadmium-zinc-telluride detector gamma camera

    DEFF Research Database (Denmark)

    Haarmark, Christian; Haase, Christine; Jensen, Maria Maj


    BACKGROUND: Estimation of left ventricular ejection fraction (LVEF) using equilibrium radionuclide angiography is an established method for assessment of left ventricular function. The purpose of this study was to establish normative data on left and right ventricular volumes and ejection fractio...

  6. A Computer Simulation of the Effect of the Inert Gas Volume Fraction in Low-Caloric Biogas on the Performance of an Engine

    Directory of Open Access Journals (Sweden)

    Choong Hoon Lee


    Full Text Available A computer simulation of a gas engine was performed to investigate the effects of the inert gas volume fraction in biogas on engine performance, specifically the engine torque and the brakespecific fuel consumption (BSFC using GT-Power®. The engine speeds used in the simulation were 900 and 1800 rpm, while the simulated engine loads were 25, 50, 75 and 100%. The volume fraction of the inert gas N2 in the biogas was varied from 20 to 80% with an interval of 10%. In a simulation of a naturally aspirated gas engine which is operated with an 80% volume fraction of N2 in biogas, the optimal air-fuel ratio in terms of the fuel economy and brake power generation was 3.5. In a simulation of a turbo intercooler gas engine operated with an 80% volume fraction of N2 in biogas, the optimal air-fuel ratios with regard to the fuel economy and brake power generation were 5.0 and 3.5, respectively.

  7. Impact of ribs on flow parameters and laminar heat transfer of water–aluminum oxide nanofluid with different nanoparticle volume fractions in a three-dimensional rectangular microchannel

    Directory of Open Access Journals (Sweden)

    Omid Ali Akbari


    Full Text Available This article aims to study the impact of ribs on flow parameters and laminar heat transfer of water–aluminum oxide nanofluid with different nanoparticle volume fractions in a three-dimensional rectangular microchannel. To this aim, compulsory convection heat transfer of water–aluminum oxide nanofluid in a rib-roughened microchannel has been numerically studied. The results of this simulation for rib-roughened three-dimensional microchannel have been evaluated in contrast to the smooth (unribbed three-dimensional microchannel with identical geometrical and heat–fluid boundary conditions. Numerical simulation is performed for different nanoparticle volume fractions for Reynolds numbers of 10 and 100. Cold fluid entering the microchannel is heated in order to apply constant flux to external surface of the microchannel walls and then leaves it. Given the results, the fluid has a higher heat transfer with a hot wall in surfaces with ribs rather than in smooth ones. As Reynolds number, number of ribs, and nanoparticle volume fractions increase, more temperature increase happens in fluid in exit intersection of the microchannel. By investigating Nusselt number and friction factor, it is observed that increase in nanoparticle volume fractions causes nanofluid heat transfer properties to have a higher heat transfer and friction factor compared to the base fluid used in cooling due to an increase in viscosity.

  8. Determination of the Surface and Volume Porosity, on the Basis of the Main Fraction of the Polifractional Matrix of Moulding and Core Sands

    Directory of Open Access Journals (Sweden)

    Dańko R.


    Full Text Available The aim of the hereby paper is to present the developed model of determining the volume and surface porosity based on the main fraction of polifractional materials, its experimental verification and utilisation for the interpretation of effects accompanying the formation of a moulding sand apparent density, porosity and permeability in the blowing processes of the core and moulds technology.

  9. Measurement of oil volume fraction and velocity distributions in vertical oil-in-water flows using ERT and a local probe

    Institute of Scientific and Technical Information of China (English)

    LI Hua; WANG Mi; WU Ying-xiang; MA Yi-xin; WILLIAMS Richard


    This paper presents the use of a high performance dual-plane electrical resistance tomography (ERT) system and a local dual-sensor conductance probe to measure the vertical upward oil-in-water pipe flows in which the mean oil volume fraction is up to 23.1%.A sensitivity coefficient back-projection (SBP) algorithm was adopted to reconstruct the flow distributions and a cross correlation method was applied to obtain the oil velocity distributions. The oil volume fraction and velocity distributions obtained from both measurement techniques were compared and good agreement was found, which indicates that the ERT technique can be used to measure the low fraction oil-water flows. Finally, the factors affecting measurement precision were discussed.

  10. Advanced fractional crystallisation and homogenization of large-volume rhyolite before the Oraefajokull 1362 AD plinian eruption, SE Iceland (United States)

    Selbekk, R. S.; Tronnes, R. G.


    In the 50 km wide Icelandic rift zones rhyolite magma is generated by partial melting of hydrated metabasaltic crust, subsiding under the weight of the growing volcanic pile. This mechanism of silicic melt formation is indicated by the basalt-rhyolite bimodality and rhyolite O-isotope composition. The low 18/16O-isotope ratios of rift zone rhyolites trace the high-latitude meteoric water component of the subsiding hydrated basalts [1]. The rhyolites of the volcanic flank zones (VFZ), however, have generally as heavy oxygen as the associated alkaline to transitional basalts and intermediate volcanics [2,3]. The minor volcanic loading of the older, thicker and stronger VFZ crust is insufficient for significant subsidence, and less pronounced basalt-rhyolite bimodality combined with other geochemical features support silicic melt generation by fractional crystallization. An extreme case in Icelandic, as well as global, perspective is the rhyolite magma of the plinian eruption from the large VFZ-volcano, Oraefajokull, in 1362 AD [4]. Glass, mineral and bulk tephra analyses show no chemical variation exceeding the analytical precision for the entire erupted volume of 2 km3 DRE. This applies even to the glass shards from distant locations in Greenland, Norway and Ireland. The total phenocryst content is 0.5-1 wt percent, with oligoclase (An14 Ab81 Or5.5), fayalite (Fa99.7 Fo0.3) and hedenbergite (Wo44.7 En2.6 Fs52.7) constituting 50- 80, 10-25 and 10-25 percent of the total phenocrysts, respectively. The extreme mineral compositions (especially pure fayalite and hedenbergite) resemble those of the granophyres in the Skaergaard and Bushveld complexes and differ from all other investigated rhyolites. The advanced fractionation and homogenisation to form the erupted 2 km3 DRE rhyolite is petrogenetically challenging, and a parental magma chamber of 20-40 km3 seems like a conservative estimate. The time-scale of the historic magma chamber evolution under Oraefajokull is

  11. Bone volume fraction and fabric anisotropy are better determinants of trabecular bone stiffness than other morphological variables. (United States)

    Maquer, Ghislain; Musy, Sarah N; Wandel, Jasmin; Gross, Thomas; Zysset, Philippe K


    As our population ages, more individuals suffer from osteoporosis. This disease leads to impaired trabecular architecture and increased fracture risk. It is essential to understand how morphological and mechanical properties of the cancellous bone are related. Morphology-elasticity relationships based on bone volume fraction (BV/TV) and fabric anisotropy explain up to 98% of the variation in elastic properties. Yet, other morphological variables such as individual trabeculae segmentation (ITS) and trabecular bone score (TBS) could improve the stiffness predictions. A total of 743 micro-computed tomography (μCT) reconstructions of cubic trabecular bone samples extracted from femur, radius, vertebrae, and iliac crest were analyzed. Their morphology was assessed via 25 variables and their stiffness tensor (CFE) was computed from six independent load cases using micro finite element (μFE) analyses. Variance inflation factors were calculated to evaluate collinearity between morphological variables and decide upon their inclusion in morphology-elasticity relationships. The statistically admissible morphological variables were included in a multiple linear regression model of the dependent variable CFE. The contribution of each independent variable was evaluated (ANOVA). Our results show that BV/TV is the best determinant of CFE(r(2) adj  = 0.889), especially in combination with fabric anisotropy (r(2) adj  = 0.968). Including the other independent predictors hardly affected the amount of variance explained by the model (r(2) adj  = 0.975). Across all anatomical sites, BV/TV explained 87% of the variance of the bone elastic properties. Fabric anisotropy further described 10% of the bone stiffness, but the improvement in variance explanation by adding other independent factors was marginal (variables do not bring any further contribution. These overall conclusions remain to be confirmed for specific bone diseases and postelastic properties.

  12. Bone volume fraction explains the variation in strength and stiffness of cancellous bone affected by metastatic cancer and osteoporosis. (United States)

    Nazarian, Ara; von Stechow, Dietrich; Zurakowski, David; Müller, Ralph; Snyder, Brian D


    Preventing nontraumatic fractures in millions of patients with osteoporosis or metastatic cancer may significantly reduce the associated morbidity and reduce health-care expenditures incurred by these fractures. Predicting fracture occurrence requires an accurate understanding of the relationship between bone structure and the mechanical properties governing bone fracture that can be readily measured. The aim of this study was to test the hypothesis that a single analytic relationship with either bone tissue mineral density or bone volume fraction (BV/TV) as independent variables could predict the strength and stiffness of normal and pathologic cancellous bone affected by osteoporosis or metastatic cancer. After obtaining institutional review board approval and informed consent, 15 patients underwent excisional biopsy of metastatic prostate, breast, lung, ovarian, or colon cancer from the spine and/or femur to obtain 41 metastatic cancer specimens. In addition, 96 noncancer specimens were excised from 43 age- and site-matched cadavers. All specimens were imaged using micro-computed tomography (micro-CT) and backscatter emission imaging and tested mechanically by uniaxial compression and nanoindentation. The minimum BV/TV, measured using quantitative micro-CT, accounted for 84% of the variation in bone stiffness and strength for all cancellous bone specimens. While relationships relating bone density to strength and stiffness have been derived empirically for normal and osteoporotic bone, these relationships have not been applied to skeletal metastases. This simple analytic relationship will facilitate large-scale screening and prediction of fracture risk for normal and pathologic cancellous bone using clinical CT systems to determine the load capacity of bones altered by metastatic cancer, osteoporosis, or both.

  13. A study of fiber volume fraction effects in notched unidirectional SCS-6/Ti-15V-3Cr-3Al-3Sn composite. Ph.D. Thesis Final Report (United States)

    Covey, Steven J.


    Notched unidirectional SCS-6/Ti-15-3 composite of three different fiber volume fractions (vf = 0.15, 0.37, and 0.41) was investigated for various room temperature microstructural and material properties including: fatigue crack initiation, fatigue crack growth, and fracture toughness. While the matrix hardness is similar for all fiber volume fractions, the fiber/matrix interfacial shear strength and matrix residual stress increases with fiber volume fraction. The composite fatigue crack initiation stress is shown to be matrix controlled and occurs when the net maximum matrix stress approaches the endurance limit stress of the matrix. A model is presented which includes residual stresses and presents the composite initiation stress as a function of fiber volume fraction. This model predicts a maximum composite initiation stress at vf approximately 0.15 which agrees with the experimental data. The applied composite stress levels were increased as necessary for continued crack growth. The applied Delta(K) values at crack arrest increase with fiber volume fraction by an amount better approximated using an energy based formulation rather than when scaled linear with modulus. After crack arrest, the crack growth rate exponents for vf37 and vf41 were much lower and toughness much higher, when compared to the unreinforced matrix, because of the bridged region which parades with the propagating fatigue crack. However, the vf15 material exhibited a higher crack growth rate exponent and lower toughness than the unreinforced matrix because once the bridged fibers nearest the crack mouth broke, the stress redistribution broke all bridged fibers, leaving an unbridged crack. Degraded, unbridged behavior is modeled using the residual stress state in the matrix ahead of the crack tip. Plastic zone sizes were directly measured using a metallographic technique and allow prediction of an effective matrix stress intensity which agrees with the fiber pressure model if residual stresses

  14. Nanoparticle volume fraction with heat and mass transfer on MHD mixed convection flow in a nanofluid in the presence of thermo-diffusion under convective boundary condition (United States)

    Kandasamy, R.; Jeyabalan, C.; Sivagnana Prabhu, K. K.


    This article examines the influence of thermophoresis, Brownian motion of the nanoparticles with variable stream conditions in the presence of magnetic field on mixed convection heat and mass transfer in the boundary layer region of a semi-infinite porous vertical plate in a nanofluid under the convective boundary conditions. The transformed boundary layer ordinary differential equations are solved numerically using Maple 18 software with fourth-fifth order Runge-Kutta-Fehlberg method. Numerical results are presented both in tabular and graphical forms illustrating the effects of these parameters with magnetic field on momentum, thermal, nanoparticle volume fraction and solutal concentration boundary layers. The numerical results obtained for the velocity, temperature, volume fraction, and concentration profiles reveal interesting phenomenon, some of these qualitative results are presented through plots. It is interesting to note that the magnetic field plays a dominant role on nanofluid flow under the convective boundary conditions.

  15. Wear Behavior of Al-Mg2Si Cast In-situ Composite: Effect of Mg2Si Different Volume Fractions (United States)

    Ghiasinejad, J.; Emamy, M.; Ghorbani, M. R.; Malekan, A.


    Al-Mg2Si in situ composites are great candidates for automobile brake discs due to their low density, reasonably high young's modulus and low thermal expansion coefficient. Thus, understanding wear properties of this composite is of a great importance. In this study wear behavior of an in-situ Al-Mg2Si composite, prepared from a simple casting route, has been investigated using a pin-on-disc configuration concerning the effect of Mg2Si volume fractions, 15, 20 and 25% respectively. It was found that the weight loss increases with increase in reinforce volume fraction which can be due to a coarse morphology of primary Mg2Si particles. It was found that the variations of weight loss with sliding distance comprise different regimes of which the mechanisms are discussed.

  16. Large volume TENAX {sup registered} extraction of the bioaccessible fraction of sediment-associated organic compounds for a subsequent effect-directed analysis

    Energy Technology Data Exchange (ETDEWEB)

    Schwab, K.; Brack, W. [UFZ - Helmholtz Centre or Environmental Research, Leipzig (Germany). Dept. of Effect-Directed Analysis


    Background, Aim and Scope: Effect-directed analysis (EDA) is a powerful tool for the identification of key toxicants in complex environmental samples. In most cases, EDA is based on total extraction of organic contaminants leading to an erroneous prioritization with regard to hazard and risk. Bioaccessibility-directed extraction aims to discriminate between contaminants that take part in partitioning between sediment and biota in a relevant time frame and those that are enclosed in structures, that do not allow rapid desorption. Standard protocols of targeted extraction of rapidly desorbing, and thus bioaccessible fraction using TENAX {sup registered} are based only on small amounts of sediment. In order to get sufficient amounts of extracts for subsequent biotesting, fractionation, and structure elucidation a large volume extraction technique needs to be developed applying one selected extraction time and excluding toxic procedural blanks. Materials and Methods: Desorption behaviour of sediment contaminants was determined by a consecutive solid-solid extraction of sediment using TENAX {sup registered} fitting a tri-compartment model on experimental data. Time needed to remove the rapidly desorbing fraction trap was calculated to select a fixed extraction time for single extraction procedures. Up-scaling by about a factor of 100 provided a large volume extraction technique for EDA. Reproducibility and comparability to small volume approach were proved. Blanks of respective TENAX {sup registered} mass were investigated using Scenedesmus vacuolatus and Artemia salina as test organisms. Results: Desorption kinetics showed that 12 to 30 % of sediment associated pollutants are available for rapid desorption. t{sub r}ap is compound dependent and covers a range of 2 to 18 h. On that basis a fixed extraction time of 24 h was selected. Validation of large volume approach was done by the means of comparison to small method and reproducibility. The large volume showed a good

  17. Axon diameter and intra-axonal volume fraction of the corticospinal tract in idiopathic normal pressure hydrocephalus measured by q-space imaging.

    Directory of Open Access Journals (Sweden)

    Kouhei Kamiya

    Full Text Available PURPOSE: Previous studies suggest that compression and stretching of the corticospinal tract (CST potentially cause treatable gait disturbance in patients with idiopathic normal pressure hydrocephalus (iNPH. Measurement of axon diameter with diffusion MRI has recently been used to investigate microstructural alterations in neurological diseases. In this study, we investigated alterations in the axon diameter and intra-axonal fraction of the CST in iNPH by q-space imaging (QSI analysis. METHODS: Nineteen patients with iNPH and 10 age-matched controls were recruited. QSI data were obtained with a 3-T system by using a single-shot echo planar imaging sequence with the diffusion gradient applied parallel to the antero-posterior axis. By using a two-component low-q fit model, the root mean square displacements of intra-axonal space ( =  axon diameter and intra-axonal volume fraction of the CST were calculated at the levels of the internal capsule and body of the lateral ventricle, respectively. RESULTS: Wilcoxon's rank-sum test revealed a significant increase in CST intra-axonal volume fraction at the paraventricular level in patients (p<0.001, whereas no significant difference was observed in the axon diameter. At the level of the internal capsule, neither axon diameter nor intra-axonal volume fraction differed significantly between the two groups. CONCLUSION: Our results suggest that in patients with iNPH, the CST does not undergo irreversible axonal damage but is rather compressed and/or stretched owing to pressure from the enlarged ventricle. These analyses of axon diameter and intra-axonal fraction yield insights into microstructural alterations of the CST in iNPH.

  18. The effects of temperature, volume fraction and vibration time on the thermo-physical properties of a carbon nanotube suspension (carbon nanofluid)

    Energy Technology Data Exchange (ETDEWEB)

    Amrollahi, A; Hamidi, A A [Faculty of Engineering, University of Teheran, PO Box 11365-4563, Teheran (Iran, Islamic Republic of); Rashidi, A M [Gas Division of Research Institute of Petroleum Industry, PO Box 18745-4163, Tehran (Iran, Islamic Republic of)], E-mail:


    In this investigation, nanofluids of carbon nanotubes are prepared and the thermal conductivity and volumetric heat capacity of these fluids are measured using a thin layer technique as a function of time of ultrasonication, temperature, and volume fraction. It has been observed that after using the ultrasonic disrupter, the size of agglomerated particles and number of primary particles in a particle cluster was significantly decreased and that the thermal conductivity increased with elapsed ultrasonication time. The clustering of carbon nanotubes was also confirmed microscopically. The strong dependence of the effective thermal conductivity on temperature and volume fraction of nanofluids was attributed to Brownian motion and the interparticle potential, which influences the particle motion. The effect of temperature will become much more evident with an increase in the volume fraction and the agglomeration of the nanoparticles, as observed experimentally. The data obtained from this work have been compared with those of other studies and also with mathematical models at present proven for suspensions. Using a 2.5% volumetric concentration of carbon nanotubes resulted in a 20% increase in the thermal conductivity of the base fluid (ethylene glycol).The volumetric heat capacity also showed a pronounced increase with respect to that of the pure base fluid.

  19. The effects of temperature, volume fraction and vibration time on the thermo-physical properties of a carbon nanotube suspension (carbon nanofluid). (United States)

    Amrollahi, A; Hamidi, A A; Rashidi, A M


    In this investigation, nanofluids of carbon nanotubes are prepared and the thermal conductivity and volumetric heat capacity of these fluids are measured using a thin layer technique as a function of time of ultrasonication, temperature, and volume fraction. It has been observed that after using the ultrasonic disrupter, the size of agglomerated particles and number of primary particles in a particle cluster was significantly decreased and that the thermal conductivity increased with elapsed ultrasonication time. The clustering of carbon nanotubes was also confirmed microscopically. The strong dependence of the effective thermal conductivity on temperature and volume fraction of nanofluids was attributed to Brownian motion and the interparticle potential, which influences the particle motion. The effect of temperature will become much more evident with an increase in the volume fraction and the agglomeration of the nanoparticles, as observed experimentally. The data obtained from this work have been compared with those of other studies and also with mathematical models at present proven for suspensions. Using a 2.5% volumetric concentration of carbon nanotubes resulted in a 20% increase in the thermal conductivity of the base fluid (ethylene glycol).The volumetric heat capacity also showed a pronounced increase with respect to that of the pure base fluid.

  20. The effect of the volume fraction and viscosity on the compression and tension behavior of the cobalt-ferrite magneto-rheological fluids

    Directory of Open Access Journals (Sweden)

    H. Shokrollahi


    Full Text Available The purpose of this work is to investigate the effects of the volume fraction and bimodal distribution of solid particles on the compression and tension behavior of the Co-ferrite-based magneto-rheological fluids (MRFs containing silicon oil as a carrier. Hence, Co-ferrite particles (CoFe2O4 with two various sizes were synthesized by the chemical co-precipitation method and mixed so as to prepare the bimodal MRF. The X-Ray Diffraction (XRD analysis, Fourier Transform Infrared Spectroscopy (FTIR, Laser Particle Size Analysis (LPSA and Vibrating Sample Magnetometer (VSM were conducted to examine the structural and magnetic properties, respectively. The results indicated that the increase of the volume fraction has a direct increasing influence on the values of the compression and tension strengths of fluids. In addition, the compression and tension strengths of the mixed MRF sample (1.274 and 0.647 MPa containing 60 and 550 nm samples were higher than those of the MRF sample with the same volume fraction and uniform particle size of 550 nm.

  1. Effect of Coarse Particle Volume Fraction on the Yield Stress of Muddy Sediments from Marennes Oléron Bay

    Directory of Open Access Journals (Sweden)

    A. Pantet


    Full Text Available Coastal erosion results from a combination of various factors, both natural and humaninduced, which have different time and space patterns. In addition, uncertainties still remain about the interactions of the forcing agents, as well as on the significance of non-local causes of erosion. We focused about the surface sediments in the Marennes Oléron bay, after a general description of the site that has many various activities. The superficial sediments show a mechanical behavior, mainly depends on the fine fraction for a composition that contains up to 60% of sandy material. Fine sediments fraction has a typical yield stress depending naturally of concentration or water content. This yield could be modified slightly or significantly by adding silt or sand. As a result, the rheological measurement sensitivity allows us to characterize five typical sediments that correlate with solid fraction and fine fraction.

  2. Microcomputed tomographic analysis of human condyles in unilateral condylar hyperplasia: increased cortical porosity and trabecular bone volume fraction with reduced mineralisation. (United States)

    Karssemakers, L H E; Nolte, J W; Tuinzing, D B; Langenbach, G E J; Raijmakers, P G; Becking, A G


    Unilateral condylar hyperplasia or hyperactivity is a disorder of growth that affects the mandible, and our aim was to visualise the 3-dimensional bony microstructure of resected mandibular condyles of affected patients. We prospectively studied 17 patients with a clinical presentation of progressive mandibular asymmetry and an abnormal single-photon emission computed tomographic (SPECT) scan. All patients were treated by condylectomy to arrest progression. The resected condyles were scanned with micro-CT (18 μm resolution). Rectangular volumes of interest were selected in 4 quadrants (lateromedial and superoinferior) of the trabecular bone of each condyle. Variables of bone architecture (volume fraction, trabecular number, thickness, and separation, degree of mineralisation, and degree of structural anisotrophy) were calculated with routine morphometric software. Eight of the 17 resected condyles showed clear destruction of the subchondral layer of cortical bone. There was a significant superoinferior gradient for all trabecular variables. Mean (SD) bone volume fraction (25.1 (6) %), trabecular number (1.69 (0.26) mm(-1)), trabecular thickness (0.17 (0.03) mm), and degree of mineralisation (695.39 (39.83) mg HA/cm(3)) were higher in the superior region. Trabecular separation (0.6 (0.16) mm) and structural anisotropy (1.84 (0.28)) were higher in the inferior region. The micro-CT analysis showed increased cortical porosity in many of the condyles studied. It also showed a higher bone volume fraction, greater trabecular thickness and trabecular separation, greater trabecular number, and less mineralisation in the condyles of the 17 patients compared with the known architecture of unaffected mandibular condyles.

  3. Global fractional anisotropy and mean diffusivity together with segmented brain volumes assemble a predictive discriminant model for young and elderly healthy brains: a pilot study at 3T (United States)

    Garcia-Lazaro, Haydee Guadalupe; Becerra-Laparra, Ivonne; Cortez-Conradis, David; Roldan-Valadez, Ernesto


    Summary Several parameters of brain integrity can be derived from diffusion tensor imaging. These include fractional anisotropy (FA) and mean diffusivity (MD). Combination of these variables using multivariate analysis might result in a predictive model able to detect the structural changes of human brain aging. Our aim was to discriminate between young and older healthy brains by combining structural and volumetric variables from brain MRI: FA, MD, and white matter (WM), gray matter (GM) and cerebrospinal fluid (CSF) volumes. This was a cross-sectional study in 21 young (mean age, 25.71±3.04 years; range, 21–34 years) and 10 elderly (mean age, 70.20±4.02 years; range, 66–80 years) healthy volunteers. Multivariate discriminant analysis, with age as the dependent variable and WM, GM and CSF volumes, global FA and MD, and gender as the independent variables, was used to assemble a predictive model. The resulting model was able to differentiate between young and older brains: Wilks’ λ = 0.235, χ2 (6) = 37.603, p = .000001. Only global FA, WM volume and CSF volume significantly discriminated between groups. The total accuracy was 93.5%; the sensitivity, specificity and positive and negative predictive values were 91.30%, 100%, 100% and 80%, respectively. Global FA, WM volume and CSF volume are parameters that, when combined, reliably discriminate between young and older brains. A decrease in FA is the strongest predictor of membership of the older brain group, followed by an increase in WM and CSF volumes. Brain assessment using a predictive model might allow the follow-up of selected cases that deviate from normal aging. PMID:27027893

  4. Effect of Phase Contiguity and Morphology on the Evolution of Deformation Texture in Two-Phase Alloys (United States)

    Gurao, N. P.; Suwas, Satyam


    Deformation texture evolution in two-phase xFe- yNi-(100- x- y)Cr model alloys and Ti-13Nb-13Zr alloy was studied during rolling to develop an understanding of micro-mechanisms of deformation in industrially relevant two-phase FCC-BCC steels and HCP-BCC titanium alloys, respectively. It was found that volume fraction and contiguity of phases lead to systematic changes in texture, while morphology affects the strength of texture. There was a characteristic change in texture from typical Brass-type to a weaker Copper-type texture in the austenite phase accompanied with a change from alpha fiber to gamma fiber in ferrite phase for Fe-Ni-Cr alloys with increase in fraction of harder ferrite phase. However, similar characteristic texture evolution was noted in both α and β phase irrespective of the different initial morphologies in Ti-13Nb-13Zr alloy. Viscoplastic self-consistent simulations with two-phase scheme were able to qualitatively predict texture evolution in individual phases. It is proposed that the transition from iso-strain-type behavior for equiaxed microstructure at low strain to iso-stress-type behavior at higher strain is aided by the presence of higher volume fraction of the second phase and increasing aspect ratio of individual phases in two-phase alloys.

  5. Identification of myocardial diffuse fibrosis by 11 heartbeat MOLLI T 1 mapping: averaging to improve precision and correlation with collagen volume fraction. (United States)

    Vassiliou, Vassilios S; Wassilew, Katharina; Cameron, Donnie; Heng, Ee Ling; Nyktari, Evangelia; Asimakopoulos, George; de Souza, Anthony; Giri, Shivraman; Pierce, Iain; Jabbour, Andrew; Firmin, David; Frenneaux, Michael; Gatehouse, Peter; Pennell, Dudley J; Prasad, Sanjay K


    Our objectives involved identifying whether repeated averaging in basal and mid left ventricular myocardial levels improves precision and correlation with collagen volume fraction for 11 heartbeat MOLLI T 1 mapping versus assessment at a single ventricular level. For assessment of T 1 mapping precision, a cohort of 15 healthy volunteers underwent two CMR scans on separate days using an 11 heartbeat MOLLI with a 5(3)3 beat scheme to measure native T 1 and a 4(1)3(1)2 beat post-contrast scheme to measure post-contrast T 1, allowing calculation of partition coefficient and ECV. To assess correlation of T 1 mapping with collagen volume fraction, a separate cohort of ten aortic stenosis patients scheduled to undergo surgery underwent one CMR scan with this 11 heartbeat MOLLI scheme, followed by intraoperative tru-cut myocardial biopsy. Six models of myocardial diffuse fibrosis assessment were established with incremental inclusion of imaging by averaging of the basal and mid-myocardial left ventricular levels, and each model was assessed for precision and correlation with collagen volume fraction. A model using 11 heart beat MOLLI imaging of two basal and two mid ventricular level averaged T 1 maps provided improved precision (Intraclass correlation 0.93 vs 0.84) and correlation with histology (R (2) = 0.83 vs 0.36) for diffuse fibrosis compared to a single mid-ventricular level alone. ECV was more precise and correlated better than native T 1 mapping. T 1 mapping sequences with repeated averaging could be considered for applications of 11 heartbeat MOLLI, especially when small changes in native T 1/ECV might affect clinical management.

  6. The Effect of Volume Fraction of Single-Walled Carbon Nanotubes on Natural Frequencies of Polymer Composite Cone-Shaped Shell Made from Poly(Methyl Methacrylate

    Directory of Open Access Journals (Sweden)

    A. H. Meysami


    Full Text Available In this paper, the effect of volume fraction of single-walled carbon nanotubes on natural frequencies of polymer composite cone-shaped shells made from Poly(Methyl Methacrylate (PMMA is studied. In order to determine the characterization of materials reinforced with nanoparticles, the molecular dynamics and mixture rule has been used. The motion equations of composite shell based on the classical thin shells theory using Hamilton’s principle are obtained. Then, using the Ritz method, approximate analytical solution of the natural frequency is presented. Results indicate that the nanotubes have a noticeable effect on the natural frequencies.

  7. On the influence of local fluctuations in volume fraction of constituents on the effective properties of nonlinear composites. Application to porous materials (United States)

    Gărăjeu, M.; Suquet, P.


    Composite materials often exhibit local fluctuations in the volume fraction of their individual constituents. This paper studies the influence of such small fluctuations on the effective properties of composites. A general asymptotic expansion of these properties in terms of powers of the amplitude of the fluctuations is given first. Then, this general result is applied to porous materials. As is well-known, the effective yield surface of ductile voided materials is accurately described by Gurson's criterion. Suitable extensions for viscoplastic solids have also been proposed. The question addressed in the present study pertains to nonuniform distributions of voids in a typical volume element or in other words to the presence of matrix-rich and pore-rich zones in the material. It is shown numerically and analytically that such deviations from a uniform distribution result in a weakening of the macroscopic carrying capacity of the material.

  8. 3-D Numerical Simulation and Analysis of Complex Fiber Geometry RaFC Materials with High Volume Fraction and High Aspect Ratio based on ABAQUS PYTHON (United States)

    Jin, BoCheng


    Organic and inorganic fiber reinforced composites with innumerable fiber orientation distributions and fiber geometries are abundantly available in several natural and synthetic structures. Inorganic glass fiber composites have been introduced to numerous applications due to their economical fabrication and tailored structural properties. Numerical characterization of such composite material systems is necessitated due to their intrinsic statistical nature, which renders extensive experimentation prohibitively time consuming and costly. To predict various mechanical behavior and characterizations of Uni-Directional Fiber Composites (UDFC) and Random Fiber Composites (RaFC), we numerically developed Representative Volume Elements (RVE) with high accuracy and efficiency and with complex fiber geometric representations encountered in uni-directional and random fiber networks. In this thesis, the numerical simulations of unidirectional RaFC fiber strand RVE models (VF>70%) are first presented by programming in ABAQUS PYTHON. Secondly, when the cross sectional aspect ratios (AR) of the second phase fiber inclusions are not necessarily one, various types of RVE models with different cross sectional shape fibers are simulated and discussed. A modified random sequential absorption algorithm is applied to enhance the volume fraction number (VF) of the RVE, which the mechanical properties represents the composite material. Thirdly, based on a Spatial Segment Shortest Distance (SSSD) algorithm, a 3-Dimentional RaFC material RVE model is simulated in ABAQUS PYTHON with randomly oriented and distributed straight fibers of high fiber aspect ratio (AR=100:1) and volume fraction (VF=31.8%). Fourthly, the piecewise multi-segments fiber geometry is obtained in MATLAB environment by a modified SSSD algorithm. Finally, numerical methods including the polynomial curve fitting and piecewise quadratic and cubic B-spline interpolation are applied to optimize the RaFC fiber geometries

  9. Impact of epoetin alfa on left ventricular structure, function, and pressure volume relations as assessed by cardiac magnetic resonance: the heart failure preserved ejection fraction (HFPEF) anemia trial. (United States)

    Green, Philip; Babu, Benson A; Teruya, Sergio; Helmke, Stephen; Prince, Martin; Maurer, Mathew S


    Anemia, a common comorbidity in older adults with heart failure and a preserved ejection fraction (HFPEF), is associated with worse outcomes. The authors quantified the effect of anemia treatment on left ventricular (LV) structure and function as measured by cardiac magnetic resonance (CMR) imaging. A prospective, randomized single-blind clinical trial (NCT NCT00286182) comparing the safety and efficacy of epoetin alfa vs placebo for 24 weeks in which a subgroup (n=22) had cardiac magnetic resonance imaging (MRI) at baseline and after 3 and 6 months to evaluate changes in cardiac structure and function. Pressure volume (PV) indices were derived from MRI measures of ventricular volume coupled with sphygmomanometer-measured pressure and Doppler estimates of filling pressure. The end-systolic and end-diastolic PV relations and the area between them as a function of end-diastolic pressure, the isovolumic PV area (PVAiso), were calculated. Patients (75±10 years, 64% women) with HFPEF (EF=63%±15%) with an average hemoglobin of 10.3±1.1 gm/dL were treated with epoetin alfa using a dose-adjusted algorithm that increased hemoglobin compared with placebo (PHFPEF resulted in a significant increase in hemoglobin, without evident change in LV structure, function, or pressure volume relationships as measured quantitatively using CMR imaging.

  10. Fractional rate of change of swim-bladder volume is reliably related to absolute depth during vertical displacements in teleost fish. (United States)

    Taylor, Graham K; Holbrook, Robert Iain; de Perera, Theresa Burt


    Fish must orient in three dimensions as they navigate through space, but it is unknown whether they are assisted by a sense of depth. In principle, depth can be estimated directly from hydrostatic pressure, but although teleost fish are exquisitely sensitive to changes in pressure, they appear unable to measure absolute pressure. Teleosts sense changes in pressure via changes in the volume of their gas-filled swim-bladder, but because the amount of gas it contains is varied to regulate buoyancy, this cannot act as a long-term steady reference for inferring absolute pressure. In consequence, it is generally thought that teleosts are unable to sense depth using hydrostatic pressure. Here, we overturn this received wisdom by showing from a theoretical physical perspective that absolute depth could be estimated during fast, steady vertical displacements by combining a measurement of vertical speed with a measurement of the fractional rate of change of swim-bladder volume. This mechanism works even if the amount of gas in the swim-bladder varies, provided that this variation occurs over much longer time scales than changes in volume during displacements. There is therefore no a priori physical justification for assuming that teleost fish cannot sense absolute depth by using hydrostatic pressure cues.

  11. Dosimetric consequences of tumor volume changes after kilovoltage cone-beam computed tomography for non-operative lung cancer during adaptive intensity-modulated radiotherapy or fractionated stereotactic radiotherapy

    Institute of Scientific and Technical Information of China (English)

    Jian Hu; Ximing Xu; Guangjin Yuan; Wei Ge; Liming Xu; Aihua Zhang; Junjian Deng


    Objective The aim of this study was to investigate tumor volume changes with kilovoltage cone-beam computed tomography (kV-CBCT) and their dosimetric consequences for non-operative lung cancer during intensity-modulated radiotherapy (IMRT) or fractionated stereotactic radiotherapy. Methods Eighteen patients with non-operative lung cancer who received IMRT consisting of 1.8-2.2 Gy/fraction and five fractions per week or stereotactic radiotherapy with 5-8 Gy/fraction and three fractions a week were studied. kV-CBCT was performed once per week during IMRT and at every fraction during stereotactic radiotherapy. The gross tumor volume (GTV) was contoured on the kV-CBCT images, and adaptive treatment plans were created using merged kV-CBCT and primary planning computed tomogra-phy image sets. Tumor volume changes and dosimetric parameters, including the minimum dose to 95%(D95) or 1% (D1) of the planning target volume (PTV), mean lung dose (MLD), and volume of lung tissue that received more than 5 (V5), 10 (V10), 20 (V20), and 30 (V30) Gy were retrospectively analyzed. Results The average maximum change in GTV observed during IMRT or fractionated stereotactic radio-therapy was -25.85% (range, -13.09% --56.76%). The D95 and D1 of PTV for the adaptive treatment plans in all patients were not significantly different from those for the initial or former adaptive treatment plans. In patients with tumor volume changes of >20% in the third or fourth week of treatment during IMRT, adap-tive treatment plans offered clinically meaningful decreases in MLD and V5, V10, V20, and V30; however, in patients with tumor volume changes of 20% in the third or fourth week of treatment.

  12. County-Level Climate Uncertainty for Risk Assessments: Volume 20 Appendix S - Historical Sea Ice Area Fraction

    Energy Technology Data Exchange (ETDEWEB)

    Backus, George A.; Lowry, Thomas Stephen; Jones, Shannon M; Walker, La Tonya Nicole; Roberts, Barry L; Malczynski, Leonard A.


    This report uses the CMIP5 series of climate model simulations to produce country- level uncertainty distributions for use in socioeconomic risk assessments of climate change impacts. It provides appropriate probability distributions, by month, for 169 countries and autonomous-areas on temperature, precipitation, maximum temperature, maximum wind speed, humidity, runoff, soil moisture and evaporation for the historical period (1976-2005), and for decadal time periods to 2100. It also provides historical and future distributions for the Arctic region on ice concentration, ice thickness, age of ice, and ice ridging in 15-degree longitude arc segments from the Arctic Circle to 80 degrees latitude, plus two polar semicircular regions from 80 to 90 degrees latitude. The uncertainty is meant to describe the lack of knowledge rather than imprecision in the physical simulation because the emphasis is on unfalsified risk and its use to determine potential socioeconomic impacts. The full report is contained in 27 volumes.

  13. County-Level Climate Uncertainty for Risk Assessments: Volume 21 Appendix T - Forecast Sea Ice Area Fraction.

    Energy Technology Data Exchange (ETDEWEB)

    Backus, George A.; Lowry, Thomas Stephen; Jones, Shannon M; Walker, La Tonya Nicole; Roberts, Barry L; Malczynski, Leonard A.


    This report uses the CMIP5 series of climate model simulations to produce country- level uncertainty distributions for use in socioeconomic risk assessments of climate change impacts. It provides appropriate probability distributions, by month, for 169 countries and autonomous-areas on temperature, precipitation, maximum temperature, maximum wind speed, humidity, runoff, soil moisture and evaporation for the historical period (1976-2005), and for decadal time periods to 2100. It also provides historical and future distributions for the Arctic region on ice concentration, ice thickness, age of ice, and ice ridging in 15-degree longitude arc segments from the Arctic Circle to 80 degrees latitude, plus two polar semicircular regions from 80 to 90 degrees latitude. The uncertainty is meant to describe the lack of knowledge rather than imprecision in the physical simulation because the emphasis is on unfalsified risk and its use to determine potential socioeconomic impacts. The full report is contained in 27 volumes.

  14. How do jet time, pressure and bone volume fraction influence the drilling depth when waterjet drilling in porcine bone? (United States)

    den Dunnen, Steven; Dankelman, Jenny; Kerkhoffs, Gino M M J; Tuijthof, Gabrielle J M


    Using water jets for orthopedic procedures that require bone drilling can be beneficial due to the absence of thermal damage and the always sharp cut. Previously, the influence of the water jet diameter and bone architectural properties on the drilling depth have been determined. To develop water jet instruments that can safely drill in orthopedic surgery, the impact of the two remaining primary factors were determined: the jet time (tjet [s]) and pressure (P [MPa]). To this end, 84 holes were drilled in porcine tali and femora with water jets using Ø 0.4mm nozzle. tjet was varied between 1, 3 and 5s and P between 50 and 70MPa. Drilling depths Lhole (mm), diameters Dhole (mm) and the volume of mineralized bone per unit volume (BV/TV) were determined with microCT scans. A non-linear regression analysis resulted in the predictive equation: Lhole= 0.22 * tjet(0.18) * (1.2-BV/TV) * (P-29) (R(2)=0.904). The established relation between the machine settings and drilling depth allows surgeons to adjust jet time and pressure for the patient׳s BV/TV to drill holes at a predetermined depth. For developers, the relation allows design decisions to be made that influence the dimensions, flexibility and accuracy of water jet instruments. For a pressure of 50MPa, the potential hole depth spread indicated by the 95% confidence interval is drilling can be applied in orthopedic surgery to drill holes in bone with controlled depth.

  15. Radiobiological restrictions and tolerance doses of repeated single-fraction hdr-irradiation of intersecting small liver volumes for recurrent hepatic metastases

    Directory of Open Access Journals (Sweden)

    Wust Peter


    Full Text Available Abstract Background To assess radiobiological restrictions and tolerance doses as well as other toxic effects derived from repeated applications of single-fraction high dose rate irradiation of small liver volumes in clinical practice. Methods Twenty patients with liver metastases were treated repeatedly (2 - 4 times at identical or intersecting locations by CT-guided interstitial brachytherapy with varying time intervals. Magnetic resonance imaging using the hepatocyte selective contrast media Gd-BOPTA was performed before and after treatment to determine the volume of hepatocyte function loss (called pseudolesion, and the last acquired MRI data set was merged with the dose distributions of all administered brachytherapies. We calculated the BED (biologically equivalent dose for a single dose d = 2 Gy for different α/β values (2, 3, 10, 20, 100 based on the linear-quadratic model and estimated the tolerance dose for liver parenchyma D90 as the BED exposing 90% of the pseudolesion in MRI. Results The tolerance doses D90 after repeated brachytherapy sessions were found between 22 - 24 Gy and proved only slightly dependent on α/β in the clinically relevant range of α/β = 2 - 10 Gy. Variance analysis showed a significant dependency of D90 with respect to the intervals between the first irradiation and the MRI control (p 90 and the pseudolesion's volume. No symptoms of liver dysfunction or other toxic effects such as abscess formation occurred during the follow-up time, neither acute nor on the long-term. Conclusions Inactivation of liver parenchyma occurs at a BED of approx. 22 - 24 Gy corresponding to a single dose of ~10 Gy (α/β ~ 5 Gy. This tolerance dose is consistent with the large potential to treat oligotopic and/or recurrent liver metastases by CT-guided HDR brachytherapy without radiation-induced liver disease (RILD. Repeated small volume irradiation may be applied safely within the limits of this study.

  16. Synaptic encoding of temporal contiguity

    Directory of Open Access Journals (Sweden)

    Srdjan eOstojic


    Full Text Available Often we need to perform tasks in an environment that changes stochastically. In these situations it is important to learn the statistics of sequences of events in order to predict the future and the outcome of our actions. The statistical description of many of these sequences can be reduced to the set of probabilities that a particular event follows another event (temporal contiguity. Under these conditions, it is important to encode and store in our memory these transition probabilities. Here we show that for a large class of synaptic plasticity models, the distribution of synaptic strengths encodes transitions probabilities. Specifically, when the synaptic dynamics depend on pairs of contiguous events and the synapses can remember multiple instances of the transitions, then the average synaptic weights are a monotonic function of the transition probabilities. The synaptic weights converge to the distribution encoding the probabilities also when the correlations between consecutive synaptic modifications are considered. We studied how this distribution depends on the number of synaptic states for a specific model of a multi-state synapse with hard bounds. In the case of bistable synapses, the average synaptic weights are a smooth function of the transition probabilities and the accuracy of the encoding depends on the learning rate. As the number of synaptic states increases, the average synaptic weights become a step function of the transition probabilities. We finally show that the information stored in the synaptic weights can be read out by a simple rate-based neural network. Our study shows that synapses encode transition probabilities under general assumptions and this indicates that temporal contiguity is likely to be encoded and harnessed in almost every neural circuit in the brain.

  17. Task mapping for non-contiguous allocations.

    Energy Technology Data Exchange (ETDEWEB)

    Leung, Vitus Joseph; Bunde, David P.; Ebbers, Johnathan; Price, Nicholas W.; Swank, Matthew.; Feer, Stefan P.; Rhodes, Zachary D.


    This paper examines task mapping algorithms for non-contiguously allocated parallel jobs. Several studies have shown that task placement affects job running time for both contiguously and non-contiguously allocated jobs. Traditionally, work on task mapping either uses a very general model where the job has an arbitrary communication pattern or assumes that jobs are allocated contiguously, making them completely isolated from each other. A middle ground between these two cases is the mapping problem for non-contiguous jobs having a specific communication pattern. We propose several task mapping algorithms for jobs with a stencil communication pattern and evaluate them using experiments and simulations. Our strategies improve the running time of a MiniApp by as much as 30% over a baseline strategy. Furthermore, this improvement increases markedly with the job size, demonstrating the importance of task mapping as systems grow toward exascale.

  18. Synthesis and characterization of high volume fraction Al-Al{sub 2}O{sub 3} nanocomposite powders by high-energy milling

    Energy Technology Data Exchange (ETDEWEB)

    Prabhu, B. [Department of Mechanical, Materials, and Aerospace Engineering, University of Central Florida, Orlando, FL 32816-2450 (United States); Suryanarayana, C. [Department of Mechanical, Materials, and Aerospace Engineering, University of Central Florida, Orlando, FL 32816-2450 (United States)]. E-mail:; An, L. [Department of Mechanical, Materials, and Aerospace Engineering, University of Central Florida, Orlando, FL 32816-2450 (United States); Advanced Materials Processing and Analysis Center, University of Central Florida, Orlando, FL 32816-2455 (United States); Vaidyanathan, R. [Department of Mechanical, Materials, and Aerospace Engineering, University of Central Florida, Orlando, FL 32816-2450 (United States); Advanced Materials Processing and Analysis Center, University of Central Florida, Orlando, FL 32816-2455 (United States)


    Al-Al{sub 2}O{sub 3} metal matrix composite (MMC) powders with volume fractions of 20, 30, and 50% Al{sub 2}O{sub 3} were synthesized by high-energy milling of the blended component powders. The particle sizes of Al{sub 2}O{sub 3} studied were 50 nm, 150 nm, and 5 {mu}m. A uniform distribution of the Al{sub 2}O{sub 3} reinforcement in the Al matrix was successfully obtained after milling the powders for a period of 20 h at a ball-to-powder ratio of 10:1 in a SPEX mill. The uniform distribution of Al{sub 2}O{sub 3} in the Al matrix was confirmed by characterizing these nanocomposite powders by scanning electron microscopy (SEM), energy dispersive spectrometry (EDS), X-ray mapping, and X-ray diffraction (XRD) techniques.

  19. Temperature dependence of pin solar cell parameters with intrinsic layers made of pm-Si:H and low crystalline volume fraction {mu}c-Si:H

    Energy Technology Data Exchange (ETDEWEB)

    Hamadeh, H. [AECS, Physics Department, P.O. Box 6091, Damascus (Syria)


    A comparison of the temperature dependence of the IV characteristics parameters of hydrogenated silicon pin solar cells with intrinsic layers made of polymorphous silicon (pm-Si:H) and of {mu}c-Si:H with low crystalline volume fraction has been performed. When using pm-Si:H, higher efficiency and higher filling factors are achieved over a wide temperature range. Diode quality factors of both types of cells show similar temperature dependence. Recombination processes over the whole intrinsic layer dominates the forward current. A change of the cell parameters under illumination is also observed. The transport mechanism of both cells is similar in the temperature range that is important for most applications. Due to its optical and transport properties, pm-Si:H poses a very interesting alternative to {mu}c-Si:H and a-Si:H in the temperature range of normal terrestrial applications. (author)

  20. Temperature, Oxygen, and Soot-Volume-Fraction Measurements in a Turbulent C2H4-Fueled Jet Flame

    Energy Technology Data Exchange (ETDEWEB)

    Kearney, Sean P. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Guildenbecher, Daniel Robert [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Winters, Caroline [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Farias, Paul Abraham [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Grasser, Thomas W. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Hewson, John C. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)


    We present a detailed set of measurements from a piloted, sooting, turbulent C 2 H 4 - fueled diffusion flame. Hybrid femtosecond/picosecond coherent anti-Stokes Raman scattering (CARS) is used to monitor temperature and oxygen, while laser-induced incandescence (LII) is applied for imaging of the soot volume fraction in the challenging jet-flame environment at Reynolds number, Re = 20,000. Single-laser shot results are used to map the mean and rms statistics, as well as probability densities. LII data from the soot-growth region of the flame are used to benchmark the soot source term for one-dimensional turbulence (ODT) modeling of this turbulent flame. The ODT code is then used to predict temperature and oxygen fluctuations higher in the soot oxidation region higher in the flame.

  1. Revisiting the Lick Observatory Supernova Search Volume-Limited Sample: Updated Classifications and Revised Stripped-envelope Supernova Fractions

    CERN Document Server

    Shivvers, Isaac; Zheng, Weikang; Filippenko, Alexei V; Silverman, Jeffrey M; Liu, Yuqian; Matheson, Thomas; Pastorello, Andrea; Graur, Or; Foley, Ryan J; Chornock, Ryan; Smith, Nathan; Leaman, Jesse; Benetti, Stefano


    We re-examine the classifications of supernovae (SNe) presented in the Lick Observatory Supernova Search (LOSS) volume-limited sample with a focus on the stripped-envelope SNe. The LOSS volumetric sample, presented by Leaman et al. (2011) and Li et al. (2011b), was calibrated to provide meaningful measurements of SN rates in the local universe; the results presented therein continue to be used for comparisons to theoretical and modeling efforts. Many of the objects from the LOSS sample were originally classified based upon only a small subset of the data now available, and recent studies have both updated some subtype distinctions and improved our ability to perform robust classifications, especially for stripped-envelope SNe. We re-examine the spectroscopic classifications of all events in the LOSS volumetric sample (180 SNe and SN impostors) and update them if necessary. We discuss the populations of rare objects in our sample including broad-lined Type Ic SNe, Ca-rich SNe, SN 1987A-like events (we identify...

  2. Effects of nano anatase-rutile TiO2 volume fraction with natural dye containing anthocyanin on the dye sensitized solar cell performance (United States)

    Agustini, S.; Wahyuono, R. A.; Sawitri, D.; Risanti, D. D.


    Since its first development, efforts to improve efficiency of Dye Sensitized Solar Cell (DSSC) are continuously carried out, either through selection of dye materials, the type of semiconductor, counter electrode design or the sandwiched structure. It is widely known that anatase and rutile are phases of TiO2 that often being used for fabrication of DSSC. Rutile is thermodynamically more stable phase having band-gap suitable for absorption of sunlight spectrum. On the other hand, anatase has higher electrical conductivity, capability to adsorp dye as well as higher electron diffusion coefficient than those of rutile. Present research uses mangosteen pericarp and Rhoeo spathacea extracted in ethanol as natural dye containing anthocyanin. These dyes were characterized by using UV-Vis and FTIR, showing that the absorption maxima peaks obtained at 389 nm and 413 nm, for mangosteen and Rhoeo spathacea, respectively. The nano TiO2 was prepared by means of co-precipitation method. The particle size were 9-11 nm and 54.5 nm for anatase and rutile, respectively, according to Scherrer's equation. DSSCs were fabricated in various volume fractions of anatase and rutile TiO2. The fabricated DSSCs were tested under 17 mW/cm2 of solar irradiation. The current-voltage (I-V) characteristic of DSSCs employing 75%: 25% volume fraction of anatase and rutile TiO2 have outstanding result than others. The highest conversion efficiencies of 0.037% and 0.013% are obtained for DSSC employing natural dye extract from mangosteen pericarp and Rhoeo spathacea, respectively.

  3. Maintaining Arrays of Contiguous Objects (United States)

    Bender, Michael A.; Fekete, Sándor P.; Kamphans, Tom; Schweer, Nils

    In this paper we consider methods for dynamically storing a set of different objects (“modules”) in a physical array. Each module requires one free contiguous subinterval in order to be placed. Items are inserted or removed, resulting in a fragmented layout that makes it harder to insert further modules. It is possible to relocate modules, one at a time, to another free subinterval that is contiguous and does not overlap with the current location of the module. These constraints clearly distinguish our problem from classical memory allocation. We present a number of algorithmic results, including a bound of {Θ}(n^2) on physical sorting if there is a sufficiently large free space and sum up NP-hardness results for arbitrary initial layouts. For online scenarios in which modules arrive one at a time, we present a method that requires O(1) moves per insertion or deletion and amortized cost O(m_i lg hat{m}) per insertion or deletion, where m i is the module’s size, hat{m} is the size of the largest module and costs for moves are linear in the size of a module.

  4. Maintaining Arrays of Contiguous Objects

    CERN Document Server

    Bender, Michael A; Kamphans, Tom; Schweer, Nils


    In this paper we consider methods for dynamically storing a set of different objects ("modules") in a physical array. Each module requires one free contiguous subinterval in order to be placed. Items are inserted or removed, resulting in a fragmented layout that makes it harder to insert further modules. It is possible to relocate modules, one at a time, to another free subinterval that is contiguous and does not overlap with the current location of the module. These constraints clearly distinguish our problem from classical memory allocation. We present a number of algorithmic results, including a bound of Theta(n^2) on physical sorting if there is a sufficiently large free space and sum up NP-hardness results for arbitrary initial layouts. For online scenarios in which modules arrive one at a time, we present a method that requires O(1) moves per insertion or deletion and amortized cost O(m_i log M) per insertion or deletion, where m_i is the module's size, M is the size of the largest module and costs for ...

  5. Different nano-particles volume fraction and Hartmann number effects on flow and heat transfer of water-silver nanofluid under the variable heat flux (United States)

    Forghani-Tehrani, Pezhman; Karimipour, Arash; Afrand, Masoud; Mousavi, Sayedali


    Nanofluid flow and heat transfer composed of water-silver nanoparticles is investigated numerically inside a microchannel. Finite volume approach (FVM) is applied and the effects of gravity are ignored. The whole length of Microchannel is considered in three sections as l1=l3=0.151 and l2=0.71. The linear variable heat flux affects the microchannel wall in the length of l2 while a magnetic field with strength of B0 is considered over the whole domain of it. The influences of different values of Hartmann number (Ha=0, 10, 20), volume fraction of the nanoparticles (ɸ=0, 0.02, 0.04) and Reynolds number (Re=10, 50, 200) on the hydrodynamic and thermal properties of flow are reported. The investigation of slip velocity variations under the effects of a magnetic field are presented for the first time (to the best knowledge of author) while the non-dimensional slip coefficient are selected as B=0.01, 0.05, 0.1 at different states.

  6. Cerebral white matter fractional anisotropy and tract volume as measured by MR imaging are associated with impaired cognitive and motor function in pediatric posterior fossa tumor survivors. (United States)

    Rueckriegel, Stefan M; Bruhn, Harald; Thomale, Ulrich W; Hernáiz Driever, Pablo


    Disease and therapy cause brain damage and subsequent functional loss in pediatric patients with posterior fossa tumors. Treatment-related toxicity factors are resection in patients with pilocytic astrocytoma (PA) and, additionally, cranio-spinal irradiation together with chemotherapy in patients with medulloblastoma (MB). We tested whether damage to white matter (WM) as revealed by diffusion tensor MR imaging (DTI) correlated with specific cognitive and motor impairments in survivors of pediatric posterior fossa tumors. Eighteen MB (mean age ± SD, 15.2 ± 4.9 y) and 14 PA (12.6 ± 5.0 y) survivors were investigated with DTI on a 3-Tesla-MR system. We identified fractional anisotropy (FA) of WM, the volume ratio of WM to gray matter and cerebrospinal fluid (WM/GM + CSF), and volume of specific frontocerebellar tracts. Ataxia was assessed using the International Cooperative Ataxia Rating Scale (ICARS), while the Wechsler Intelligence Scale for Children determined full-scale intelligence quotients (FSIQ). Amsterdam Neuropsychological Tasks (ANT) was used to assess processing speed. Handwriting automation was analyzed using a digitizing graphic tablet. The WM/GM + CSF ratio correlated significantly with cognitive measures (IQ, P = 0.002; ANT baseline speed, P = 0.04; ANT shifting attention, P = 0.004). FA of skeletonized tracts correlated significantly with FSIQ (P = 0.008), ANT baseline speed (P = 0.028) and ANT shifting attention (P = 0.045). Moreover, frontocerebellar tract volumes correlated with both the FSIQ (P = 0.011) and ICARS (P = 0.007). DTI provides a method for quantification of WM damage by tumor and by therapy-associated effects in survivors of pediatric posterior fossa tumors. DTI-derived WM integrity may be a representative marker for cognitive and motor deterioration. © 2015 Wiley Periodicals, Inc.

  7. Granger causality and contiguity between stochastic processes

    Energy Technology Data Exchange (ETDEWEB)

    Triacca, Umberto [Universita di L' Aquila, Roio Poggio, I-67040 L' Aquila (Italy)]. E-mail:


    Although according to many econometricians the definition of causality proposed by Granger differs from other definitions of causation in the philosophy of science, in this Letter we argue that it is not completely lacking in philosophical legitimacy. We attempt to shed new light on the nexus between Granger causality and the concept of contiguity. In particular, we prove that the existence of a Granger causal link between two stochastic processes requires that these be 'contiguous' or that there exist a chain of processes, one contiguous to the next, which link the two processes.

  8. T2’-Imaging to Assess Cerebral Oxygen Extraction Fraction in Carotid Occlusive Disease: Influence of Cerebral Autoregulation and Cerebral Blood Volume (United States)

    Deichmann, Ralf; Pfeilschifter, Waltraud; Hattingen, Elke; Singer, Oliver C.; Wagner, Marlies


    Purpose Quantitative T2'-mapping detects regional changes of the relation of oxygenated and deoxygenated hemoglobin (Hb) by using their different magnetic properties in gradient echo imaging and might therefore be a surrogate marker of increased oxygen extraction fraction (OEF) in cerebral hypoperfusion. Since elevations of cerebral blood volume (CBV) with consecutive accumulation of Hb might also increase the fraction of deoxygenated Hb and, through this, decrease the T2’-values in these patients we evaluated the relationship between T2’-values and CBV in patients with unilateral high-grade large-artery stenosis. Materials and Methods Data from 16 patients (13 male, 3 female; mean age 53 years) with unilateral symptomatic or asymptomatic high-grade internal carotid artery (ICA) or middle cerebral artery (MCA) stenosis/occlusion were analyzed. MRI included perfusion-weighted imaging and high-resolution T2’-mapping. Representative relative (r)CBV-values were analyzed in areas of decreased T2’ with different degrees of perfusion delay and compared to corresponding contralateral areas. Results No significant elevations in cerebral rCBV were detected within areas with significantly decreased T2’-values. In contrast, rCBV was significantly decreased (pperfusion delay and decreased T2’. Furthermore, no significant correlation between T2’- and rCBV-values was found. Conclusions rCBV is not significantly increased in areas of decreased T2’ and in areas of restricted perfusion in patients with unilateral high-grade stenosis. Therefore, T2’ should only be influenced by changes of oxygen metabolism, regarding our patient collective especially by an increase of the OEF. T2’-mapping is suitable to detect altered oxygen consumption in chronic cerebrovascular disease. PMID:27560515

  9. Effects of Alloying Elements on the Volume Fraction of Ordered α2 Phase Precipitated in Ti-Al-Sn-Zr Alloys

    Institute of Scientific and Technical Information of China (English)

    Jun ZHANG; Na PENG; Xinan WANG; LI Li; Qingjiang WANG


    An ideal method has been established for calculating the precipitation of α2 ordered phase in near-α titanium alloys based on the theory on the critical electron concentration for the precipitation of α 2 ordered phase in near-α titanium alloys. With complete precipitation of α2 phase in near-α titanium alloys, the alloys can be considered to be composed of two parts: (1) the α2 ordered phase with the stoichiometric atomic ratio of Ti3X; (2) the disorder solid solution with the critical composition in which the α2 ordered phase is just unable to precipitate. By using this method, the volume fractions of α2 ordered phase precipitated in Ti-Al, Ti-Sn,Ti-Al-Sn-Zr alloys with various Al, Sn and/or Zr contents have been calculated. The influences of Al and Sn on the precipitation of α2 ordered phase are discussed. The calculating results show substantial agreement with the experimental ones.

  10. Native T1 Relaxation Time and Extracellular Volume Fraction as Accurate Markers of Diffuse Myocardial Fibrosis in Heart Valve Disease - Comparison With Targeted Left Ventricular Myocardial Biopsy. (United States)

    Kockova, Radka; Kacer, Petr; Pirk, Jan; Maly, Jiri; Sukupova, Lucie; Sikula, Viktor; Kotrc, Martin; Barciakova, Lucia; Honsova, Eva; Maly, Marek; Kautzner, Josef; Sedmera, David; Penicka, Martin


    The aim of our study was to investigate the relationship between the cardiac magnetic resonance (CMR)-derived native T1 relaxation time and myocardial extracellular volume (ECV) fraction and the extent of diffuse myocardial fibrosis (DMF) on targeted myocardial left ventricular (LV) biopsy. The study population consisted of 40 patients (age 63±8 years, 65% male) undergoing valve and/or ascending aorta surgery for severe aortic stenosis (77.5%), root dilatation (7.5%) or valve regurgitation (15%). The T1 relaxation time was assessed in the basal interventricular septum pre- and 10-min post-contrast administration using the modified Look-Locker Inversion recovery sequence prior to surgery. LV myocardial biopsy specimen was obtained during surgery from the basal interventricular septal segment matched with the T1 mapping assessment. The percentage of myocardial collagen was quantified using picrosirius red staining. The average percentage of myocardial collagen was 22.0±14.8%. Both native T1 relaxation time with cutoff value ≥1,010 ms (sensitivity=90%, specificity=73%, area under the curve=0.82) and ECV with cutoff value ≥0.32 (sensitivity=80%, specificity=90%, area under the curve=0.85) showed high accuracy to identify severe (>30%) DMF. The native T1 relaxation time showed significant correlation with LV mass (P<0.01). Native T1 relaxation time and ECV at 10 min after contrast administration are accurate markers of DMF. (Circ J 2016; 80: 1202-1209).

  11. Influence of the Metal Volume Fraction on the permanent dent depth and energy absorption of GLARE plates subjected to low velocity impact (United States)

    Bikakis, GSE; Savaidis, A.; Zalimidis, P.; Tsitos, S.


    Fiber-metal laminates are hybrid composite materials, consisting of alternating metal layers bonded to fiber-reinforced prepreg layers. GLARE (GLAss REinforced) belongs to this new family of materials. GLARE is the most successful fiber-metal laminate up to now and is currently being used for the construction of primary aerospace structures, such as the fuselage of the Airbus A380 air plane. Impact properties are very important in aerospace structures, since impact damage is caused by various sources, such as maintenance damage from dropped tools, collision between service cars or cargo and the structure, bird strikes and hail. The principal objective of this article is to evaluate the influence of the Metal Volume Fraction (MVF) on the low velocity impact response of GLARE fiber-metal laminates. Previously published differential equations of motion are employed for this purpose. The low velocity impact behavior of various circular GLARE plates is predicted and characteristic values of impact variables, which represent the impact phenomenon, are evaluated versus the corresponding MVF of the examined GLARE material grades. The considered GLARE plates are subjected to low velocity impact under identical impact conditions. A strong effect of the MVF on the maximum impact load and a significant effect on the maximum plate deflection of GLARE plates has been found.

  12. Influence of the Metal Volume Fraction on the maximum deflection and impact load of GLARE plates subjected to low velocity impact (United States)

    Bikakis, GSE; Savaidis, A.; Zalimidis, P.; Tsitos, S.


    Fiber-metal laminates are hybrid composite materials, consisting of alternating metal layers bonded to fiber-reinforced prepreg layers. GLARE (GLAss REinforced) belongs to this new family of materials. GLARE is the most successful fiber-metal laminate up to now and is currently being used for the construction of primary aerospace structures, such as the fuselage of the Airbus A380 air plane. Impact properties are very important in aerospace structures, since impact damage is caused by various sources, such as maintenance damage from dropped tools, collision between service cars or cargo and the structure, bird strikes and hail. The principal objective of this article is to evaluate the influence of the Metal Volume Fraction (MVF) on the low velocity impact response of GLARE fiber-metal laminates. Previously published differential equations of motion are employed for this purpose. The low velocity impact behavior of various circular GLARE plates is predicted and characteristic values of impact variables, which represent the impact phenomenon, are evaluated versus the corresponding MVF of the examined GLARE material grades. The considered GLARE plates are subjected to low velocity impact under identical impact conditions. A strong effect of the MVF on the maximum impact load and a significant effect on the maximum plate deflection of GLARE plates has been found.

  13. The Debye temperature of YBa sub 2 Cu sub 3 O sub 7-. delta. and its dependence on the volume fraction of superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, R.A.; Phillips, N.E. (Lawrence Berkeley Lab., CA (United States)); Gordon, J.E. (Lawrence Berkeley Lab., CA (United States) Amherst Coll., MA (United States). Dept. of Physics)


    Specific-heat measurements, on polycrystalline samples of YBa{sub 2}Cu{sub 3}O{sub 7-{delta}}, YBCO, have shown sample-to-sample variations in the volume fraction of superconductivity, f{sub s}, which is correlated with the concentration of Cu{sup 2+} magnetic moments in the YBCO lattice. At low temperatures the lattice specific heat also varies with f{sub s}, but these variations do not persist above {approximately}20K. The low-temperature data show that {Theta}{sub 0}{sup {minus}3} varies linearly with f{sub 3}, and give values of 520 and 390K for {Theta}{sub o} for fully-superconducting and fully-normal'' YBCO, respectively. These results suggest that the long wavelength phonon modes are altered when Cu{sup 2+} magnetic moments are present in the lattice. The fact that different samples have the same lattice specific heat at {approximately}20K and above T{sub c} indicates that the higher energy phonon modes are insensitive to these Cu{sup 2+} moments.

  14. The Debye temperature of YBa{sub 2}Cu{sub 3}O{sub 7-{delta}} and its dependence on the volume fraction of superconductivity

    Energy Technology Data Exchange (ETDEWEB)

    Fisher, R.A.; Phillips, N.E. [Lawrence Berkeley Lab., CA (United States); Gordon, J.E. [Lawrence Berkeley Lab., CA (United States)]|[Amherst Coll., MA (United States). Dept. of Physics


    Specific-heat measurements, on polycrystalline samples of YBa{sub 2}Cu{sub 3}O{sub 7-{delta}}, YBCO, have shown sample-to-sample variations in the volume fraction of superconductivity, f{sub s}, which is correlated with the concentration of Cu{sup 2+} magnetic moments in the YBCO lattice. At low temperatures the lattice specific heat also varies with f{sub s}, but these variations do not persist above {approximately}20K. The low-temperature data show that {Theta}{sub 0}{sup {minus}3} varies linearly with f{sub 3}, and give values of 520 and 390K for {Theta}{sub o} for fully-superconducting and ``fully-normal`` YBCO, respectively. These results suggest that the long wavelength phonon modes are altered when Cu{sup 2+} magnetic moments are present in the lattice. The fact that different samples have the same lattice specific heat at {approximately}20K and above T{sub c} indicates that the higher energy phonon modes are insensitive to these Cu{sup 2+} moments.

  15. Large-scale three-dimensional phase-field simulations for phase coarsening at ultrahigh volume fraction on high-performance architectures (United States)

    Yan, Hui; Wang, K. G.; Jones, Jim E.


    A parallel algorithm for large-scale three-dimensional phase-field simulations of phase coarsening is developed and implemented on high-performance architectures. From the large-scale simulations, a new kinetics in phase coarsening in the region of ultrahigh volume fraction is found. The parallel implementation is capable of harnessing the greater computer power available from high-performance architectures. The parallelized code enables increase in three-dimensional simulation system size up to a 5123 grid cube. Through the parallelized code, practical runtime can be achieved for three-dimensional large-scale simulations, and the statistical significance of the results from these high resolution parallel simulations are greatly improved over those obtainable from serial simulations. A detailed performance analysis on speed-up and scalability is presented, showing good scalability which improves with increasing problem size. In addition, a model for prediction of runtime is developed, which shows a good agreement with actual run time from numerical tests.

  16. Validation of Blood Volume Fraction Quantification with 3D Gradient Echo Dynamic Contrast-Enhanced Magnetic Resonance Imaging in Porcine Skeletal Muscle. (United States)

    Hindel, Stefan; Söhner, Anika; Maaß, Marc; Sauerwein, Wolfgang; Möllmann, Dorothe; Baba, Hideo Andreas; Kramer, Martin; Lüdemann, Lutz


    The purpose of this study was to assess the accuracy of fractional blood volume (vb) estimates in low-perfused and low-vascularized tissue using dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). The results of different MRI methods were compared with histology to evaluate the accuracy of these methods under clinical conditions. vb was estimated by DCE-MRI using a 3D gradient echo sequence with k-space undersampling in five muscle groups in the hind leg of 9 female pigs. Two gadolinium-based contrast agents (CA) were used: a rapidly extravasating, extracellular, gadolinium-based, low-molecular-weight contrast agent (LMCA, gadoterate meglumine) and an extracellular, gadolinium-based, albumin-binding, slowly extravasating blood pool contrast agent (BPCA, gadofosveset trisodium). LMCA data were evaluated using the extended Tofts model (ETM) and the two-compartment exchange model (2CXM). The images acquired with administration of the BPCA were used to evaluate the accuracy of vb estimation with a bolus deconvolution technique (BD) and a method we call equilibrium MRI (EqMRI). The latter calculates the ratio of the magnitude of the relaxation rate change in the tissue curve at an approximate equilibrium state to the height of the same area of the arterial input function (AIF). Immunohistochemical staining with isolectin was used to label endothelium. A light microscope was used to estimate the fractional vascular area by relating the vascular region to the total tissue region (immunohistochemical vessel staining, IHVS). In addition, the percentage fraction of vascular volume was determined by multiplying the microvascular density (MVD) with the average estimated capillary lumen, [Formula: see text], where d = 8μm is the assumed capillary diameter (microvascular density estimation, MVDE). Except for ETM values, highly significant correlations were found between most of the MRI methods investigated. In the cranial thigh, for example, the vb medians

  17. Validation of Blood Volume Fraction Quantification with 3D Gradient Echo Dynamic Contrast-Enhanced Magnetic Resonance Imaging in Porcine Skeletal Muscle (United States)

    Söhner, Anika; Maaß, Marc; Sauerwein, Wolfgang; Möllmann, Dorothe; Baba, Hideo Andreas; Kramer, Martin; Lüdemann, Lutz


    The purpose of this study was to assess the accuracy of fractional blood volume (vb) estimates in low-perfused and low-vascularized tissue using dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). The results of different MRI methods were compared with histology to evaluate the accuracy of these methods under clinical conditions. vb was estimated by DCE-MRI using a 3D gradient echo sequence with k-space undersampling in five muscle groups in the hind leg of 9 female pigs. Two gadolinium-based contrast agents (CA) were used: a rapidly extravasating, extracellular, gadolinium-based, low-molecular-weight contrast agent (LMCA, gadoterate meglumine) and an extracellular, gadolinium-based, albumin-binding, slowly extravasating blood pool contrast agent (BPCA, gadofosveset trisodium). LMCA data were evaluated using the extended Tofts model (ETM) and the two-compartment exchange model (2CXM). The images acquired with administration of the BPCA were used to evaluate the accuracy of vb estimation with a bolus deconvolution technique (BD) and a method we call equilibrium MRI (EqMRI). The latter calculates the ratio of the magnitude of the relaxation rate change in the tissue curve at an approximate equilibrium state to the height of the same area of the arterial input function (AIF). Immunohistochemical staining with isolectin was used to label endothelium. A light microscope was used to estimate the fractional vascular area by relating the vascular region to the total tissue region (immunohistochemical vessel staining, IHVS). In addition, the percentage fraction of vascular volume was determined by multiplying the microvascular density (MVD) with the average estimated capillary lumen, π(d2)2, where d = 8μm is the assumed capillary diameter (microvascular density estimation, MVDE). Except for ETM values, highly significant correlations were found between most of the MRI methods investigated. In the cranial thigh, for example, the vb medians (interquartile range

  18. Correction to "What is a fractional derivative?" by Ortigueira and Machado [Journal of Computational Physics, Volume 293, 15 July 2015, Pages 4-13. Special issue on Fractional PDEs (United States)

    Katugampola, Udita N.


    There is a debate among contemporary mathematicians about what it really means by a fractional derivative. The question arose as a consequence of introducing a 'new' definition of a fractional derivative in [1]. In a reply, Ortigueira and Machado [2] came up with several very important criteria to determine whether a given derivative is a fractional derivative. According to their criterion, the new fractional derivative, called conformable fractional derivative, introduced by Khalil et al. [1] turns out not to be a fractional derivative, but rather a controlled or conformable derivative. In proving the claim the authors in [2] use an example [2, p. 6]. It turns out that the explanation given there needs some corrections and it is the sole purpose of this note.

  19. Assessment of changes in vascularity and blood volume in canine sarcomas and squamous cell carcinomas during fractionated radiation therapy using quantified contrast-enhanced power Doppler ultrasonography: a preliminary study. (United States)

    Ohlerth, Stefanie; Bley, Carla Rohrer; Laluhová, Dagmar; Roos, Malgorzata; Kaser-Hotz, Barbara


    Radiation therapy does not only target tumour cells but also affects tumour vascularity. In the present study, changes in tumour vascularity and blood volume were investigated in five grade 1 oral fibrosarcomas, eight other sarcomas (non-oral soft tissue and bone sarcomas) and 12 squamous cell carcinomas in dogs during fractionated radiation therapy (total dose, 45-56 Gy). Contrast-enhanced power Doppler ultrasound was performed before fraction 1, 3, 6, 8, 10, 12, 14 and 15 or 16 (sarcomas) or 17 (squamous cell carcinomas). Prior to treatment, median vascularity and blood volume were significantly higher in squamous cell carcinomas (P=0.0005 and 0.001), whereas measurements did not differ between oral fibrosarcomas and other sarcomas (P=0.88 and 0.999). During the course of radiation therapy, only small, non-significant changes in vascularity and blood volume were observed in all three tumour histology groups (P=0.08 and P=0.213), whereas median tumour volume significantly decreased until the end of treatment (P=0.04 for fibrosarcomas and other sarcomas, P=0.008 for squamous cell carcinomas). It appeared that there was a proportional decrease in tumour volume, vascularity and blood volume. Doppler measurements did not predict progression free interval or survival in any of the three tumour groups (P=0.06-0.86). However, the number of tumours investigated was small and therefore, the results can only be considered preliminary.

  20. Impact of the target volume (prostate alone vs. prostate with seminal vesicles) and fraction dose (1.8 Gy vs. 2.0 Gy) on quality of life changes after external-beam radiotherapy for prostate cancer

    Energy Technology Data Exchange (ETDEWEB)

    Eble, Michael J. [Dept. of Radiotherapy, RWTH Aachen (Germany); Pinkawa, Michael; Piroth, Marc D.; Fischedick, Karin; Holy, Richard; Klotz, Jens; Nussen, Sandra; Krenkel, Barbara


    Purpose: to evaluate the impact of the clinical target volume (CTV) and fraction dose on quality of life (QoL) after external-beam radiotherapy (EBRT) for prostate cancer. Patients and methods: a group of 283 patients has been surveyed prospectively before, at the last day, at a median time of 2 months and 15 months after EBRT (70.2-72 Gy) using a validated questionnaire (Expanded Prostate Cancer Index Composite). FBRT of prostate alone (P, n = 70) versus prostate with seminal vesicles (PS, n = 213) was compared. Differences of fraction doses (1.8 Gy, n = 80, vs. 2.0 Gy, n = 69) have been evaluated in the patient group receiving a total dose of 72 Gy. Results: significantly higher bladder and rectum volumes were found at all dose levels for the patients with PS versus P within the CTV (p < 0.001). Similar volumes resulted in the groups with different fraction doses. Paradoxically, bowel function scores decreased significantly less 2 and 15 months after EBRT of PS versus P. 2 months after EBRT, patients with a fraction dose of 2.0 Gy versus 1.8 Gy reported pain with urination ({>=} once a day in 12% vs. 3%; p = 0.04) and painful bowel movements ({>=} rarely in 46% vs. 29%; p = 0.05) more frequently. No long-term differences were found. Conclusion: the risk of adverse QoL changes after EBRT for prostate cancer cannot be derived from the dose-volume histogram alone. Seminal vesicles can be included in the CTV up to a moderate total dose without adverse effects on QoL. Apart from a longer recovery period, higher fraction doses were not associated with higher toxicity. (orig.)

  1. A Causal Contiguity Effect That Persists across Time Scales (United States)

    Kilic, Asli; Criss, Amy H.; Howard, Marc W.


    The contiguity effect refers to the tendency to recall an item from nearby study positions of the just recalled item. Causal models of contiguity suggest that recalled items are used as probes, causing a change in the memory state for subsequent recall attempts. Noncausal models of the contiguity effect assume the memory state is unaffected by…

  2. 46 CFR 154.172 - Contiguous steel hull structure. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous steel hull structure. 154.172 Section 154.172... Structure § 154.172 Contiguous steel hull structure. (a) Except as allowed in paragraphs (b) and (c) of this... construction of the contiguous steel hull structure must meet the thickness and steel grade in Table 1 for...

  3. Determination of volume fraction in biphasic flows oil-gas and water-gas using artificial neural network and gamma densitometry; Determinacao de fracoes de volume em fluxos bifasicos oleo-gas e agua-gas utilizando redes neurais artificiais e densitometria gama

    Energy Technology Data Exchange (ETDEWEB)

    Peixoto, Philippe Netto Belache


    This study presents a methodology based on the principles of gamma ray attenuation to identify volume fractions in biphasic systems composed of oil-gas-water and gas which are found in the offshore oil industry. This methodology is based on the acknowledgment counts per second on the photopeak energy using a detection system composed of a NaI (Tl) detector, a source of {sup 137}Cs without collimation positioned at 180 ° relative to the detector on a smooth stratified flow regime. The mathematical modeling for computational simulation using the code MCNP-X was performed using the experimental measurements of the detector characteristics (energy resolution and efficiency), characteristics of the material water and oil (density and coefficient attenuation) and measurement of the volume fractions. To predict these fractions were used artificial neural networks (ANNs), and to obtain an adequate training the ANNs for the prediction of volume fractions were simulated a larger number of volume fractions in MCNP-X. The experimental data were used in the set data necessary for validation of ANNs and the data generated using the computer code MCNP-X were used in training and test sets of the ANNs. Were used ANNs of type feed-forward Multilayer Perceptron (MLP) and analyzed two functions of training, Levenberg-Marquardt (LM) and gradient descent with momentum (GDM), both using the Backpropagation training algorithm. The ANNs identified correctly the volume fractions of the multiphase system with mean relative errors lower than 1.21 %, enabling the application of this methodology for this purpose. (author)

  4. Measuring of Volume Fraction for SiC Particles in SiCP/Al Composite%SiC颗粒增强铝基复合材料中SiC颗粒体积分数的测定

    Institute of Scientific and Technical Information of China (English)

    木二珍; 李强


    利用金相法和XRD定量分析法对SiC颗粒增强铝基复合材料的SiC颗粒体积分数进行测定.用定量金相法测得SiC增强铝基复合材料SiC颗粒的体积分数为58.6%,用XRD定量分析法测得的体积分数为62.7%.%The volume fraction for SiC particle was measured by metallographic method and XRD quantitative analysis.The volume fraction for SiC particles is 56.1% for metallographic method and 62.7% for XRD quantitative analysis.

  5. Myocardial Extracellular Volume Fraction with Dual-Energy Equilibrium Contrast-enhanced Cardiac CT in Nonischemic Cardiomyopathy: A Prospective Comparison with Cardiac MR Imaging. (United States)

    Lee, Hye-Jeong; Im, Dong Jin; Youn, Jong-Chan; Chang, Suyon; Suh, Young Joo; Hong, Yoo Jin; Kim, Young Jin; Hur, Jin; Choi, Byoung Wook


    Purpose To evaluate the feasibility of equilibrium contrast material-enhanced dual-energy cardiac computed tomography (CT) to determine extracellular volume fraction (ECV) in nonischemic cardiomyopathy (CMP) compared with magnetic resonance (MR) imaging. Materials and Methods This study was approved by the institutional review board; informed consent was obtained. Seven healthy subjects and 23 patients (six with hypertrophic CMP, nine with dilated CMP, four with amyloidosis, and four with sarcoidosis) (mean age ± standard deviation, 57.33 years ± 14.82; 19 male participants [63.3%]) were prospectively enrolled. Twelve minutes after contrast material injection (1.8 mL/kg at 3 mL/sec), dual-energy cardiac CT was performed. ECV was measured by two observers independently. Hematocrit levels were compared between healthy subjects and patients with the Mann-Whitney U test. In per-subject analysis, interobserver agreement for CT was assessed with the intraclass correlation coefficient (ICC), and intertest agreement between MR imaging and CT was assessed with Bland-Altman analysis. In per-segment analysis, Student t tests in the linear mixed model were used to compare ECV on CT images between healthy subjects and patients. Results Hematocrit level was 43.44% ± 1.80 for healthy subjects and 41.23% ± 5.61 for patients with MR imaging (P = .16) and 43.50% ± 1.92 for healthy subjects and 41.35% ± 5.92 for patients with CT (P = .15). For observer 1 in per-subject analysis, ECV was 34.18% ± 8.98 for MR imaging and 34.48% ± 8.97 for CT. For observer 2, myocardial ECV was 34.42% ± 9.03 for MR imaging and 33.98% ± 9.05 for CT. Interobserver agreement for ECV at CT was excellent (ICC = 0.987). Bland-Altman analysis between MR imaging and CT showed a small bias (-0.06%), with 95% limits of agreement of -1.19 and 1.79. Compared with healthy subjects, patients with hypertrophic CMP, dilated CMP, amyloidosis, and sarcoidosis had significantly higher myocardial ECV at dual

  6. Influence of T-semi attached rib on turbulent flow and heat transfer parameters of a silver-water nanofluid with different volume fractions in a three-dimensional trapezoidal microchannel (United States)

    Alipour, Habibollah; Karimipour, Arash; Safaei, Mohammad Reza; Semiromi, Davood Toghraie; Akbari, Omid Ali


    This study aimed at exploring influence of T-semi attached rib on the turbulent flow and heat transfer parameters of a silver-water nanofluid with different volume fractions in a three-dimensional trapezoidal microchannel. For this purpose, convection heat transfer of the silver-water nanofluid in a ribbed microchannel was numerically studied under a constant heat flux on upper and lower walls as well as isolated side walls. Calculations were done for a range of Reynolds numbers between 10,000 and 16,000, and in four different sorts of serrations with proportion of rib width to hole of serration width (R/W). The results of this research are presented as the coefficient of friction, Nusselt number, heat transfer coefficient and thermal efficiency, four different R/W microchannels. The results of numerical modeling showed that the fluid's convection heat transfer coefficient is increased as the Reynolds number and volume fraction of solid nanoparticle are increased. For R/W=0.5, it was also maximum for all the volume fractions of nanoparticle and different Reynolds numbers in comparison to other similar R/W situations. That's while friction coefficient, pressure drop and pumping power is maximum for serration with R/W=0 compared to other serration ratios which lead to decreased fluid-heat transfer performance.

  7. Fetal cardiac ventricular volume, cardiac output, and ejection fraction determined with four-dimensional ultrasound using Spatio-Temporal Image Correlation (STIC) and Virtual Organ Computed-aided AnaLysis (VOCAL™) (United States)

    Hamill, Neil; Yeo, Lami; Romero, Roberto; Hassan, Sonia S.; Myers, Stephen A.; Mittal, Pooja; Kusanovic, Juan Pedro; Balasubramaniam, Mamtha; Chaiworapongsa, Tinnakorn; Vaisbuch, Edi; Espinoza, Jimmy; Gotsch, Francesca; Goncalves, Luis F.; Lee, Wesley


    Objective To quantify fetal cardiovascular parameters with Spatio-Temporal Image Correlation (STIC) and Virtual Organ Computed-aided AnaLysis (VOCAL™) utilizing the sub-feature: “Contour Finder: Trace”. Study Design A cross-sectional study was designed consisting of patients with normal pregnancies between 19 and 40 weeks of gestation. After STIC datasets were acquired, analysis was performed offline (4DView) and the following cardiovascular parameters were evaluated: ventricular volume in end systole and end diastole, stroke volume, cardiac output, and ejection fraction. To account for fetal size, cardiac output was also expressed as a function of head circumference, abdominal circumference, or femoral diaphysis length. Regression models were fitted for each cardiovascular parameter to assess the effect of gestational age and paired comparisons were made between the left and right ventricles. Results 1) Two hundred and seventeen patients were retrospectively identified, of whom 184 had adequate STIC datasets (85% acceptance); 2) ventricular volume, stroke volume, cardiac output, and adjusted cardiac output increased with gestational age; whereas, the ejection fraction decreased as gestation advanced; 3) the right ventricle was larger than the left in both systole (Right: 0.50 ml, IQR: 0.2 – 0.9; vs. Left: 0.27 ml, IQR: 0.1 – 0.5; p<0.001) and diastole (Right: 1.20 ml, IQR: 0.7 – 2.2; vs. Left: 1.03 ml, IQR: 0.5 – 1.7; p<0.001); 4) there were no differences between the left and right ventricle with respect to stroke volume, cardiac output, or adjusted cardiac output; and 5) the left ventricular ejection fraction was greater than the right (Left: 72.2%, IQR: 64 – 78; vs. Right: 62.4%, IQR: 56 – 69; p<0.001). Conclusion Fetal echocardiography, utilizing STIC and VOCAL™ with the sub-feature: “Contour Finder: Trace”, allows assessment of fetal cardiovascular parameters. Normal fetal cardiovascular physiology is characterized by ventricular

  8. On Coding Non-Contiguous Letter Combinations

    Directory of Open Access Journals (Sweden)

    Frédéric eDandurand


    Full Text Available Starting from the hypothesis that printed word identification initially involves the parallel mapping of visual features onto location-specific letter identities, we analyze the type of information that would be involved in optimally mapping this location-specific orthographic code onto a location-invariant lexical code. We assume that some intermediate level of coding exists between individual letters and whole words, and that this involves the representation of letter combinations. We then investigate the nature of this intermediate level of coding given the constraints of optimality. This intermediate level of coding is expected to compress data while retaining as much information as possible about word identity. Information conveyed by letters is a function of how much they constrain word identity and how visible they are. Optimization of this coding is a combination of minimizing resources (using the most compact representations and maximizing information. We show that in a large proportion of cases, non-contiguous letter sequences contain more information than contiguous sequences, while at the same time requiring less precise coding. Moreover, we found that the best predictor of human performance in orthographic priming experiments was within-word ranking of conditional probabilities, rather than average conditional probabilities. We conclude that from an optimality perspective, readers learn to select certain contiguous and non-contiguous letter combinations as information that provides the best cue to word identity.

  9. A method to estimate the fractional fat volume within a ROI of a breast biopsy for WAXS applications: Animal tissue evaluation

    Energy Technology Data Exchange (ETDEWEB)

    Tang, Robert Y., E-mail: [Biomolecular Sciences Program, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6 (Canada); McDonald, Nancy, E-mail:; Laamanen, Curtis, E-mail: [Department of Physics, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6 (Canada); LeClair, Robert J., E-mail: [Department of Physics, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6, Canada and Biomolecular Sciences Program, Laurentian University, 935 Ramsey Lake Road, Sudbury, Ontario P3E 2C6 (Canada)


    Purpose: To develop a method to estimate the mean fractional volume of fat (ν{sup ¯}{sub fat}) within a region of interest (ROI) of a tissue sample for wide-angle x-ray scatter (WAXS) applications. A scatter signal from the ROI was obtained and use of ν{sup ¯}{sub fat} in a WAXS fat subtraction model provided a way to estimate the differential linear scattering coefficient μ{sub s} of the remaining fatless tissue. Methods: The efficacy of the method was tested using animal tissue from a local butcher shop. Formalin fixed samples, 5 mm in diameter 4 mm thick, were prepared. The two main tissue types were fat and meat (fibrous). Pure as well as composite samples consisting of a mixture of the two tissue types were analyzed. For the latter samples, ν{sub fat} for the tissue columns of interest were extracted from corresponding pixels in CCD digital x-ray images using a calibration curve. The means ν{sup ¯}{sub fat} were then calculated for use in a WAXS fat subtraction model. For the WAXS measurements, the samples were interrogated with a 2.7 mm diameter 50 kV beam and the 6° scattered photons were detected with a CdTe detector subtending a solid angle of 7.75 × 10{sup −5} sr. Using the scatter spectrum, an estimate of the incident spectrum, and a scatter model, μ{sub s} was determined for the tissue in the ROI. For the composite samples, a WAXS fat subtraction model was used to estimate the μ{sub s} of the fibrous tissue in the ROI. This signal was compared to μ{sub s} of fibrous tissue obtained using a pure fibrous sample. Results: For chicken and beef composites, ν{sup ¯}{sub fat}=0.33±0.05 and 0.32 ± 0.05, respectively. The subtractions of these fat components from the WAXS composite signals provided estimates of μ{sub s} for chicken and beef fibrous tissue. The differences between the estimates and μ{sub s} of fibrous obtained with a pure sample were calculated as a function of the momentum transfer x. A t-test showed that the mean of the

  10. A method to estimate the fractional fat volume within a ROI of a breast biopsy for WAXS applications: animal tissue evaluation. (United States)

    Tang, Robert Y; McDonald, Nancy; Laamanen, Curtis; LeClair, Robert J


    To develop a method to estimate the mean fractional volume of fat (ν¯fat) within a region of interest (ROI) of a tissue sample for wide-angle x-ray scatter (WAXS) applications. A scatter signal from the ROI was obtained and use of ν¯fat in a WAXS fat subtraction model provided a way to estimate the differential linear scattering coefficient μs of the remaining fatless tissue. The efficacy of the method was tested using animal tissue from a local butcher shop. Formalin fixed samples, 5 mm in diameter 4 mm thick, were prepared. The two main tissue types were fat and meat (fibrous). Pure as well as composite samples consisting of a mixture of the two tissue types were analyzed. For the latter samples, νfat for the tissue columns of interest were extracted from corresponding pixels in CCD digital x-ray images using a calibration curve. The means ν¯fat were then calculated for use in a WAXS fat subtraction model. For the WAXS measurements, the samples were interrogated with a 2.7 mm diameter 50 kV beam and the 6° scattered photons were detected with a CdTe detector subtending a solid angle of 7.75 × 10(-5) sr. Using the scatter spectrum, an estimate of the incident spectrum, and a scatter model, μs was determined for the tissue in the ROI. For the composite samples, a WAXS fat subtraction model was used to estimate the μs of the fibrous tissue in the ROI. This signal was compared to μs of fibrous tissue obtained using a pure fibrous sample. For chicken and beef composites, ν¯fat=0.33±0.05 and 0.32 ± 0.05, respectively. The subtractions of these fat components from the WAXS composite signals provided estimates of μs for chicken and beef fibrous tissue. The differences between the estimates and μs of fibrous obtained with a pure sample were calculated as a function of the momentum transfer x. A t-test showed that the mean of the differences did not vary from zero in a statistically significant way thereby validating the methods. The methodology to

  11. Automated quantification of aortic regurgitant volume and regurgitant fraction using the digital colour Doppler velocity profile integration method in patients with aortic regurgitation


    Miyake, Y.; Hozumi, T; Mori, I.; Sugioka, K; Yamamuro, A; Akasaka, T; Homma, S; Yoshida, K.; Yoshikawa, J


    Background: The recently introduced automated cardiac flow measurement (ACM) technique provides a quick and an accurate automated calculation of stroke volume and cardiac output. This is obtained by spatio-temporal integration of digital Doppler velocity profile data.

  12. 含掺合料混凝土水化产物体积分数计算及其影响因素%Calculation of concrete with mineral admixture hydration products volume fraction and its influential factors

    Institute of Scientific and Technical Information of China (English)

    吴福飞; 董双快; 宫经伟; 陈亮亮; 李东生; 侍克斌


    Powers theory proposes calculation method for the pure volume of cement hydration products, which does not apply to calculate the volume of cementitious materials with mineral admixture. The formula of cementitious materials volume was proposed that based on the basic principles of cement and mineral admixture hydration, and the proposed method of reliability was verified by the results of Powers theoretical model and volume fraction of cement hydration products. On this basis, the factor such as water-cement ratio, the ratio of admixture and types was further researched for the volumes of cementitious materials hydration products. Mixture in test were designed 2 water-cement ratio (0.30 and 0.40, respectively), two content (20% and 60%, respectively) of mineral admixture, and 3 kinds of mineral admixture (lithium slag, fly ash and steel slag, respectively), forming paste that was stirred according with the designed ratio in 5 mL centrifuge tube in a blender and curing to 1, 7, 14, 28, 60 and 90 d in curing room (temperature was (20±1)℃, humidity was not less than 95%), and then testing reaction extent of cement and mineral admixture (such as fly ash, steel slag. lithium slag) according with the chemical bound water and HCl dissolution method. The results showed that hydration extent of lithium slag, fly ash and steel slag at 28d decreased by 46.63%, 69.56% and 74.82% (P<0.05) when mineral admixture content varied from 20% to 60% and water-cement ratio was 0.30. Hydration extent of cement at 28 d was increased by 7.25% when water-cement ratio increased from 0.30 to 0.40. When mineral admixture content varied from 20% to 60%, hydration extent of lithium slag, fly ash and steel slag at 28 d increased by 24.14% 18.56%, 17.61% and 8.84%, 12.21%, and 29.37% (P<0.05), respectively. In contrast, the influence of the mineral admixture content was bigger than water-cement ratio for the hydration extent of composite cementitious materials. In different water-cement ratio

  13. Shaping of the axial power density distribution in the core to minimize the vapor volume fraction at the outlet of the VVER-1200 fuel assemblies (United States)

    Savander, V. I.; Shumskiy, B. E.; Pinegin, A. A.


    The possibility of decreasing the vapor fraction at the VVER-1200 fuel assembly outlet by shaping the axial power density field is considered. The power density field was shaped by axial redistribution of the concentration of the burnable gadolinium poison in the Gd-containing fuel rods. The mathematical modeling of the VVER-1200 core was performed using the NOSTRA computer code.

  14. Fractional Echoes

    CERN Document Server

    Karras, G; Billard, F; Lavorel, B; Siour, G; Hartmann, J -M; Faucher, O; Gershnabel, Erez; Prior, Yehiam; Averbukh, Ilya Sh


    We report the observation of fractional echoes in a double-pulse excited nonlinear system. Unlike standard echoes which appear periodically at delays which are integer multiple of the delay between the two exciting pulses, the fractional echoes appear at rational fractions of this delay. We discuss the mechanism leading to this phenomenon, and provide the first experimental demonstration of fractional echoes by measuring third harmonic generation in a thermal gas of CO2 molecules excited by a pair of femtosecond laser pulses.



    Maria Klimikova


    Understanding the reasons of the present financial problems lies In understanding the substance of fractional reserve banking. The substance of fractional banking is in lending more money than the bankers have. Banking of partial reserves is an alternative form which links deposit banking and credit banking. Fractional banking is causing many unfavorable economic impacts in the worldwide system, specifically an inflation.



    Maria Klimikova


    Understanding the reasons of the present financial problems lies In understanding the substance of fractional reserve banking. The substance of fractional banking is in lending more money than the bankers have. Banking of partial reserves is an alternative form which links deposit banking and credit banking. Fractional banking is causing many unfavorable economic impacts in the worldwide system, specifically an inflation.

  17. Fractional randomness (United States)

    Tapiero, Charles S.; Vallois, Pierre


    The premise of this paper is that a fractional probability distribution is based on fractional operators and the fractional (Hurst) index used that alters the classical setting of random variables. For example, a random variable defined by its density function might not have a fractional density function defined in its conventional sense. Practically, it implies that a distribution's granularity defined by a fractional kernel may have properties that differ due to the fractional index used and the fractional calculus applied to define it. The purpose of this paper is to consider an application of fractional calculus to define the fractional density function of a random variable. In addition, we provide and prove a number of results, defining the functional forms of these distributions as well as their existence. In particular, we define fractional probability distributions for increasing and decreasing functions that are right continuous. Examples are used to motivate the usefulness of a statistical approach to fractional calculus and its application to economic and financial problems. In conclusion, this paper is a preliminary attempt to construct statistical fractional models. Due to the breadth and the extent of such problems, this paper may be considered as an initial attempt to do so.

  18. 导流介质对VARTM复合材料纤维分布及空隙率的影响%Effects of Infusion Media on Fiber Volume Fraction Distribution and Void Content in Vacuum Assisted Resin Transfer Molding

    Institute of Scientific and Technical Information of China (English)

    赖家美; 陈显明; 王德盼; 鄢冬冬; 王科


    Effects of the size of infusion media on resin flow behavior,fiber volume fraction distribution and void content in vacuum assisted resin transfer molding(VARTM) were studied.The results showed that with the increase of infusion media size, the resin flow rate increased exponentially;the fiber volume fraction showed a tendency to increase after the first decrease,and the infusion media boundary was just the high and low fiber volume fraction line;the void content increased first and then decreased and increased tremendously at last,varied from 3.86% to 19.92%.%研究了导流介质尺寸对真空辅助树脂传递模塑(VARTM)工艺中树脂流动行为的影响,以及对复合材料制品中纤维分布和空隙率的影响。结果表明,随着导流介质尺寸的增加,树脂在增强体中的流动速度加快,并呈现指数加速趋势;制品中纤维体积含量呈现先减少后增大的趋势,并且以导流介质边界为纤维体积含量高低的分界线;复合材料制品的空隙率范围在3.86%~19.92%,空隙率呈现先增大后减小再加速增大的趋势。

  19. 钢纤维掺量对活性粉末混凝土力学性能的影响%On the Influence of Steel Fiber Volume Fraction on Mechanical Properties of Reactive Powder Concrete

    Institute of Scientific and Technical Information of China (English)

    鞠彦忠; 王德弘; 李秋晨; 贾玉琢; 肖琦


    Basic mechanical properties such as compressive strength, splitting tensile strength and flexural strength of reactive powder concrete were experimentally investigated.The influence of steel fiber volume fraction on mechanical properties of RPC was analyzed.A fitted relation expression between flexural strength and splitting tensile strength was obtained.A mathematical expression for compressive stress-strain curve of reactive powder concrete was established for different steel fiber volume fractions based on experimental analysis.Results show that compressive strength, splitting tensile strength and flexural strength of reactive powder concrete specimens increase along with the steel fiber content increase when the steel fiber volume fraction is in the range from 1.0 % to 3.5 %.When the steel fiber volume fraction is higher than 3.5%, its compressive strength decreases, the splitting tensile strength increases slightly, however, its flexural strength increases obviously.%通过实验研究了活性粉末混凝土的基本力学性能(杭压强度、劈拉强度和杭折强度),分析了钢纤维掺量对活性粉末混凝土力学性能的影响,拟合得到了杭折强度与劈拉强度之间的关系表达式.在实验分析的基础上,建立了不同钢纤维体积含量活性粉末混凝土受压应力-应变全曲线的数学表达式.研究结果表明:钢纤维体积含量在1.0%~3.5%之间时,活性粉末混凝土的抗压强度、臂拉强度和抗折强度均随着钢纤维掺量的增加而增大;当钢纤维体积含量超过3.5%后,活性粉末混凝土杭压强度下降,臂拉强度略有提高,而杭折强度仍有明显的提高.

  20. Mean nuclear volume

    DEFF Research Database (Denmark)

    Mogensen, O.; Sørensen, Flemming Brandt; Bichel, P.


    We evaluated the following nine parameters with respect to their prognostic value in females with endometrial cancer: four stereologic parameters [mean nuclear volume (MNV), nuclear volume fraction, nuclear index and mitotic index], the immunohistochemical expression of cancer antigen (CA125...

  1. Fractional thermoelasticity

    CERN Document Server

    Povstenko, Yuriy


    This book is devoted to fractional thermoelasticity, i.e. thermoelasticity based on the heat conduction equation with differential operators of fractional order. Readers will discover how time-fractional differential operators describe memory effects and space-fractional differential operators deal with the long-range interaction. Fractional calculus, generalized Fourier law, axisymmetric and central symmetric problems and many relevant equations are featured in the book. The latest developments in the field are included and the reader is brought up to date with current research.  The book contains a large number of figures, to show the characteristic features of temperature and stress distributions and to represent the whole spectrum of order of fractional operators.  This work presents a picture of the state-of-the-art of fractional thermoelasticity and is suitable for specialists in applied mathematics, physics, geophysics, elasticity, thermoelasticity and engineering sciences. Corresponding sections of ...

  2. Results of volume-staged fractionated Gamma Knife radiosurgery for large complex arteriovenous malformations: obliteration rates and clinical outcomes of an evolving treatment paradigm. (United States)

    Franzin, Alberto; Panni, Pietro; Spatola, Giorgio; Vecchio, Antonella Del; Gallotti, Alberto L; Gigliotti, Carmen R; Cavalli, Andrea; Donofrio, Carmine A; Mortini, Pietro


    OBJECTIVE There are few reported series regarding volume-staged Gamma Knife radiosurgery (GKRS) for the treatment of large, complex, cerebral arteriovenous malformations (AVMs). The object of this study was to report the results of using volume-staged Gamma Knife radiosurgery for patients affected by large and complex AVMs. METHODS Data from 20 patients with large AVMs were prospectively included in the authors' AVM database between 2004 and 2012. A staging strategy was used when treating lesion volumes larger than 10 cm(3). Hemorrhage and seizures were the presenting clinical feature for 6 (30%) and 8 (40%) patients, respectively. The median AVM volume was 15.9 cm(3) (range 10.1-34.3 cm(3)). The mean interval between stages (± standard deviation) was 15 months (± 9 months). The median margin dose for each stage was 20 Gy (range 18-25 Gy). RESULTS Obliteration was confirmed in 8 (42%) patients after a mean follow-up of 45 months (range 19-87 months). A significant reduction (> 75%) of the original nidal volume was achieved in 4 (20%) patients. Engel Class I-II seizure status was reported by 75% of patients presenting with seizures (50% Engel Class I and 25% Engel Class II) after radiosurgery. After radiosurgery, 71.5% (5/7) of patients who had presented with a worsening neurological deficit reported a complete resolution or amelioration. None of the patients who presented acutely because of hemorrhage experienced a new bleeding episode during follow-up. One (5%) patient developed radionecrosis that caused sensorimotor hemisyndrome. Two (10%) patients sustained a bleeding episode after GKRS, although only 1 (5%) was symptomatic. High nidal flow rate and a time interval between stages of less than 11.7 months were factors significantly associated with AVM obliteration (p = 0.021 and p = 0.041, respectively). Patient age younger than 44 years was significantly associated with a greater than 75% reduction in AVM volume but not with AVM obliteration (p = 0

  3. 46 CFR 154.178 - Contiguous hull structure: Heating system. (United States)


    ... 46 Shipping 5 2010-10-01 2010-10-01 false Contiguous hull structure: Heating system. 154.178... Equipment Hull Structure § 154.178 Contiguous hull structure: Heating system. The heating system for... the heating capacity to meet § 154.174(b)(2) or § 154.176(b)(2); (b) Have stand-by heating to...

  4. Ethanol-gasoline volume fraction estimation of vehicles%车用乙醇汽油体积分数估计

    Institute of Scientific and Technical Information of China (English)

    郑太雄; 王波; 李永福; 陈琳


    为获得精确的乙醇体积分数,在发动机进气模型的基础上,设计了高增益观测器估计歧管压力,并对观测器误差进行了收敛性和稳定性分析。设计PI控制器对空燃比进行控制,使过量空气系数趋于理论值。利用PI控制器输出的燃油反馈信号,通过积分清零运算得出化学计量空燃比(Rs ),根据 Rs 与乙醇体积分数的关系计算得出乙醇体积分数估计值。仿真结果表明:乙醇体积分数估计时间在2s以内,估计误差绝对值小于1%,满足汽车的排放性和经济性要求。%For acquiring a precise estimation of ethanol proportion , based on the engine air charge model ,the high gain observer was designed to estimate the manifold absolute pressure ,and property of convergence and stability were analyzed to the observer errors .PI controller was proposed to con‐trol the air to fuel ratio ,which compelled the excess air coefficient to the theoretical value .After‐wards ,the fuel feedback signal from the PI control was utilized ,and the stoichiometric air‐to‐fuel rati‐o (Rs ) was achieved through the integral zero clearing operation .At last ,ethanol volume fracrion es‐timation value was calculated based on the relationship between the Rs and the ethanol volume fracri‐on .Simulation results show that the estimated time of the ethanol volume fracrion is within 2 s ,and the absolute value of the estimated error is less than 1% ,w hich meets the emissions and fuel economy of the vehicles .

  5. Effects of slice orientation on reproducibility of sequential assessment of right ventricular volumes and ejection fraction: short-axis vs transverse SSFP cine cardiovascular magnetic resonance. (United States)

    D'Errico, Luigia; Lamacie, Mariana M; Jimenez Juan, Laura; Deva, Djeven; Wald, Rachel M; Ley, Sebastian; Hanneman, Kate; Thavendiranathan, Paaladinesh; Wintersperger, Bernd J


    Test-retest reproducibility is of utmost importance in follow-up of right ventricular (RV) volumes and function; optimal slice orientation though is not yet known. We compared test-retest reproducibility and intra-/inter-observer variability of right ventricular (RV) volumes and function assessed with short-axis and transverse cardiovascular magnetic resonance (CMR). Eighteen volunteers underwent cine CMR for RV assessment obtaining ventricular coverage in short-axis and transverse slice orientation. Additional 2D phase contrast flow imaging of the main pulmonary artery (MPA) was performed. After complete repositioning repeat acquisitions were performed. Data sets were contoured by two blinded observers. Statistical analysis included Student's t-test, Bland-Altman plots, intra-class correlation coefficient (ICC) and 2-way ANOVA, SEM and minimal detectable difference calculations. Heart rates (65.0 ± 7.4 vs. 67.6 ± 9.9 bpm; P = 0.1) and MPA flow (89.8 ± 16.6 vs. 87.2 ± 14.9 mL; P = 0.1) did not differ between imaging sessions. EDV and ESV demonstrated an inter-study bias of 0.4 %[-9.5 %,10.3 %] and 2.1 %[-12.3 %,16.4 %] for short-axis and 1.1 %[-7.3 %,9.4 %] and 0.8 %[-16.0 %,17.6 %] for transverse orientation, respectively. There was no significant interaction between imaging orientation and interstudy reproducibility (p = 0.395-0.824), intra-observer variability (p = 0.726-0.862) or inter-observer variability (p = 0.447-0.706) by 2-way ANOVA. Inter-observer agreement by ICC was greater for short axis versus transverse orientation for all parameters (0.769-0.986 vs. 0.625-0.983, respectively). Minimal detectable differences for short axis and transverse orientations were 10.1 mL/11.5 mL for EDV, 8.3 mL/8.4 mL for ESV and 4.1 % vs. 4.7 % for EF, respectively. Short-axis and transverse orientation both provide reliable and reproducible measures for follow-up of RV volumes and global function. Therefore

  6. Fractional motions

    Energy Technology Data Exchange (ETDEWEB)

    Eliazar, Iddo I., E-mail: [Holon Institute of Technology, P.O. Box 305, Holon 58102 (Israel); Shlesinger, Michael F., E-mail: [Office of Naval Research, Code 30, 875 N. Randolph St., Arlington, VA 22203 (United States)


    Brownian motion is the archetypal model for random transport processes in science and engineering. Brownian motion displays neither wild fluctuations (the “Noah effect”), nor long-range correlations (the “Joseph effect”). The quintessential model for processes displaying the Noah effect is Lévy motion, the quintessential model for processes displaying the Joseph effect is fractional Brownian motion, and the prototypical model for processes displaying both the Noah and Joseph effects is fractional Lévy motion. In this paper we review these four random-motion models–henceforth termed “fractional motions” –via a unified physical setting that is based on Langevin’s equation, the Einstein–Smoluchowski paradigm, and stochastic scaling limits. The unified setting explains the universal macroscopic emergence of fractional motions, and predicts–according to microscopic-level details–which of the four fractional motions will emerge on the macroscopic level. The statistical properties of fractional motions are classified and parametrized by two exponents—a “Noah exponent” governing their fluctuations, and a “Joseph exponent” governing their dispersions and correlations. This self-contained review provides a concise and cohesive introduction to fractional motions.

  7. A Coupled Mean Field / Gurson-Tvergaard Micromechanical Model For Ductile Fracture In Multiphase Materials With Large Volume Fraction of Voids (United States)

    Van Hoof, Thibaut; Piérard, Olivier; Lani, Frédéric


    In the framework of the European project PROHIPP (New design and manufacturing processes for high pressure fluid power product — NMP 2-CT-2004-50546), CENAERO develops a library of constitutive models used to predict the mechanical response of a family of cast iron. The present contribution focuses on one particular microstructure, corresponding to a ferrite matrix containing spheroidal graphite and isolated inclusions of pearlite. An incremental mean field homogenisation scheme such as the one developed by Doghri and Ouaar is used. In the present application, the ferrite matrix is described by a Gurson type constitutive law (porous plasticity) while the pearlite inclusions are assumed to obey the classical isotropic J2 plasticity. The predictions of the micromechanical model are compared to the results of Finite Element simulations performed on three-dimensional representative volume elements (RVEs).

  8. Decoupling crystalline volume fraction and V{sub OC} in microcrystalline silicon pin solar cells by using a {mu}c-Si:F:H intrinsic layer

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Q.; Johnson, E.V.; Djeridane, Y.; Abramov, A.; Roca i Cabarrocas, P. [LPICM-CNRS, Ecole Polytechnique, Palaiseau (France)


    Microcrystalline silicon thin film pin solar cells with a highly crystallized intrinsic {mu}c-Si:F:H absorber were prepared by RF-plasma enhanced chemical vapour deposition using SiF{sub 4} as the gas precursor. The cells were produced with a vacuum break between the doped layer and intrinsic layer depositions, and the effect of different subsequent interface treatment processes was studied. The use of an intrinsic {mu}c-Si:H p/i buffer layer before the first air break increased the short circuit current density from 22.3 mA/cm{sup 2} to 24.7 mA/cm{sup 2}. However, the use of a hydrogen-plasma treatment after both air breaks without an interface buffer layer improved both the open circuit voltage and the fill factor. Although the material used for the absorber layer showed a very high crystalline fraction and thus an increased spectral response at long wavelengths, an open-circuit voltage (V{sub OC}) of 0.523 V was nevertheless observed. Such a value of V{sub OC} is higher than is typically obtained in devices that employ a highly crystallized absorber as reported in the literature (see abstract figure). Using a hydrogen-plasma treatment, a single junction {mu}c-Si:F:H pin solar cell with an efficiency of 8.3% was achieved. (copyright 2008 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  9. Polymer fractionation

    Energy Technology Data Exchange (ETDEWEB)

    Hadermann, A. F.


    Soluble polymers are fractionated according to molecular weight by cryogenically comminuting the polymer and introducing the polymer particles, while still in the active state induced by cryogenic grinding, into a liquid having a solvent power selected to produce a coacervate fraction containing high molecular weight polymer species and a dilute polymer solution containing lower molecular weight polymer species. The coacervate may be physically separated from the solution and finds use in the production of antimisting jet fuels and the like.

  10. Real-time three-dimensional echocardiographic left ventricular ejection fraction and volumes assessment: comparison with cardiac computed tomography; Comparacao entre a afericao da fracao de ejecao e dos volumes do ventriculo esquerdo, medidos com ecocardiografia tridimensional em tempo real e com tomografia computadorizada ultra-rapida

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Marcelo L.C.; Nomura, Cesar H.; Tranchesi Junior, Bernardino; Oliveira, Wercules A. de; Naccarato, Gustavo; Serpa, Bruna S.; Cury, Alexandre; Passos, Rodrigo B.D.; Nobrega, Marcel V. da; Funari, Marcelo B.G.; Pfefermam, Abhaham; Makdisse, Marcia; Fischer, Claudio H.; Morhy, Samira S., E-mail: [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil)


    Background and objective: Few studies addressed the comparison between real-time 3D echocardiography (RT3DE) and cardiac computed tomography (CCT) concerning left ventricular ejection fraction and volumes assessment. We sought to compare both techniques regarding left ventricle (LV) ejection fraction function and volumes analysis. Methods: we studied by RT3DE (Philips IE 33, And, MA, USA) and by CCT (Toshiba, 64-slice, Otawara, Japan) 41 consecutive patients (29 males, 58 ± 11 yrs). We analysed by both techniques LVEF, LVEDV, LVESV. RT3DE and CCT data were compared by coefficients of determination (r: Pearson), Bland and Altman test and linear regression, 95% CI. Results: RT3DE data: LVEF ranged from 56.7 to 78.9 % (65.3 + 5.7 ); LVEDV ranged from 49.6 to 178.2 (88 + 27.5) mL; LVESV from 11.4 to 78 ( 33.9 + 13.7) mL. CCT data: LVEF ranged from 53 to 86 % (67.3 + 7.9 ); LVEDV ranged from 51 to 186 (106.4 + 30.7) mL; LVESV from 7 to 72 ( 35.1 + 13.8) mL. Correlations relative to RT3DE and CCT were: LVEF (r: 0. 7877, p<0.0001, 95 % CI 0.6327 to 0.8853 ); LVEDV (r:0.7671, p<0.0001, 95 % CI 0.5974 to 0.8745); LVESV (r: 0.8121, p<0.0001, 95 % CI 0.6659 to 0.8957). Conclusions: it was observed adequate correlation between real-time 3D echocardiography and cardiac computed tomography concerning ejection fraction and volumes assessment. (author)

  11. Comparison of multi-echo dixon methods with volume interpolated breath-hold gradient magnetic resonance imaging in fat-signal fraction quantification of paravaertebral muscle

    Energy Technology Data Exchange (ETDEWEB)

    Yoo, Yeon Hwa; Kim, Hak Sun; Lee, Young Han [Dept. of Radiology, Gangnam Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of); and others


    To assess whether multi-echo Dixon magnetic resonance (MR) imaging with simultaneous T2{sup *} estimation and correction yields more accurate fat-signal fraction (FF) measurement of the lumbar paravertebral muscles, in comparison with non-T2{sup *}-corrected two-echo Dixon or T2{sup *}-corrected three-echo Dixon, using the FF measurements from single-voxel MR spectroscopy as the reference standard. Sixty patients with low back pain underwent MR imaging with a 1.5T scanner. FF mapping images automatically obtained using T2{sup *}-corrected Dixon technique with two (non-T2{sup *}-corrected), three, and six echoes, were compared with images from single-voxel MR spectroscopy at the paravertebral muscles on levels L4 through L5. FFs were measured directly by two radiologists, who independently drew the region of interest on the mapping images from the three sequences. A total of 117 spectroscopic measurements were performed either bilaterally (57 of 60 subjects) or unilaterally (3 of 60 subjects). The mean spectroscopic FF was 14.3 ± 11.7% (range, 1.9-63.7%). Interobserver agreement was excellent between the two radiologists. Lin's concordance correlation between the spectroscopic findings and all the imaging-based FFs were statistically significant (p < 0.001). FFs obtained from the T2*-corrected six-echo Dixon sequences showed a significantly better concordance with the spectroscopic data, with its concordance correlation coefficient being 0.99 and 0.98 (p < 0.001), as compared with two- or three-echo methods. T2{sup *}-corrected six-echo Dixon sequence would be a better option than two- or three-echo methods for noninvasive quantification of lumbar muscle fat quantification.

  12. Non-Contiguous Pattern Avoidance in Binary Trees

    CERN Document Server

    Dairyko, Michael; Tyner, Samantha; Wynn, Casey


    In this paper we consider the enumeration of binary trees avoiding non-contiguous binary tree patterns. We begin by computing closed formulas for the number of trees avoiding a single binary tree pattern with 4 or fewer leaves and compare these results to analogous work for contiguous tree patterns. Next, we give an explicit generating function that counts binary trees avoiding a single non-contiguous tree pattern according to number of leaves. In addition, we enumerate binary trees that simultaneously avoid more than one tree pattern. Finally, we explore connections between pattern-avoiding trees and pattern-avoiding permutations.

  13. Understanding Multiplication of Fractions. (United States)

    Sweetland, Robert D.


    Discussed the use of Cuisenaire rods in teaching the multiplication of fractions. Considers whole number times proper fraction, proper fraction multiplied by proper fraction, mixed number times proper fraction, and mixed fraction multiplied by mixed fractions. (JN)

  14. Room evacuation through two contiguous exits

    CERN Document Server

    Sticco, I M; Dorso, C O


    Current regulations demand that at least two exits should be available for a safe evacuation during a panic situation. Although the "faster is slower" effect is expected to take place near the exits, the evacuation time will improve because of the additional exits. However, rooms having contiguous doors not always reduce the leaving time as expected. We investigated the relation between the doors separation and the evacuation performance. We found that there exists a separation distance range that does not really improve the evacuation time, or it can even worsen the process performance. To our knowledge, no attention has been given to this issue in the literature. This work reports how the pedestrians dynamics differ when the separation distance between two exit doors changes and how this affects the overall performance.

  15. Contiguous spinal metastasis mimicking infectious spondylodiscitis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Chul Min; Lee, Seung Hun [Dept. of Radiology, Hanyang University Hospital, Seoul (Korea, Republic of); Bae, Ji Yoon [Dept. of Pathology, National Police Hospital, Seoul (Korea, Republic of)


    Differential diagnosis between spinal metastasis and infectious spondylodiscitis is one of the occasional challenges in daily clinical practice. We encountered an unusual case of spinal metastasis in a 75-year-old female breast cancer patient that mimicked infectious spondylodiscitis. Magnetic resonance imaging (MRI) showed diffuse bone marrow infiltrations with paraspinal soft tissue infiltrative changes in 5 contiguous cervical vertebrae without significant compression fracture or cortical destruction. These MRI findings made it difficult to differentiate between spinal metastasis and infectious spondylodiscitis. Infectious spondylodiscitis such as tuberculous spondylodiscitis was regarded as the more appropriate diagnosis due to the continuous involvement of > 5 cervical vertebrae. The patient's clinical presentation also supported the presumptive diagnosis of infectious spondylodiscitis rather than spinal metastasis. Intravenous antibiotics were administered, but clinical symptoms worsened despite treatment. After pathologic confirmation by computed tomography-guided biopsy, we were able to confirm a final diagnosis of spinal metastasis.

  16. Extended T2-IVIM model for correction of TE dependence of pseudo-diffusion volume fraction in clinical diffusion-weighted magnetic resonance imaging (United States)

    Jerome, N. P.; d'Arcy, J. A.; Feiweier, T.; Koh, D.-M.; Leach, M. O.; Collins, D. J.; Orton, M. R.


    The bi-exponential intravoxel-incoherent-motion (IVIM) model for diffusion-weighted MRI (DWI) fails to account for differential T 2 s in the model compartments, resulting in overestimation of pseudodiffusion fraction f. An extended model, T2-IVIM, allows removal of the confounding echo-time (TE) dependence of f, and provides direct compartment T 2 estimates. Two consented healthy volunteer cohorts (n  =  5, 6) underwent DWI comprising multiple TE/b-value combinations (Protocol 1: TE  =  62-102 ms, b  =  0-250 mm-2s, 30 combinations. Protocol 2: 8 b-values 0-800 mm-2s at TE  =  62 ms, with 3 additional b-values 0-50 mm-2s at TE  =  80, 100 ms scanned twice). Data from liver ROIs were fitted with IVIM at individual TEs, and with the T2-IVIM model using all data. Repeat-measures coefficients of variation were assessed for Protocol 2. Conventional IVIM modelling at individual TEs (Protocol 1) demonstrated apparent f increasing with longer TE: 22.4  ±  7% (TE  =  62 ms) to 30.7  ±  11% (TE  =  102 ms) T2-IVIM model fitting accounted for all data variation. Fitting of Protocol 2 data using T2-IVIM yielded reduced f estimates (IVIM: 27.9  ±  6%, T2-IVIM: 18.3  ±  7%), as well as T 2  =  42.1  ±  7 ms, 77.6  ±  30 ms for true and pseudodiffusion compartments, respectively. A reduced Protocol 2 dataset yielded comparable results in a clinical time frame (11 min). The confounding dependence of IVIM f on TE can be accounted for using additional b/TE images and the extended T2-IVIM model.

  17. US Forest Service Forest Carbon Stocks Contiguous United States (United States)

    US Forest Service, Department of Agriculture — Through application of a nearest-neighbor imputation approach, mapped estimates of forest carbon density were developed for the contiguous United States using the...

  18. Spatial neighborhood matrix computation: Inverse distance weighted versus binary contiguity


    Negreiros, J


    Paper presented at Geo-Spatial Crossroad GI_Forum, Salzburg, Austria. A particular GIS aspect is the existence of the spatial neighborhood weighted matrix (W) needed for their assessment and commonly setup by the binary or inverse distance weight (IDW)contiguity. This article recommends that if the former approach fulfills W specification quite well, the distance decay contiguity of IDW, by itself, is blinded to its natural neighbors because the exponent of 1/dexp already underlies the con...

  19. Mystery Fractions (United States)

    Bhattacharyya, Sonalee; Namakshi, Nama; Zunker, Christina; Warshauer, Hiroko K.; Warshauer, Max


    Making math more engaging for students is a challenge that every teacher faces on a daily basis. These authors write that they are constantly searching for rich problem-solving tasks that cover the necessary content, develop critical-thinking skills, and engage student interest. The Mystery Fraction activity provided here focuses on a key number…

  20. Mystery Fractions (United States)

    Bhattacharyya, Sonalee; Namakshi, Nama; Zunker, Christina; Warshauer, Hiroko K.; Warshauer, Max


    Making math more engaging for students is a challenge that every teacher faces on a daily basis. These authors write that they are constantly searching for rich problem-solving tasks that cover the necessary content, develop critical-thinking skills, and engage student interest. The Mystery Fraction activity provided here focuses on a key number…

  1. Fraction Reduction through Continued Fractions (United States)

    Carley, Holly


    This article presents a method of reducing fractions without factoring. The ideas presented may be useful as a project for motivated students in an undergraduate number theory course. The discussion is related to the Euclidean Algorithm and its variations may lead to projects or early examples involving efficiency of an algorithm.

  2. Differentiation between focal malignant marrow-replacing lesions and benign red marrow deposition of the spine with T2{sup *}-corrected fat-signal fraction map using a three -echo volume interpolated breath-hold gradient echo dixon sequence

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Yong Pyo; Kim, Sung Jun; Chung, Tae Sub; Yoo, Yeon Hwa; Yoon, Choon Sik [Dept. of Radiology, Gangnam Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of); Kanneengiesser, Stephan [MR Applications Development, Siemens AG, Healthcare Sector, Erlangen (Germany); Paek, Moon Young [Siemens Ltd., Seoul (Korea, Republic of); Song, Ho Taek; Lee, Young Han; Suh, Jin Suck [Dept. of Radiology, Severance Hospital, Yonsei University College of Medicine, Seoul (Korea, Republic of)


    To assess the feasibility of T2{sup *}-corrected fat-signal fraction (FF) map by using the three-echo volume interpolated breath-hold gradient echo (VIBE) Dixon sequence to differentiate between malignant marrow-replacing lesions and benign red marrow deposition of vertebrae. We assessed 32 lesions from 32 patients who underwent magnetic resonance imaging after being referred for assessment of a known or possible vertebral marrow abnormality. The lesions were divided into 21 malignant marrow-replacing lesions and 11 benign red marrow depositions. Three sequences for the parameter measurements were obtained by using a 1.5-T MR imaging scanner as follows: three-echo VIBE Dixon sequence for FF; conventional T1-weighted imaging for the lesion-disc ratio (LDR); pre- and post-gadolinium enhanced fat-suppressed T1-weighted images for the contrast-enhancement ratio (CER). A region of interest was drawn for each lesion for parameter measurements. The areas under the curve (AUC) of the parameters and their sensitivities and specificities at the most ideal cutoff values from receiver operating characteristic curve analysis were obtained. AUC, sensitivity, and specificity were respectively compared between FF and CER. The AUCs of FF, LDR, and CER were 0.96, 0.80, and 0.72, respectively. In the comparison of diagnostic performance between the FF and CER, the FF showed a significantly larger AUC as compared to the CER (p = 0.030), although the difference of sensitivity (p = 0.157) and specificity (p = 0.157) were not significant. Fat-signal fraction measurement using T2{sup *}-corrected three-echo VIBE Dixon sequence is feasible and has a more accurate diagnostic performance, than the CER, in distinguishing benign red marrow deposition from malignant bone marrow-replacing lesions.

  3. Effect of Methanol Volume Fractions in Gasoline on Anti-Swelling Property of Rubber Materials%甲醇体积分数不同的甲醇汽油对橡胶材料膨胀性的影响

    Institute of Scientific and Technical Information of China (English)

    熊娥; 闫锋; 张文鹏


    Because of inherent characters of rubber materials,there exists some differences on anti-swelling property of rubber materials in gasoline with different methanol volume fraction.Immersion tests in gasoline 93# or gasoline with different methanol proportions are conducted to show the anti-swelling property of 3 rubber materials commonly used in motor vehicles.The results show that silicone rubber has better anti-swelling property in gasoline with high methanol proportion; on the contrary,fluorine rubber has good resistance to swelling in low-proportion-methanol gasoline; Nitrile Rubber has good antiswelling property in all gasoline with different proportion of methanol.%由于橡胶材料自身的特性不同,对甲醇体积分数不同的甲醇汽油的抗膨胀性存在差异,采用汽车上常见的3种橡胶材料分别在93#汽油和不同甲醇体积分数的甲醇汽油中进行浸泡实验.试验结果表明,硅橡胶在高比例甲醇汽油中抗膨胀性较好,氟橡胶在低比例甲醇汽油中抗膨胀性较好,而丁腈类橡胶在不同比例甲醇汽油中均有很好的抗膨胀性.

  4. Effect of the Volume Fraction of Jute Fiber on the Interlaminar Shear Stress and Tensile Behavior Characteristics of Hybrid Glass/Jute Fiber Reinforced Polymer Composite Bar for Concrete Structures

    Directory of Open Access Journals (Sweden)

    Chan-Gi Park


    Full Text Available Hybrid glass/jute fiber reinforced polymer (HGJFRP composite bars were manufactured for concrete structures, and their interlaminar shear stress and tensile performance were evaluated. HGJFRP composite bars were manufactured using a combination of pultrusion and braiding processes. Jute fiber was surface-treated with a silane coupling agent. The mixing ratio of the fiber to the vinyl ester used in the HGJFRP composite bars was 7 : 3. Jute fiber was used to replace glass fiber in proportions of 0, 30, 50, 70, and 100%. The interlaminar shear stress decreased as the proportion of jute fiber increased. Fractures appeared due to delamination between the surface-treated component and the main part of the HGJFRP composite bar. Tensile load-strain curves with 50% jute fiber exhibited linear behavior. With a jute fiber volume fraction of 70%, some plastic deformation occurred. A jute fiber mixing ratio of 100% resulted in a display of linear elastic brittle behavior from the fiber; however, when the surface of the fiber was coated with poly(vinyl acetate, following failure, the jute fiber exhibited partial load resistance. The tensile strength decreased as the jute fiber content increased; however, the tensile strength did not vary linearly with jute fiber content.

  5. Measurement and Modeling of Resistivity as a Microscale Tool to Quantify the Volume Fraction of Lenticular (alpha)' Particles in a Partially Transformed (delta)-phase Pu-Ga Matrix

    Energy Technology Data Exchange (ETDEWEB)

    Haslam, J J; Wall, M A; Johnson, D L; Mayhall, D J; Schwartz, A J


    We have measured and modeled the change in electrical resistivity due to partial transformation to the martensitic {alpha}{prime}-phase in a {delta}-phase Pu-Ga matrix. The primary objective is to relate the change in resistance, measured with a 4-probe technique during the transformation, to the volume fraction of the {alpha}{prime} phase created in the microstructure. Analysis by finite element methods suggests that considerable differences in the resistivity may be anticipated depending on the orientational and morphological configurations of the {alpha}{prime} particles. Finite element analysis of the computed resistance of an assembly of lenticular shaped particles indicates that series resistor or parallel resistor approximations are inaccurate and can lead to an underestimation of the predicted amount of {alpha}{prime} in the sample by 15% or more. Comparison of the resistivity of a simulated network of partially transformed grains or portions of grains suggests that a correction to the measured resistivity allows quantification of the amount of {alpha}{prime} phase in the microstructure with minimal consideration of how the {alpha}{prime} morphology may evolve. It is found that the average of the series and parallel resistor approximations provide the most accurate relationship between the measured resistivity and the amount of {alpha}{prime} phase. The methods described here are applicable to any evolving two-phase microstructure in which the resistance difference between the two phases is measurable.

  6. Dicty_cDB: Contig-U00819-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||||||| Sbjct: 61 acaaaatnnacnagntnnacaaaatnnacnagntcnacaaaatnnacnagntcnacaaaa 120 Query: 121 tnnacnagnncaacaaaatccccna...||||||||||||| Sbjct: 121 tnnacnagnncaacaaaatccccnagntcnacnagntcnacaaaacc 167 >Contig-U16510-1 (Contig-U16510...aagctcaacaaaatcaacaagctcaacaaaatcaacaagctcaacaaa 2335 Query: 102 atnnacnagntcnacaaaatnnacnagnncaacaaaatccccna...uery: 102 atnnacnagntcnacaaaatnnacnagnncaacaaaatccccnagntcnacnagntcnac 161 || || || || ||||||| || || |||||||...173 acaaaatnnacnagntnnacaaaatnnacnagntcnacaaaatnnacnagntcnacaaaa 114 Query: 121 tnnacnagnncaacaaaatccccna

  7. The fractionation of adipose tissue procedure to obtain stromal vascular fractions for regenerative purposes

    NARCIS (Netherlands)

    van Dongen, Joris A.; Stevens, Hieronymus P.; Parvizi, Mojtaba; van der Lei, Berend; Harmsen, Martin C.


    Autologous adipose tissue transplantation is clinically used to reduce dermal scarring and to restore volume loss. The therapeutic benefit on tissue damage more likely depends on the stromal vascular fraction of adipose tissue than on the adipocyte fraction. This stromal vascular fraction can be obt

  8. The Fractionation of Adipose Tissue (FAT) procedure to obtain stromal vascular fractions for regenerative purposes

    NARCIS (Netherlands)

    van Dongen, Joris A; Stevens, Hieronymus P; Parvizi, Mojtaba; van der Lei, Berend; Harmsen, Martin C


    Autologous adipose tissue transplantation is clinically used to reduce dermal scarring and to restore volume loss. The therapeutic benefit on tissue damage more likely depends on the stromal vascular fraction of adipose tissue than on the adipocyte fraction. This stromal vascular fraction can be obt

  9. The fractionation of adipose tissue procedure to obtain stromal vascular fractions for regenerative purposes

    NARCIS (Netherlands)

    van Dongen, Joris A.; Stevens, Hieronymus P.; Parvizi, Mojtaba; van der Lei, Berend; Harmsen, Martin C.


    Autologous adipose tissue transplantation is clinically used to reduce dermal scarring and to restore volume loss. The therapeutic benefit on tissue damage more likely depends on the stromal vascular fraction of adipose tissue than on the adipocyte fraction. This stromal vascular fraction can be obt

  10. 14 CFR 99.43 - Contiguous U.S. ADIZ. (United States)


    ... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Contiguous U.S. ADIZ. 99.43 Section 99.43... Zones § 99.43 Contiguous U.S. ADIZ. The area bounded by a line from 43°15′N, 65°55′W; 44°21′N; 67°16′W...; 25°58′N; 97°07′W; westward along the U.S./Mexico border to 32°32′03″N, 117°07′25″W; 32°30′N;...

  11. Fractional complex transforms for fractional differential equations

    National Research Council Canada - National Science Library

    Ibrahim, Rabha W


    The fractional complex transform is employed to convert fractional differential equations analytically in the sense of the Srivastava-Owa fractional operator and its generalization in the unit disk...

  12. 前处理对高体积分数SiCp/Al复合材料化学镀镍的影响∗%Influence of pretreatment on electroless nickel plating on high volume fraction SiCp/Al composite

    Institute of Scientific and Technical Information of China (English)

    张建云; 张灿铭; 李普同; 崔霞


    对高体积分数 SiCp/Al 复合材料进行前处理,再化学镀镍。研究了除油、粗化、活化对 SiCp/Al复合材料化学镀镍的影响。分析了镀镍层的显微组织。结果表明,有机溶剂除油比碱液除油效果好。H2 O2系粗化比 HF 系粗化更为适宜。在由醋酸镍、次亚磷酸钠和乙醇组成的活化剂中室温浸润,然后160℃温度下热还原30 min,化学镀镍镀速较高。前处理后在 SiCp/Al 复合材料表面化学镀镍可沉积上致密、均匀、结合良好的镀镍层。%The high volume fraction SiCp/Al composite was processed by pretreatment,then it was proceeded by electroless nickel plating.The influence of deoiling,roughening,activating on electroless nickel plating on SiCp/Al composite was investigated.The microstructure of electroless nickel plating on composite was ana-lyzed.The results show that organic solvent was better than alkaline solvent for deoiling.H2 O2 system was more appropriate than HF system for roughening.Infiltrating in activation solution consisted nickel acetate,so-dium hypophosphite and alcohol at room temperature,then thermo deoxidizing at 160 ℃ temperature for 30 min,the procedure makes electroless nickel plating rate higher.After pretreatment,electroless nickel plating deposited on SiCp/Al composite surface was dense,uniform,firmly combined.

  13. Fractional complex transform for fractional differential equations

    National Research Council Canada - National Science Library

    Lİ, Zheng Biao; HE, Ji Huan


    Fractional complex transform is proposed to convert fractional differential equations into ordinary differential equations, so that all analytical methods devoted to advanced calculus can be easily...

  14. Chemical systems, chemical contiguity and the emergence of life

    DEFF Research Database (Denmark)

    Kee, Terrence P.; Monnard, Pierre Alain


    to complex chemical systems over specific isolated functional apparatuses. We will summarize the recent advances in system chemistry and show that chemical systems in the geochemical context imply a form of chemical contiguity in the syntheses of the various molecules that precede modern biomolecules....

  15. Meadow based Fraction Theory


    Bergstra, Jan A.


    In the context of an involutive meadow a precise definition of fractions is formulated and on that basis formal definitions of various classes of fractions are given. The definitions follow the fractions as terms paradigm. That paradigm is compared with two competing paradigms for storytelling on fractions: fractions as values and fractions as pairs.

  16. Effect the addition of 10% (volume fraction) chromium on the mechanical properties of NiAlCr processed by powder metallurgy; Efecto de la adicion de un 10% en volumen de cromo en el comportamiento a traccion de aleaciones pulvimetalurgicas NiAlCr

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Barriocanal, J.; Garces, G.; Perez, P.; Adeva, P.


    The mechanical properties of Ni{sub 3}Al-Cr reinforced with 10% in volume fraction of chromium particles produced by powder metallurgy have been studied. For this purpose, milled powders with composition of Ni-20.9Al-8Cr-0.49B (% st.) with and without the addition of 10% in volume fraction of chromium particles have been produced. Both alloys were consolidated by hot isostatic pressing (HIP). After HIP, heat treatment was applied to homogenize the microstructure. The chromium reinforcement has an important effect in the yield strength and ultimate strength increase. The reinforced alloy presents a yield strength of 1300 MPa at room temperature with respect to 800 MPa for the un-reinforced material. After heat treatment, the yield strength of both alloys does not change significantly. However, a decrease in ductility and ultimate tensile strength have been observed. (Author) 4 refs.

  17. T1 mapping of the myocardium: intra-individual assessment of post-contrast T1 time evolution and extracellular volume fraction at 3T for Gd-DTPA and Gd-BOPTA

    Directory of Open Access Journals (Sweden)

    Kawel Nadine


    Full Text Available Abstract Purpose Myocardial T1 relaxation time (T1 time and extracellular volume fraction (ECV are altered in patients with diffuse myocardial fibrosis. The purpose of this study was to perform an intra-individual assessment of normal T1 time and ECV for two different contrast agents. Methods A modified Look-Locker Inversion Recovery (MOLLI sequence was acquired at 3 T in 24 healthy subjects (8 men; 28 ± 6 years at mid-ventricular short axis pre-contrast and every 5 min between 5-45 min after injection of a bolus of 0.15 mmol/kg gadopentetate dimeglumine (Gd-DTPA; Magnevist® (exam 1 and 0.1 mmol/kg gadobenate dimeglumine (Gd-BOPTA; Multihance® (exam 2 during two separate scanning sessions. T1 times were measured in myocardium and blood on generated T1 maps. ECVs were calculated as ΔR1myocardium/ΔR1blood*1−hematocrit. Results Mean pre-contrast T1 relaxation times for myocardium and blood were similar for both the first and second CMR exam (p > 0.5. Overall mean post-contrast myocardial T1 time was 15 ± 2 ms (2.5 ± 0.7% shorter for Gd-DTPA at 0.15 mmol/kg compared to Gd-BOPTA at 0.1 mmol/kg (p  0.05. Between 5 and 45 minutes after contrast injection, mean ECV values increased linearly with time for both contrast agents from 0.27 ± 0.03 to 0.30 ± 0.03 (p pre-contrast myocardial T1 relaxation time (CV 4.5% [exam 1] and 3.0% [exam 2], respectively. ECV with Gd-DTPA was highly correlated to ECV by Gd-BOPTA (r = 0.803; p  Conclusion In comparison to pre-contrast myocardial T1 relaxation time, variation in ECV values of normal subjects is larger. However, absolute differences in ECV between Gd-DTPA and Gd-BOPTA were small and rank correlation was high. There is a small and linear increase in ECV over time, therefore ideally images should be acquired at the same delay after contrast injection.

  18. Contiguous Uniform Deviation for Multiple Linear Regression in Pattern Recognition (United States)

    Andriana, A. S.; Prihatmanto, D.; Hidaya, E. M. I.; Supriana, I.; Machbub, C.


    Understanding images by recognizing its objects is still a challenging task. Face elements detection has been developed by researchers but not yet shows enough information (low resolution in information) needed for recognizing objects. Available face recognition methods still have error in classification and need a huge amount of examples which may still be incomplete. Another approach which is still rare in understanding images uses pattern structures or syntactic grammars describing shape detail features. Image pixel values are also processed as signal patterns which are approximated by mathematical function curve fitting. This paper attempts to add contiguous uniform deviation method to curve fitting algorithm to increase applicability in image recognition system related to object movement. The combination of multiple linear regression and contiguous uniform deviation method are applied to the function of image pixel values, and show results in higher resolution (more information) of visual object detail description in object movement.

  19. Acromioclavicular septic arthritis and sternoclavicular septic arthritis with contiguous pyomyositis. (United States)

    Corey, Sally A; Agger, William A; Saterbak, Andrew T


    Acromioclavicular (AC) and sternoclavicular (SC) septic arthritis with contiguous pyomyositis are rare, especially in immunocompetent individuals. We report a case of septic AC joint with pyomyositis of the deltoid and supraspinatus muscles and a separate case with septic SC joint with pyomysitis of the sternocleidomastoid muscle. Both patients had similar presentations of infections with Staphylococcus aureus and were successfully treated with surgical incision and drainage followed by prolonged antibiotic therapy.

  20. Matrix fractional systems (United States)

    Tenreiro Machado, J. A.


    This paper addresses the matrix representation of dynamical systems in the perspective of fractional calculus. Fractional elements and fractional systems are interpreted under the light of the classical Cole-Cole, Davidson-Cole, and Havriliak-Negami heuristic models. Numerical simulations for an electrical circuit enlighten the results for matrix based models and high fractional orders. The conclusions clarify the distinction between fractional elements and fractional systems.

  1. Initialized Fractional Calculus (United States)

    Lorenzo, Carl F.; Hartley, Tom T.


    This paper demonstrates the need for a nonconstant initialization for the fractional calculus and establishes a basic definition set for the initialized fractional differintegral. This definition set allows the formalization of an initialized fractional calculus. Two basis calculi are considered; the Riemann-Liouville and the Grunwald fractional calculi. Two forms of initialization, terminal and side are developed.

  2. Quantitative Measurements of Soot Volume Fractions in Diesel Engine Using Laser-Induced Incandescence Method%利用激光诱导炽光法定量测量柴油机缸内燃烧过程碳烟体积分数

    Institute of Scientific and Technical Information of China (English)

    唐青龙; 张鹏; 刘海峰; 尧命发


    激光诱导炽光(LII)法是一种用于测量火焰中碳烟体积分数的光学测试方法.本文介绍了LII的基本原理以及LII实现定量测量的常见标定方法,建立了一套基于双色法-激光诱导炽光法(2C-LII)的用于柴油机缸内燃烧过程碳烟体积分数定量测量的测试系统,该测试系统采用双成像原理,可以实现多点标定和全视场范围内的碳烟体积分数测量.在一台工作在1200 r∙min-1、喷油量21 mg的光学单缸柴油机上,研究了60、100和140 MPa三个不同喷油压力下,缸内燃烧过程碳烟的分布情况,结果表明,碳烟自发光出现在燃烧放热率峰值之后,且随着喷油压力提高,碳烟发光持续期缩短,碳烟发光强度降低.测试区域内火焰中的碳烟体积分数范围约为0-50×10-6.不同喷油压力下,碳烟生成初期、碳烟峰值和碳烟氧化三个阶段内平均碳烟体积分数的范围分别是:5×10-6-9×10-6,15×10-6-20×10-6和14×10-6-16×10-6.喷油压力提高后火焰中的碳烟分布区域面积增大,平均碳烟体积分数减小,碳烟体积分数的空间分布趋于均匀.%Laser-induced incandescence (LII) is an optical diagnostic method used to measure the soot volume fraction in a flame. In this paper, the principle of LII and the calibration methods normal y used are introduced. Based on two-color LII theory, a quantitative test system for determining the in-cylinder soot volume fraction was established. A dual imaging setup was used, which can achieve multipoint calibration and ful field-of-view quantification of soot in a diesel engine chamber. An investigation was carried out on an optical diesel engine with the conditions 1200 r∙min-1 and 21 mg fuel injection per cycle, with various injection pressures (60, 100, and 140 MPa). The results show that the natural soot incandescence emerged after the peak rate of combustion heat release. With increasing injection pressure, the duration of natural soot

  3. Dicty_cDB: Contig-U02755-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available .d Length = 113 Score = 83.8 bits (42), Expect = 3e-17 Identities = 45/45 (100%) Strand = Plus / Plus Query: 1 cactctacatan...|||||||||||||||| Sbjct: 1 cactctacatanacaacacacattgataaaataatagtttctttc 45 >Contig-U11697-1 (Contig-U11697-1...ct = 1e-12 Identities = 44/45 (97%) Strand = Plus / Minus Query: 1 cactctacatanacaacacacattgataaaataatagtttc

  4. Dicty_cDB: Contig-U14893-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ), Expect = 3e-15 Identities = 48/48 (100%) Strand = Plus / Plus Query: 26 attttcctctaaccccccaaattaaaactanatcntttcan...ttcctctaaccccccaaattaaaactanatcntttcanttttcac 73 >Contig-U11657-1 (Contig-U11657-1Q) /CSM_Contig/Contig-U116...entities = 48/48 (100%) Strand = Plus / Minus Query: 26 attttcctctaaccccccaaattaaaactanatcntttcan...ttttcac 73 |||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 116 attttcctctaaccccccaaattaaaactanatcntttcan

  5. Dicty_cDB: Contig-U02496-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available cattcaatgcaaattttggtagtttatttagaactcatacaaacgcaacaatatt 1020 Query: 1021 tgcttcan...cccaanaaa 1037 ||||||||||||||||| Sbjct: 1021 tgcttcancccaanaaa 1037 >Contig-U09887-1 (Contig-U09887-1Q) /CSM...tcaatgcaaattttggtagtttatttagaactcatacaaacg 32 Query: 1011 caacaatatttgcttcancccaanaaa 1037 |||||||||||||||||...|||||||||| Sbjct: 31 caacaatatttgcttcancccaanaaa 5 Lambda K H 1.37 0.711 1.31 Mat

  6. Dicty_cDB: Contig-U12850-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tcncttnattantttcgtttaaaaatttgtnnnaaacatgntnttgga 133 Query: 134 atcgccnaacntta 14...7 |||||||||||||| Sbjct: 134 atcgccnaacntta 147 >Contig-U13258-1 (Contig-U13258-1Q) /CSM_Contig/Contig-U13258...ttgtnnnaaacatgntnttgga 27 Query: 134 atcgccnaacntta 147 |||||||||||||| Sbjct: 26 atcgccnaacntta 13 Lambda K

  7. Dicty_cDB: Contig-U08421-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available Plus / Plus Query: 11 tgatgaatgngntcnatcancaaanaattttccngaaccccnaaaaagnttattagattg 70 |||||||||||||||||||||...||||||||||||||||||||||||||||||||||||||| Sbjct: 11 tgatgaatgngntcnatcancaaanaattttccngaaccccna...gatgncnataaaacgncagcnca 130 Query: 131 aaatttagccatcgntgntgcnccnaattta 161 ||||||...||||||||||||||||||||||||| Sbjct: 131 aaatttagccatcgntgntgcnccnaattta 161 >Contig-U13983-1 (Contig-U13983-1Q)... (82%) Strand = Plus / Plus Query: 11 tgatgaatgngntcnatcancaaanaattttccngaaccccnaaaaagnttattagattg 70 ||||||

  8. Dicty_cDB: Contig-U14610-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ttttangccngnanggaantgttanttttgctttaaaaantgnggaattccnngan 66 Query: 67 cnctnttggccnactggaatagt 89 |||||||||||...|||||||||||| Sbjct: 67 cnctnttggccnactggaatagt 89 >Contig-U12363-1 (Contig-U12363...cngnanggaantgttanttttgctttaaaaantgnggaattccnngan 132 Query: 67 cnctnttggccnactgga...atagt 89 ||||||||||||||||||||||| Sbjct: 131 cnctnttggccnactggaatagt 109 Lambda K H 1.37 0.711 1.31 Matrix: b

  9. Dicty_cDB: Contig-U06096-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available |||||||||||| Sbjct: 64 gaaatngatgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 123 Query: 124 ggnaatgttggngatgntacaacnccna...ctt 154 ||||||||||||||||||||||||||||||| Sbjct: 124 ggnaatgttggngatgntacaacnccnactt 154 Query: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 |||||||||||||||||||||||||||||||||||||||...||||||||||| Sbjct: 219 atcncaacnatnncaacaacnaactgaatcagaattacnaccnattcaaa 268 >Contig-U11917-1 (Contig-U1191...atgntncaacnccaacaatggctgcaaanattttttnnccnttttcaattggt 147 Query: 124 ggnaatgttggngatgntacaacnccnacttnaaaanaa

  10. Fraction Sense: Foundational Understandings. (United States)

    Fennell, Francis Skip; Karp, Karen


    The intent of this commentary is to identify elements of fraction sense and note how the research studies provided in this special issue, in related but somewhat different ways, validate the importance of such understandings. Proficiency with fractions serves as a prerequisite for student success in higher level mathematics, as well as serving as a gateway to many occupations and varied contexts beyond the mathematics classroom. Fraction sense is developed through instructional opportunities involving fraction equivalence and magnitude, comparing and ordering fractions, using fraction benchmarks, and computational estimation. Such foundations are then extended to operations involving fractions and decimals and applications involving proportional reasoning. These components of fraction sense are all addressed in the studies provided in this issue, with particular consideration devoted to the significant importance of the use of the number line as a central representational tool for conceptually understanding fraction magnitude.

  11. A numerical investigation of pumping-test responses from contiguous aquifers (United States)

    Rafini, Silvain; Chesnaux, Romain; Ferroud, Anouck


    Adequate groundwater management requires models capable of representing the heterogeneous nature of aquifers. A key point is the theoretical knowledge of flow behaviour in various heterogeneous archetypal conditions, using analytically or numerically based models. This study numerically investigates transient pressure transfers between linearly contiguous homogeneous domains with non-equal hydraulic properties, optionally separated by a conductive fault. Responses to pumping are analysed in terms of time-variant flow dimension, n. Two radial stages are predicted (n: 2 - 2) with a positive or negative vertical offset depending of the transmissivity ratio between domains. A transitional n = 4 segment occurs when the non-pumped domain is more transmissive (n: 2 - 4 - 2), and a fractional flow segment occurs when the interface is a fault (n: 2 - 4 - 1.5 - 2). The hydrodynamics are generally governed by the transmissivity ratio; the storativity ratio impact is limited. The drawdown log-derivative late stabilization, recorded at any well, does not tend to reflect the local transmissivity but rather the higher transmissivity region, possibly distant and blind, as it predominantly supplies groundwater to the well. This study provides insights on the behaviour of non-uniform aquifers and on theoretical responses that can aid practitioners to detect such conditions in nature.

  12. Applications of fractional calculus in physics

    CERN Document Server


    Fractional calculus is a collection of relatively little-known mathematical results concerning generalizations of differentiation and integration to noninteger orders. While these results have been accumulated over centuries in various branches of mathematics, they have until recently found little appreciation or application in physics and other mathematically oriented sciences. This situation is beginning to change, and there are now a growing number of research areas in physics which employ fractional calculus.This volume provides an introduction to fractional calculus for physicists, and co

  13. Chimeric mitochondrial peptides from contiguous regular and swinger RNA

    Directory of Open Access Journals (Sweden)

    Hervé Seligmann


    Full Text Available Previous mass spectrometry analyses described human mitochondrial peptides entirely translated from swinger RNAs, RNAs where polymerization systematically exchanged nucleotides. Exchanges follow one among 23 bijective transformation rules, nine symmetric exchanges (X ↔ Y, e.g. A ↔ C and fourteen asymmetric exchanges (X → Y → Z → X, e.g. A → C → G → A, multiplying by 24 DNA's protein coding potential. Abrupt switches from regular to swinger polymerization produce chimeric RNAs. Here, human mitochondrial proteomic analyses assuming abrupt switches between regular and swinger transcriptions, detect chimeric peptides, encoded by part regular, part swinger RNA. Contiguous regular- and swinger-encoded residues within single peptides are stronger evidence for translation of swinger RNA than previously detected, entirely swinger-encoded peptides: regular parts are positive controls matched with contiguous swinger parts, increasing confidence in results. Chimeric peptides are 200× rarer than swinger peptides (3/100,000 versus 6/1000. Among 186 peptides with >8 residues for each regular and swinger parts, regular parts of eleven chimeric peptides correspond to six among the thirteen recognized, mitochondrial protein-coding genes. Chimeric peptides matching partly regular proteins are rarer and less expressed than chimeric peptides matching non-coding sequences, suggesting targeted degradation of misfolded proteins. Present results strengthen hypotheses that the short mitogenome encodes far more proteins than hitherto assumed. Entirely swinger-encoded proteins could exist.

  14. Chimeric mitochondrial peptides from contiguous regular and swinger RNA. (United States)

    Seligmann, Hervé


    Previous mass spectrometry analyses described human mitochondrial peptides entirely translated from swinger RNAs, RNAs where polymerization systematically exchanged nucleotides. Exchanges follow one among 23 bijective transformation rules, nine symmetric exchanges (X ↔ Y, e.g. A ↔ C) and fourteen asymmetric exchanges (X → Y → Z → X, e.g. A → C → G → A), multiplying by 24 DNA's protein coding potential. Abrupt switches from regular to swinger polymerization produce chimeric RNAs. Here, human mitochondrial proteomic analyses assuming abrupt switches between regular and swinger transcriptions, detect chimeric peptides, encoded by part regular, part swinger RNA. Contiguous regular- and swinger-encoded residues within single peptides are stronger evidence for translation of swinger RNA than previously detected, entirely swinger-encoded peptides: regular parts are positive controls matched with contiguous swinger parts, increasing confidence in results. Chimeric peptides are 200 × rarer than swinger peptides (3/100,000 versus 6/1000). Among 186 peptides with > 8 residues for each regular and swinger parts, regular parts of eleven chimeric peptides correspond to six among the thirteen recognized, mitochondrial protein-coding genes. Chimeric peptides matching partly regular proteins are rarer and less expressed than chimeric peptides matching non-coding sequences, suggesting targeted degradation of misfolded proteins. Present results strengthen hypotheses that the short mitogenome encodes far more proteins than hitherto assumed. Entirely swinger-encoded proteins could exist.

  15. Meaning of Fractions (United States)

    Dewi, D. A. K.; Suryadi, D.; Suratno, T.; Mulyana, E.; Kurniawan, H.


    Introducing fractions is identical to divide an object. Suppose we divide the apple into two parts. One divided into two parts, the question arises whether one part can be called a half or not. Based on this activity, how can students give meaning to fractions. This study aims at designing a different fractions lesson by applying Didactical Design Research. In doing so, we undertook several research phases: 1) thinking what is fractions and why students should learn this concept; 2) designing didactical situation based on identified learning obstacles; and 3) reflecting retrospectively on the lesson design and its implementation as to redesign the fractions lesson. Our analysis revealed that most students held epistemological obstacles in giving meaning of fractions because they only know fractions as numbers that have numerator and denominator. By positioning ourselves as students, we discuss the ideal design to help students in constructing the meaning of fractions.

  16. Fractional Dynamical Systems

    CERN Document Server

    Edelman, Mark


    In this paper the author presents the results of the preliminary investigation of fractional dynamical systems based on the results of numerical simulations of fractional maps. Fractional maps are equivalent to fractional differential equations describing systems experiencing periodic kicks. Their properties depend on the value of two parameters: the non-linearity parameter, which arises from the corresponding regular dynamical systems; and the memory parameter which is the order of the fractional derivative in the corresponding non-linear fractional differential equations. The examples of the fractional Standard and Logistic maps demonstrate that phase space of non-linear fractional dynamical systems may contain periodic sinks, attracting slow diverging trajectories, attracting accelerator mode trajectories, chaotic attractors, and cascade of bifurcations type trajectories whose properties are different from properties of attractors in regular dynamical systems. The author argues that discovered properties s...

  17. Valor prognóstico da fração de volume de colágeno na cardiomiopatia hipertrófica Valor pronóstico de la fracción de volumen de colágeno en la cardiomiopatía hipertrófica Prognostic value of the collagen volume fraction in hypertrophic cardiomyopathy

    Directory of Open Access Journals (Sweden)

    Edmundo Arteaga


    ó, con éxito, biopsia endomiocárdica del ventrículo derecho en 21 pacientes sintomáticos con CMH. La fracción de volumen de colágeno (FVC miocárdico se determinó por medio de histología. Se determinó la FVC también en fragmentos de nueve corazones normales de individuos fallecidos por causas no cardiacas. Respecto a la FVC, se dividieron a los pacientes en grupos supra e inframedianos (FVC elevada y FVC baja, respectivamente, y se compararon las características clínicas y ecocardiográficas y las curvas de sobrevida. RESULTADOS: Entre los pacientes, la FVC tuvo variación del 1,86% al 29,9%, con mediana en el 6,19%. Ya en los corazones normales, del 0,13% al 1,46%, mediana en el 0,36% (p6,19%, sin que se observara diferencias basales. Sin embargo, tras un período de seguimiento promedio de 110 meses, cuatro muertes ocurrieron (dos súbitas, y otras dos por insuficiencia cardiaca en el grupo con FVC mayor, mientras que los pacientes del grupo con FVC menor estaban vivos al final del período (p=0,02. CONCLUSIÓN: Por primera vez, se asoció prospectivamente la fibrosis miocárdica a un peor diagnóstico en pacientes con CMH. Se deben encaminar esfuerzos hacia la cuantificación de la fibrosis en la CMH, al aceptar que la asociación con el pronóstico puede auxiliar tanto en la estratificación de riesgo para implante de desfibrilador, como en la prescripción de fármacos potencialmente reparadores miocárdicos.BACKGROUND: In hypertrophic cardiomyopathy (HCM, interstitial myocardial fibrosis is an important histological modification that has been associated with sudden death and evolution toward myocardial dilation. OBJECTIVE:To prospectively evaluate the prognostic value of the collagen volume fraction in HCM. METHODS: An endomyocardial biopsy of the right ventricle was successfully performed in 21 symptomatic patients with HCM. The myocardial collagen volume fraction (CVF was determined by histology. The CVF was also determined in fragments of nine normal

  18. On continued fraction algorithms

    NARCIS (Netherlands)

    Smeets, Ionica


    Is there a good continued fraction approximation between every two bad ones? What is the entropy of the natural extension for alpha-Rosen fractions? How do you find multi-dimensional continued fractions with a guaranteed quality in polynomial time? These, and many more, questions are answered in thi

  19. DIY Fraction Pack. (United States)

    Graham, Alan; Graham, Louise


    Describes a very successful attempt to teach fractions to year 5 pupils based on pupils making their own fraction pack. Children decided for themselves how to make the fractional slices used in the activity using colored cardboard sheets and templates of a paper circle consisting of 24 equal slices. (Author/NB)

  20. On continued fraction algorithms

    NARCIS (Netherlands)

    Smeets, Ionica


    Is there a good continued fraction approximation between every two bad ones? What is the entropy of the natural extension for alpha-Rosen fractions? How do you find multi-dimensional continued fractions with a guaranteed quality in polynomial time? These, and many more, questions are answered in thi

  1. Si3N4颗粒体积分数对Si3N4/Al复合材料微观组织和力学性能的影响%Effect of volume fraction on microstructure and mechanical properties of Si3N4/Al composites

    Institute of Scientific and Technical Information of China (English)

    修子扬; 陈国钦; 武高辉; 杨文澍; 刘艳梅


    采用压力浸渗法制备Si3N4体积分数分别为45%、50%和55%的颗粒增强铝基复合材料(Si3N4/Al).研究Si3N4体积分数和T6热处理对Si3N4/Al复合材料微观组织和力学性能的影响.结果表明:Si3N4颗粒分散均匀,Si3N4/Al复合材料浸渗良好,没有明显的孔洞和铸造缺陷;在Si3N4颗粒附近的铝基体中,可以观察到高密度位错;Si3N4/Al复合材料的弯曲强度随着Si3N4体积分数的增大而降低;T6热处理能提高复合材料的强度;复合材料的弹性模量随着Si3N4体积分数的增加而线性增加;在低Si3N4体积分数时,可以观察到更多的撕裂棱和韧窝;T6热处理对断口形貌的影响较小.%Si3N4 particles reinforced aluminium matrix composites (Si3N4/Al) with different particle volume fractions (45%,50%,and 55%) were fabricated by pressure infiltration method.The effects of Si3N4 volume fraction and T6 treatment on mierostructure and mechanical properties of Si3N4/Al composite were investigated.The results show that Si3N4/Al composites are well infiltrated with good particles dispersion and no apparent porosity or significant casting defects are observed.High density of dislocations in Al matrix around Si3N4 particles is observed.The bending strength of Si3N4/Al composites decreases with an increase in Si3N4 volume fraction,and can be greatly improved by T6 treatment.Elastic modulus of composites increases linearly with Si3N4 volume fraction.At a lower Si3N4 volume fraction,more tearing ridge and dimples with elongation are observed.T6 heat treatment shows minor effect on the fracture surface of composite.

  2. Fractional Differential Equations

    Directory of Open Access Journals (Sweden)

    Jianping Zhao


    Full Text Available An extended fractional subequation method is proposed for solving fractional differential equations by introducing a new general ansätz and Bäcklund transformation of the fractional Riccati equation with known solutions. Being concise and straightforward, this method is applied to the space-time fractional coupled Burgers’ equations and coupled MKdV equations. As a result, many exact solutions are obtained. It is shown that the considered method provides a very effective, convenient, and powerful mathematical tool for solving fractional differential equations.

  3. Fractional smith chart theory

    KAUST Repository

    Shamim, Atif


    For the first time, a generalized Smith chart is introduced here to represent fractional order circuit elements. It is shown that the standard Smith chart is a special case of the generalized fractional order Smith chart. With illustrations drawn for both the conventional integer based lumped elements and the fractional elements, a graphical technique supported by the analytical method is presented to plot impedances on the fractional Smith chart. The concept is then applied towards impedance matching networks, where the fractional approach proves to be much more versatile and results in a single element matching network for a complex load as compared to the two elements in the conventional approach. © 2010 IEEE.

  4. Fractional Dynamics and Control

    CERN Document Server

    Machado, José; Luo, Albert


    Fractional Dynamics and Control provides a comprehensive overview of recent advances in the areas of nonlinear dynamics, vibration and control with analytical, numerical, and experimental results. This book provides an overview of recent discoveries in fractional control, delves into fractional variational principles and differential equations, and applies advanced techniques in fractional calculus to solving complicated mathematical and physical problems.Finally, this book also discusses the role that fractional order modeling can play in complex systems for engineering and science. Discusses how fractional dynamics and control can be used to solve nonlinear science and complexity issues Shows how fractional differential equations and models can be used to solve turbulence and wave equations in mechanics and gravity theories and Schrodinger’s equation  Presents factional relaxation modeling of dielectric materials and wave equations for dielectrics  Develops new methods for control and synchronization of...

  5. Fractional factorial plans

    CERN Document Server

    Dey, Aloke


    A one-stop reference to fractional factorials and related orthogonal arrays.Presenting one of the most dynamic areas of statistical research, this book offers a systematic, rigorous, and up-to-date treatment of fractional factorial designs and related combinatorial mathematics. Leading statisticians Aloke Dey and Rahul Mukerjee consolidate vast amounts of material from the professional literature--expertly weaving fractional replication, orthogonal arrays, and optimality aspects. They develop the basic theory of fractional factorials using the calculus of factorial arrangements, thereby providing a unified approach to the study of fractional factorial plans. An indispensable guide for statisticians in research and industry as well as for graduate students, Fractional Factorial Plans features: * Construction procedures of symmetric and asymmetric orthogonal arrays. * Many up-to-date research results on nonexistence. * A chapter on optimal fractional factorials not based on orthogonal arrays. * Trend-free plans...

  6. Free volume under shear (United States)

    Maiti, Moumita; Vinutha, H. A.; Sastry, Srikanth; Heussinger, Claus


    Using an athermal quasistatic simulation protocol, we study the distribution of free volumes in sheared hard-particle packings close to, but below, the random-close packing threshold. We show that under shear, and independent of volume fraction, the free volumes develop features similar to close-packed systems — particles self-organize in a manner as to mimick the isotropically jammed state. We compare athermally sheared packings with thermalized packings and show that thermalization leads to an erasure of these structural features. The temporal evolution in particular the opening-up and the closing of free-volume patches is associated with the single-particle dynamics, showing a crossover from ballistic to diffusive behavior.

  7. The radiosurgery fractionation quandary: single fraction or hypofractionation? (United States)

    Kirkpatrick, John P; Soltys, Scott G; Lo, Simon S; Beal, Kathryn; Shrieve, Dennis C; Brown, Paul D


    Stereotactic radiosurgery (SRS), typically administered in a single session, is widely employed to safely, efficiently, and effectively treat small intracranial lesions. However, for large lesions or those in close proximity to critical structures, it can be difficult to obtain an acceptable balance of tumor control while avoiding damage to normal tissue when single-fraction SRS is utilized. Treating a lesion in 2 to 5 fractions of SRS (termed "hypofractionated SRS" [HF-SRS]) potentially provides the ability to treat a lesion with a total dose of radiation that provides both adequate tumor control and acceptable toxicity. Indeed, studies of HF-SRS in large brain metastases, vestibular schwannomas, meningiomas, and gliomas suggest that a superior balance of tumor control and toxicity is observed compared with single-fraction SRS. Nonetheless, a great deal of effort remains to understand radiobiologic mechanisms for HF-SRS driving the dose-volume response relationship for tumors and normal tissues and to utilize this fundamental knowledge and the results of clinic studies to optimize HF-SRS. In particular, the application of HF-SRS in the setting of immunomodulatory cancer therapies offers special challenges and opportunities.

  8. Packing Effect of Excluded Volume on Hard-Sphere Colloids

    Institute of Scientific and Technical Information of China (English)

    肖长明; 金国钧; 马余强


    We apply the principle of maximum entropy to consider the excluded volume effect on the phase separation of binary mixtures consisting of hard spheres with two different diameters. We show that a critical volume fraction of hard spheres exists locating the packing of large spheres. In particular, through numerical calculation, we have found that the critical volume fraction becomes lower when the ratio α = σ1/σ2 of large-to-small sphere diameters increases, but becomes higher when the ratio of the large sphere volume fraction to the total volume fraction of large and small spheres increases.

  9. Station Climatic Summaries North America. Volume 1: The Contiguous United States (United States)


    1050 950I MEAN REL HUM 07 LSTM ~ 71.7 I74.6 I74.0 I69.5 I73.0 I75.0 I78.3 79.9 I79.6 I7𔄁.9 I75.6 I74.1 I75.3I I MEAN REL HUM 13 LST(X) I57.4 I59.4 I55.7...34MEAN REL HUM 07 LSTM ~ 76.4 78.11 78.1 178.11 83 9 184.7 184.3 183.4 182.4182.9 178.8175.2 180.5

  10. Dicty_cDB: Contig-U13113-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ig-U13113-1 Contig ID Contig-U13113-1 Contig update 2002.12.18 Contig sequence >Contig-U13113-1 (Contig-U131...******* Frame C: xxxxxnnnxnnnnnnnnnnnnnnnnnnnnnnnnnnnnn own update ---------- Homology vs CSM-cDNA - dna update...arch space: 8947161656352 Effective search space used: 8947161656352 X1: 11 (21.8 bits) S2: 20 (40.1 bits) protein update...H + PRF protein sequence database [Last update Jun/09/2006] 3,762,210 sequences; 1,237,044,461 total letters... Searchingdone ***** No hits found ****** sequence database [Last update Jun/09/2

  11. Dicty_cDB: Contig-U10478-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nces; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Contig-U10478...-U10495-1Q) /CSM_Contig/Conti... 32 1.1 >Contig-U10478-1 (Contig-U10478-1Q) /CSM_Contig/Contig-U10478-1Q.Seq.d Length = 1022 Score... Query: 943 gtgaaattccctctcctt 960 |||||||||||||||||| Sbjct: 943 gtgaaattccctctcctt 960 Score = 412 bits (20...|||||||||||||||||||||||||| Sbjct: 322 atcaagngaaagtcaaagngcctcaggtcaaaacactgccagc 364 Score = 75.8 bits (38)...|||||| Sbjct: 362 agccaaagttcaagtcaaagtgcaagtcaaagtgcaagtcaaagtgcaagtcaaagtg 419 Score = 61.9 bits (31), Exp

  12. Study on Gas Cubic Drainage Technology in Contiguous Seams%近距离煤层群瓦斯立体抽采技术研究

    Institute of Scientific and Technical Information of China (English)

    刘珂铭; 张勇; 许力峰; 张江利; 张西斌; 李艳君; 杨维帅


    According to the mining in contiguous seams of Tongzi Mine, a seam with low gas content and low outburst danger was selected as a protective seam for coal mining. The mining disturbance role was applied to improve the permeability of the below pressure released seam. The borehole drilled along seam, low level strike borehole drilled through seam, pipeline buried in goaf, floor upward borehole drilled through seam and other measures were applied to comprehensive cubic gas drainage of the seam group. The experiment showed that the gas drainage rate of the coal mining face in protective seam was over 55% , coal and gas outburst danger was eliminated and the upper corner gas volume fraction was controlled below 1% after mining operation of the coal mining face completed. After the pressure released by the protective seam, the permeability coefficient of No. 6, No. 7 and No. 9 seam was individually increased by 392,320 and 289 times, the gas drainage rate was over 60% and the safe and efficient coal and gas jointly mining realized.%针对桐梓煤矿近距离煤层群开采,首先选择瓦斯含量较小、突出危险性低的煤层作为保护层进行开采,利用其开采扰动作用提高下部卸压煤层的透气性。采用顺层钻孔、低位走向穿层钻孔、采空区埋管和底板上向穿层钻孔等措施对煤层群进行立体化综合抽采,试验表明:保护层工作面瓦斯预抽采率在55%以上,消除了煤与瓦斯突出危险性,工作面开采后上隅角瓦斯体积分数控制在1%以下;6号、7号和9号被保护煤层经卸压后透气性系数分别增加了392、320和289倍,瓦斯抽采率超过60%,实现了煤与瓦斯安全高效共采

  13. Volume Entropy

    CERN Document Server

    Astuti, Valerio; Rovelli, Carlo


    Building on a technical result by Brunnemann and Rideout on the spectrum of the Volume operator in Loop Quantum Gravity, we show that the dimension of the space of the quadrivalent states --with finite-volume individual nodes-- describing a region with total volume smaller than $V$, has \\emph{finite} dimension, bounded by $V \\log V$. This allows us to introduce the notion of "volume entropy": the von Neumann entropy associated to the measurement of volume.

  14. Dividing Fractions: A Pedagogical Technique (United States)

    Lewis, Robert


    When dividing one fraction by a second fraction, invert, that is, flip the second fraction, then multiply it by the first fraction. To multiply fractions, simply multiply across the denominators, and multiply across the numerators to get the resultant fraction. So by inverting the division of fractions it is turned into an easy multiplication of…

  15. Non-contiguous multifocal vertebral osteomyelitis caused by Serratia marcescens. (United States)

    Lau, Jen Xin; Li, Jordan Yuanzhi; Yong, Tuck Yean


    Serratia marcescens is a common nosocomial infection but a rare cause of osteomyelitis and more so of vertebral osteomyelitis. Vertebral osteomyelitis caused by this organism has been reported in few studies. We report a case of S. marcescens vertebral discitis and osteomyelitis affecting multiple non-contiguous vertebras. Although Staphylococcus aureus is the most common cause of vertebral osteomyelitis, rare causes, such as S. marcescens, need to be considered, especially when risk factors such as intravenous heroin use, post-spinal surgery and immunosuppression are present. Therefore, blood culture and where necessary biopsy of the infected region should be undertaken to establish the causative organism and determine appropriate antibiotic susceptibility. Prompt diagnosis of S. marcescens vertebral osteomyelitis followed by the appropriate treatment can achieve successful outcomes.

  16. Fractional graph theory a rational approach to the theory of graphs

    CERN Document Server

    Scheinerman, Edward R


    A unified treatment of the most important results in the study of fractional graph concepts, this volume explores the various ways in which integer-valued concepts can be modified to derive nonintegral values. It begins with the general fractional theory of hypergraphs and presents in-depth coverage of fundamental and advanced topics. Subjects include fractional matching, fractional coloring, fractional edge coloring, fractional arboricity via matroid methods, and fractional isomorphism. The final chapter examines additional topics such as fractional domination, fractional intersection numbers

  17. Fractional Pure Birth Processes

    CERN Document Server

    Orsingher, Enzo; 10.3150/09-BEJ235


    We consider a fractional version of the classical non-linear birth process of which the Yule-Furry model is a particular case. Fractionality is obtained by replacing the first-order time derivative in the difference-differential equations which govern the probability law of the process, with the Dzherbashyan-Caputo fractional derivative. We derive the probability distribution of the number $ \\mathcal{N}_\

  18. Fractional vortex Hilbert's Hotel

    CERN Document Server

    Gbur, Greg


    We demonstrate how the unusual mathematics of transfinite numbers, in particular a nearly perfect realization of Hilbert's famous hotel paradox, manifests in the propagation of light through fractional vortex plates. It is shown how a fractional vortex plate can be used, in principle, to create any number of "open rooms," i.e. topological charges, simultaneously. Fractional vortex plates are therefore demonstrated to create a singularity of topological charge, in which the vortex state is completely undefined and in fact arbitrary.

  19. Fractional Electromagnetic Waves

    CERN Document Server

    Gómez, J F; Bernal, J J; Tkach, V I; Guía, M


    In the present work we consider the electromagnetic wave equation in terms of the fractional derivative of the Caputo type. The order of the derivative being considered is 0 <\\gamma<1. A new parameter \\sigma, is introduced which characterizes the existence of the fractional components in the system. We analyze the fractional derivative with respect to time and space, for \\gamma = 1 and \\gamma = 1/2 cases.

  20. Mean Monthly Evaporation Atlas for the Contiguous 48 United States (1956-1970) (United States)

    U.S. Geological Survey, Department of the Interior — TR-33: Maps are presented showing the areal distribution in the contiguous 48 states of evaporation (1) observed from Class A pans from from May through October, (2)...

  1. Hebbian Learning is about contingency, not contiguity, and explains the emergence of predictive mirror neurons

    NARCIS (Netherlands)

    Keysers, Christian; Perrett, David I.; Gazzola, Valeria


    Hebbian Learning should not be reduced to contiguity, as it detects contingency and causality. Hebbian Learning accounts of mirror neurons make predictions that differ from associative learning: Through Hebbian Learning, mirror neurons become dynamic networks that calculate predictions and predictio

  2. Dicty_cDB: Contig-U14477-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available vmvvvivfylqviynlriivilmvqlivivf*mglvmvtviiivivii i*rinnnnsnnnnnsnnnkikmif*yqiinrlnnyf*shyqkfiiiqrldfwdyqrler* *hhlyqrlvnqvvivq*fhwisl...amvlaimxxx own update 2004. 6.10 Homology vs CSM-cDNA Query= Contig-U14477-1 (Conti

  3. Change in Total Snowfall in the Contiguous 48 States, 1930-2007 (United States)

    U.S. Environmental Protection Agency — This map shows the average rate of change in total snowfall from 1930 to 2007 at 419 weather stations in the contiguous 48 states. Blue circles represent increased...

  4. Hebbian Learning is about contingency, not contiguity, and explains the emergence of predictive mirror neurons

    NARCIS (Netherlands)

    Keysers, Christian; Perrett, David I.; Gazzola, Valeria

    Hebbian Learning should not be reduced to contiguity, as it detects contingency and causality. Hebbian Learning accounts of mirror neurons make predictions that differ from associative learning: Through Hebbian Learning, mirror neurons become dynamic networks that calculate predictions and

  5. Fração de ejeção e volumes do ventrículo esquerdo medidos com eco 3D e com tomografia ultra-rápida Fracción de eyección y volúmenes del ventrículo izquierdo medidos con eco- 3DTR y con tomografía ultrarrápida Left ventricular ejection fraction and volumes as measured by 3d echocardiography and ultrafast computed tomography

    Directory of Open Access Journals (Sweden)

    Marcelo Luiz Campos Vieira


    Full Text Available FUNDAMENTO: O ecocardiograma tridimensional em tempo real (ECO 3D e a tomografia computadorizada ultra-rápida (CT são dois novos métodos de análise da fração de ejeção e dos volumes do VE. OBJETIVO: Comparar as medidas da FEVE e dos volumes do VE aferidos pelo ECO 3D e pela CT ultra-rápida. MÉTODOS: Foram estudados pelo ECO 3D e pela CT ultra-rápida de 64 cortes, 39 pacientes consecutivos (27 homens, média etária de 57±12 anos. Foram analisados: FEVE e volumes do VE. Análise estatística: coeficiente de correlação (r: Pearson, teste de Bland & Altman, teste de regressão linear, 95 % IC, pFUNDAMENTO: La ecocardiografía tridimensional en tiempo real (Eco-3DTR y la tomografía computarizada ultrarrápida (TC ultrarrápida son dos nuevos métodos de análisis de la fracción de eyección (FE y de los volúmenes del ventrículo izquierdo (VI. OBJETIVO: Comparar las mediciones de la fracción de eyección del ventrículo izquierdo (FEVI y de los volúmenes del VI apurados por la Eco-3DTR y por la TC ultrarrápida. MÉTODOS: Se estudiaron, mediante la Eco-3DTR y la TC ultrarrápida de 64 cortes, a 39 pacientes consecutivos (27 varones, promedio de edad de 57±12 años. Se analizaron: FEVI y volúmenes del VI. Análisis estadístico: coeficiente de correlación (r: Pearson, prueba de Bland & Altman, prueba de regresión lineal, 95 % IC, pBACKGROUND: Real-time three-dimensional echocargiography (RT-3D-Echo and ultrafast computed tomography (CT are two novel methods for the analysis of LV ejection fraction and volumes. OBJECTIVE: To compare LVEF and volume measurements as obtained using RT-3D-Echo and ultrafast CT. METHODS: Thirty nine consecutive patients (27 men, mean age of 57±12 years were studied using RT-3D-Echo and 64-slice ultrafast CT. LVEF and LV volumes were analyzed. Statistical analysis: coefficient of correlation (r: Pearson, Bland-Altman analysis, linear regression analysis, 95% CI, p<0.05. RESULTS: RT-3D

  6. Quantitative analysis of cardiac function: Comparison of electrocardiogram dual gated single photon emission tomography, planar radionuclide ventriculogram and contrast ventriculography in the determination of LV volume and ejection fraction

    Energy Technology Data Exchange (ETDEWEB)

    Ziada, G.; Abdel-Dayem, H.M.; Higazy, E.; Mohamed, M.M.; Bahar, R.; Hayat, N.; Yousof, A.M.


    A dual gated tomography (DGT) program for end systolic and end diastolic acquisition and subsequent processing for calculation of LVEF, end diastolic and end systolic volumes (EDV, ESV) has been evaluated in 20 healthy volunteers (25 years-40 years) and 45 patients (25 years-60 years): 20 with ischaemic heart disease and 25 with valvular heart disease (VHD). All had biplane multigated blood pool (MUGA) studies in the 40/sup 0/ LAO projection using in vivo /sup 99m/Tc-R BCs, immediately followed by DG. The results in the patients group were correlated with contrast ventriculography (CV). In the volunteer group, the normal values for LVEF, EDV and ESV measured with DGT were found to be 63%+10%, 91 ml + 6 ml and 30 ml + 6ml and r value for the LVEF=0.91 compared with MUGA. In the IHD group, r values compared with CV were 0.915 and 0.97 for the EDV and ESV and 0.934 for the LVEF. Compared with the MUGA, the r value for LVEF was 0.883. In the VHD group, r values were 0.98 for both the EDV and ESV and 0.948 for the LVEF (P<0.002) compared with CV and 0.789 for the LVEF compared with the MUGA. We feel that DGT is an accurate and reproducible technique for LV function measurements.

  7. Fractional and noncommutative spacetimes

    NARCIS (Netherlands)

    Arzano, M.; Calcagni, M.; Oriti, D.; Scalisi, M.


    We establish a mapping between fractional and noncommutative spacetimes in configuration space. Depending on the scale at which the relation is considered, there arise two possibilities. For a fractional spacetime with log-oscillatory measure, the effective measure near the fundamental scale determi

  8. Can Kindergartners Do Fractions? (United States)

    Cwikla, Julie


    Mathematics professor Julie Cwikla decided that she needed to investigate young children's understandings and see what precurricular partitioning notions young minds bring to the fraction table. Cwikla realized that only a handful of studies have examined how preschool-age and early elementary school-age students solve fraction problems (Empson…

  9. Can Kindergartners Do Fractions? (United States)

    Cwikla, Julie


    Mathematics professor Julie Cwikla decided that she needed to investigate young children's understandings and see what precurricular partitioning notions young minds bring to the fraction table. Cwikla realized that only a handful of studies have examined how preschool-age and early elementary school-age students solve fraction problems (Empson…

  10. An Appetite for Fractions (United States)

    Wilkerson, Trena L.; Bryan, Tommy; Curry, Jane


    This article describes how using candy bars as models gives sixth-grade students a taste for learning to represent fractions whose denominators are factors of twelve. Using paper models of the candy bars, students explored and compared fractions. They noticed fewer different representations for one-third than for one-half. The authors conclude…

  11. Categories of Fractions Revisited


    Fritz, Tobias


    The theory of categories of fractions as originally developed by Gabriel and Zisman is reviewed in a pedagogical manner giving detailed proofs of all statements. A weakening of the category of fractions axioms used by Higson is discussed and shown to be equivalent to the original axioms.

  12. On fractional programming

    Energy Technology Data Exchange (ETDEWEB)

    Bajona-Xandri, C.; Martinez-Legaz, J.E.


    This paper studies the minimax fractional programming problem, assuming quasiconvexity of the objective function, under the lower subdifferentiability viewpoint. Necessary and sufficient optimality conditions and dual properties are found. We present applications of this theory to find the Pareto efficient solutions of a multiobjective fractional problem and to solve several economic models.

  13. Fractional calculus in bioengineering. (United States)

    Magin, Richard L


    Fractional calculus (integral and differential operations of noninteger order) is not often used to model biological systems. Although the basic mathematical ideas were developed long ago by the mathematicians Leibniz (1695), Liouville (1834), Riemann (1892), and others and brought to the attention of the engineering world by Oliver Heaviside in the 1890s, it was not until 1974 that the first book on the topic was published by Oldham and Spanier. Recent monographs and symposia proceedings have highlighted the application of fractional calculus in physics, continuum mechanics, signal processing, and electromagnetics, but with few examples of applications in bioengineering. This is surprising because the methods of fractional calculus, when defined as a Laplace or Fourier convolution product, are suitable for solving many problems in biomedical research. For example, early studies by Cole (1933) and Hodgkin (1946) of the electrical properties of nerve cell membranes and the propagation of electrical signals are well characterized by differential equations of fractional order. The solution involves a generalization of the exponential function to the Mittag-Leffler function, which provides a better fit to the observed cell membrane data. A parallel application of fractional derivatives to viscoelastic materials establishes, in a natural way, hereditary integrals and the power law (Nutting/Scott Blair) stress-strain relationship for modeling biomaterials. In this review, I will introduce the idea of fractional operations by following the original approach of Heaviside, demonstrate the basic operations of fractional calculus on well-behaved functions (step, ramp, pulse, sinusoid) of engineering interest, and give specific examples from electrochemistry, physics, bioengineering, and biophysics. The fractional derivative accurately describes natural phenomena that occur in such common engineering problems as heat transfer, electrode/electrolyte behavior, and sub

  14. Social Trust and Fractionalization:

    DEFF Research Database (Denmark)

    Bjørnskov, Christian


    This paper takes a closer look at the importance of fractionalization for the creation of social trust. It first argues that the determinants of trust can be divided into two categories: those affecting individuals' trust radii and those affecting social polarization. A series of estimates using...... a much larger country sample than in previous literature confirms that fractionalization in the form of income inequality and political diversity adversely affects social trust while ethnic diversity does not. However, these effects differ systematically across countries, questioning standard...... interpretations of the influence of fractionalization on trust....

  15. Discrete fractional calculus

    CERN Document Server

    Goodrich, Christopher


    This text provides the first comprehensive treatment of the discrete fractional calculus. Experienced researchers will find the text useful as a reference for discrete fractional calculus and topics of current interest. Students who are interested in learning about discrete fractional calculus will find this text to provide a useful starting point. Several exercises are offered at the end of each chapter and select answers have been provided at the end of the book. The presentation of the content is designed to give ample flexibility for potential use in a myriad of courses and for independent study. The novel approach taken by the authors includes a simultaneous treatment of the fractional- and integer-order difference calculus (on a variety of time scales, including both the usual forward and backwards difference operators). The reader will acquire a solid foundation in the classical topics of the discrete calculus while being introduced to exciting recent developments, bringing them to the frontiers of the...

  16. Fractional Derivative Cosmology

    CERN Document Server

    Roberts, Mark D


    The degree by which a function can be differentiated need not be restricted to integer values. Usually most of the field equations of physics are taken to be second order, curiosity asks what happens if this is only approximately the case and the field equations are nearly second order. For Robertson-Walker cosmology there is a simple fractional modification of the Friedman and conservation equations. In general fractional gravitational equations similar to Einstein's are hard to define as this requires fractional derivative geometry. What fractional derivative geometry might entail is briefly looked at and it turns out that even asking very simple questions in two dimensions leads to ambiguous or intractable results. A two dimensional line element which depends on the Gamma-function is looked at.

  17. The economic efficiency of investment in the development of reserves of small groups of geographically contiguous gold deposits

    Directory of Open Access Journals (Sweden)

    Evdokimov S.I.


    Full Text Available The object of the research is a group of geographically contiguous low volume gold deposits. The subject of the study is an economic justification for a way to involve economic turnover to get a positive commercial result on a specially formed group of gold deposits, in which individual field development is unprofitable. A small production volume, combined with high capital and operating costs are objective reasons for the reduction in investment attractiveness of the deposits which have reserves of gold of 50%, equipped with a mobile processing complex with deep processing technology on highly liquid commodity products on site. An economic-mathematical model was devised to determine the rational placement of the processing capacity of the group.A simulation was conducted and an economic evaluation was performed on the effectiveness of investments in individual and group mining projects. The simulation results show that the joint exploitation of the reserves of the group of deposits, the internal rate of return on investments exceed the rate of return of funds to the bank deposit, the return on investment is above the level of inflation. The group project complies with the strategic line of small mining companies in terms of cost recovery terms, availability of financial sources to cover expenses, provision of stable means of income and obtaining competitive advantage.

  18. Intracellular Cadmium Isotope Fractionation (United States)

    Horner, T. J.; Lee, R. B.; Henderson, G. M.; Rickaby, R. E.


    Recent stable isotope studies into the biological utilization of transition metals (e.g. Cu, Fe, Zn, Cd) suggest several stepwise cellular processes can fractionate isotopes in both culture and nature. However, the determination of fractionation factors is often unsatisfactory, as significant variability can exist - even between different organisms with the same cellular functions. Thus, it has not been possible to adequately understand the source and mechanisms of metal isotopic fractionation. In order to address this problem, we investigated the biological fractionation of Cd isotopes within genetically-modified bacteria (E. coli). There is currently only one known biological use or requirement of Cd, a Cd/Zn carbonic anhydrase (CdCA, from the marine diatom T. weissfloggii), which we introduce into the E. coli genome. We have also developed a cleaning procedure that allows for the treating of bacteria so as to study the isotopic composition of different cellular components. We find that whole cells always exhibit a preference for uptake of the lighter isotopes of Cd. Notably, whole cells appear to have a similar Cd isotopic composition regardless of the expression of CdCA within the E. coli. However, isotopic fractionation can occur within the genetically modified E. coli during Cd use, such that Cd bound in CdCA can display a distinct isotopic composition compared to the cell as a whole. Thus, the externally observed fractionation is independent of the internal uses of Cd, with the largest Cd isotope fractionation occurring during cross-membrane transport. A general implication of these experiments is that trace metal isotopic fractionation most likely reflects metal transport into biological cells (either actively or passively), rather than relating to expression of specific physiological function and genetic expression of different metalloenzymes.

  19. Digestion kinetics of carbohydrate fractions of citrus by-products. (United States)

    Lashkari, Saman; Taghizadeh, Akbar


    The present experiment was carried out to determine the digestion kinetics of carbohydrate fractions of citrus by-products. Grapefruit pulp (GP), lemon pulp (LE), lime pulp (LI) and orange pulp (OP) were the test feed. Digestion kinetic of whole citrus by-products and neutral detergent fiber (NDF) fraction and acid detergent fiber (ADF) fractions of citrus by-products were measured using the in vitro gas production technique. Fermentation kinetics of the neutral detergent soluble carbohydrates (NDSC) fraction and hemicelluloses were calculated using a curve subtraction. The fermentation rate of whole was the highest for the LE (p fractions. There was no significant difference among potential gas production (A) volumes of whole test feeds (p fractions of citrus by-products have high potential for degradability. It could also be concluded that carbohydrate fractions of citrus by-products have remarkable difference in digestion kinetics and digestive behavior.

  20. New Fractional Complex Transform for Conformable Fractional Partial Differential Equations

    Directory of Open Access Journals (Sweden)

    Çenesiz Y.


    Full Text Available Conformable fractional complex transform is introduced in this paper for converting fractional partial differential equations to ordinary differential equations. Hence analytical methods in advanced calculus can be used to solve these equations. Conformable fractional complex transform is implemented to fractional partial differential equations such as space fractional advection diffusion equation and space fractional telegraph equation to obtain the exact solutions of these equations.

  1. Fractional Brownian motion and motion governed by the fractional Langevin equation in confined geometries. (United States)

    Jeon, Jae-Hyung; Metzler, Ralf


    Motivated by subdiffusive motion of biomolecules observed in living cells, we study the stochastic properties of a non-Brownian particle whose motion is governed by either fractional Brownian motion or the fractional Langevin equation and restricted to a finite domain. We investigate by analytic calculations and simulations how time-averaged observables (e.g., the time-averaged mean-squared displacement and displacement correlation) are affected by spatial confinement and dimensionality. In particular, we study the degree of weak ergodicity breaking and scatter between different single trajectories for this confined motion in the subdiffusive domain. The general trend is that deviations from ergodicity are decreased with decreasing size of the movement volume and with increasing dimensionality. We define the displacement correlation function and find that this quantity shows distinct features for fractional Brownian motion, fractional Langevin equation, and continuous time subdiffusion, such that it appears an efficient measure to distinguish these different processes based on single-particle trajectory data.

  2. Fractional Vortices and Lumps

    CERN Document Server

    Eto, Minoru; Gudnason, Sven Bjarke; Konishi, Kenichi; Nagashima, Takayuki; Nitta, Muneto; Ohashi, Keisuke; Vinci, Walter


    We study what might be called fractional vortices, vortex configurations with the minimum winding from the viewpoint of their topological stability, but which are characterized by various notable substructures in the transverse energy distribution. The fractional vortices occur in diverse Abelian or non-Abelian generalizations of the Higgs model. The global and local features characterizing these are studied, and we identify the two crucial ingredients for their occurrence - the vacuum degeneracy leading to non-trivial vacuum moduli M, and the BPS nature of the vortices. Fractional vortices are further classified into two kinds. The first type of such vortices appear when M has orbifold Z_n singularities; the second type occurs in systems in which the vacuum moduli space M possesses either a deformed geometry or some singularity. These general features are illustrated with several concrete models.

  3. Fractional-order devices

    CERN Document Server

    Biswas, Karabi; Caponetto, Riccardo; Mendes Lopes, António; Tenreiro Machado, José António


    This book focuses on two specific areas related to fractional order systems – the realization of physical devices characterized by non-integer order impedance, usually called fractional-order elements (FOEs); and the characterization of vegetable tissues via electrical impedance spectroscopy (EIS) – and provides readers with new tools for designing new types of integrated circuits. The majority of the book addresses FOEs. The interest in these topics is related to the need to produce “analogue” electronic devices characterized by non-integer order impedance, and to the characterization of natural phenomena, which are systems with memory or aftereffects and for which the fractional-order calculus tool is the ideal choice for analysis. FOEs represent the building blocks for designing and realizing analogue integrated electronic circuits, which the authors believe hold the potential for a wealth of mass-market applications. The freedom to choose either an integer- or non-integer-order analogue integrator...

  4. Fractional and noncommutative spacetimes (United States)

    Arzano, Michele; Calcagni, Gianluca; Oriti, Daniele; Scalisi, Marco


    We establish a mapping between fractional and noncommutative spacetimes in configuration space. Depending on the scale at which the relation is considered, there arise two possibilities. For a fractional spacetime with log-oscillatory measure, the effective measure near the fundamental scale determining the log-period coincides with the nonrotation-invariant but cyclicity-preserving measure of κ-Minkowski spacetime. At scales larger than the log-period, the fractional measure is averaged and becomes a power law with real exponent. This can be also regarded as the cyclicity-inducing measure in a noncommutative spacetime defined by a certain nonlinear algebra of the coordinates, which interpolates between κ-Minkowski and canonical spacetime. These results are based upon a braiding formula valid for any nonlinear algebra which can be mapped onto the Heisenberg algebra.

  5. Fractional and noncommutative spacetimes

    CERN Document Server

    Arzano, Michele; Oriti, Daniele; Scalisi, Marco


    We establish a mapping between fractional and noncommutative spacetimes in configuration space. Depending on the scale at which the relation is considered, there arise two possibilities. For a fractional spacetime with log-oscillatory measure, the effective measure near the fundamental scale determining the log-period coincides with the non-rotation-invariant but cyclicity-preserving measure of \\kappa-Minkowski. At scales larger than the log-period, the fractional measure is averaged and becomes a power-law with real exponent. This can be also regarded as the cyclicity-inducing measure in a noncommutative spacetime defined by a certain nonlinear algebra of the coordinates, which interpolates between \\kappa-Minkowski and canonical spacetime. These results are based upon a braiding formula valid for any nonlinear algebra which can be mapped onto the Heisenberg algebra.

  6. Fractional standard map

    Energy Technology Data Exchange (ETDEWEB)

    Edelman, Mark, E-mail: edelman@cims.nyu.ed [Courant Institute of Mathematical Sciences, New York University, 251 Mercer St., New York, NY 10012 (United States)] [Department of Physics, Stern College at Yeshiva University, 245 Lexington Avenue, New York, NY 10016 (United States); Tarasov, Vasily E. [Courant Institute of Mathematical Sciences, New York University, 251 Mercer St., New York, NY 10012 (United States)] [Skobeltsyn Institute of Nuclear Physics, Moscow State University, Moscow 119991 (Russian Federation)


    Properties of the phase space of the standard map with memory are investigated. This map was obtained from a kicked fractional differential equation. Depending on the value of the map parameter and the fractional order of the derivative in the original differential equation, this nonlinear dynamical system demonstrates attractors (fixed points, stable periodic trajectories, slow converging and slow diverging trajectories, ballistic trajectories, and fractal-like structures) and/or chaotic trajectories. At least one type of fractal-like sticky attractors in the chaotic sea was observed.

  7. Tuberous sclerosis complex and polycystic kidney disease contiguous gene syndrome with Moyamoya disease. (United States)

    Lai, Jonathan; Modi, Lopa; Ramai, Daryl; Tortora, Matthew


    Tuberous sclerosis complex (TSC) and autosomal dominant polycystic kidney disease (ADPKD) are two diseases sharing close genetic loci on chromosome 16. Due to contiguous gene syndrome, also known as contiguous gene deletion syndrome, the proximity of TSC2 and PKD1 genes increases the risk of co-deletion resulting in a shared clinical presentation. Furthermore, Moyamoya disease (MMD) is a rare vaso-occlusive disease in the circle of Willis. We present the first case of TSC2/PKD1 contiguous gene syndrome in a patient with MMD along with detailed histopathologic, radiologic, and cytogenetic analyses. We also highlight the clinical presentation and surgical complications in this case. Copyright © 2017 Elsevier GmbH. All rights reserved.

  8. Study of oil and residual fractions in products of thermal destruction of bitumen beds

    Energy Technology Data Exchange (ETDEWEB)

    Diskina, D.Ye.; Kadyrov, M.U.; Shabalina, T.N.; Soldatova, V.G.; Tokareva, R.V.; Tyshchenko, N.Ye.; Usacheva, G.M.; Vigdergauz, M.S.


    Investigation of average and heavy fractions derived from thermodestruction products in the bitumen bed at Mordovo-Karmal in Tatariya. Composition of average fractions is characterized by presence of unsaturated and a certain volume of oxygen-containing compounds, as well as high content of S and a low congelation temp. With respect to content of aromatic compounds, these fractions are similar to fractions of sulphurous oils. Residual fractions (..-->..350/sup 0/) were studied by conversion chromatography; these have low values of viscosity, density, content of S (in comparison with the same fractions of Mordovo-Karmal oil). Examines potential directions for utilizing these fractions.

  9. From Complex Fractional Fourier Transform to Complex Fractional Radon Transform

    Institute of Scientific and Technical Information of China (English)

    FAN Hong-Yi; JIANG Nian-Quan


    We show that for n-dimensional complex fractional Fourier transform the corresponding complex fractional Radon transform can also be derived, however, it is different from the direct product of two n-dimensional real fractional Radon transforms. The complex fractional Radon transform of two-mode Wigner operator is calculated.

  10. Avoidance of Fractions. (United States)

    Hart, Kathleen; Kerslake, Daphne

    The Concepts in Secondary Mathematics and Science (CSMS) and Strategies and Errors in Secondary Mathematics (SESM) research projects based at Chelsa College, England, have shown the marked reluctance of secondary school students to use fractions when solving mathematical problems, even though they have been taught the topic for a number of years.…

  11. Brewing with fractionated barley

    NARCIS (Netherlands)

    Donkelaar, van L.H.G.


    Brewing with fractionated barley Beer is a globally consumed beverage, which is produced from malted barley, water, hops and yeast. In recent years, the use of unmalted barley and exogenous enzymes have become more popular because they enable simpler processing and reduced environmental impact. Raw

  12. Ramping up on Fractions (United States)

    Stephens, Ana C.; Bottge, Brian A.; Rueda, Enrique


    This article describes a technology-based and hands-on instructional intervention designed to advance middle school students' understandings of fractions. This problem-solving experience is based on the principles of Enhanced Anchored Instruction (EAI) and proved instructionally worthwhile and motivating to teachers and students in both inclusive …

  13. Sweet Work with Fractions (United States)

    Vinogradova, Natalya; Blaine, Larry


    Almost everyone loves chocolate. However, the same cannot be said about fractions, which are loved by markedly fewer. Middle school students tend to view them with wary respect, but little affection. The authors attempt to sweeten the subject by describing a type of game involving division of chocolate bars. The activity they describe provides a…

  14. Momentum fractionation on superstrata (United States)

    Bena, Iosif; Martinec, Emil; Turton, David; Warner, Nicholas P.


    Superstrata are bound states in string theory that carry D1, D5, and momentum charges, and whose supergravity descriptions are parameterized by arbitrary functions of (at least) two variables. In the D1-D5 CFT, typical three-charge states reside in high-degree twisted sectors, and their momentum charge is carried by modes that individually have fractional momentum. Understanding this momentum fractionation holographically is crucial for understanding typical black-hole microstates in this system. We use solution-generating techniques to add momentum to a multi-wound supertube and thereby construct the first examples of asymptotically-flat superstrata. The resulting supergravity solutions are horizonless and smooth up to well-understood orbifold singularities. Upon taking the AdS3 decoupling limit, our solutions are dual to CFT states with momentum fractionation. We give a precise proposal for these dual CFT states. Our construction establishes the very nontrivial fact that large classes of CFT states with momentum fractionation can be realized in the bulk as smooth horizonless supergravity solutions.

  15. Fractional statistics and confinement

    CERN Document Server

    Gaete, P; Gaete, Patricio; Wotzasek, Clovis


    It is shown that a pointlike composite having charge and magnetic moment displays a confining potential for the static interaction while simultaneously obeying fractional statistics in a pure gauge theory in three dimensions, without a Chern-Simons term. This result is distinct from the Maxwell-Chern-Simons theory that shows a screening nature for the potential.

  16. Brewing with fractionated barley

    NARCIS (Netherlands)

    Donkelaar, van L.H.G.


    Brewing with fractionated barley Beer is a globally consumed beverage, which is produced from malted barley, water, hops and yeast. In recent years, the use of unmalted barley and exogenous enzymes have become more popular because they enable simpler processing and reduced environmental impact. Raw

  17. Fractional Differential Equation

    Directory of Open Access Journals (Sweden)

    Moustafa El-Shahed


    where 2<α<3 is a real number and D0+α is the standard Riemann-Liouville fractional derivative. Our analysis relies on Krasnoselskiis fixed point theorem of cone preserving operators. An example is also given to illustrate the main results.

  18. Dicty_cDB: Contig-U04993-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SM_Contig/Contig-U04993-1Q.Seq.d (339 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E... 0.001 >Contig-U04993-1 (Contig-U04993-1Q) /CSM_Contig/Contig-U04993-1Q.Seq.d Length = 339 Score...|||||||||||||||||||||||||||||| Sbjct: 286 taactttaatagaaacacataatttattagacaatagtaaattatcatatgacc 339 Score =...: 54 taaattgatttttcaaataataataataccacacccaaacacact 98 Score = 48.1 bits (24), Expect = 6e-06 Identities = 24...tggaacatctttgtagaattaact 186 Score = 42.1 bits (21), Expect = 4e-04 Identities =

  19. Dicty_cDB: Contig-U08438-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 05 sequences; 5,674,871 total letters Score E Sequences producing significant alignments: (bits) Value Conti...757-1Q) /CSM_Contig/Conti... 28 1.7 >Contig-U14622-1 (Contig-U14622-1Q) /CSM_Contig/Contig-U14622-1Q.Seq.d Length = 149 Score...aagntttttttttttnttttt 32 |||||||||||||||| ||||| Sbjct: 87 aaagntttttttttttattttt 66 Score...nttttt 32 ||||||||||| ||||| Sbjct: 136 ttttttttttttttttt 120 Score = 28.2 bits (14), Expect = 1.7 Identities... = 16/17 (94%) Strand = Plus / Plus Query: 16 tttttttttttnttttt 32 ||||||||||| ||||| Sbjct: 85 ttttttttttttttttt 101 Score

  20. Dicty_cDB: Contig-U06756-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ontig/Contig-U06756-1Q.Seq.d (336 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Seq... >Contig-U06756-1 (Contig-U06756-1Q) /CSM_Contig/Contig-U06756-1Q.Seq.d Length = 336 Score...125 Query: 126 at 127 || Sbjct: 126 at 127 Score = 69.9 bits (35), Expect = 2e-12 Identities = 35/35 (100%) ...ct: 1 caaaataatgataaatcaaattaaattatttattt 35 Score = 65.9 bits (33), Expect = 3e-11 Identities = 36/36 (100%...|||||||||||||||||||||||||||||| Sbjct: 253 ttaaaaatnccttttttttttttttggggaaatttt 288 Score = 28.2 bits (14), E

  1. Dicty_cDB: Contig-U13336-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available g/Contig-U13336-1Q.Seq.d (630 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequenc...Q) /CSM_Contig/Conti... 32 0.69 >Contig-U13336-1 (Contig-U13336-1Q) /CSM_Contig/Contig-U13336-1Q.Seq.d Length = 630 Score...tgaacaaccaactgaatcatcaaatg 388 |||||||||||||||||||||||||||| Sbjct: 361 gctgaacaaccaactgaatcatcaaatg 388 Score...|||||||||| Sbjct: 580 gctgaacaaccaactgattcacaacaaccaccagcagaatcatcatcagcc 630 Score = 60.0 bits (30), Expect...|||||||||| Sbjct: 365 aacaaccaactgaatcatcaaatgctgaacaacaacaaactgactcacaacaacca 420 Score = 50.1 bits (25), E

  2. Synthetic Strategies toward Natural Products Containing Contiguous Stereogenic Quaternary Carbon Atoms. (United States)

    Büschleb, Martin; Dorich, Stéphane; Hanessian, Stephen; Tao, Daniel; Schenthal, Kyle B; Overman, Larry E


    Strategies for the total synthesis of complex natural products that contain two or more contiguous stereogenic quaternary carbon atoms in their intricate structures are reviewed with 12 representative examples. Emphasis has been put on methods to create quaternary carbon stereocenters, including syntheses of the same natural product by different groups, thereby showcasing the diversity of thought and individual creativity. A compendium of selected natural products containing two or more contiguous stereogenic quaternary carbon atoms and key reactions in their total or partial syntheses is provided in the Supporting Information.

  3. Effect of reinforcement volume fraction on the density & elastic ...

    African Journals Online (AJOL)

    صﺧﻟﻣ. ق. ﻲﻧدﻌﻣﻟا جﺎﺟزﻟا نﻣ سﮐﯾرﺗﺎﻣ وﻧ طﯾﻟﺧﻟﻟ ﺔﯾﻟوطﻟا ﺔﻧورﻣﻟا تﺑاوﺛ و ﺔﻓﺎﺛﮐﻟا ﯽﻟﻋ ﺔﯾوﻘﻣﻟا فﺎﯾﻟﻷا ﺔﺑﺳﻧ رﯾﻐﺗ رﯾﺛﺄﺗ ﺔﺳاردﺑ ﺎﻧﻣ. ) Zr41.2Ti13.8Cu12.5Ni10Be22.5. (. نﻣ فﺎﯾﻟﺄﺑ ﺔﻣﻋدﻣﻟا. : glass E. ,. Fe.

  4. High Volume Fraction Carbon Nanotube Composites for Aerospace Applications (United States)

    Siochi, Emilie J.; Kim, Jae-Woo; Sauti, Godfrey; Cano, Roberto J.; Wincheski, Russell A.; Ratcliffe, James G.; Czabaj, Michael; Jensen, Benjamin D.; Wise, Kristopher E.


    Reported nanoscale mechanical properties of carbon nanotubes (CNTs) suggest that their use may enable the fabrication of significantly lighter structures for use in space applications. To be useful in the fabrication of large structures, however, their attractive nanoscale properties must be retained as they are scaled up to bulk materials and converted into practically useful forms. Advances in CNT production have significantly increased the quantities available for use in manufacturing processes, but challenges remain with the retention of nanoscale properties in larger assemblies of CNTs. This work summarizes recent progress in producing carbon nanotube composites with tensile properties approaching those of carbon fiber reinforced polymer composites. These advances were achieved in nanocomposites with CNT content of 70% by weight. The processing methods explored to yield these CNT composite properties will be discussed, as will the characterization and test methods that were developed to provide insight into the factors that contribute to the enhanced tensile properties. Technology maturation was guided by parallel advancements in computational modeling tools that aided in the interpretation of experimental data.

  5. High Volume Fraction Carbon Nanotube Composites for Aerospace Applications (United States)

    Siochi, E. J.; Kim, J.-W.; Sauti, G.; Cano, R. J.; Wincheski, R. A.; Ratcliffe, J. G.; Czabaj, M.


    Reported mechanical properties of carbon nanotubes (CNTs) at the nanoscale suggest their potential to enable significantly lighter structures of interest for space applications. However, their utility depends on the retention of these properties in bulk material formats that permit practical fabrication of large structures. This presentation summarizes recent progress made to produce carbon nanotube composites with specific tensile properties that begin to rival those of carbon fiber reinforced polymer composites. CNT content in these nanocomposites was greater than 70% by weight. Tested nanocomposite specimens were fabricated from kilometers or tens of square meters of CNT, depending on the starting material format. Processing methods to yield these results, and characterization and testing to evaluate the performance of these composites will be discussed. The final objective is the demonstration of a CNT composite overwrapped pressure vessel to be flight tested in the Fall of 2016.

  6. A Computer-Interfaced Drop Counter as an Inexpensive Fraction Collector for Column Chromatography (United States)

    Nash, Barbara T.


    A computer-interfaced drop counter is described that serves as an inexpensive alternative to a fraction collector for column chromatography experiments. Undergraduate biochemistry laboratories frequently do not have the budget to purchase fraction collectors. Protocols that call for the manual measurement of fraction volumes as well as the manual…

  7. A Computer-Interfaced Drop Counter as an Inexpensive Fraction Collector for Column Chromatography (United States)

    Nash, Barbara T.


    A computer-interfaced drop counter is described that serves as an inexpensive alternative to a fraction collector for column chromatography experiments. Undergraduate biochemistry laboratories frequently do not have the budget to purchase fraction collectors. Protocols that call for the manual measurement of fraction volumes as well as the manual…

  8. Dependence of stability of metastable superconductors on copper fraction

    Energy Technology Data Exchange (ETDEWEB)

    Elrod, S. A.; Lue, J. W.; Miller, J. R.; Dresner, L.


    The stability of composite superconductors operating in the metastable regime depends upon such factors as matrix resistivity, cooled surface dimensions, fraction of critical current, and volume fraction of stabilizer. By assuming constant thermophysical properties, we developed analytic expressions for the energy and voltage of the minimum propagating zone (MPZ). With other factors held constant, these expressions have been used to predict composite superconductor stability as a function of copper fraction: lower copper fractions lead to higher MPZ energies. MPZ voltages have been measured for three NbTi/Cu composites having different copper fractions and different critical current densities for several magnetic fields and transport currents. Experimental MPZ voltages have been used to calculate an effective heat transfer coefficient, which is subsequently used to calculate the MPZ energy. The experimental MPZ energies support the theoretical expectation that lower copper fractions lead to higher stability in the metastable regime.

  9. Creating, Naming, and Justifying Fractions (United States)

    Siebert, Daniel; Gaskin, Nicole


    For students to develop meaningful conceptions of fractions and fraction operations, they need to think of fractions in terms other than as just whole-number combinations. In this article, we suggest two powerful images for thinking about fractions that move beyond whole-number reasoning. (Contains 5 figures.)

  10. -Dimensional Fractional Lagrange's Inversion Theorem

    Directory of Open Access Journals (Sweden)

    F. A. Abd El-Salam


    Full Text Available Using Riemann-Liouville fractional differential operator, a fractional extension of the Lagrange inversion theorem and related formulas are developed. The required basic definitions, lemmas, and theorems in the fractional calculus are presented. A fractional form of Lagrange's expansion for one implicitly defined independent variable is obtained. Then, a fractional version of Lagrange's expansion in more than one unknown function is generalized. For extending the treatment in higher dimensions, some relevant vectors and tensors definitions and notations are presented. A fractional Taylor expansion of a function of -dimensional polyadics is derived. A fractional -dimensional Lagrange inversion theorem is proved.

  11. Fractional lattice charge transport (United States)

    Flach, Sergej; Khomeriki, Ramaz


    We consider the dynamics of noninteracting quantum particles on a square lattice in the presence of a magnetic flux α and a dc electric field E oriented along the lattice diagonal. In general, the adiabatic dynamics will be characterized by Bloch oscillations in the electrical field direction and dispersive ballistic transport in the perpendicular direction. For rational values of α and a corresponding discrete set of values of E(α) vanishing gaps in the spectrum induce a fractionalization of the charge in the perpendicular direction - while left movers are still performing dispersive ballistic transport, the complementary fraction of right movers is propagating in a dispersionless relativistic manner in the opposite direction. Generalizations and the possible probing of the effect with atomic Bose-Einstein condensates and photonic networks are discussed. Zak phase of respective band associated with gap closing regime has been computed and it is found converging to π/2 value. PMID:28102302

  12. Fractions in elementary education

    CERN Document Server

    Quinn, Frank


    This paper is one of a series in which elementary-education practice is analyzed by comparison with the history of mathematics, mathematical structure, modern practice, and (occasionally) cognitive neuroscience. The primary concerns are: Why do so many children find elementary mathematics difficult? And, why are the ones who succeed still so poorly prepared for college material needed for technical careers? The answer provided by conventional wisdom is essentially that mathematics is difficult. Third-graders are not developmentally ready for the subtlety of fractions, for instance, and even high-performing students cannot be expected to develop the skills of experienced users. However we will see that this is far from the whole story and is probably wrong: elementary-education fractions are genuinely harder and less effective than the version employed by experienced users. Experts discard at least 90% of what is taught in schools. Our educational system is actually counterproductive for skill development, and...

  13. Testing Fractional Action Cosmology

    CERN Document Server

    Shchigolev, V K


    The present work deals with a combined test of the so-called Fractional Action Cosmology (FAC) on the example of a specific model obtained by the author earlier. In this model, the effective cosmological term is proportional to the Hubble parameter squared through the so-called kinematic induction. The reason of studying this cosmological model could be explained by its ability to describe two periods of accelerated expansion, that is in agreement with the recent observations and the cosmological inflation paradigm. First of all, we put our model through the theoretical tests that gives a general conception of the influence of the model parameters on its behavior. Then, we obtain some restrictions on the principal parameters of the model, including the fractional index, by means of the observational data. Finally, the cosmography parameters and the observational data compared to the theoretical predictions are presented both analytically and graphically.

  14. Testing fractional action cosmology (United States)

    Shchigolev, V. K.


    The present work deals with a combined test of the so-called Fractional Action Cosmology (FAC) on the example of a specific model obtained by the author earlier. In this model, the effective cosmological term is proportional to the Hubble parameter squared through the so-called kinematic induction. The reason of studying this cosmological model could be explained by its ability to describe two periods of accelerated expansion, that is in agreement with the recent observations and the cosmological inflation paradigm. First of all, we put our model through the theoretical tests, which gives a general conception of the influence of the model parameters on its behavior. Then, we obtain some restrictions on the principal parameters of the model, including the fractional index, by means of the observational data. Finally, the cosmography parameters and the observational data compared to the theoretical predictions are presented both analytically and graphically.

  15. Nonlinear fractional relaxation

    Indian Academy of Sciences (India)

    A Tofighi


    We define a nonlinear model for fractional relaxation phenomena. We use -expansion method to analyse this model. By studying the fundamental solutions of this model we find that when → 0 the model exhibits a fast decay rate and when → ∞ the model exhibits a power-law decay. By analysing the frequency response we find a logarithmic enhancement for the relative ratio of susceptibility.

  16. Brewing with fractionated barley


    Donkelaar, van, CC René


    Brewing with fractionated barley Beer is a globally consumed beverage, which is produced from malted barley, water, hops and yeast. In recent years, the use of unmalted barley and exogenous enzymes have become more popular because they enable simpler processing and reduced environmental impact. Raw barley, however, contains less endogenous enzymes and more undesired components for the use of beer brewing, compared to malted barley.  The overall aim of this thesis is to investigate how ba...

  17. A comparison of anatomical and dosimetric variations in the first 15 fractions, and between fractions 16 and 25, of intensity-modulated radiotherapy for nasopharyngeal carcinoma. (United States)

    Yang, Haihua; Tu, Yu; Wang, Wei; Hu, Wei; Ding, Weijun; Yu, Changhui; Zhou, Chao


    The purpose of this study was to compare anatomical and dosimetric variations in first 15 fractions, and between fractions 16 and 25, during intensity-modulated radiotherapy (IMRT) for nasopharyngeal carcinoma (NPC). Twenty-three NPC patients who received IMRT in 33 fractions were enrolled. Each patient had two repeat computed tomography (CT) scans before the 16th and 25th fraction. Hybrid IMRT plans were generated to evaluate the dosimetric changes. There was a significant decrease of the transverse diameter of nasopharyngeal and neck as well as gross tumor volume (GTV) in the primary nasopharyngeal carcinoma (GTVnx) and involved lymph nodes (GTVnd) during the first 15 fractions, and between fraction 16 and 25 (p fractions treatment compared to that between fraction 16 and 25 (p fractions (p fraction 16 and 25. While the maximum dose to the spinal cord was significantly increased both in the first 15 fractions, and between fraction 16 and 25 (p fractions compared to that between fraction 16 and 25 (p fractions, and between fractions 16 and 25, of IMRT.

  18. Momentum Fractionation on Superstrata

    CERN Document Server

    Bena, Iosif; Turton, David; Warner, Nicholas P


    Superstrata are bound states in string theory that carry D1, D5, and momentum charges, and whose supergravity descriptions are parameterized by arbitrary functions of (at least) two variables. In the D1-D5 CFT, typical three-charge states reside in high-degree twisted sectors, and their momentum charge is carried by modes that individually have fractional momentum. Understanding this momentum fractionation holographically is crucial for understanding typical black-hole microstates in this system. We use solution-generating techniques to add momentum to a multi-wound supertube and thereby construct the first examples of asymptotically-flat superstrata. The resulting supergravity solutions are horizonless and smooth up to well-understood orbifold singularities. Upon taking the AdS3 decoupling limit, our solutions are dual to CFT states with momentum fractionation. We give a precise proposal for these dual CFT states. Our construction establishes the very nontrivial fact that large classes of CFT states with mom...

  19. Fractional derivatives for physicists and engineers background and theory

    CERN Document Server

    Uchaikin, Vladimir V


    The first derivative of a particle coordinate means its velocity, the second means its acceleration, but what does a fractional order derivative mean? Where does it come from, how does it work, where does it lead to? The two-volume book written on high didactic level answers these questions. Fractional Derivatives for Physicists and Engineers— The first volume contains a clear introduction into such a modern branch of analysis as the fractional calculus. The second develops a wide panorama of applications of the fractional calculus to various physical problems. This book recovers new perspectives in front of the reader dealing with turbulence and semiconductors, plasma and thermodynamics, mechanics and quantum optics, nanophysics and astrophysics.  The book is addressed to students, engineers and physicists, specialists in theory of probability and statistics, in mathematical modeling and numerical simulations, to everybody who doesn't wish to stay apart from the new mathematical methods becoming more and ...

  20. Flow Cytometric Analysis of DNA Content in Parotid Tumor and Its Contiguous Acini

    Institute of Scientific and Technical Information of China (English)

    ZHU Shengrong; SHAO Lenan; CHEN Weimin; WU Huihua; WANG Xiuli; CHEN Xinming


    To investigate the relationship between proliferative capacity of salivary gland cells in contiguous acini of parotid tumors and recurrent neoplasma, DNA contents of 30 fresh specimens of parotid were studied by using cytometry in tumors, normal and shallow or deep lobe acini of the masses. The results showed that the DI was 1.369, S % 16.95, PI 26.18 in malignant tumors;DI was 1.171, S % 12.41, PI 15.54 in recurrent pleomorphic adenoma; DI was 1.141, S % 12.74, PI 13.07 in pleomorphic adenoma, DI was 0.999, S % 5.10, PI 8.00 in normal acini. Analysis of variance showed there was a significant difference (P<0.01). The average DNA contents of shallow on deep lobe of contiguous tumors was 1.08 in DI, 10. 65 in S %, 13.49 in PI in malignant tumor, 1.06 in DI, 8.96 in S % and 9.85 in PI in pleomorphic adenoma, which were all higher than in normal acini (P>0.05). It was concluded that the levels of DI and S % of parotid tumor and its contiguous acini are related to degree of malignancy or recurrent condition of the tumors, suggesting contiguous acini of parotid tumors had the strong capacity of proliferation,which might play an important role in recurrent or malignant change of the parotid tumors.

  1. CONTIGuator: a bacterial genomes finishing tool for structural insights on draft genomes

    Directory of Open Access Journals (Sweden)

    Bazzicalupo Marco


    Full Text Available Abstract Recent developments in sequencing technologies have given the opportunity to sequence many bacterial genomes with limited cost and labor, compared to previous techniques. However, a limiting step of genome sequencing is the finishing process, needed to infer the relative position of each contig and close sequencing gaps. An additional degree of complexity is given by bacterial species harboring more than one replicon, which are not contemplated by the currently available programs. The availability of a large number of bacterial genomes allows geneticists to use complete genomes (possibly from the same species as templates for contigs mapping. Here we present CONTIGuator, a software tool for contigs mapping over a reference genome which allows the visualization of a map of contigs, underlining loss and/or gain of genetic elements and permitting to finish multipartite genomes. The functionality of CONTIGuator was tested using four genomes, demonstrating its improved performances compared to currently available programs. Our approach appears efficient, with a clear visualization, allowing the user to perform comparative structural genomics analysis on draft genomes. CONTIGuator is a Python script for Linux environments and can be used on normal desktop machines and can be downloaded from

  2. Hebbian Learning is about contingency, not contiguity, and explains the emergence of predictive mirror neurons. (United States)

    Keysers, Christian; Perrett, David I; Gazzola, Valeria


    Hebbian Learning should not be reduced to contiguity, as it detects contingency and causality. Hebbian Learning accounts of mirror neurons make predictions that differ from associative learning: Through Hebbian Learning, mirror neurons become dynamic networks that calculate predictions and prediction errors and relate to ideomotor theories. The social force of imitation is important for mirror neuron emergence and suggests canalization.

  3. Building a Potential Wetland Restoration Indicator for the Contiguous United States. (United States)

    Wetlands provide key functions in the landscape from improving water quality, to regulating flows, to providing wildlife habitat. Over half of the wetlands in the contiguous United States (CONUS) have been converted to agricultural and urban land uses. However, over the last seve...

  4. Climate change presents increased potential for very large fires in the contiguous United States (United States)

    R. Barbero; J. T. Abatzoglou; Sim Larkin; C. A. Kolden; B. Stocks


    Very large fires (VLFs) have important implications for communities, ecosystems, air quality and fire suppression expenditures. VLFs over the contiguous US have been strongly linked with meteorological and climatological variability. Building on prior modelling of VLFs (>5000 ha), an ensemble of 17 global climate models were statistically downscaled over the US...

  5. Dicty_cDB: Contig-U07481-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available gnttttntgnatnattnnnggaataataaanaaacatttcngt 70 Query: 71 tnntagngccagggncatttcannttttttnttnaccatac 111 |||||...|||||||||||||||||||||||||||||||||||| Sbjct: 71 tnntagngccagggncatttcannttttttnttnaccatac 111 >Contig-U13902-...ngt 60 Query: 71 tnntagngccagggncatttcannttttttnttnaccatac 111 ||||||||||||||||||||||||||||||||||||||||| Sbj...ct: 61 tnntagngccagggncatttcannttttttnttnaccatac 101 Lambda K H 1.37 0.711 1.31 M

  6. Dicty_cDB: Contig-U14318-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available aaacnann 109 Query: 110 caaggngntncaaaggncncatnaaaagccnancccctttaagaaaac 157 |||||||||||||||||||||||||||||||...||||||||||||||||| Sbjct: 110 caaggngntncaaaggncncatnaaaagccnancccctttaagaaaac 157 >Contig-U11143-1 (Contig-U...ttanttttggtggnaaaaaaggntangantantggaaancaanncaaggngn 337 Query: 118 tncaaaggncncatnaaaagccna...ncccctttaagaaa 155 |||||||| ||||| |||||||||||||||||| |||| Sbjct: 338 tncaaaggccncatcaaaagccnanccc...inus Query: 120 caaaggncncatnaaaagccnancccctttaagaaaac 157 |||||||||||||||||||||||||||||||||||||| Sbjct: 42 caaaggncncatnaaaagccna

  7. Dicty_cDB: Contig-U13193-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4 (97%) Strand = Plus / Plus Query: 13 aatagaggnacccnacatggtgaacttggncaaagaaatcatagatttnaattgaaaatc 72 |||||...||||||||||||||||||||||||||||||||||||||||||||||||||||||| Sbjct: 13 aatagaggnacccnacatggtgaacttggncaaagaaatcat...| Sbjct: 313 gatgaaaaanaagaagatcnagatgctgatgaagaagaaaatgaagaagatagagcntgg 372 Query: 373 attgatgatattggnttgaatgatgatgatganacccna...||||||||||||| Sbjct: 373 attgatgatattggnttgaatgatgatgatganacccnagttgataattccacc 426 >Contig-U08437-1 (Contig...trand = Plus / Minus Query: 13 aatagaggnacccnacatggtgaacttggncaaagaaatcatagatttnaattgaaaatc 72 |||||||||||||

  8. Fractional random walk lattice dynamics

    CERN Document Server

    Michelitsch, Thomas; Riascos, Alejandro Perez; Nowakowski, Andrzeij; Nicolleau, Franck


    We analyze time-discrete and continuous `fractional' random walks on undirected regular networks with special focus on cubic periodic lattices in $n=1,2,3,..$ dimensions.The fractional random walk dynamics is governed by a master equation involving {\\it fractional powers of Laplacian matrices $L^{\\frac{\\alpha}{2}}$}where $\\alpha=2$ recovers the normal walk.First we demonstrate thatthe interval $0\\textless{}\\alpha\\leq 2$ is admissible for the fractional random walk. We derive analytical expressions for fractional transition matrix and closely related the average return probabilities. We further obtain thefundamental matrix $Z^{(\\alpha)}$, and the mean relaxation time (Kemeny constant) for the fractional random walk.The representation for the fundamental matrix $Z^{(\\alpha)}$ relates fractional random walks with normal random walks.We show that the fractional transition matrix elements exihibit for large cubic $n$-dimensional lattices a power law decay of an $n$-dimensional infinite spaceRiesz fractional deriva...

  9. Non-contiguous spinal injury in cervical spinal trauma: evaluation with cervical spine MRI

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Soo Jung; Shin, Myung Jin; Kim, Sung Moon [University of Ulsan College of Medicine, Seoul (Korea, Republic of); Bae, Sang Jin [Sanggyepaik Hospital, Inje University, Seoul (Korea, Republic of)


    We wished to evaluate the incidence of non-contiguous spinal injury in the cervicothoracic junction (CTJ) or the upper thoracic spines on cervical spinal MR images in the patients with cervical spinal injuries. Seventy-five cervical spine MR imagings for acute cervical spinal injury were retrospectively reviewed (58 men and 17 women, mean age: 35.3, range: 18-81 years). They were divided into three groups based on the mechanism of injury; axial compression, hyperflexion or hyperextension injury, according to the findings on the MR and CT images. On cervical spine MR images, we evaluated the presence of non-contiguous spinal injury in the CTJ or upper thoracic spine with regard to the presence of marrow contusion or fracture, ligament injury, traumatic disc herniation and spinal cord injury. Twenty-one cases (28%) showed CTJ or upper thoracic spinal injuries (C7-T5) on cervical spinal MR images that were separated from the cervical spinal injuries. Seven of 21 cases revealed overt fractures in the CTJs or upper thoracic spines. Ligament injury in these regions was found in three cases. Traumatic disc herniation and spinal cord injury in these regions were shown in one and two cases, respectively. The incidence of the non-contiguous spinal injuries in CTJ or upper thoracic spines was higher in the axial compression injury group (35.5%) than in the hyperflexion injury group (26.9%) or the hyperextension (25%) injury group. However, there was no statistical significance ({rho} > 0.05). Cervical spinal MR revealed non-contiguous CTJ or upper thoracic spinal injuries in 28% of the patients with cervical spinal injury. The mechanism of cervical spinal injury did not significantly affect the incidence of the non-contiguous CTJ or upper thoracic spinal injury.

  10. Gauge Invariant Fractional Electromagnetic Fields

    CERN Document Server

    Lazo, Matheus Jatkoske


    Fractional derivatives and integrations of non-integers orders was introduced more than three centuries ago but only recently gained more attention due to its application on nonlocal phenomenas. In this context, several formulations of fractional electromagnetic fields was proposed, but all these theories suffer from the absence of an effective fractional vector calculus, and in general are non-causal or spatially asymmetric. In order to deal with these difficulties, we propose a spatially symmetric and causal gauge invariant fractional electromagnetic field from a Lagrangian formulation. From our fractional Maxwell's fields arose a definition for the fractional gradient, divergent and curl operators.

  11. Fractional Langevin equation and Riemann-Liouville fractional derivative. (United States)

    Sau Fa, Kwok


    In this present work we consider a fractional Langevin equation with Riemann-Liouville fractional time derivative which modifies the classical Newtonian force, nonlocal dissipative force, and long-time correlation. We investigate the first two moments, variances and position and velocity correlation functions of this system. We also compare them with the results obtained from the same fractional Langevin equation which uses the Caputo fractional derivative.

  12. Preheating with fractional powers (United States)

    Moghaddam, Hossein Bazrafshan; Brandenberger, Robert


    We consider preheating in models in which the potential for the inflaton is given by a fractional power, as is the case in axion monodromy inflation. We assume a standard coupling between the inflaton field and a scalar matter field. We find that in spite of the fact that the oscillation of the inflaton about the field value which minimizes the potential is anharmonic, there is nevertheless a parametric resonance instability, and we determine the Floquet exponent which describes this instability as a function of the parameters of the inflaton potential.

  13. Fractional cointegration rank estimation

    DEFF Research Database (Denmark)

    Lasak, Katarzyna; Velasco, Carlos

    We consider cointegration rank estimation for a p-dimensional Fractional Vector Error Correction Model. We propose a new two-step procedure which allows testing for further long-run equilibrium relations with possibly different persistence levels. The fi…rst step consists in estimating......-likelihood ratio test of no-cointegration on the estimated p - r common trends that are not cointegrated under the null. The cointegration degree is re-estimated in the second step to allow for new cointegration relationships with different memory. We augment the error correction model in the second step...

  14. Fractional Reserve Banking


    Andreasen, Niels; Bjerregaard, Mads; Lund, Jonas; Olsen, Ove Bitsch; Rasmussen, Andreas Dalgas


    Projektet er bygget op omkring kritisk realisme, som er det gennemgående videnskabelige fundament til undersøgelsen af hvilke strukturelle grunde der er til finansiel ustabilitet i Danmark. Projektet går i dybden med Fractional Reserve Banking og incitamentsstrukturen i banksystemet. Vi bevæger os både på det makro- og mikroøkonomiske niveau i analysen. På makro niveau bruger vi den østrigske skole om konjunktur teori (The Positive Theory of the Cycle). På mikro niveau arbejder vi med princip...

  15. Fractional Reserve Banking


    Andreasen, Niels; Bjerregaard, Mads; Lund, Jonas; Olsen, Ove Bitsch; Rasmussen, Andreas Dalgas


    Projektet er bygget op omkring kritisk realisme, som er det gennemgående videnskabelige fundament til undersøgelsen af hvilke strukturelle grunde der er til finansiel ustabilitet i Danmark. Projektet går i dybden med Fractional Reserve Banking og incitamentsstrukturen i banksystemet. Vi bevæger os både på det makro- og mikroøkonomiske niveau i analysen. På makro niveau bruger vi den østrigske skole om konjunktur teori (The Positive Theory of the Cycle). På mikro niveau arbejder vi med princip...

  16. Fractional Integral Inequalities via Hadamard’s Fractional Integral



    We establish new fractional integral inequalities, via Hadamard’s fractional integral. Several new integral inequalities are obtained, including a Grüss type Hadamard fractional integral inequality, by using Young and weighted AM-GM inequalities. Many special cases are also discussed.

  17. Body Fractions: A Physical Approach to Fraction Learning (United States)

    Mills, Judith


    Many students experience great difficulty understanding the meaning of fractions. For many students who have spent their early mathematics lessons focusing on counting (whole) numbers, recognising that there are many numbers between those whole numbers called fractional numbers, is quite revolutionary. The foundation of understanding fractions is…

  18. Cosmological Models with Fractional Derivatives and Fractional Action Functional

    Institute of Scientific and Technical Information of China (English)

    V.K. Shchigolev


    Cosmological models of a scalar field with dynamical equations containing fractional derivatives or derived from the Einstein-Hilbert action of fractional order, are constructed. A number of exact solutions to those equations of fractional cosmological models in both eases is given.

  19. Tcp and NTCP radiobiological models: conventional and hypo fractionated treatments in radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Astudillo V, A.; Paredes G, L. [ININ, Carretera Mexico-Toluca s/n, Ocoyoacac 52750, Estado de Mexico (Mexico); Resendiz G, G.; Posadas V, A. [Hospital Angeles Lomas, Av. Vialidad de la Barranca s/n, Col. Valle de las Palmas, 52763 Huixquilucan de Degallado, Estado de Mexico (Mexico); Mitsoura, E. [Universidad Autonoma del Estado de Mexico, Facultad de Medicina, Paseo Tollocan, Esq. Jesus Carranza s/n, Col. Moderna de la Cruz, 50180 Toluca, Estado de Mexico (Mexico); Rodriguez L, A.; Flores C, J. M., E-mail: [Hospital Medica Sur, Puente de Piedra 150, Col. Toriello Guerra, 14050 Tlalpan, Mexico D. F. (Mexico)


    The hypo and conventional fractionated schedules performance were compared in terms of the tumor control and the normal tissue complications. From the records of ten patients, treated for adenocarcinoma and without mastectomy, the dose-volume histogram was used. Using radiobiological models the probabilities for tumor control and normal tissue complications were calculated. For both schedules the tumor control was approximately the same. However, the damage in the normal tissue was larger in conventional fractionated schedule. This is important because patients assistance time to their fractions (15 fractions/25 fractions) can be optimized. Thus, the hypo fractionated schedule has suitable characteristics to be implemented. (Author)

  20. Renormalized Volume (United States)

    Gover, A. Rod; Waldron, Andrew


    We develop a universal distributional calculus for regulated volumes of metrics that are suitably singular along hypersurfaces. When the hypersurface is a conformal infinity we give simple integrated distribution expressions for the divergences and anomaly of the regulated volume functional valid for any choice of regulator. For closed hypersurfaces or conformally compact geometries, methods from a previously developed boundary calculus for conformally compact manifolds can be applied to give explicit holographic formulæ for the divergences and anomaly expressed as hypersurface integrals over local quantities (the method also extends to non-closed hypersurfaces). The resulting anomaly does not depend on any particular choice of regulator, while the regulator dependence of the divergences is precisely captured by these formulæ. Conformal hypersurface invariants can be studied by demanding that the singular metric obey, smoothly and formally to a suitable order, a Yamabe type problem with boundary data along the conformal infinity. We prove that the volume anomaly for these singular Yamabe solutions is a conformally invariant integral of a local Q-curvature that generalizes the Branson Q-curvature by including data of the embedding. In each dimension this canonically defines a higher dimensional generalization of the Willmore energy/rigid string action. Recently, Graham proved that the first variation of the volume anomaly recovers the density obstructing smooth solutions to this singular Yamabe problem; we give a new proof of this result employing our boundary calculus. Physical applications of our results include studies of quantum corrections to entanglement entropies.

  1. Long memory and tail dependence in trading volume and volatility

    DEFF Research Database (Denmark)

    Rossi, Eduardo; Santucci de Magistris, Paolo


    We investigate the relationship between volatility, measured by realized volatility, and trading volume for 25 NYSE stocks. We show that volume and volatility are long memory but not fractionally cointegrated in most cases. We also find right tail dependence in the volatility and volume innovations...

  2. Long memory and tail dependence in trading volume and volatility

    DEFF Research Database (Denmark)

    Rossi, Eduardo; Santucci de Magistris, Paolo


    We investigate the relationship between volatility, measured by realized volatility, and trading volume for 25 NYSE stocks. We show that volume and volatility are long memory but not fractionally cointegrated in most cases. We also find right tail dependence in the volatility and volume innovations...

  3. Radiation dose-volume effects in the lung

    DEFF Research Database (Denmark)

    Marks, Lawrence B; Bentzen, Soren M; Deasy, Joseph O;


    The three-dimensional dose, volume, and outcome data for lung are reviewed in detail. The rate of symptomatic pneumonitis is related to many dosimetric parameters, and there are no evident threshold "tolerance dose-volume" levels. There are strong volume and fractionation effects....

  4. The Geminga Fraction

    CERN Document Server

    Harding, A K; Gonthier, P L; Harding, Alice K.; Grenier, Isabelle A.; Gonthier, Peter L.


    Radio-quiet gamma-ray pulsars like Geminga may account for a number of the unidentified EGRET sources in the Galaxy. The number of Geminga-like pulsars is very sensitive to the geometry of both the gamma-ray and radio beams. Recent studies of the shape and polarization of pulse profiles of young radio pulsars have provided evidence that their radio emission originates in wide cone beams at altitudes that are a significant fraction (1 -10%) of their light cylinder radius. Such wide radio emission beams will be visible at a much larger range of observer angles than the narrow core components thought to originate at lower altitude. Using 3D geometrical modeling that includes relativistic effects from pulsar rotation, we study the visibility of such radio cone beams as well as that of the gamma-ray beams predicted by slot gap and outer gap models. From the results of this study one can obtain revised predictions for the fraction of Geminga-like, radio quiet pulsars present in the gamma-ray pulsar population.

  5. NESDIS VIIRS Green Vegetation Fraction (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This dataset contains weekly Green Vegetation Fraction (GVF) derived from VIIRS. The Green Vegetation Fraction product is updated daily and is used as an input to...

  6. Advances in robust fractional control

    CERN Document Server

    Padula, Fabrizio


    This monograph presents design methodologies for (robust) fractional control systems. It shows the reader how to take advantage of the superior flexibility of fractional control systems compared with integer-order systems in achieving more challenging control requirements. There is a high degree of current interest in fractional systems and fractional control arising from both academia and industry and readers from both milieux are catered to in the text. Different design approaches having in common a trade-off between robustness and performance of the control system are considered explicitly. The text generalizes methodologies, techniques and theoretical results that have been successfully applied in classical (integer) control to the fractional case. The first part of Advances in Robust Fractional Control is the more industrially-oriented. It focuses on the design of fractional controllers for integer processes. In particular, it considers fractional-order proportional-integral-derivative controllers, becau...

  7. Fractional Reserve in Banking System


    Valkonen, Maria


    This thesis is aimed to provide understanding of the role of the fractional reserve in the mod-ern banking system worldwide and particularly in Finland. The fractional reserve banking is used worldwide, but the benefits of this system are very disputable. On the one hand, experts say that the fractional reserve is a necessary instrument for the normal business and profit making. On the other hand, sceptics openly criticize the fractional reserve system and blame it for fiat money (money n...

  8. Fractional Reserve in Banking System


    Valkonen, Maria


    This thesis is aimed to provide understanding of the role of the fractional reserve in the mod-ern banking system worldwide and particularly in Finland. The fractional reserve banking is used worldwide, but the benefits of this system are very disputable. On the one hand, experts say that the fractional reserve is a necessary instrument for the normal business and profit making. On the other hand, sceptics openly criticize the fractional reserve system and blame it for fiat money (money n...

  9. Experimental observation of fractional echoes (United States)

    Karras, G.; Hertz, E.; Billard, F.; Lavorel, B.; Siour, G.; Hartmann, J.-M.; Faucher, O.; Gershnabel, Erez; Prior, Yehiam; Averbukh, Ilya Sh.


    We report the observation of fractional echoes in a double-pulse excited nonlinear system. Unlike standard echoes, which appear periodically at delays which are integer multiples of the delay between the two exciting pulses, the fractional echoes appear at rational fractions of this delay. We discuss the mechanism leading to this phenomenon, and provide experimental demonstration of fractional echoes by measuring third harmonic generation in a thermal gas of CO2 molecules excited by a pair of femtosecond laser pulses.

  10. Fractional Hopfield Neural Networks: Fractional Dynamic Associative Recurrent Neural Networks. (United States)

    Pu, Yi-Fei; Yi, Zhang; Zhou, Ji-Liu


    This paper mainly discusses a novel conceptual framework: fractional Hopfield neural networks (FHNN). As is commonly known, fractional calculus has been incorporated into artificial neural networks, mainly because of its long-term memory and nonlocality. Some researchers have made interesting attempts at fractional neural networks and gained competitive advantages over integer-order neural networks. Therefore, it is naturally makes one ponder how to generalize the first-order Hopfield neural networks to the fractional-order ones, and how to implement FHNN by means of fractional calculus. We propose to introduce a novel mathematical method: fractional calculus to implement FHNN. First, we implement fractor in the form of an analog circuit. Second, we implement FHNN by utilizing fractor and the fractional steepest descent approach, construct its Lyapunov function, and further analyze its attractors. Third, we perform experiments to analyze the stability and convergence of FHNN, and further discuss its applications to the defense against chip cloning attacks for anticounterfeiting. The main contribution of our work is to propose FHNN in the form of an analog circuit by utilizing a fractor and the fractional steepest descent approach, construct its Lyapunov function, prove its Lyapunov stability, analyze its attractors, and apply FHNN to the defense against chip cloning attacks for anticounterfeiting. A significant advantage of FHNN is that its attractors essentially relate to the neuron's fractional order. FHNN possesses the fractional-order-stability and fractional-order-sensitivity characteristics.

  11. Nonholonomic constraints with fractional derivatives

    Energy Technology Data Exchange (ETDEWEB)

    Tarasov, Vasily E [Skobeltsyn Institute of Nuclear Physics, Moscow State University, Moscow 119992 (Russian Federation); Zaslavsky, George M [Courant Institute of Mathematical Sciences, New York University, 251 Mercer St, New York, NY 10012 (United States)


    We consider the fractional generalization of nonholonomic constraints defined by equations with fractional derivatives and provide some examples. The corresponding equations of motion are derived using variational principle. We prove that fractional constraints can be used to describe the evolution of dynamical systems in which some coordinates and velocities are related to velocities through a power-law memory function.

  12. How Weird Are Weird Fractions? (United States)

    Stuffelbeam, Ryan


    A positive rational is a weird fraction if its value is unchanged by an illegitimate, digit-based reduction. In this article, we prove that each weird fraction is uniquely weird and initiate a discussion of the prevalence of weird fractions.

  13. EnviroAtlas - Percent of Each 12-Digit HUC in the Contiguous U.S. with Potentially Restorable Wetlands (United States)

    U.S. Environmental Protection Agency — This EnviroAtlas dataset shows the percent of each 12-digit Hydrologic Unit (HUC) subwatershed in the contiguous U.S. with potentially restorable wetlands. Beginning...

  14. Nonhomogeneous fractional Poisson processes

    Energy Technology Data Exchange (ETDEWEB)

    Wang Xiaotian [School of Management, Tianjin University, Tianjin 300072 (China)]. E-mail:; Zhang Shiying [School of Management, Tianjin University, Tianjin 300072 (China); Fan Shen [Computer and Information School, Zhejiang Wanli University, Ningbo 315100 (China)


    In this paper, we propose a class of non-Gaussian stationary increment processes, named nonhomogeneous fractional Poisson processes W{sub H}{sup (j)}(t), which permit the study of the effects of long-range dependance in a large number of fields including quantum physics and finance. The processes W{sub H}{sup (j)}(t) are self-similar in a wide sense, exhibit more fatter tail than Gaussian processes, and converge to the Gaussian processes in distribution in some cases. In addition, we also show that the intensity function {lambda}(t) strongly influences the existence of the highest finite moment of W{sub H}{sup (j)}(t) and the behaviour of the tail probability of W{sub H}{sup (j)}(t)

  15. Membrane Assisted Enzyme Fractionation

    DEFF Research Database (Denmark)

    Yuan, Linfeng

    . In this thesis, separations using crossflow elecro-membrane filtration (EMF) of amino acids, bovine serum albumin (BSA) and industrial enzymes from Novozymes were performed. The main objective of this study was to investigate the technological feasibility of EMF in the application of industrial enzyme...... fractionation, such as removal of a side activity from the main enzyme activity. As a proof-of-concept, amino acids were used as model solution to test the feasibility of EMF in the application of amphoteric molecule separation. A single amino acid was used to illustrate the effect of an electric field...... on the separation performance were very small in the investigated range. The mass transport of each enzyme can be well explained by the Extended-Nernst-Planck equation. Better separation was observed at lower feed concentration, higher solution pH in the investigated range and with a polysulfone (PS) MF membrane...

  16. Membrane Assisted Enzyme Fractionation

    DEFF Research Database (Denmark)

    Yuan, Linfeng

    . In this thesis, separations using crossflow elecro-membrane filtration (EMF) of amino acids, bovine serum albumin (BSA) and industrial enzymes from Novozymes were performed. The main objective of this study was to investigate the technological feasibility of EMF in the application of industrial enzyme...... fractionation, such as removal of a side activity from the main enzyme activity. As a proof-of-concept, amino acids were used as model solution to test the feasibility of EMF in the application of amphoteric molecule separation. A single amino acid was used to illustrate the effect of an electric field...... on the separation performance were very small in the investigated range. The mass transport of each enzyme can be well explained by the Extended-Nernst-Planck equation. Better separation was observed at lower feed concentration, higher solution pH in the investigated range and with a polysulfone (PS) MF membrane...

  17. Fractional Chemotaxis Diffusion Equations

    CERN Document Server

    Langlands, T A M


    We introduce mesoscopic and macroscopic model equations of chemotaxis with anomalous subdiffusion for modelling chemically directed transport of biological organisms in changing chemical environments with diffusion hindered by traps or macro-molecular crowding. The mesoscopic models are formulated using Continuous Time Random Walk master equations and the macroscopic models are formulated with fractional order differential equations. Different models are proposed depending on the timing of the chemotactic forcing. Generalizations of the models to include linear reaction dynamics are also derived. Finally a Monte Carlo method for simulating anomalous subdiffusion with chemotaxis is introduced and simulation results are compared with numerical solutions of the model equations. The model equations developed here could be used to replace Keller-Segel type equations in biological systems with transport hindered by traps, macro-molecular crowding or other obstacles.

  18. Impact of Expanded North Slope of Alaska Crude Oil Production on Crude Oil Flows in the Contiguous United States

    Energy Technology Data Exchange (ETDEWEB)

    DeRosa, Sean E. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flanagan, Tatiana Paz [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)


    The National Transportation Fuels Model was used to simulate a hypothetical increase in North Slope of Alaska crude oil production. The results show that the magnitude of production utilized depends in part on the ability of crude oil and refined products infrastructure in the contiguous United States to absorb and adjust to the additional supply. Decisions about expanding North Slope production can use the National Transportation Fuels Model take into account the effects on crude oil flows in the contiguous United States.

  19. Estimation of vegetation fraction in arid areas using ALOS imagery

    NARCIS (Netherlands)

    Matkan, A.A.; Darvishzadeh, R.; Hosseiniasl, A.; Ebrahimi, M.


    Fraction of vegetation (Fv) plays an important role in ecosystems. Estimation of Fv is essential for drought monitoring, natural resources studies, estimation of soil erosion volume etc. The aim of this study is to estimate Fv in an arid area in Iran using ALOS Imagery (June 2008). In order to find

  20. Anisotropic diffusion of macromolecules in the contiguous nucleocytoplasmic fluid during eukaryotic cell division. (United States)

    Pawar, Nisha; Donth, Claudia; Weiss, Matthias


    Character and rapidity of protein diffusion in intracellular fluids are key determinants of the dynamics and steady state of a plethora of biochemical reactions. So far, an anomalous diffusion in cytoplasmic fluids with viscoelastic and even glassy characteristics has been reported in a variety of organisms on several length scales and timescales. Here, we show that the contiguous fluid of former cytoplasm and nucleoplasm features an anisotropically varying diffusion of macromolecules during eukaryotic cell division. In metaphase, diffusion in the contiguous nucleocytoplasmic fluid appears less anomalous along the spindle axis as compared to perpendicular directions. As a consequence, the long-time diffusion of macromolecules preferentially points along the spindle axis, leading to prolonged residence of macromolecules in the spindle region. Based on our experimental data, we suggest that anisotropic diffusion facilitates the encounter and interaction of spindle-associated proteins, e.g., during the formation of a dynamic spindle matrix. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Handover Performance over a Coordinated Contiguous Carrier Aggregation Deployment Scenario in the LTE-Advanced System

    Directory of Open Access Journals (Sweden)

    Ibraheem Shayea


    Full Text Available Although various carrier aggregation deployment scenarios (CADSs have been introduced in the LTE-Advanced system, issues related to insufficient eNB coverage that leads to low throughput and high drop call have yet to be solved. This paper proposes a new deployment scenario called coordinated contiguous-CADS (CC-CADS, which utilizes two-component carriers (CCs that operate on two frequencies located in a contiguous band. Each CC antenna is directed to a cell boundary of the other CC. The handover performance of users with various mobility speeds under CC-CADS has been investigated and compared with various deployment scenarios proposed by 3GPP. Simulation results show that the received signal reference power (RSRP enhancement and performed handover, ping-pong, drop call, and outage probabilities reductions in CC-CADS outperformed the 3GPP’s CADSs, thus leading to reduced interruption time, improved spectral efficiency, and seamless handover.

  2. Fractional Calculus: Integral and Differential Equations of Fractional Order

    CERN Document Server

    Gorenflo, Rudolf


    We introduce the linear operators of fractional integration and fractional differentiation in the framework of the Riemann-Liouville fractional calculus. Particular attention is devoted to the technique of Laplace transforms for treating these operators in a way accessible to applied scientists, avoiding unproductive generalities and excessive mathematical rigor. By applying this technique we shall derive the analytical solutions of the most simple linear integral and differential equations of fractional order. We show the fundamental role of the Mittag-Leffler function, whose properties are reported in an ad hoc Appendix. The topics discussed here will be: (a) essentials of Riemann-Liouville fractional calculus with basic formulas of Laplace transforms, (b) Abel type integral equations of first and second kind, (c) relaxation and oscillation type differential equations of fractional order.

  3. An improved fractional divider for fractional-N frequency synthesizers (United States)

    Zhang, Wei; Liu, Yang; Zhou, Yongqi


    This paper presents an improved fractional divider used in 1.8~2GHz fractional-N frequency synthesizers. A new clock setting for delta-sigma modulator (DSM) is proposed to prevent the potential problems of traditional fractional dividers: the DSM output would be wrongly loaded and the action of DSM circuit may affect the phase-detection of phase-frequency-detector (PFD). Simulation result shows the effectiveness of this improvement.

  4. 左心房容积指数及左心房内径指数对射血分数正常心力衰竭的诊断价值对比分析%Compraison between index left atrium volume and index left atrium diameter of their diagnostic value for heart failure with preserved ejection fraction

    Institute of Scientific and Technical Information of China (English)

    叶茜; 杨昕宇; 朱楠; 何大军


    Objective To explore the value of left atrium volume index (LAVI)and left atrium diameter index ( LADI) in diagnosis of heart failure with preserved ejection fraction ( HFPEF). Methods Thirty-live patients with HFPEF and 35 patients with Non-HFPEF recruited from Oct 2010 to Oct 2011 in the second people's hospital of Dazhou were enrolled in this study. A series of parameters including left ventricular ejection fraction (LVEF) , LAVI, LADI, left ventricular mass index (LVMI) , mitral low velocity peak at early diastole ( E) , mitral low velocity peak at the end of diastole (A) , initial mitral low deceleration time ( DT) , mitral ring velocity at early diastole (E') , E/A ratio and E/E'ratio were measured and compared between two groups of patients ( HFPEF and Non-HFPEF). Parameters exhibited significant variations between two groups were tested by Pearson association analysis and ROC curve analysis for their association with HFPEF. Results At the cutting edge of 36 ml/m2 , a remarkable association between LAVI and HFPEF was observed. The specificity, sensitivity and accuracy of LAVI for diagnosing HFPEF were 84%. LADI showed a lesser association with HFPEF at the cutting edge of 2.5 cm/m2 , for which the specificity, sensitivity and accuracy were 65% ,70% and 66% , respectively. Conclusions LAVI might play a role as a potential indicator in the diagnosis of HFPEF.%目的 探讨超声心动图左心房容积指数(LAVI)及左心房内径指数(LADI)对射血分数保存心力衰竭(HFPEF)的诊断价值.方法 选取2010年9月至2011年9月于达州市第二人民医院住院的心力衰竭患者70例,其中HEPEF患者35例,非HEPEF患者35例,分别比较2组患者左心室射血分数(LVEF)、LAVI、LADI、左心室质量指数(LVMI)、舒张早期血流速度(E)、舒张晚期血流速度(A)、早期二尖瓣减速时间(DT)、舒张早期运动速度(E′)、舒张早期血流速度与舒张晚期血流速度比值(E/A)、舒张早期二尖瓣血流速度与

  5. Dicty_cDB: Contig-U14990-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available lekhlkkskkinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkil milkq*hhh**sskyswyfsnsfny**nxik**lk*kktl Frame B: gllekhlkkskkinikqi*k*kcqvvemvvii*kilaiilkkllfnhqkkqlql*ynkil milkq...qfvqvvqvkmhvnhk liilikrvlkle*kllkiryw*chqrvvlvnqqfhpcyhmvfqreiitppkyly*mlifa vrqfqs*wvlinckl*iqsmvgfhqrcnkqimilk...4 Query: 992 NHDIKVMSVGFLLGTPDAPVIWKGPRKTTMIRRFLKDTFWGKQDYLIIDTPPGTSDEHLS 1171 ++...Contig-U14990-1 no gap 1568 4 3104178 3102621 MINUS 5 8 U14990 0 0 2 0 3 0 0 0 0 0

  6. Effects of the contiguity between the extinction and the reinforcement components in observing-response procedures


    Rogelio Escobar; Carlos A. Bruner


    The role of the stimulus correlated with extinction (S-) in observing-response procedures has been ambiguous. Although the S- is associated with extinction, some studies demonstrated that it effectively sustained observing behavior. To explore the conditions responsible for the S- to function as a conditioned reinforcer, the present experiment showed whether observing responses during an extinction component are controlled by the temporal contiguity between S- presentation and the reinforceme...

  7. Thoracic cord compression caused by contiguous multilevel ossification of ligamentum flavum in Chinese patients

    Institute of Scientific and Technical Information of China (English)

    WANG Kai; CHEN Xin


    Objective:To explore the epidemiology, clinical presentation, radiology and surgical treatment outcome in Chinese patients with myelopathy caused by contiguous multilevel ossification of ligamentum flavum.Methods: Medical notes and imaging data of 18 Chinese patients (14 males and 4 females, aged 43-72 years, mean: 57 years ) with myelopathy caused by contiguous multilevel ossification of ligamentum flavum were studied retrospectively in this article. The diagnosis was based on clinical examination, X-ray films, computerized tomography ( CT) and magnetic resonance imaging (MRI) scanning results and pathological results. Sixteen patients were treated by laminectomy and two by laminoplasty. The average follow-up duration was 34 months ( range, 28-49 months ). The outcome was evaluated by Japanese Orthopaedics Association (JOA) score.Results: The average time for occurring clinical symptoms was 7.5 months (range, 2 days-16 months). All the 18 cases presented with clinical evidences of chronic and progressive thoracic spinal cord compression, which included bilateral leg weakness, spastic gait, numbness in lower limbs, paresthesia in terminal and perineum, and urinary incontinence. Neurological examination revealed severe spastic paraparesis, absence of abdominal reflexes, and reduction of the sensory function below the compression level. The mean JOA score before operation was 3. 6 (range, 0-6). MRI and CT scans of the thoracic spine confirmed the presence of contiguous multilevel ossification of the ligamentum flavum. The mean recovery rate after surgery in terms of JOA score was 66.3% (range, 33.3%-100%), with a mean final JOA score of 8. 3. Thoracic decompression laminectomy or laminoplasty could result in a good postoperative outcome.Conclusions: Contiguous multilevel ossification of the ligamentum flavum is not a common cause of myelopathy in Chinese population and should be treated as early as possible. MRI and CT scan examinations may diagnose the presence of

  8. In vitro, long-range sequence information for de novo genome assembly via transposase contiguity. (United States)

    Adey, Andrew; Kitzman, Jacob O; Burton, Joshua N; Daza, Riza; Kumar, Akash; Christiansen, Lena; Ronaghi, Mostafa; Amini, Sasan; Gunderson, Kevin L; Steemers, Frank J; Shendure, Jay


    We describe a method that exploits contiguity preserving transposase sequencing (CPT-seq) to facilitate the scaffolding of de novo genome assemblies. CPT-seq is an entirely in vitro means of generating libraries comprised of 9216 indexed pools, each of which contains thousands of sparsely sequenced long fragments ranging from 5 kilobases to > 1 megabase. These pools are "subhaploid," in that the lengths of fragments contained in each pool sums to ∼5% to 10% of the full genome. The scaffolding approach described here, termed fragScaff, leverages coincidences between the content of different pools as a source of contiguity information. Specifically, CPT-seq data is mapped to a de novo genome assembly, followed by the identification of pairs of contigs or scaffolds whose ends disproportionately co-occur in the same indexed pools, consistent with true adjacency in the genome. Such candidate "joins" are used to construct a graph, which is then resolved by a minimum spanning tree. As a proof-of-concept, we apply CPT-seq and fragScaff to substantially boost the contiguity of de novo assemblies of the human, mouse, and fly genomes, increasing the scaffold N50 of de novo assemblies by eight- to 57-fold with high accuracy. We also demonstrate that fragScaff is complementary to Hi-C-based contact probability maps, providing midrange contiguity to support robust, accurate chromosome-scale de novo genome assemblies without the need for laborious in vivo cloning steps. Finally, we demonstrate CPT-seq as a means of anchoring unplaced novel human contigs to the reference genome as well as for detecting misassembled sequences.

  9. Electric power supply and demand for the contiguous United States, 1980-1989

    Energy Technology Data Exchange (ETDEWEB)



    A limited review is presented of the outlook for the electric power supply and demand during the period 1980 to 1989. Only the adequacy and reliability aspects of bulk electric power supply in the contiguous US are considered. The economic, financial and environmental aspects of electric power system planning and the distribution of electricity (below the transmission level) are topics of prime importance, but they are outside the scope of this report.

  10. Analysis of changes in the magnitude, frequency, and seasonality of heavy precipitation over the contiguous USA (United States)

    Mallakpour, Iman; Villarini, Gabriele


    Auc(bstract) Gridded daily precipitation observations over the contiguous USA are used to investigate the past observed changes in the frequency and magnitude of heavy precipitation, and to examine its seasonality. Analyses are based on the Climate Prediction Center (CPC) daily precipitation data from 1948 to 2012. We use a block maxima approach to identify changes in the magnitude of heavy precipitation and a peak-over-threshold (POT) approach for the changes in the frequency. The results of this study show that there is a stronger signal of change in the frequency rather than in the magnitude of heavy precipitation events. Also, results show an increasing trend in the frequency of heavy precipitation over large areas of the contiguous USA with the most notable exception of the US Northwest. These results indicate that over the last 65 years, the stronger storms are not getting stronger, but a larger number of heavy precipitation events have been observed. The annual maximum precipitation and annual frequency of heavy precipitation reveal a marked seasonality over the contiguous USA. However, we could not find any evidence suggesting shifting in the seasonality of annual maximum precipitation by investigating whether the day of the year at which the maximum precipitation occurs has changed over time. Furthermore, we examine whether the year-to-year variations in the frequency and magnitude of heavy precipitation can be explained in terms of climate variability driven by the influence of the Atlantic and Pacific Oceans. Our findings indicate that the climate variability of both the Atlantic and Pacific Oceans can exert a large control on the precipitation frequency and magnitude over the contiguous USA. Also, the results indicate that part of the spatial and temporal features of the relationship between climate variability and heavy precipitation magnitude and frequency can be described by one or more of the climate indices considered here.

  11. Database of normal human cerebral blood flow, cerebral blood volume, cerebral oxygen extraction fraction and cerebral metabolic rate of oxygen measured by positron emission tomography with {sup 15}O-labelled carbon dioxide or water, carbon monoxide and oxygen: a multicentre study in Japan

    Energy Technology Data Exchange (ETDEWEB)

    Ito, Hiroshi [Department of Radiology and Nuclear Medicine, Akita Research Institute of Brain and Blood Vessels, Akita (Japan); Department of Nuclear Medicine and Radiology, Division of Brain Sciences, Institute of Development, Aging and Cancer, Tohoku University, 4-1 Seiryo-Machi, 980-8575, Aoba-Ku, Sendai (Japan); Kanno, Iwao [Department of Radiology and Nuclear Medicine, Akita Research Institute of Brain and Blood Vessels, Akita (Japan); Kato, Chietsugu [Department of Nuclear Medicine, Hokkaido University School of Medicine, Sapporo (Japan); Sasaki, Toshiaki [Cyclotoron Research Center, Iwate Medical University, Morioka (Japan); Ishii, Kenji [Positron Medical Center, Tokyo Metropolitan Institute of Gerontology, Tokyo (Japan); Ouchi, Yasuomi [Positron Medical Center, Hamamatsu Medical Center, Hamakita (Japan); Iida, Akihiko [Nagoya City Rehabilitation Center, Nagoya (Japan); Okazawa, Hidehiko [PET Unit, Research Institute, Shiga Medical Center, Moriyama (Japan); Hayashida, Kohei [Department of Radiology, National Cardiovascular Center, Suita, Osaka (Japan); Tsuyuguchi, Naohiro [Department of Neurosurgery, Osaka City University Medical School, Osaka (Japan); Ishii, Kazunari [Division of Imaging Research, Hyogo Institute for Aging Brain and Cognitive Disorders, Himeji, Hyogo (Japan); Kuwabara, Yasuo [Department of Radiology, Faculty of Medicine, Kyushu University, Fukuoka (Japan); Senda, Michio [Department of Image-based Medicine, Institute of Biomedical Research and Innovation, Kobe (Japan)


    Measurement of cerebral blood flow (CBF), cerebral blood volume (CBV), cerebral oxygen extraction fraction (OEF) and cerebral metabolic rate of oxygen (CMRO{sub 2}) by positron emission tomography (PET) with oxygen-15 labelled carbon dioxide (C{sup 15}O{sub 2}) or {sup 15}O-labelled water (H{sub 2}{sup 15}O), {sup 15}O-labelled carbon monoxide (C{sup 15}O) and {sup 15}O-labelled oxygen ({sup 15}O{sub 2}) is useful for diagnosis and treatment planning in cases of cerebrovascular disease. The measured values theoretically depend on various factors, which may differ between PET centres. This study explored the applicability of a database of {sup 15}O-PET by examining between-centre and within-centre variation in values. Eleven PET centres participated in this multicentre study; seven used the steady-state inhalation method, one used build-up inhalation and three used bolus administration of C{sup 15}O{sub 2} (or H{sub 2}{sup 15}O) and {sup 15}O{sub 2}. All used C{sup 15}O for measurement of CBV. Subjects comprised 70 healthy volunteers (43 men and 27 women; mean age 51.8{+-}15.1 years). Overall mean{+-}SD values for cerebral cortical regions were: CBF=44.4{+-}6.5 ml 100 ml{sup -1} min{sup -1}; CBV=3.8{+-}0.7 ml 100 ml{sup -1}; OEF=0.44{+-}0.06; CMRO{sub 2}=3.3{+-}0.5 ml 100 ml{sup -1} min{sup -1}. Significant between-centre variation was observed in CBV, OEF and CMRO{sub 2} by one-way analysis of variance. However, the overall inter-individual variation in CBF, CBV, OEF and CMRO{sub 2} was acceptably small. Building a database of normal cerebral haemodynamics obtained by the{sup 15}O-PET methods may be practicable. (orig.)

  12. Large contiguous gene deletions in Sjögren-Larsson syndrome. (United States)

    Engelstad, Holly; Carney, Gael; S'aulis, Dana; Rise, Janae; Sanger, Warren G; Rudd, M Katharine; Richard, Gabriele; Carr, Christopher W; Abdul-Rahman, Omar A; Rizzo, William B


    Sjögren-Larsson syndrome (SLS) is an autosomal recessive disorder characterized by ichthyosis, mental retardation, spasticity and mutations in the ALDH3A2 gene for fatty aldehyde dehydrogenase, an enzyme that catalyzes the oxidation of fatty aldehyde to fatty acid. More than 70 mutations have been identified in SLS patients, including small deletions or insertions, missense mutations, splicing defects and complex nucleotide changes. We now describe 2 SLS patients whose disease is caused by large contiguous gene deletions of the ALDH3A2 locus on 17p11.2. The deletions were defined using long distance inverse PCR and microarray-based comparative genomic hybridization. A 24-year-old SLS female was homozygous for a 352-kb deletion involving ALDH3A2 and 4 contiguous genes including ALDH3A1, which codes for the major soluble protein in cornea. Although lacking corneal disease, she showed severe symptoms of SLS with uncommon deterioration in oral motor function and loss of ambulation. The other 19-month-old female patient was a compound heterozygote for a 1.44-Mb contiguous gene deletion and a missense mutation (c.407C>T, P136L) in ALDH3A2. These studies suggest that large gene deletions may account for up to 5% of the mutant alleles in SLS. Geneticists should consider the possibility of compound heterozygosity for large deletions in patients with SLS and other inborn errors of metabolism, which has implications for carrier testing and prenatal diagnosis.

  13. [Analysis of Microsatellite DNA in Rodents from Eastern Urals Radioactive Trace Zone and Contiguous Territories]. (United States)

    Rakitin, S B; Grigorkina, E B; Olenev, G V


    The variability of four microsatellite loci of rodents, caught from the head part of Eastern Urals Radioactive Trace (EURT), along with the rodents inhabiting contiguous zone with background radiation level and distant-reference territory, was analyzed forthe first time. Differences in the parameters of genetic diversity between northern red-backed voles from the EURT zone and from the reference population were detected. An increase in some indices of genetic diversity in animals from a contiguous to the EURT zone was found; this is probably associated with animal migration and configuration of the area of pollution. A transfer of radiation-induced effects to the contiguous territories and a decrease in the possibility of fixation of adaptations in a series of generations of mobile rodent species in the area of local radioactive pollution are consequences of migrations. The results of the study make it possible to recommend microsatellite markers for the analysis of radiation-induced effects in rodents as model objects of radioecological monitoring.

  14. Recommendations from gynaecological (GYN) GEC ESTRO working group (II): concepts and terms in 3D image-based treatment planning in cervix cancer brachytherapy-3D dose volume parameters and aspects of 3D image-based anatomy, radiation physics, radiobiology. (United States)

    Pötter, Richard; Haie-Meder, Christine; Van Limbergen, Erik; Barillot, Isabelle; De Brabandere, Marisol; Dimopoulos, Johannes; Dumas, Isabelle; Erickson, Beth; Lang, Stefan; Nulens, An; Petrow, Peter; Rownd, Jason; Kirisits, Christian


    The second part of the GYN GEC ESTRO working group recommendations is focused on 3D dose-volume parameters for brachytherapy of cervical carcinoma. Methods and parameters have been developed and validated from dosimetric, imaging and clinical experience from different institutions (University of Vienna, IGR Paris, University of Leuven). Cumulative dose volume histograms (DVH) are recommended for evaluation of the complex dose heterogeneity. DVH parameters for GTV, HR CTV and IR CTV are the minimum dose delivered to 90 and 100% of the respective volume: D90, D100. The volume, which is enclosed by 150 or 200% of the prescribed dose (V150, V200), is recommended for overall assessment of high dose volumes. V100 is recommended for quality assessment only within a given treatment schedule. For Organs at Risk (OAR) the minimum dose in the most irradiated tissue volume is recommended for reporting: 0.1, 1, and 2 cm3; optional 5 and 10 cm3. Underlying assumptions are: full dose of external beam therapy in the volume of interest, identical location during fractionated brachytherapy, contiguous volumes and contouring of organ walls for >2 cm3. Dose values are reported as absorbed dose and also taking into account different dose rates. The linear-quadratic radiobiological model-equivalent dose (EQD2)-is applied for brachytherapy and is also used for calculating dose from external beam therapy. This formalism allows systematic assessment within one patient, one centre and comparison between different centres with analysis of dose volume relations for GTV, CTV, and OAR. Recommendations for the transition period from traditional to 3D image-based cervix cancer brachytherapy are formulated. Supplementary data (available in the electronic version of this paper) deals with aspects of 3D imaging, radiation physics, radiation biology, dose at reference points and dimensions and volumes for the GTV and CTV (adding to [Haie-Meder C, Pötter R, Van Limbergen E et al. Recommendations from

  15. Incompressible Stars and Fractional Derivatives

    CERN Document Server

    Bayin, S S


    Fractional calculus is an effective tool in incorporating the effects of non-locality and memory into physical models. In this regard, successful applications exist rang- ing from signal processing to anomalous diffusion and quantum mechanics. In this paper we investigate the fractional versions of the stellar structure equations for non radiating spherical objects. Using incompressible fluids as a comparison, we develop models for constant density Newtonian objects with fractional mass distributions or stress conditions. To better understand the fractional effects, we discuss effective values for the density, gravitational field and equation of state. The fractional ob- jects are smaller and less massive than integer models. The fractional parameters are related to a polytropic index for the models considered.

  16. Proton Fraction in Neutron Stars

    Institute of Scientific and Technical Information of China (English)

    张丰收; 陈列文


    The proton fraction in β-stable neutron stars is investigated within the framework of the Skyrme-Hartree-Fock theory using the extended Skyrme effective interaction for the first time. The calculated results show that the proton fraction disappears at high density, which implies that the pure neutron matter may exist in the interior of neutron stars. The incompressibility of the nuclear equation-of-state is shown to be more important to determine the proton fraction. Meanwhile, it is indicated that the addition of muons in neutron stars will change the proton fraction. It is also found that the higher-order terms of the nuclear symmetry energy have obvious effects on the proton fraction and the parabolic law of the nuclear symmetry energy is not enough to determine the proton fraction.

  17. Accessible solitons of fractional dimension

    Energy Technology Data Exchange (ETDEWEB)

    Zhong, Wei-Ping, E-mail: [Department of Electronic and Information Engineering, Shunde Polytechnic, Guangdong Province, Shunde 528300 (China); Texas A& M University at Qatar, P.O. Box 23874, Doha (Qatar); Belić, Milivoj [Texas A& M University at Qatar, P.O. Box 23874, Doha (Qatar); Zhang, Yiqi [Key Laboratory for Physical Electronics and Devices of the Ministry of Education & Shaanxi Key Lab of Information Photonic Technique, Xi’an Jiaotong University, Xi’an 710049 (China)


    We demonstrate that accessible solitons described by an extended Schrödinger equation with the Laplacian of fractional dimension can exist in strongly nonlocal nonlinear media. The soliton solutions of the model are constructed by two special functions, the associated Legendre polynomials and the Laguerre polynomials in the fraction-dimensional space. Our results show that these fractional accessible solitons form a soliton family which includes crescent solitons, and asymmetric single-layer and multi-layer necklace solitons. -- Highlights: •Analytic solutions of a fractional Schrödinger equation are obtained. •The solutions are produced by means of self-similar method applied to the fractional Schrödinger equation with parabolic potential. •The fractional accessible solitons form crescent, asymmetric single-layer and multilayer necklace profiles. •The model applies to the propagation of optical pulses in strongly nonlocal nonlinear media.

  18. Volume-effect in radiation therapy part one: volume-effect and tumour; L'effet volume en radiotherapie premiere partie: effet volume et tumeur

    Energy Technology Data Exchange (ETDEWEB)

    Huchet, A.; Wu, J. [Hopital Europeen Georges-Pompidou (AP-HP), Service de Radiotherapie, 75 - Paris (France); Caudry, M.; Trouette, R.; Vendrely, V.; Causse, N.; Recaldini, L.; Dahan, O.; Maire, J.P. [Hopital Saint-Andre, Service de Radiotherapie, 33 - Bordeaux (France); Belkacemi, Y. [Centre de Lutte Contre le Cancer Oscar-Lambret, Dept. de Radiotherapie, 59 - Lille (France)


    Volume is an important parameter of radiation therapy. Local control is inversely related to tumor size and the complication rate increases with the importance of the irradiated volume. Although the effect of irradiated volume has been widely reported since the beginning of radiotherapy, it has been less studied than other radiation parameters such as dose, fractionation, or treatment duration. One of the first organ system in which the adverse effect of increased volume was well defined is the skin. Over the last twenty years, numerous mathematical models have been developed for different organs. In this report we will discuss the relation between irradiated volume and tumor control. In a second article we will study the impact of irradiated volume on radiation adverse effects. (authors)

  19. Influence of Parameters of Quenching and Partitioning Process on Microstructure and Fraction of Retained Austenite

    Directory of Open Access Journals (Sweden)

    A. Shirali


    of partitioning temperature made the retained austenite films become thicker and its volume fraction increase. On the other hand, by increasing the quenching temperature, carbon content of retained austenite increased sharply.

  20. Number line representations of fractions


    Behr, Merlyn J.; Bright, George W.; Wachsmuth, Ipke; Wagner, Sigrid


    The study explored students' interpretations of representations of fractions on number lines and the effect of instruction on those interpretations. Subjects were five fourth-graders, and instruction was a four-day unit on the use of number lines. A 16-item, multiple-choice pre- and posttest was used along with videotaped interviews. Performance improved except when students had to associate a reduced fraction symbol with an equivalent, unreduced fraction representation on a number line. The ...

  1. IMRT dose fractionation for head and neck cancer: Variation in current approaches will make standardisation difficult

    Energy Technology Data Exchange (ETDEWEB)

    Ho, Kean F. (Academic Dept. of Radiation Oncology, Univ. of Manchester, Manchester (United Kingdom)); Fowler, Jack F. (Dept. of Human Oncology and Medical Physics, Univ. of Wisconsin, Wisconsin (United States)); Sykes, Andrew J.; Yap, Beng K.; Lee, Lip W.; Slevin, Nick J. (Dept. of Clinical Oncology, Christie Hospital NHS Foundation Trust, Manchester (United Kingdom))


    Introduction. Altered fractionation has demonstrated clinical benefits compared to the conventional 2 Gy/day standard of 70 Gy. When using synchronous chemotherapy, there is uncertainty about optimum fractionation. IMRT with its potential for Simultaneous Integrated Boost (SIB) adds further to this uncertainty. This survey will examine international practice of IMRT fractionation and suggest possible reasons for diversity in approach. Material and methods. Fourteen international cancer centres were surveyed for IMRT dose/fractionation practised in each centre. Results. Twelve different types of dose fractionation were reported. Conventional 70-72 Gy (daily 2 Gy/fraction) was used in 3/14 centres with concurrent chemotherapy while 11/14 centres used altered fractionation. Two centres used >1 schedule. Reported schedules and number of centres included 6 fractions/week DAHANCA regime (3), modest hypofractionation (=2.2 Gy/fraction) (3), dose-escalated hypofractionation (=2.3 Gy/fraction) (4), hyperfractionation (1), continuous acceleration (1) and concomitant boost (1). Reasons for dose fractionation variability include (i) dose escalation; (ii) total irradiated volume; (iii) number of target volumes; (iv) synchronous systemic treatment; (v) shorter overall treatment time; (vi) resources availability; (vii) longer time on treatment couch; (viii) variable GTV margins; (ix) confidence in treatment setup; (x) late tissue toxicity and (xi) use of lower neck anterior fields. Conclusions. This variability in IMRT fractionation makes any meaningful comparison of treatment results difficult. Some standardization is needed particularly for design of multi-centre randomized clinical trials.

  2. 翼外肌在髁突矢状骨折愈合中对新生骨形成的影响%Changes of New Bone Trabecular Number,Thickness,Gap Width and Bone Volume Fraction and Its Clinical Significance of Pterygoid Muscle in Condyle Fracture

    Institute of Scientific and Technical Information of China (English)

    李燕波; 何志良; 王承阳; 贺成功; 曹雷; 苏丹妮


    [Objective] To explore the effects of new bone formation of pterygoid muscle in condyle fracture .[Meth‐ods] A total of 8 healthy sheep were randomly divided into observation and control groups ( n=4 each) .Condylar osteot‐omy was used for mimicking mandibular condyle sagittal fracture .Pterygoid muscle function was retained for observation group and blocked for control group .At Weeks 4 ,12 and 24 ,the changes of new bone trabecular number ,thickness ,gap width and bone volume fraction were recorded .Reverse transcription‐polymerase chain reaction (RT‐PCR) and immuno‐histochemistry were used for detecting the changes of osteocalcin (OCN) ,transforming growth factor‐β1 (TGF‐β1) gene and protein .[Results]With elapsing time ,trabecular number ,thickness and bone volume fraction increased significantly while trabecular gap width significantly decreased in observation group as compared to control group ( P0 .05) .In observation group ,the expressions of OCN mRNA and TGF‐β1 mRNA and positive cell percentage increased significantly ( P <0 .05) .As compared with control group ,the expressions of OCN mRNA and TGF‐β1 mRNA and positive cell percentage were significantly higher in observation group during each period ( P<0 .05) .In control group ,the expressions of OCN mRNA and TGF‐β1 mRNA and positive cell percentage peaked during Week 12 and then decreased significantly ( P <0 .05) .[Conclusion] Pterygoid muscle affects remodeling of condyle shape in healing of sagittal condylar fracture .And the mechanism may be due to a formation of new bone and an aggravation of condyle deformity resulting in joint disk or articular fossa adhesion and ankylosis .%【目的】探讨翼外肌在髁突矢状骨折愈合中对新骨形成的影响。【方法】10只健康绵羊随机分为观察组(5只)和对照组(5只),两组绵羊均通过髁突截骨术造成髁突矢状骨折,观察组保留翼外肌功能,对照组阻断翼外肌功

  3. Stochastic calculus for fractional Brownian motion and related processes

    CERN Document Server

    Mishura, Yuliya S


    The theory of fractional Brownian motion and other long-memory processes are addressed in this volume. Interesting topics for PhD students and specialists in probability theory, stochastic analysis and financial mathematics demonstrate the modern level of this field. Among these are results about Levy characterization of fractional Brownian motion, maximal moment inequalities for Wiener integrals including the values 0fractional Brownian SDE. The author develops optimal filtering of mixed models including linear case, and studies financial applications and statistical inference with hypotheses testing and parameter estimation. She proves that the market with stock guided by the mixed model is arbitrage-free without any restriction on the dependence of the components and deduces different forms of the Black-Scholes equation for fractional mark...

  4. Nootropic Effects of Filipendula Vulgaris Moench Water Extract Fractions. (United States)

    Shilova, I V; Suslov, N I; Amelchenko, V P


    Nootropic activity of water extract fractions from aerial parts of Filipendula vulgaris Moench was demonstrated on the models of hermetic volume hypoxia, conditioned passive avoidance response, open field test, and forced swimming with a load. The fractions stimulated hypoxic resistance, normalized orientation and exploratory behavior, improved conditioned response reproduction during testing after hypoxic injury, and increased exercise tolerance. Fractionation of the extract led to dissociation of the effect components, which suggests that individual constituents have specific characteristics. Ethylacetate fraction exhibited most pronounced nootropic activity and was superior to plant extract by some characteristics. The detected effects seemed to be caused by modulation of the hippocampus activity the under the effects of phenol and triterpene compounds.

  5. Comment on "Fractional quantum mechanics" and "Fractional Schroedinger equation"

    CERN Document Server

    Wei, Yuchuan


    In this comment, we point out some shortcomings in two papers "Fractional quantum mechanics" [Phys. Rev. E 62, 3135 (2000)] and "Fractional Schroedinger equation" [Phys. Rev. E 66, 056108 (2002)]. We prove that the fractional uncertainty relation does not hold generally. The probability continuity equation in fractional quantum mechanics has a missing source term, which leads to particle teleportation, i.e., a particle can teleport from one place to another. Since the relativistic kinetic energy can be viewed as an approximate realization of the fractional kinetic energy, the particle teleportation should be an observable relativistic effect in quantum mechanics. With the help of this concept, superconductivity could be viewed as the teleportation of electrons from one side of a superconductor to another and superfluidity could be viewed as the teleportation of helium atoms from one end of a capillary tube to the other. We also point out how to teleport a particle to a destination.

  6. Renormalized Volume

    CERN Document Server

    Gover, A Rod


    For any conformally compact manifold with hypersurface boundary we define a canonical renormalized volume functional and compute an explicit, holographic formula for the corresponding anomaly. For the special case of asymptotically Einstein manifolds, our method recovers the known results. The anomaly does not depend on any particular choice of regulator, but the coefficients of divergences do. We give explicit formulae for these divergences valid for any choice of regulating hypersurface; these should be relevant to recent studies of quantum corrections to entanglement entropies. The anomaly is expressed as a conformally invariant integral of a local Q-curvature that generalizes the Branson Q-curvature by including data of the embedding. In each dimension this canonically defines a higher dimensional generalization of the Willmore energy/rigid string action. We show that the variation of these energy functionals is exactly the obstruction to solving a singular Yamabe type problem with boundary data along the...


    Energy Technology Data Exchange (ETDEWEB)

    S.O. Bader


    The purpose of this design analysis is to specify and document the total and respirable fractions for radioactive materials that are released from an accident event at the Monitored Geologic Repository (MGR) involving commercial spent nuclear fuel (CSNF) in a dry environment. The total and respirable release fractions will be used to support the preclosure licensing basis for the MGR. The total release fraction is defined as the fraction of total CSNF assembly inventory, typically expressed as an activity inventory (e.g., curies), of a given radionuclide that is released to the environment from a waste form. The radionuclides are released from the inside of breached fuel rods (or pins) and from the detachment of radioactive material (crud) from the outside surfaces of fuel rods and other components of fuel assemblies. The total release fraction accounts for several mechanisms that tend to retain, retard, or diminish the amount of radionuclides that are available for transport to dose receptors or otherwise can be shown to reduce exposure of receptors to radiological releases. The total release fraction includes a fraction of airborne material that is respirable and could result in inhalation doses. This subset of the total release fraction is referred to as the respirable release fraction. Potential accidents may involve waste forms that are characterized as either bare (unconfined) fuel assemblies or confined fuel assemblies. The confined CSNF assemblies at the MGR are contained in shipping casks, canisters, or disposal containers (waste packages). In contrast to the bare fuel assemblies, the container that confines the fuel assemblies has the potential of providing an additional barrier for diminishing the total release fraction should the fuel rod cladding breach during an accident. However, this analysis will not take credit for this additional bamer and will establish only the total release fractions for bare unconfined CSNF assemblies, which may however be

  8. Deterministic ratchets for suspension fractionation

    NARCIS (Netherlands)

    Kulrattanarak, T.


    Driven by the current insights in sustainability and technological development in biorefining natural renewable resources, the food industry has taken an interest in fractionation of agrofood materials, like milk and cereal crops. The purpose of fractionation is to split the raw material in sever

  9. Financial Planning with Fractional Goals

    NARCIS (Netherlands)

    M.H. Goedhart; J. Spronk (Jaap)


    textabstractWhen solving financial planning problems with multiple goals by means of multiple objective programming, the presence of fractional goals leads to technical difficulties. In this paper we present a straightforward interactive approach for solving such linear fractional programs with mult

  10. Financial Planning with Fractional Goals


    Goedhart, M.H.; Spronk, Jaap


    textabstractWhen solving financial planning problems with multiple goals by means of multiple objective programming, the presence of fractional goals leads to technical difficulties. In this paper we present a straightforward interactive approach for solving such linear fractional programs with multiple goal variables. The approach is illustrated by means of an example in financial planning.

  11. Approximations of fractional Brownian motion

    CERN Document Server

    Li, Yuqiang; 10.3150/10-BEJ319


    Approximations of fractional Brownian motion using Poisson processes whose parameter sets have the same dimensions as the approximated processes have been studied in the literature. In this paper, a special approximation to the one-parameter fractional Brownian motion is constructed using a two-parameter Poisson process. The proof involves the tightness and identification of finite-dimensional distributions.

  12. Investigations on Multiplication of Fractions. (United States)

    Sai, Khoo Phon; Inder, Walter R. D.


    Three different models with continuous materials, discontinuous materials, and number lines were used to study the operation concept in six investigations on multiplication with fractions with pupils aged 11-12 in a Penang International School. All approaches could be understood by pupils, but they preferred the area and fractional models. (MNS)

  13. Understanding Magnitudes to Understand Fractions (United States)

    Gabriel, Florence


    Fractions are known to be difficult to learn and difficult to teach, yet they are vital for students to have access to further mathematical concepts. This article uses evidence to support teachers employing teaching methods that focus on the conceptual understanding of the magnitude of fractions.

  14. Ejection Fraction Heart Failure Measurement (United States)

    ... Disease Venous Thromboembolism Aortic Aneurysm More Ejection Fraction Heart Failure Measurement Updated:Feb 15,2017 The ejection fraction ( ... failure This content was last reviewed April 2015. Heart Failure • Home • About Heart Failure • Causes and Risks for ...

  15. Unwrapping Students' Ideas about Fractions (United States)

    Lewis, Rebecca M.; Gibbons, Lynsey K.; Kazemi, Elham; Lind, Teresa


    Supporting students to develop an understanding of the meaning of fractions is an important goal of elementary school mathematics. This involves developing partitioning strategies, creating representations, naming fractional quantities, and using symbolic notation. This article describes how teachers can use a formative assessment problem to…

  16. Rational Exponentials and Continued Fractions (United States)

    Denny, J. K.


    Using continued fraction expansions, we can approximate constants, such as pi and e, using an appropriate integer n raised to the power x[superscript 1/x], x a suitable rational. We review continued fractions and give an algorithm for producing these approximations.

  17. Wavelet-fractional Fourier transforms

    Institute of Scientific and Technical Information of China (English)

    Yuan Lin


    This paper extends the definition of fractional Fourier transform (FRFT) proposed by Namias V by using other orthonormal bases for L2 (R) instead of Hermite-Ganssian functions.The new orthonormal basis is gained indirectly from multiresolution analysis and orthonormal wavelets. The so defined FRFT is called wavelets-fractional Fourier transform.

  18. Spinal cord tolerance to reirradiation with single-fraction radiosurgery: a swine model.

    NARCIS (Netherlands)

    Medin, P.M.; Foster, R.D.; Kogel, A.J. van der; Sayre, J.W.; McBride, W.H.; Solberg, T.D.


    PURPOSE: This study was performed to determine swine spinal cord tolerance to single-fraction, partial-volume irradiation 1 year after receiving uniform irradiation to 30 Gy in 10 fractions. METHODS AND MATERIALS: A 10-cm length of spinal cord (C3-T1) was uniformly irradiated to 30 Gy in 10 consecut

  19. Fractional active disturbance rejection control. (United States)

    Li, Dazi; Ding, Pan; Gao, Zhiqiang


    A fractional active disturbance rejection control (FADRC) scheme is proposed to improve the performance of commensurate linear fractional order systems (FOS) and the robust analysis shows that the controller is also applicable to incommensurate linear FOS control. In FADRC, the traditional extended states observer (ESO) is generalized to a fractional order extended states observer (FESO) by using the fractional calculus, and the tracking differentiator plus nonlinear state error feedback are replaced by a fractional proportional-derivative controller. To simplify controller tuning, the linear bandwidth-parameterization method has been adopted. The impacts of the observer bandwidth ωo and controller bandwidth ωc on system performance are then analyzed. Finally, the FADRC stability and frequency-domain characteristics for linear single-input single-output FOS are analyzed. Simulation results by FADRC and ADRC on typical FOS are compared to demonstrate the superiority and effectiveness of the proposed scheme.

  20. Radiating subdispersive fractional optical solitons

    Energy Technology Data Exchange (ETDEWEB)

    Fujioka, J., E-mail:; Espinosa, A.; Rodríguez, R. F. [Departamento de Física Química, Instituto de Física, Universidad Nacional Autónoma de México, Mexico, DF 04510 (Mexico); Malomed, B. A. [Department of Physical Electronics, School of Electrical Engineering, Faculty of Engineering, Tel Aviv University, Tel Aviv 69978 (Israel)


    It was recently found [Fujioka et al., Phys. Lett. A 374, 1126 (2010)] that the propagation of solitary waves can be described by a fractional extension of the nonlinear Schrödinger (NLS) equation which involves a temporal fractional derivative (TFD) of order α > 2. In the present paper, we show that there is also another fractional extension of the NLS equation which contains a TFD with α < 2, and in this case, the new equation describes the propagation of radiating solitons. We show that the emission of the radiation (when α < 2) is explained by resonances at various frequencies between the pulses and the linear modes of the system. It is found that the new fractional NLS equation can be derived from a suitable Lagrangian density, and a fractional Noether's theorem can be applied to it, thus predicting the conservation of the Hamiltonian, momentum and energy.

  1. Mechanical Analogies of Fractional Elements

    Institute of Scientific and Technical Information of China (English)

    HU Kai-Xin; ZHU Ke-Qin


    A Fractional element model describes a special kind of viscoelastic material.Its stress is proportional to the fractional-order derivative of strain. Physically the mechanical analogies of fractional elements can be represented by spring-dashpot fractal networks. We introduce a constitutive operator in the constitutive equations of viscoelastic materials.To derive constitutive operators for spring-dashpot fractal networks, we use Heaviside operational calculus, which provides explicit answers not otherwise obtainable simply.Then the series-parallel formulas for the constitutive operator are derived. Using these formulas, a constitutive equation of fractional element with 1/2-order derivative is obtained.Finally we find the way to derive the constitutive equations with other fractional-order derivatives and their mechanical analogies.

  2. Permutation entropy of fractional Brownian motion and fractional Gaussian noise

    Energy Technology Data Exchange (ETDEWEB)

    Zunino, L. [Centro de Investigaciones Opticas, C.C. 124 Correo Central, 1900 La Plata (Argentina); Departamento de Ciencias Basicas, Facultad de Ingenieria, Universidad Nacional de La Plata (UNLP), 1900 La Plata (Argentina); Departamento de Fisica, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 1900 La Plata (Argentina)], E-mail:; Perez, D.G. [Instituto de Fisica, Pontificia Universidad Catolica de Valparaiso (PUCV), 23-40025 Valparaiso (Chile)], E-mail:; Martin, M.T. [Instituto de Fisica (IFLP), Facultad de Ciencias Exactas, Universidad Nacional de La Plata and Argentina' s National Council (CCT-CONICET), C.C. 727, 1900 La Plata (Argentina)], E-mail:; Garavaglia, M. [Centro de Investigaciones Opticas, C.C. 124 Correo Central, 1900 La Plata (Argentina); Departamento de Fisica, Facultad de Ciencias Exactas, Universidad Nacional de La Plata, 1900 La Plata (Argentina)], E-mail:; Plastino, A. [Instituto de Fisica (IFLP), Facultad de Ciencias Exactas, Universidad Nacional de La Plata and Argentina' s National Council (CCT-CONICET), C.C. 727, 1900 La Plata (Argentina)], E-mail:; Rosso, O.A. [Centre for Bioinformatics, Biomarker Discovery and Information-Based Medicine, School of Electrical Engineering and Computer Science, The University of Newcastle, University Drive, Callaghan NSW 2308 (Australia); Chaos and Biology Group, Instituto de Calculo, Facultad de Ciencias Exactas y Naturales, Universidad de Buenos Aires, Pabellon II, Ciudad Universitaria, 1428 Ciudad de Buenos Aires (Argentina)], E-mail:


    We have worked out theoretical curves for the permutation entropy of the fractional Brownian motion and fractional Gaussian noise by using the Bandt and Shiha [C. Bandt, F. Shiha, J. Time Ser. Anal. 28 (2007) 646] theoretical predictions for their corresponding relative frequencies. Comparisons with numerical simulations show an excellent agreement. Furthermore, the entropy-gap in the transition between these processes, observed previously via numerical results, has been here theoretically validated. Also, we have analyzed the behaviour of the permutation entropy of the fractional Gaussian noise for different time delays.

  3. Spatially resolved intake fraction estimates for primary and secondary particulate matter in the United States (United States)

    Lamancusa, Carmen; Parvez, Fatema; Wagstrom, Kristina


    This study uses intake fraction, the fraction of emissions that are inhaled from a given source, to quantify how emissions from different regions proportionally contribute to human exposure to both primary and secondary particulate matter species. The intake fraction for secondary species is defined using the common atomic constituents between precursor species and products, allowing estimates to include both primary and secondary species. The Particulate Matter Source Apportionment Technology (PSAT) in the Comprehensive Air Quality Model with Extensions (CAMx) regional air quality model is used to calculate the intake fraction for twenty-five source regions throughout the contiguous United States over four seasons. The calculations use spatially explicit emissions and population density to more accurately capture the variation in intake fraction between regions. The spatially explicit emissions allow for the calculation of spatial trends and variations within the intake fraction. More specifically it allows for the calculation of the amount of intake that occurs within a given distance of the emissions source or source region. Based on the results sulfate inhalation occurs over larger distances than other particulate matter species. For most regions, a substantial fraction (>75%) of the inhalation occurs within 50 km for all seasons, demonstrating that efforts to reduce emissions will have the largest health impact on the local community. Furthermore the distance over which 75% of the inhalation occurs increases by 20% for all species during the winter and a larger percentage of pollutants emitted during the winter are inhaled relative to pollutants emitted during other seasons. This demonstrates that emission reductions during the winter will have a greater impact on health than reductions during other seasons.

  4. 左房容积指数对射血分数保留型心力衰竭的诊断价值分析%The diagnostic value of left atrial volume index for heart failure with preserved ejection fraction

    Institute of Scientific and Technical Information of China (English)

    杨醒; 魏学标; 林耀望; 陈婉雯; 付明; 周颖玲; 陈竹君; 吴樱; 余丹青


    Objective To explore the value of left atrium volume index (LAVI) in the diagnosis of heart failure with preserved ejection fraction (HFPEF). Methods Seventy-seven patients with HFPEF and 33 patients without HFPEF who had been treated from May 2012 to September 2013 in Guangdong General Hospital were en-rolled. The clinical data and a series of ultrasound parameters were collected and analysed. The relationship between LAVI, LAV, and other indexes of diastolic function was determined by Pearson correlation analysis. The value of LAVI and LAV for diagnosing HFPEF was compared by the ROC curve. Results LAVI and LAV of were signifi-cantly greater in HFPEF group than in non-HFPEF group. LAV and LAVI were significantly associated wtih HEPEF. The area under the ROC curve (AUC) of LAVI increased significantly as compared with the AUC of LAV (0.832 vs. 0.799, P<0.05). With a cut-off value of 30 mL/m2, the specificity and sensitivity for diagnosing HEPEF were 64.9%and 84.8%, respectively. Conclusions LAVI may be valuable in the diagnosis of HFPEF.%目的:探讨左房容积指数(LAVI)对射血分数保留型心衰(HFPEF)的诊断价值。方法:入选2012年5月至2013年9月期间就诊于广东省人民医院的住院患者110例,包括病例组(HFPEF)77例和对照组(非HFPEF)33例。分别比较两组人群临床资料及超声心动图指标,对左房容积(LAV)、LAVI与各舒张功能指标之间行 Pearson 相关分析,应用 ROC 曲线对比 LAV、LAVI 在 HFPEF 中的诊断价值。结果:HFPEF 组LAVI、LAV 大于对照组,差异有统计学意义(P<0.05);LAV、LAVI 与 HFPEF 具有良好的相关性; LAVI 在诊断HFPEF 中的ROC 曲线下面积较LAV 显著增大(0.832 vs.0.799, P<0.05);以30 mL/m2作为截点,其特异度为64.9%,敏感度为84.8%。结论:LAVI对HFPEF具有一定的诊断价值。

  5. Thermal Cloud Point Fractionation of Poly(vinyl alcohol-co-vinyl acetate: Partition of Nanogels in the Fractions

    Directory of Open Access Journals (Sweden)

    Gérard Riess


    Full Text Available Poly(vinyl acetate-co-vinyl alcohol (PVA, well-known as emulsion stabilizers, are obtained by partial hydrolysis of poly(vinyl acetate (PVAc. Their thermal cloud point fractionation was performed in aqueous medium between 40 and 75 °C. This fractionation was carried out in order to get an insight in the partition of the initially present nanogels in the different fractions. All the fractions were characterized by size exclusion chromatography (SEC, NMR and dynamic light scattering (DLS giving access to average degree of polymerization , DPw average degree of hydrolysis DH, average sequence lengths of vinyl acetate VAc, volume fraction and average size diameter (Dv of nanogels and “free PVA chains”. The polydispersity of the samples in DPw, DH and VAc could be confirmed. The nanogels characterized by the highest values of volume fraction and Dv, in the range of 40–43 nm, were separated in the first coacervate fraction, whereas the most soluble fraction with low VAc content does not contain nanogels but only “free chains” of a Dv value of around 7–8 nm. The nanogels in the various fractions could further be disaggregated into “free chains” by complex formation with sodium dodecyl sulfate (SDS.

  6. Ferroelectric Fractional-Order Capacitors

    KAUST Repository

    Agambayev, Agamyrat


    Poly(vinylidene fluoride)-based polymers and their blends are used to fabricate electrostatic fractional-order capacitors. This simple but effective method allows us to precisely tune the constant phase angle of the resulting fractional-order capacitor by changing the blend composition. Additionally, we have derived an empirical relation between the ratio of the blend constituents and the constant phase angle to facilitate the design of a fractional order capacitor with a desired constant phase angle. The structural composition of the fabricated blends is investigated using Fourier transform infrared spectroscopy and X-ray diffraction techniques.

  7. On Generalized Fractional Differentiator Signals

    Directory of Open Access Journals (Sweden)

    Hamid A. Jalab


    Full Text Available By employing the generalized fractional differential operator, we introduce a system of fractional order derivative for a uniformly sampled polynomial signal. The calculation of the bring in signal depends on the additive combination of the weighted bring-in of N cascaded digital differentiators. The weights are imposed in a closed formula containing the Stirling numbers of the first kind. The approach taken in this work is to consider that signal function in terms of Newton series. The convergence of the system to a fractional time differentiator is discussed.

  8. Fractional trajectories: Decorrelation versus friction (United States)

    Svenkeson, A.; Beig, M. T.; Turalska, M.; West, B. J.; Grigolini, P.


    The fundamental connection between fractional calculus and subordination processes is explored and affords a physical interpretation of a fractional trajectory, that being an average over an ensemble of stochastic trajectories. Heretofore what has been interpreted as intrinsic friction, a form of non-Markovian dissipation that automatically arises from adopting the fractional calculus, is shown to be a manifestation of decorrelations between trajectories. We apply the general theory developed herein to the Lotka-Volterra ecological model, providing new insight into the final equilibrium state. The relaxation time to achieve this state is also considered.

  9. Unusual presentation of Kallmannn syndrome with contiguous gene deletion in three siblings of a family. (United States)

    Madhu, Sri Venkat; Kant, Saket; Holla, Vikram Venkappayya; Arora, Rakesh; Rathi, Sahaj


    We report the case of 3 brothers aged 34, 24, and 22 years, unmarried, who presented to our endocrinology clinic with absence of secondary sexual characters. There was no such history in other siblings, but their maternal uncle had similar complaints. On examination, all 3 had pre-pubertal appearance, voice, and genitalia along with anosmia and bimanual synkinesia. Cryptorchidism was noticed in 2 while third person had small hypoplastic testes. It was also noted that all 3 patients had icthyosis mainly involving trunk, back, and limbs. The hormonal assays were consistent with isolated hypogonadotrophic hypogonadism. IQ testing revealed mental retardation in the 2 patients. Ultrasound showed ectopic right kidney in one patient, atrophic right kidney in the second patient while the third patient had normal kidneys. MRI brain of all the patients showed poorly visualized olfactory tract and bulb. Kallmann syndrome (KS) was diagnosed based on hormonal evaluation and MRI results. Of the four types of KS: Synkinesia, renal anomaly, and X-linked pedigree pattern in our patients pointed towards X-linked type 1 KS as the possible cause. But, icthyosis and mental retardation are not usual presentation of type 1 KS. They are usually seen as a result of contiguous gene deletion of KAL1, steroid sulfatase (STS), and mental retardation (MRX) gene on X chromosome. Hence, the possible gene defect in our cases is inherited defect in contiguous gene deletion. The contiguous gene deletion as the cause of KS in 3 patients of same family is very rare and worth reporting. Also, the significance of phenotype-genotypic association in Kallmann syndrome is discussed.

  10. Dicty_cDB: Contig-U05779-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available tig/Contig-U05779-1Q.Seq.d (181 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Seque...-U05779-1 (Contig-U05779-1Q) /CSM_Contig/Contig-U05779-1Q.Seq.d Length = 181 Score...||| Sbjct: 99 tttttaatttttttt 113 Score = 28.2 bits (14), Expect = 2.9 Identities... = 14/14 (100%) Strand = Plus / Minus Query: 1 tttttttttttttt 14 |||||||||||||| Sbjct: 175 tttttttttttttt 162 14 |||||||||||||| Sbjct: 174 tttttttttttttt 161 Score = 28.2 bits (14), Expect

  11. Dicty_cDB: Contig-U14424-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 424-1Q.Seq.d (129 letters) Database: CSM 6905 sequences; 5,674,871 total letters Score E Sequences producing... (Contig-U14424-1Q) /CSM_Contig/Contig-U14424-1Q.Seq.d Length = 129 Score = 58.0 bits (29), Expect = 2e-09 I...ttttttttt 35 ||||||||||||||||||||||||||||||||||| Sbjct: 1 aaaaaaaccccnaaaaaaaantttttttttttttt 35 Score = 34....35 |||||||| ||||||||||||| Sbjct: 88 aaaaaaaacnttttttttttttt 110 Score = 34.2 bits (17), Expect = 0.033 Ident...||||| |||||||||||||| Sbjct: 104 aaaaaaangtttttttttttttt 82 Score = 32.2 bits (16), Expect = 0.13 Identities

  12. Dicty_cDB: Contig-U16573-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available U16573-1Q.Seq.d (1612 letters) Database: CSM 8402 sequences; 8,075,542 total letters Score E Sequences produ...-U16575-1 (Contig-U16575-1Q) /CSM_Contig/Contig-U16575-1Q.Seq.d Length = 1462 Score...||||||||||||| Sbjct: 350 ttcatcaacttcattattatcagcacaagcaatttcagcc 389 Score = 109 bits (55), Expect = 1e-23 ...aagaaaaagagttggctgagaaatta 869 Score = 67.9 bits (34), Expect = 5e-11 Identities ...|||||||||||||| Sbjct: 752 attggctgataaacttgaaaaggaacgtttagat 785 Score = 67.9 bits (34), Expect = 5e-11 Iden

  13. Dicty_cDB: Contig-U15995-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nnqllppppppplplvahkll*pmkpiqphvhsvvvlsqpwifqiitq lvn*skimisqkelklhsihyvllkllnmislkkslkninhllnyqtqsmkfqnlqkllv klsknskmilk...2416 ) RPCI44_377O10.f RPCI-44 Sus scrofa genomic clone ... 46 3.8 1 ( DW488282 ) GH_RMIRS_068_G03_R Cotton ...Contig-U15995-1 gap included 1478 2 3965902 3964425 MINUS 5 8 U15995 1 0 2 0 0 1 0 3964425 Strand (PLUS/MINUS) MINUS Number of clones 5 Number of EST 8 Link to ...3.8 1 ( CP000576 ) Prochlorococcus marinus str. MIT 9301, complete g... 46 3.8 1

  14. Integrated Common Radio Resource Management with Spectrum Aggregation over Non-Contiguous Frequency Bands

    DEFF Research Database (Denmark)

    Cabral, Orlando; Meucci, Filippo; Mihovska, Albena D.;


    This paper proposes an integrated Common Radio Resource Management (iCRRM). The iCRRM performs classic CRRM functionalities jointly with Spectrum Aggregation (SA), being able to switch users between non-contiguous frequency bands. The SA scheduling is obtained with an optimised General Multi......-Band Scheduling (GMBS) algorithm with the aim of cell throughput maximisation. In particular, we investigate the dependence of the throughput on the cell coverage distance for the allocation of users over the 2 and 5 GHz bands for a single operator scenario under a constant average Signal to Interference...

  15. Molecular analysis of contiguous exons of the phenylalanine hydroxylase gene: identification of a new PKU mutation.


    Dianzani, I; Camaschella, C.; Saglio, G; Ferrero, G B; Ramus, S; Ponzone, A; Cotton, R G


    A modified application of the chemical cleavage of mismatch (CCM) method has been used to screen three contiguous exons (exons 9, 10, and 11) of the phenylalanine hydroxylase gene in 17 Italian PKU patients. A new nonsense heterozygous C-->G transversion within exon 11 (S359X) was identified in a single patient. Only one of the four mutations previously reported in this DNA region in Caucasians was found. This lesion, IVS X-546, was detected in five of the 34 PKU alleles examined. Our results...

  16. Solutions of fractional diffusion problems

    Directory of Open Access Journals (Sweden)

    Rabha W. Ibrahim


    Full Text Available Using the concept of majorant functions, we prove the existence and uniqueness of holomorphic solutions to nonlinear fractional diffusion problems. The analytic continuation of these solutions is studied and the singularity for two cases are posed.

  17. Australia's Next Top Fraction Model (United States)

    Gould, Peter


    Peter Gould suggests Australia's next top fraction model should be a linear model rather than an area model. He provides a convincing argument and gives examples of ways to introduce a linear model in primary classrooms.

  18. Fractional Dynamics of Relativistic Particle

    CERN Document Server

    Tarasov, Vasily E


    Fractional dynamics of relativistic particle is discussed. Derivatives of fractional orders with respect to proper time describe long-term memory effects that correspond to intrinsic dissipative processes. Relativistic particle subjected to a non-potential four-force is considered as a nonholonomic system. The nonholonomic constraint in four-dimensional space-time represents the relativistic invariance by the equation for four-velocity u_{\\mu} u^{\\mu}+c^2=0, where c is a speed of light in vacuum. In the general case, the fractional dynamics of relativistic particle is described as non-Hamiltonian and dissipative. Conditions for fractional relativistic particle to be a Hamiltonian system are considered.

  19. Physcicists rewarded for 'fractional electrons'

    CERN Multimedia

    Ball, P


    The 1998 Nobel prize for physics has been awarded to Horst Stormer, Daniel Tsui and Robert Laughlin.Stormer and Tsui were the first to observe the fractional quantum Hall effect and Laughlin provided the theory shortly afterwards (1 page).

  20. Commercial SNF Accident Release Fractions

    Energy Technology Data Exchange (ETDEWEB)

    J. Schulz


    The purpose of this analysis is to specify and document the total and respirable fractions for radioactive materials that could be potentially released from an accident at the repository involving commercial spent nuclear fuel (SNF) in a dry environment. The total and respirable release fractions are used to support the preclosure licensing basis for the repository. The total release fraction is defined as the fraction of total commercial SNF assembly inventory, typically expressed as an activity inventory (e.g., curies), of a given radionuclide that is released to the environment from a waste form. Radionuclides are released from the inside of breached fuel rods (or pins) and from the detachment of radioactive material (crud) from the outside surfaces of fuel rods and other components of fuel assemblies. The total release fraction accounts for several mechanisms that tend to retain, retard, or diminish the amount of radionuclides that are available for transport to dose receptors or otherwise can be shown to reduce exposure of receptors to radiological releases. The total release fraction includes a fraction of airborne material that is respirable and could result in inhalation doses; this subset of the total release fraction is referred to as the respirable release fraction. Accidents may involve waste forms characterized as: (1) bare unconfined intact fuel assemblies, (2) confined intact fuel assemblies, or (3) canistered failed commercial SNF. Confined intact commercial SNF assemblies at the repository are contained in shipping casks, canisters, or waste packages. Four categories of failed commercial SNF are identified: (1) mechanically and cladding-penetration damaged commercial SNF, (2) consolidated/reconstituted assemblies, (3) fuel rods, pieces, and debris, and (4) nonfuel components. It is assumed that failed commercial SNF is placed into waste packages with a mesh screen at each end (CRWMS M&O 1999). In contrast to bare unconfined fuel assemblies, the

  1. Concurrent fractional and equilibrium crystallisation (United States)

    Sha, Lian-Kun


    This paper proposes the concept of concurrent fractional and equilibrium crystallisation (CFEC) in a multi-phase magmatic system in light of experimental results on diffusivities of elements and other species in minerals and melts. A group of equations are presented to describe how the concentrations of an element or isotope change in fractionated solid, equilibrated solid, melt, liquid, and gas phases, as well as in magma, as a function of distribution coefficients and mass fractions during the CFEC process. CFEC model is a generalised and unified formulation that is valid, not only for pure fractional crystallisation (FC) and perfect equilibrium crystallisation (EC) singly, as two of its limiting end-member cases, but also for the geologically more important process of concurrent fractional and equilibrium crystallisation. The concept that both fractional and equilibrium crystallisation can operate concurrently in a magmatic system, for a given element, among different minerals, and even within different-sized crystal grains of the very same mineral phase, is of fundamental importance in deepening our current understanding of magmatic differentiation processes. CFEC probably occurs more frequently in the natural world than either pure fractional or perfect equilibrium crystallisation alone, as a result of the interplay of varying diffusivities of elements under diverse physicochemical conditions, different residence time and growth rates of mineral phases in magmas, and varying grain sizes within each phase and among different phases. The marked systematic variations in trace element concentrations in the melts of the Bishop Tuff have long been perplexing and difficult to reconcile with existing models of differentiation. CFEC, which is able to better explain the scatter trends in a systematic way than fractional crystallisation, is considered to be the cause.

  2. The Periodogram of fractional processes


    Velasco, Carlos


    We analyse asymptotic properties of the discrete Fourier transform and the periodogram of time series obtained through (truncated) linear filtering of stationary processes. The class of filters contains the fractional differencing operator and its coefficients decay at an algebraic rate, implying long-range-dependent properties for the filtered processes when the degree of integration α is positive. These include fractional time series which are nonstationary for any value of the memory param...

  3. Fractional Reserve Banking: Some Quibbles


    Bagus, Philipp; Howden, David


    We explore several unaddressed issues in George Selgin’s (1988) claim that the best monetary system to maintain monetary equilibrium is a fractional reserve free banking one. The claim that adverse clearing balances would limit credit expansion in a fractional reserve free banking system is more troublesome than previously reckoned. Both lengthened clearing periods and interbank agreements render credit expansion unrestrained. “The theory of free banking” confuses increases in money held with...

  4. Xenon fractionation in porous planetesimals. (United States)

    Zahnle, K; Pollack, J B; Kasting, J F


    The distinctively fractionated Xe on Mars and Earth may have its root in a common source from which both planets accreted. We begin with Ozima and Nakazawa's hypothesis that terrestrial Xe fractionation was caused by gravitational separation of adsorbed solar nebular gases inside large porous planetesimals. We point out that Xe would have been trapped as the planetesimal grew and pores were squeezed shut by lithostatic pressure. We show that enough fractionated Xe to supply the Earth could have been trapped this way. The degree of fractionation is controlled by the lithostatic pressure at the pore-closing front and so would have been roughly the same for all large planetesimals. The predicted degree of fractionation agrees well with that preserved in terrestrial and martian Xe. Relative to Xe, this source is strongly depleted in other noble gases. In contrast to the original Ozima and Nakazawa hypothesis, our hypothesis predicts the observed fractionation, and it allows planetary accretion to occur after the dissipation of the solar nebula. The required planetesimals are large, representing a class of object now extinct in the solar system.

  5. Fractional Charge Definitions and Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Goldhaber, A.S.


    Fractional charge is known through theoretical and experimental discoveries of isolable objects carrying fractions of familiar charge units--electric charge Q, spin S, and the difference of baryon and lepton numbers B-L. With a few simple assumptions all these effects may be described using a generalized version of charge renormalization for locally conserved charges, in which medium correlations yield familiar adiabatic, continuous renormalization, or sometimes nonadiabatic, discrete renormalization. Fractional charges may be carried by fundamental particles or fundamental solitons. Either picture works for the simplest fractional-quantum-Hall-effect quasiholes, though the particle description is far more general. The only known fundamental solitons in three or fewer space dimensions d are the kink (d = 1), the vortex (d = 2), and the magnetic monopole (d = 3). Further, for a charge not intrinsically coupled to the topological charge of a soliton, only the kink and the monopole may carry fractional values. The same reasoning enforces fractional values of B-L for electrically charged elementary particles.

  6. A halo-ring technique for fractionated stereotactic radiotherapy

    Energy Technology Data Exchange (ETDEWEB)

    Clark, B.G.; Podgorsak, E.B.; Souhami, L.; Caron, J.-L.; Sixel, K.E. (Montreal General Hospital, PQ (Canada)); Olivier, A. (Montreal Neurological Inst., PQ (Canada). Dept. of Neurosurgery)


    Stereotactic radiosurgery has become established as an effective treatment modality for certain non-malignant brain diseases such as arteriovenous malformations. This paper describes an extension of the authors' linear accelerator-based radiosurgical technique to fractionated treatment of intracranial disease. The fractionated stereotactic radiotherapy technique expands the use of the modality by sparing normal cells within the treatment volume thus improving the therapeutic ratio. The first treatment is given using a stereotactic frame both for target localization and patient immobilization. The frame is then removed and subsequent treatments use a standard neurosurgical halo-ring for patient immobilization. The halo-ring is left in place on the skull for the duration of the course of treatment. They describe a sensitive and effective technique for checking the rotational beam parameters and collimator alignment which is used immediately prior to treatment to ensure adequate accuracy of dose delivery to the target volume. (author).

  7. Fractional characteristic times and dissipated energy in fractional linear viscoelasticity (United States)

    Colinas-Armijo, Natalia; Di Paola, Mario; Pinnola, Francesco P.


    In fractional viscoelasticity the stress-strain relation is a differential equation with non-integer operators (derivative or integral). Such constitutive law is able to describe the mechanical behavior of several materials, but when fractional operators appear, the elastic and the viscous contribution are inseparable and the characteristic times (relaxation and retardation time) cannot be defined. This paper aims to provide an approach to separate the elastic and the viscous phase in the fractional stress-strain relation with the aid of an equivalent classical model (Kelvin-Voigt or Maxwell). For such equivalent model the parameters are selected by an optimization procedure. Once the parameters of the equivalent model are defined, characteristic times of fractional viscoelasticity are readily defined as ratio between viscosity and stiffness. In the numerical applications, three kinds of different excitations are considered, that is, harmonic, periodic, and pseudo-stochastic. It is shown that, for any periodic excitation, the equivalent models have some important features: (i) the dissipated energy per cycle at steady-state coincides with the Staverman-Schwarzl formulation of the fractional model, (ii) the elastic and the viscous coefficients of the equivalent model are strictly related to the storage and the loss modulus, respectively.

  8. Defining the optimal conditions for catalytic cracking of oil fractions of different fraction and chemical composition

    Energy Technology Data Exchange (ETDEWEB)

    Zhorov, Yu.M.; Panchenkov, G.M.; Pivovarova, N.A.


    The optimum average benzene output for catalytic cracking (CC), temperature and speed of feed for raw materials of different fractions and chemical composition in the catalyzer KMTsP (microspher.) and Tseokar-2 (ball-type). Two gas oil fractions of different oils and a filtrate of paraffin production were used as raw materials. The CC was conducted in a device with an immovaeble layer of catalyzer at temperatures of 400-550/sup 0/ and a volume feed speed of 0.4-3.0 h/sup -1/. It is shown that during CC of more aromatic raw material, high temperatures are essential for benzene output. The values obtained from studying CC on catalyzer having the same chemistry but different fraction composition are the same. Using the Tseokar-2 resulted in a lower benzene output than was expected considering the chemical composition of the filtrate. This was due to the decrease in active Pv during coagulation of the catalyzer granules compared to the KMTsP. Conclusions are drawn concerning the need to consder the chemical composition of the cracking raw material before choosing the conditions for the process. The many cycle ArU is an undesirable component of the raw material and should be removed.

  9. [Correlation between ventricular volume calculated manually and by computer]. (United States)

    Gil Moreno, M; Martínez Ríos, M; Grande, F; Cisneros, F; García Moreira, C; Soní, J


    We present here a program of ventricular volumes measurements in which an area-lenght procedure and a digital computer were used. The results were compared with those obtained by the manual method using the same formula. The correlative estatistical analysis of these results showed a high index of 0.95 when compared to the telediastolic volumes obtained by both technics, while the index reached 0.99 in reference to the telesistolic volumes and the ejection fraction.

  10. Temporally contiguous pencast instruction promotes meaningful learning for dental and dental hygiene students in physiology. (United States)

    Roesch, Darren M


    Smartpens allow for the creation of computerized "pencasts" that combine voice narration with handwritten notes and illustrations. The purpose of this study was to test the effects of voluntary participation in extracurricular instruction with a pencast on student learning. Dental and dental hygiene students were given instruction in a complex physiological topic using lecture and static slides. An Internet link to a pencast that covered the complex topic in a more temporally contiguous fashion was also provided for voluntary review. The students were given a multiple-choice exam that consisted of retention and transfer test questions. Sixty-nine percent of the students who did not watch the pencast and 89 percent of the students who watched the pencast answered the retention test question correctly (p=0.08). Fifty-four percent of the students who did not watch the pencast and 90 percent of the students who watched the pencast answered the transfer test question correctly (p=0.005). This finding indicates that students who watched the pencast performed better on a transfer test, a measurement of meaningful learning, than students who received only the narrated instruction with static images. This supports the hypothesis that temporally contiguous instruction promotes more meaningful learning than lecture accompanied only by static slide images.

  11. Animal models for human contiguous gene syndromes and other genomic disorders

    Directory of Open Access Journals (Sweden)

    Katherina Walz


    Full Text Available Genomic disorders refer to a group of syndromes caused by DNA rearrangements, such as deletions and duplications, which result in an alteration of normal gene dosage. The chromosomal rearrangements are usually relatively small and often difficult to detect cytogenetically. In a subset of such conditions the rearrangements comprise multiple unrelated contiguous genes that are physically linked and thus have been referred to as contiguous gene syndromes (CGS. In general, each syndrome presents a complex clinical phenotype that has been attributed generally to dosage sensitive gene(s present in the responsible chromosomal interval. A common mechanism for CGS resulting from interstitial deletion/duplication has recently been elucidated. The DNA rearrangements result from nonallelic homologous recombination (NAHR utilizing flanking low-copy repeats (LCRs as recombination substrates. The resulting rearrangements often involve the same genomic region, a common deletion or duplication, making it difficult to assign a specific phenotype or endophenotype to a single responsible gene. The human and mouse genome sequencing projects, in conjunction with the ability to engineer mouse chromosome rearrangements, have enabled the production of mouse models for CGS and genomic disorders. In this review we present an overview of different techniques utilized to generate mouse models for selected genomic disorders. These models foment novel insights into the specific genes that convey the phenotype by dosage and/or position effects and provide opportunities to explore therapeutic options.

  12. Spatial contiguity analysis. A method for describing spatial structures of seismic data

    Energy Technology Data Exchange (ETDEWEB)

    Faraj, A. [Institut Francais du Petrole, 1-4 Av. de Bois-Preau, 92500 Rueil Malmaison, Paris (France); Cailly, F. [Beicip Franlab, 232 Av. Napoleon Bonaparte, 92500 Rueil Malmaison, Paris (France)


    We apply spatial contiguity analysis (SCA) to study spatial structures contained in seismic images. Compared to classical methods, such as principal component analysis (PCA), SCA is more efficient for multivariate description and spatial filtering of this kind of images. We present SCA according to geostatistic formalism defined by Matheron. A preliminary spatial analysis of initial variables is required. Made with the help of variogram curves, this permits to underline spatial properties of these variables and defines contiguity distance and direction to apply SCA. A series of mathematical tools is defined. They allow quantifying the information held by initial variables and factorial components in terms of variance and spatial variability and exhibit data spatial structures on different scales. The method is applied to analyse a seismic data set. We compare PCA and SCA results. This data set gives us the opportunity to show the interest of preliminary spatial analysis of initial variables, and the effects of spatial direction and distance on the data decomposition in elementary structures.

  13. Novel Handover Optimization with a Coordinated Contiguous Carrier Aggregation Deployment Scenario in LTE-Advanced Systems

    Directory of Open Access Journals (Sweden)

    Ibraheem Shayea


    Full Text Available The carrier aggregation (CA technique and Handover Parameters Optimization (HPO function have been introduced in LTE-Advanced systems to enhance system performance in terms of throughput, coverage area, and connection stability and to reduce management complexity. Although LTE-Advanced has benefited from the CA technique, the low spectral efficiency and high ping-pong effect with high outage probabilities in conventional Carrier Aggregation Deployment Scenarios (CADSs have become major challenges for cell edge User Equipment (UE. Also, the existing HPO algorithms are not optimal for selecting the appropriate handover control parameters (HCPs. This paper proposes two solutions by deploying a Coordinated Contiguous-CADS (CC-CADS and a Novel Handover Parameters Optimization algorithm that is based on the Weight Performance Function (NHPO-WPF. The CC-CADS uses two contiguous component carriers (CCs that have two different beam directions. The NHPO-WPF automatically adjusts the HCPs based on the Weight Performance Function (WPF, which is evaluated as a function of the Signal-to-Interference Noise Ratio (SINR, cell load, and UE’s velocity. Simulation results show that the CC-CADS and the NHPO-WPF algorithm provide significant enhancements in system performance over that of conventional CADSs and HPO algorithms from the literature, respectively. The integration of both solutions achieves even better performance than scenarios in which each solution is considered independently.

  14. A contiguity-enhanced k-means clustering algorithm for unsupervised multispectral image segmentation

    Energy Technology Data Exchange (ETDEWEB)

    Theiler, J.; Gisler, G.


    The recent and continuing construction of multi and hyper spectral imagers will provide detailed data cubes with information in both the spatial and spectral domain. This data shows great promise for remote sensing applications ranging from environmental and agricultural to national security interests. The reduction of this voluminous data to useful intermediate forms is necessary both for downlinking all those bits and for interpreting them. Smart onboard hardware is required, as well as sophisticated earth bound processing. A segmented image (in which the multispectral data in each pixel is classified into one of a small number of categories) is one kind of intermediate form which provides some measure of data compression. Traditional image segmentation algorithms treat pixels independently and cluster the pixels according only to their spectral information. This neglects the implicit spatial information that is available in the image. We will suggest a simple approach; a variant of the standard k-means algorithm which uses both spatial and spectral properties of the image. The segmented image has the property that pixels which are spatially contiguous are more likely to be in the same class than are random pairs of pixels. This property naturally comes at some cost in terms of the compactness of the clusters in the spectral domain, but we have found that the spatial contiguity and spectral compactness properties are nearly orthogonal, which means that we can make considerable improvements in the one with minimal loss in the other.

  15. Application of Spatial Regression Models to Income Poverty Ratios in Middle Delta Contiguous Counties in Egypt

    Directory of Open Access Journals (Sweden)

    Sohair F Higazi


    Full Text Available Regression analysis depends on several assumptions that have to be satisfied. A major assumption that is never satisfied when variables are from contiguous observations is the independence of error terms. Spatial analysis treated the violation of that assumption by two derived models that put contiguity of observations into consideration. Data used are from Egypt's 2006 latest census, for 93 counties in middle delta seven adjacent Governorates. The dependent variable used is the percent of individuals classified as poor (those who make less than 1$ daily. Predictors are some demographic indicators. Explanatory Spatial Data Analysis (ESDA is performed to examine the existence of spatial clustering and spatial autocorrelation between neighboring counties. The ESDA revealed spatial clusters and spatial correlation between locations. Three statistical models are applied to the data, the Ordinary Least Square regression model (OLS, the Spatial Error Model (SEM and the Spatial Lag Model (SLM.The Likelihood Ratio test and some information criterions are used to compare SLM and SEM to OLS. The SEM model proved to be better than the SLM model. Recommendations are drawn regarding the two spatial models used.

  16. Drought Occurrences and Their Characteristics across Selected Spatial Scales in the Contiguous United States

    Directory of Open Access Journals (Sweden)

    Navaratnam Leelaruban


    Full Text Available An understanding of drought occurrences and their characteristics such as intensity, duration, frequency, and areal coverage, and their variations on different spatial scales, is crucial to plan for droughts in different regions and in different sized areas. This study investigated the variations of spatio-temporal characteristics of droughts under selected spatial scales: National (Contiguous U.S., regional (High Plains, state (North Dakota, ND, climatic division (South Central, ND, and county (Grant, ND. Weekly drought area coverage data for the period spanning the years 2000–2014 from the U.S. Drought Monitor of the National Drought Mitigation Center were used. The study captured the areal coverages and occurrence frequency of droughts with different intensity levels for the years 2000 to 2014 for the contiguous U.S. Year to year variability in spatial distribution of the areal coverages of droughts with different intensity levels were also analysed. The study further investigated how the weekly percentage area under different intensity categories varied along time, and extracted the spatio-temporal characteristics of different drought intensity categories at different spatial scales. The study identified areas that are frequently affected by droughts of different intensity categories in the U.S. at the national scale, and reported the spatial scale dependence of drought characteristics.

  17. Heterotic Moduli Stabilization with Fractional Chern-Simons Invariants

    Energy Technology Data Exchange (ETDEWEB)

    Gukov, S


    We show that fractional flux from Wilson lines can stabilize the moduli of heterotic string compactifications on Calabi-Yau threefolds. We observe that the Wilson lines used in GUT symmetry breaking naturally induce a fractional flux. When combined with a hidden-sector gaugino condensate, this generates a potential for the complex structure moduli, Kaehler moduli, and dilaton. This potential has a supersymmetric AdS minimum at moderately weak coupling and large volume. Notably, the necessary ingredients for this construction are often present in realistic models. We explore the type IIA dual phenomenon, which involves Wilson lines in D6-branes wrapping a three-cycle in a Calabi-Yau, and comment on the nature of the fractional instantons which change the Chern-Simons invariant.

  18. From fractional Fourier transformation to quantum mechanical fractional squeezing transformation

    Institute of Scientific and Technical Information of China (English)

    吕翠红; 范洪义; 李东韡


    By converting the triangular functions in the integration kernel of the fractional Fourier transformation to the hy-perbolic function, i.e., tanα→tanhα, sinα→sinhα, we find quantum mechanical fractional squeezing transformation (FrST) which satisfies additivity. By virtue of the integration technique within ordered product of operators (IWOP) wederive the unitary operator responsible for the FrST, which is composite and is made of eiπa†a/2 and exp[ iα2 (a2+a†2)]. The FrST may be implemented in combinations of quadratic nonlinear crystals with different phase mismatches.

  19. Percutaneous closure of atrial septal defects leads to normalisation of atrial and ventricular volumes

    Directory of Open Access Journals (Sweden)

    Worthley Matthew I


    Full Text Available Abstract Background Percutaneous closure of atrial septal defects (ASDs should potentially reduce right heart volumes by removing left-to-right shunting. Due to ventricular interdependence, this may be associated with impaired left ventricular filling and potentially function. Furthermore, atrial changes post-ASD closure have been poorly understood and may be important for understanding risk of atrial arrhythmia post-ASD closure. Cardiovascular magnetic resonance (CMR is an accurate and reproducible imaging modality for the assessment of cardiac function and volumes. We assessed cardiac volumes pre- and post-percutaneous ASD closure using CMR. Methods Consecutive patients (n = 23 underwent CMR pre- and 6 months post-ASD closure. Steady state free precession cine CMR was performed using contiguous slices in both short and long axis views through the ASD. Data was collected for assessment of left and right atrial, ventricular end diastolic volumes (EDV and end systolic volumes (ESV. Data is presented as mean ± SD, volumes as mL, and paired t-testing performed between groups. Statistical significance was taken as p Results There was a significant reduction in right ventricular volumes at 6 months post-ASD closure (RVEDV: 208.7 ± 76.7 vs. 140.6 ± 60.4 mL, p Conclusion ASD closure leads to normalisation of ventricular volumes and also a reduction in right atrial volume. Further follow-up is required to assess how this predicts outcomes such as risk of atrial arrhythmias after such procedures.


    Institute of Scientific and Technical Information of China (English)

    Baosheng WU; Albert MOLINAS; Anping SHU


    A new method based on the Transport Capacity Fraction (TCF) concept is proposed to compute the fractional transport rates for nonuniform sediment mixtures in sand-bed channels. The TCF concept is derived from the understanding that the measurements and predictions of bed-material load are more accurate and reliable than the measurements and predictions of fractional loads. First the bed-material load is computed using an appropriate equation, then the fractional transport rates are determined by distributing the bed-material load into size groups through a transport capacity distribution function. For the computation of bed-material loads, the Aekers and White, Engelund and Hansen, and Yang equations are used in this study. Two new transport capacity distribution functions are developed for flows in sand-bed channels. The new expressions presented in this paper account for the sheltering and exposure effects that exist in mixtures. Comparisons with measured data show that the proposed method can significantly improve the predictions of fractional transport rates for nonuniform sediment mixtures.

  1. Use of a theoretical equation of state to interpret time-dependent free volume in polymer glasses

    Energy Technology Data Exchange (ETDEWEB)

    Curro, J.G.; Lagasse, R.R.; Simha, R.


    Many physical properties of polymer glasses change spontaneously during isothermal aging by a process commonly modeled as collapse of free volume. The model has not been verified rigorously because free volume cannot be unambiguously measured. In the present investigation we tentatively identify the free-volume fraction with the fraction of empty sites in the equation of state of Simha and Somcynsky. With this theory, volume recovery measurements can be analyzed to yield directly the time-dependent, free-volume fraction. Using this approach, recent volume measurements on poly(methyl methacrylate) are analyzed. The resulting free-volume fractions are then used in the Doolittle equation to predict the shift in stress relaxation curves at 23 /sup 0/C. These predicted shift factors agree with the experimental measurements of Cizmecioglu et al. In addition, it is shown that previous assumptions concerning temperature dependence of free volume are inconsistent with the theory.

  2. Use of a theoretical equation of state to interpret time-dependent free volume in polymer glasses (United States)

    Curro, J. G.; Lagasse, R. R.; Simha, R.


    Many physical properties of polymer glasses change spontaneously during isothermal aging by a process commonly modeled as collapse of free volume. The model has not been verified rigorously because free volume cannot be unambiguously measured. In the present investigation we tentatively identify the free-volume fraction with the fraction of empty sites in the equation of state of Simha and Somcynsky. With this theory, volume recovery measurements can be analyzed to yield directly the time-dependent, free-volume fraction. Using this approach, recent volume measurements on poly(methyl methacrylate) are analyzed. The resulting free-volume fractions are then used in the Doolittle equation to predict the shift in stress relaxation curves at 23 °C. These predicted shift factors agree with the experimental measurements of Cizmecioglu et al. In addition, it is shown that previous assumptions concerning temperature dependence of free volume are inconsistent with the theory.

  3. Phytotoxic characterization of various fractions of Launaea ...

    African Journals Online (AJOL)



    Jun 15, 2011 ... Abbreviations: DMSO, Dimethyl sulfoxide; LPME, Launaea procumbens ... 1, non treated control; 2, n-hexane fraction; 3, ethyl acetate fraction; ... fractionated using n-hexane, ethyl acetate, chloroform, butanol and distilled ...

  4. REFractions: The Representing Equivalent Fractions Game (United States)

    Tucker, Stephen I.


    Stephen Tucker presents a fractions game that addresses a range of fraction concepts including equivalence and computation. The REFractions game also improves students' fluency with representing, comparing and adding fractions.

  5. Type-2 fuzzy fractional derivatives (United States)

    Mazandarani, Mehran; Najariyan, Marzieh


    In this paper, we introduce two definitions of the differentiability of type-2 fuzzy number-valued functions of fractional order. The definitions are in the sense of Riemann-Liouville and Caputo derivative of order β ɛ (0, 1), and based on type-2 Hukuhara difference and H2-differentiability. The existence and uniqueness of the solutions of type-2 fuzzy fractional differential equations (T2FFDEs) under Caputo type-2 fuzzy fractional derivative and the definition of Laplace transform of type-2 fuzzy number-valued functions are also given. Moreover, the approximate solution to T2FFDE by a Predictor-Evaluate-Corrector-Evaluate (PECE) method is presented. Finally, the approximate solutions of two examples of linear and nonlinear T2FFDEs are obtained using the PECE method, and some cases of T2FFDEs applications in some sciences are presented.

  6. Optical encryption with cascaded fractional wavelet transforms

    Institute of Scientific and Technical Information of China (English)

    BAO Liang-hua; CHEN Lin-fei; ZHAO Dao-mu


    On the basis of fractional wavelet transform, we propose a new method called cascaded fractional wavelet transform to encrypt images. It has the virtues of fractional Fourier transform and wavelet transform. Fractional orders, standard focal lengths and scaling factors are its keys. Multistage fractional Fourier transforms can add the keys easily and strengthen information security. This method can also realize partial encryption just as wavelet transform and fractional wavelet transform. Optical realization of encryption and decryption is proposed. Computer simulations confirmed its possibility.

  7. Impact of dose size in single fraction spatially fractionated (grid) radiotherapy for melanoma

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hualin, E-mail:, E-mail: [Department of Radiation Oncology, Northwestern University Feinberg School of Medicine, Chicago, Illinois 60611 and Department of Radiation Oncology, Indiana University School of Medicine, Indianapolis, Indiana 46202 (United States); Zhong, Hualiang [Department of Radiation Oncology, Henry Ford Health System, Detroit, Michigan 48202 (United States); Barth, Rolf F. [Department of Pathology, The Ohio State University, Columbus, Ohio 43210 (United States); Cao, Minsong; Das, Indra J. [Department of Radiation Oncology, Indiana University School of Medicine, Indianapolis, Indiana 46202 (United States)


    Purpose: To evaluate the impact of dose size in single fraction, spatially fractionated (grid) radiotherapy for selectively killing infiltrated melanoma cancer cells of different tumor sizes, using different radiobiological models. Methods: A Monte Carlo technique was employed to calculate the 3D dose distribution of a commercially available megavoltage grid collimator in a 6 MV beam. The linear-quadratic (LQ) and modified linear quadratic (MLQ) models were used separately to evaluate the therapeutic outcome of a series of single fraction regimens that employed grid therapy to treat both acute and late responding melanomas of varying sizes. The dose prescription point was at the center of the tumor volume. Dose sizes ranging from 1 to 30 Gy at 100% dose line were modeled. Tumors were either touching the skin surface or having their centers at a depth of 3 cm. The equivalent uniform dose (EUD) to the melanoma cells and the therapeutic ratio (TR) were defined by comparing grid therapy with the traditional open debulking field. The clinical outcomes from recent reports were used to verify the authors’ model. Results: Dose profiles at different depths and 3D dose distributions in a series of 3D melanomas treated with grid therapy were obtained. The EUDs and TRs for all sizes of 3D tumors involved at different doses were derived through the LQ and MLQ models, and a practical equation was derived. The EUD was only one fifth of the prescribed dose. The TR was dependent on the prescribed dose and on the LQ parameters of both the interspersed cancer and normal tissue cells. The results from the LQ model were consistent with those of the MLQ model. At 20 Gy, the EUD and TR by the LQ model were 2.8% higher and 1% lower than by the MLQ, while at 10 Gy, the EUD and TR as defined by the LQ model were only 1.4% higher and 0.8% lower, respectively. The dose volume histograms of grid therapy for a 10 cm tumor showed different dosimetric characteristics from those of conventional

  8. Fractional Derivatives in Dengue Epidemics (United States)

    Pooseh, Shakoor; Rodrigues, Helena Sofia; Torres, Delfim F. M.


    We introduce the use of fractional calculus, i.e., the use of integrals and derivatives of non-integer (arbitrary) order, in epidemiology. The proposed approach is illustrated with an outbreak of dengue disease, which is motivated by the first dengue epidemic ever recorded in the Cape Verde islands off the coast of west Africa, in 2009. Numerical simulations show that in some cases the fractional models fit better the reality when compared with the standard differential models. The classical results are obtained as particular cases by considering the order of the derivatives to take an integer value.

  9. On a fractional difference operator

    Directory of Open Access Journals (Sweden)

    P. Baliarsingh


    Full Text Available In the present article, a set of new difference sequence spaces of fractional order has been introduced and subsequently, an application of these spaces, the notion of the derivatives and the integrals of a function to the case of non-integer order have been generalized. Certain results involving the unusual and non-uniform behavior of the corresponding difference operator have been investigated and also been verified by using some counter examples. We also verify these unusual and non-uniform behaviors by studying the geometry of fractional calculus.

  10. A Fast Fractional Difference Algorithm

    DEFF Research Database (Denmark)

    Jensen, Andreas Noack; Nielsen, Morten Ørregaard

    We provide a fast algorithm for calculating the fractional difference of a time series. In standard implementations, the calculation speed (number of arithmetic operations) is of order T 2, where T is the length of the time series. Our algorithm allows calculation speed of order T logT . For mode......We provide a fast algorithm for calculating the fractional difference of a time series. In standard implementations, the calculation speed (number of arithmetic operations) is of order T 2, where T is the length of the time series. Our algorithm allows calculation speed of order T log...

  11. Fractional Boundaries for Fluid Spheres

    CERN Document Server

    Bayin, S; Krisch, J P; Bayin, Selcuk; Krisch, Jean P.


    A single Israel layer can be created when two metrics adjoin with no continuous metric derivative across the boundary. The properties of the layer depend only on the two metrics it separates. By using a fractional derivative match, a family of Israel layers can be created between the same two metrics. The family is indexed by the order of the fractional derivative. The method is applied to Tolman IV and V interiors and a Schwarzschild vacuum exterior. The method creates new ranges of modeling parameters for fluid spheres. A thin shell analysis clarifies pressure/tension in the family of boundary layers.

  12. Fractional derivatives in Dengue epidemics

    CERN Document Server

    Pooseh, Shakoor; Torres, Delfim F M


    We introduce the use of fractional calculus, i.e., the use of integrals and derivatives of non-integer (arbitrary) order, in epidemiology. The proposed approach is illustrated with an outbreak of dengue disease, which is motivated by the first dengue epidemic ever recorded in the Cape Verde islands off the coast of west Africa, in 2009. Numerical simulations show that in some cases the fractional models fit better the reality when compared with the standard differential models. The classical results are obtained as particular cases by considering the order of the derivatives to take an integer value.

  13. A Comparative Analysis of Series And Finite Element Solutions For Flow In Multi-layer Aquifers With Contiguous Layers (United States)

    Wong, S.; Craig, J. R.


    Recently, Wong S. & J.R. Craig [Computational Methods in Water Resources XVII International Conference, 2008] have developed a semi-analytic series (SAS) solution method for simulating 2D steady-state groundwater flow in multi-layer aquifers with natural unconformity. The advantages of the approach include the capability to predict groundwater flow in aquifer systems with a geometrically complex structure, i.e., layers that are contiguous but vary (sometimes dramatically) in thickness across the modelled domain. The SAS approach is unorthodox compared to numerical scheme such as finite element (FE) method when handling an aquifer basin with contiguous layers. This research attempts to compare the robustness of the SAS solution with that of the FE solution under variety of different geometric conditions, including the increasing of system aspect ratios and the inclusion of pinching layers. It was found that the SAS approach is a useful benchmarking tool and that for contiguous layers, both FE methods continue to be highly accurate at even large aspect ratios. Based on the benchmarking experiments, some rules of thumb for mesh generation in FE models of regional aquifer systems with both contiguous and discontiguous layering are identified.

  14. Volume adjustment of lung density by computed tomography scans in patients with emphysema

    DEFF Research Database (Denmark)

    Shaker, S B; Dirksen, A; Laursen, Lars Christian


    package that detected the lung in contiguous images and subsequently generated a histogram of the pixel attenuation values. The total lung volume (TLV), lung weight, percentile density (PD), and relative area of emphysema (RA) were calculated from this histogram. RA and PD are commonly applied measures......PURPOSE: To determine how to adjust lung density measurements for the volume of the lung calculated from computed tomography (CT) scans in patients with emphysema. MATERIAL AND METHODS: Fifty patients with emphysema underwent 3 CT scans at 2-week intervals. The scans were analyzed with a software...... of pulmonary emphysema derived from CT scans. These parameters are markedly influenced by changes in the level of inspiration. The variability of lung density due to within-subject variation in TLV was explored by plotting TLV against PD and RA. RESULTS: The coefficients for volume adjustment for PD were...

  15. Predicting equilibrium uranium isotope fractionation in crystals and solution (United States)

    Schauble, E. A.


    Despite the rapidly growing interest in using 238U/235U measurements as a proxy for changes in oxygen abundance in surface and near-surface environments, the present theoretical understanding of uranium isotope fractionation is limited to a few simple gas-phase molecules and analogues of dissolved species (e.g., 1,2,3). Understanding uranium isotope fractionation behavior in more complicated species, such as crystals and adsorption complexes, will help in the design and interpretation of experiments and field studies, and may suggest other uses for 38U/235U measurements. In this study, a recently developed first-principles method for estimating the nuclear volume component of field shift fractionation in crystals and complex molecular species (4) is combined with mass-dependent fractionation theory to predict equilibrium 38U/235U fractionations in aqueous and crystalline uranium compounds, including uraninite (UO2). The nuclear field shift effect, caused by the interaction of electrons with the finite volume of the positive charge distribution in uranium nuclei, is estimated using Density Functional Theory and the Projector Augmented Wave method (DFT-PAW). Tests against relativistic electronic structure calculations and Mössbauer isomer shift data indicate that the DFT-PAW method is reasonably accurate, while being much better suited to models of complex and crystalline species. Initial results confirm previous predictions that the nuclear volume effect overwhelms mass depdendent fractionation in U(VI)-U(IV) exchange reactions, leading to higher 238U/235U in U(IV) species (i.e., for UO2 xtal vs. UO22+aq, ln αNV ≈ +1.8‰ , ln αMD ≈ -0.8‰, ln αTotal ≈ +1.0‰ at 25ºC). UO2 and U(H2O)94+, are within ~0.4‰ of each other, while U(VI) species appear to be more variable. This suggests that speciation is likely to significantly affect natural uranium isotope fractionations, in addition to oxidation state. Tentatively, it appears that uranyl-type (UO22

  16. Staircase and Fractional Part Functions (United States)

    Amram, Meirav; Dagan, Miriam; Ioshpe, Michael; Satianov, Pavel


    The staircase and fractional part functions are basic examples of real functions. They can be applied in several parts of mathematics, such as analysis, number theory, formulas for primes, and so on; in computer programming, the floor and ceiling functions are provided by a significant number of programming languages--they have some basic uses in…

  17. Fractional Laplace Transforms - A Perspective

    CERN Document Server

    Treumann, R A


    A form of the Laplace transform is reviewed as a paradigm for an entire class of fractional functional transforms. Various of its properties are discussed. Such transformations should be useful in application to differential/integral equations or problems in non-extensive statistical mechanics.

  18. Subcellular fractionation of rough microsomes. (United States)

    Sabatini, David D


    When eukaryotic cells are homogenized, the rough endoplasmic reticula are converted into small vesicles, called rough microsomes. Strategies for the isolation of rough microsomes are introduced here, as are methods for evaluating the purity and intactness of an isolated rough microsomal fraction.

  19. Working with a fractional object:

    DEFF Research Database (Denmark)

    Christensen, Bodil Just; Hillersdal, Line; Holm, Lotte


    constitutes ‘appetite’ was a key concern, as each discipline has its particular definition and operationalization of the term. In response, a material-semiotic approach was chosen which allowed for a reconceptualization of appetite as a ‘fractional object’, engaged in multiple relations and enacted...

  20. Complexity and the Fractional Calculus (United States)


    developed in a number of signif- icant ways in the recent past. Sokolov et al. [1] maintain that this calculus was restricted to the field of mathematics... Sokolov , J. Klafter, and A. Blumen, “Fractional kinetics,” Physics Today, vol. 55, no. 11, pp. 48–54, 2002. [2] V. Seshadri and B. J. West, “Fractal

  1. Fractional Laplace Transforms - A Perspective

    Directory of Open Access Journals (Sweden)

    Rudolf A. Treumann


    Full Text Available A new form of the Laplace transform is reviewed as a paradigm for an entire class of fractional functional transforms. Various of its properties are discussed. Such transformations should be useful in application to differential/integral equations or problems in non-extensive statistical mechanics.

  2. A note on fractional supersolutions

    Directory of Open Access Journals (Sweden)

    Janne Korvenpaa


    Full Text Available We study a class of equations driven by nonlocal, possibly degenerate, integro-differential operators of differentiability order $s\\in (0,1$ and summability growth $p>1$, whose model is the fractional $p$-Laplacian with measurable coefficients. We prove that the minimum of the corresponding weak supersolutions is a weak supersolution as well.

  3. Math Fair: Focus on Fractions (United States)

    Mokashi, Neelima A.


    This article depicts the rewarding experience of creating mathematical environments for kindergarten and elementary students by focusing on one of the most important and often difficult-to-grasp concepts (fractions) through play methods incorporated into a math fair. The basic concept of a math fair is threefold: (1) to create preplanned,…

  4. Pythagorean Approximations and Continued Fractions (United States)

    Peralta, Javier


    In this article, we will show that the Pythagorean approximations of [the square root of] 2 coincide with those achieved in the 16th century by means of continued fractions. Assuming this fact and the known relation that connects the Fibonacci sequence with the golden section, we shall establish a procedure to obtain sequences of rational numbers…

  5. Riesz potential versus fractional Laplacian

    KAUST Repository

    Ortigueira, Manuel Duarte


    This paper starts by introducing the Grünwald-Letnikov derivative, the Riesz potential and the problem of generalizing the Laplacian. Based on these ideas, the generalizations of the Laplacian for 1D and 2D cases are studied. It is presented as a fractional version of the Cauchy-Riemann conditions and, finally, it is discussed with the n-dimensional Laplacian.

  6. Antiulcer activity of methanolic extract and fractions of Picralima nitida seeds(Apocynacaea) in rats

    Institute of Scientific and Technical Information of China (English)

    Okonta Jegbefume Mathew; Adibe Maxwell Ogochukwu; Ubaka Chukwuemeka Michael


    Objective: To investigated the antisecrectory activities of the methanol extract, chloroform fraction and methanol fraction of Picralima nitida seeds. Methods: The methanol extract of Picralima nitida seeds was fractionated into chloroform fraction and methanol fraction. They were evaluated for antiulcer activity and gastric emptying time in rats using aspirin-pylorus-ligation model. Results: Oral administration of the methanol extract, chloroform fraction and methanol fraction at 1 000 mg/kg reduced gastric ulcer by 56.4%, 40.0% and 56.3%, respectively; and the fractions of the extract significantly (P<0.05) reduced gastric emptying time when compared to the control. Gastric acidity was significantly decreased when compared with saline group, 40.25 mEq/L in methanol extract, 50.0 mEq/L in chloroform fraction 51.25 mEq/L in methanol fration but had no significant effect on the gastric secretion volume. Conclusions: These findings showed that methanol extract, chloroform fraction and methanol fraction of the seeds of Picralima possessed potent antiulcer properties and some antisecretory properties.

  7. Fractional diffusion: recovering the distributed fractional derivative from overposed data (United States)

    Rundell, W.; Zhang, Z.


    There has been considerable recent study in ‘subdiffusion’ models that replace the standard parabolic equation model by a one with a fractional derivative in the time variable. There are many ways to look at this newer approach and one such is to realize that the order of the fractional derivative is related to the time scales of the underlying diffusion process. This raises the question of what order α of derivative should be taken and if a single value actually suffices. This has led to models that combine a finite number of these derivatives each with a different fractional exponent {αk} and different weighting value c k to better model a greater possible range of time scales. Ultimately, one wants to look at a situation that combines derivatives in a continuous way—the so-called distributional model with parameter μ ≤ft(α \\right) . However all of this begs the question of how one determines this ‘order’ of differentiation. Recovering a single fractional value has been an active part of the process from the beginning of fractional diffusion modeling and if this is the only unknown then the markers left by the fractional order derivative are relatively straightforward to determine. In the case of a finite combination of derivatives this becomes much more complex due to the more limited analytic tools available for such equations, but recent progress in this direction has been made, (Li et al 2015 Appl. Math. Comput. 257 381–97, Li and Yamamoto 2015 Appl. Anal. 94 570–9). This paper considers the full distributional model where the order is viewed as a function μ ≤ft(α \\right) on the interval (0, 1]. We show existence, uniqueness and regularity for an initial-boundary value problem including an important representation theorem in the case of a single spatial variable. This is then used in the inverse problem of recovering the distributional coefficient μ ≤ft(α \\right) from a time trace of the solution and a uniqueness result is

  8. Galaxy Cluster Baryon Fractions Revisited (United States)

    Gonzalez, Anthony H.; Sivanandam, Suresh; Zabludoff, Ann I.; Zaritsky, Dennis


    We measure the baryons contained in both the stellar and hot-gas components for 12 galaxy clusters and groups at z ~ 0.1 with M = 1-5 × 1014 M ⊙. This paper improves upon our previous work through the addition of XMM-Newton X-ray data, enabling measurements of the total mass and masses of each major baryonic component—intracluster medium, intracluster stars, and stars in galaxies—for each system. We recover a mean relation for the stellar mass versus halo mass, M_{\\star }\\propto M_{500}^{-0.52+/- 0.04}, that is 1σ shallower than in our previous result. We confirm that the partitioning of baryons between the stellar and hot-gas components is a strong function of M 500; the fractions of total mass in stars and X-ray gas within a sphere of radius r 500 scale as f_{\\star }\\propto M_{500}^{-0.45+/- 0.04} and f_{gas}\\propto M_{500}^{0.26+/- 0.03}, respectively. We also confirm that the combination of the brightest cluster galaxy and intracluster stars is an increasingly important contributor to the stellar baryon budget in lower halo masses. Studies that fail to fully account for intracluster stars typically underestimate the normalization of the stellar baryon fraction versus M 500 relation by ~25%. Our derived stellar baryon fractions are also higher, and the trend with halo mass weaker, than those derived from recent halo occupation distribution and abundance matching analyses. One difference from our previous work is the weak, but statistically significant, dependence here of the total baryon fraction upon halo mass: f_{bary}\\propto M_{500}^{0.16+/- 0.04}. For M 500 >~ 2 × 1014, the total baryon fractions within r 500 are on average 18% below the universal value from the seven year Wilkinson Microwave Anisotropy Probe (WMAP) analysis, or 7% below for the cosmological parameters from the Planck analysis. In the latter case, the difference between the universal value and cluster baryon fractions is less than the systematic uncertainties associated with

  9. Fractional Processes and Fractional-Order Signal Processing Techniques and Applications

    CERN Document Server

    Sheng, Hu; Qiu, TianShuang


    Fractional processes are widely found in science, technology and engineering systems. In Fractional Processes and Fractional-order Signal Processing, some complex random signals, characterized by the presence of a heavy-tailed distribution or non-negligible dependence between distant observations (local and long memory), are introduced and examined from the ‘fractional’ perspective using simulation, fractional-order modeling and filtering and realization of fractional-order systems. These fractional-order signal processing (FOSP) techniques are based on fractional calculus, the fractional Fourier transform and fractional lower-order moments. Fractional Processes and Fractional-order Signal Processing: • presents fractional processes of fixed, variable and distributed order studied as the output of fractional-order differential systems; • introduces FOSP techniques and the fractional signals and fractional systems point of view; • details real-world-application examples of FOSP techniques to demonstr...

  10. 3 Contiguous Experiments on a Design Historical Case

    DEFF Research Database (Denmark)

    Pedersen, Pia


    and demonstrate that it can inform and produce relevant knowledge to practice-based research and research through design. It is the assumption that – by forming the basis for making an epistemic artefact – a design historical case can construct knowledge on how to transform statistics into visualisations......This paper contributes to the field of practicebased research and includes insights from research through design, both research perspectives that apply methods and processes from design practice as basis for knowledge generation. The objective of the paper is to introduce a design historical case....... It is also the assumption that the combination of design history and designerly experiments can extend the theoretical scope of practice-based research, which is normally defined by focusing on the present and the future. Three contiguous experiments are demonstrated through dynamic research sketching, a new...

  11. GPC light shaper for speckle-free one- and two-photon contiguous pattern excitation

    DEFF Research Database (Denmark)

    Bañas, Andrew Rafael; Palima, Darwin; Villangca, Mark Jayson;


    Generalized Phase Contrast (GPC) is an efficient method for generating speckle-free contiguous optical distributions useful in diverse applications such as static beam shaping, optical manipulation and recently, for excitation in two-photon optogenetics. To fully utilize typical Gaussian lasers......, such as a circle and different rectangles commonly used in industrial or commercial applications. We also show simple and efficient beam shaping of arbitrary shapes geared towards biophotonics research and other contemporary applications. Optimized GPC configurations consistently give ~84% efficiency and ~3x...... in such applications, we analytically derive conditions for photon efficient light shaping with GPC. When combined with the conditions for optimal contrast developed in previous works, our analysis further simplifies GPCx2019;s implementation. The results of our analysis are applied to practical illumination shapes...

  12. Case Presentation of Concomitant and Contiguous Adenomatoid Odontogenic Tumor and Focal Cemento-Ossifying Dysplasia. (United States)

    Rezvani, Gita; Donoghue, Mandana; Reichart, Peter A; Pazuhi, Neda


    A 24 year-old male was presented for the diagnosis of an asymptomatic bony expansion in relation to the right maxillary canine and first premolar. The unilocular radiolucent lesion with central foci of calcification had caused divergence of canine and first premolar roots without any resorption. This case report details a diagnosis of two distinct disease processes of different cellular origin namely, focal cemento-ossifying dysplasia and adenomatoid odontogenic tumor in a previously unreported concomitant and contiguous relationship. The diagnosis was determined by a combination of clinical, radiographic, histopathological and surgical evidence. This case highlights two points, first the need to examine all mixed radiolucent-radiopaque lesions with advanced imaging techniques to assess the number and extent of the lesions prior to treatment planning. Second a likely role of periodontal ligament as the tissue source for odontogenic epithelial cells and mesenchymal stem cells required for the development of odontogenic tumors and cemento-osseous dysplasias.

  13. Braddock-Carey syndrome: A 21q22 contiguous gene syndrome encompassing RUNX1. (United States)

    Braddock, Stephen R; South, Sarah T; Schiffman, Joshua D; Longhurst, Maria; Rowe, Leslie R; Carey, John C


    In 1994, Braddock and Carey first reported two unrelated girls with a new multiple malformation syndrome. The primary features included Pierre Robin sequence, persistent neonatal-onset thrombocytopenia, agenesis of the corpus callosum, a distinctive facies, enamel hypoplasia, and severe developmental delay. Since that time, there have been multiple other reported patients with a similar phenotype. In addition, several reports of thrombocytopenia and developmental delay have been documented in association with deletions in the Down syndrome critical region at 21q22. The similarity of the reported cases with deletions involving 21q22 with the clinical presentation of the two patients with Braddock-Carey syndrome resulted in a reinvestigation of the genetic etiology of these two patients 20 years after the original study. This investigation provides evidence that the etiology of this and other "Fanconi-like" disorders represent a newly recognized contiguous gene deletion syndrome involving 21q22 and specifically, the RUNX1 gene. © 2016 Wiley Periodicals, Inc.

  14. Non-contiguous finished genome sequence of plant-growth promoting Serratia proteamaculans S4. (United States)

    Neupane, Saraswoti; Goodwin, Lynne A; Högberg, Nils; Kyrpides, Nikos C; Alström, Sadhna; Bruce, David; Quintana, Beverly; Munk, Christine; Daligault, Hajnalka; Teshima, Hazuki; Davenport, Karen; Reitenga, Krista; Green, Lance; Chain, Patrick; Erkkila, Tracy; Gu, Wei; Zhang, Xiaojing; Xu, Yan; Kunde, Yulia; Chertkov, Olga; Han, James; Han, Cliff; Detter, John C; Ivanova, Natalia; Pati, Amrita; Chen, Amy; Szeto, Ernest; Mavromatis, Kostas; Huntemann, Marcel; Nolan, Matt; Pitluck, Sam; Deshpande, Shweta; Markowitz, Victor; Pagani, Ioanna; Klenk, Hans-Peter; Woyke, Tanja; Finlay, Roger D


    Serratia proteamaculans S4 (previously Serratia sp. S4), isolated from the rhizosphere of wild Equisetum sp., has the ability to stimulate plant growth and to suppress the growth of several soil-borne fungal pathogens of economically important crops. Here we present the non-contiguous, finished genome sequence of S. proteamaculans S4, which consists of a 5,324,944 bp circular chromosome and a 129,797 bp circular plasmid. The chromosome contains 5,008 predicted genes while the plasmid comprises 134 predicted genes. In total, 4,993 genes are assigned as protein-coding genes. The genome consists of 22 rRNA genes, 82 tRNA genes and 58 pseudogenes. This genome is a part of the project "Genomics of four rapeseed plant growth-promoting bacteria with antagonistic effect on plant pathogens" awarded through the 2010 DOE-JGI's Community Sequencing Program.

  15. Epithelioid Hemangioma Involving Three Contiguous Bones: a Case Report with a Review of the Literature

    Energy Technology Data Exchange (ETDEWEB)

    Sirikulchayanonta, Vorachai; Jinawath, Arthit; Jaovisidha, Suphaneewan [Mahidol University, Ramathibodi Hospital Bangkok (Thailand)


    An epithelioid hemangioma involving three contiguous bones in continuity has, to the best of our knowledge, not been reported in the literature. A case of a 48-year-old man presented with radiating pain to the lower thoracic region for two years. A radiograph and CT scan revealed both permeative osteolytic and multiple trabeculated lesions involving the left posterior part of the 10th rib as well as the 9th and 10th vertebral bodies in continuity and was misled as a malignant or infectious lesion. The histopathology and immuno-histochemistry of the lesion confirmed the diagnosis of an epithelioid hemangioma. The lesion was still stable as of three years after surgery

  16. Contiguous gene syndromes due to deletions in the distal short arm of the human X chromosome

    Energy Technology Data Exchange (ETDEWEB)

    Ballabio, A.; Andria, G. (Univ. of Reggio Calabria, Catanzaro (Italy)); Bardoni, B.; Fraccaro, M.; Maraschio, P.; Zuffardi, O.; Guioli, S.; Camerino, G. (Univ. of Pavia (Italy)); Carrozzo, R. (Univ. of Naples (Italy)); Bick, D.; Campbell, L. (Univ. of Texas, San Antonio (USA)); Hamel, B. (Univ. of Nijmegen (Netherlands)); Ferguson-Smith, M.A. (Univ. of Cambridge (England)); Gimelli, G. (G. Gaslini Institute, Genoa (Italy))


    Mendelian inherited disorders to deletions of adjacent genes on a chromosome have been described as contiguous gene syndromes. Short stature, chondrodysplasia punctata, mental retardation, steroid sulfatase deficiency, and Kallmann syndrome have been found as isolated entities or associated in various combination in 27 patients with interstitial and terminal deletions involving the distal short are of the X chromosome. The use of cDNA and genomic probes from the Xp22-pter region allowed us to identify 12 different deletion intervals and to confirm, and further refine, the chromosomal assignment of X-linked recessive chondrodysplasia punctata and Kallmann syndrome genes. A putative pseudoautosomal gene affecting height and an X-linked nonspecific mental retardation gene have been tentatively assigned to specific intervals. The deletion panel described is a useful tool for mapping new sequences and orienting chromosome walks in the region.

  17. First contiguous gene deletion causing biotinidase deficiency: The enzyme deficiency in three Sri Lankan children

    Directory of Open Access Journals (Sweden)

    Danika Nadeen Senanayake


    Full Text Available We report three symptomatic children with profound biotinidase deficiency from Sri Lanka. All three children presented with typical clinical features of the disorder. The first is homozygous for a missense mutation in the BTD gene (c.98_104 del7insTCC; p.Cys33PhefsX36 that is commonly seen in the western countries, the second is homozygous for a novel missense mutation (p.Ala439Asp, and the third is the first reported instance of a contiguous gene deletion causing the enzyme deficiency. In addition, this latter finding exemplifies the importance of considering a deletion within the BTD gene for reconciling enzymatic activity with genotype, which can occur in asymptomatic children who are identified by newborn screening.

  18. Anthrax and the geochemistry of soils in the contiguous United States (United States)

    Griffin, Dale W.; Silvestri, Erin E.; Bowling, Charlena Y.; Boe, Timothy; Smith, David B.; Nichols, Tonya L.


    Soil geochemical data from sample sites in counties that reported occurrences of anthrax in wildlife and livestock since 2000 were evaluated against counties within the same states (MN, MT, ND, NV, OR, SD and TX) that did not report occurrences. These data identified the elements, calcium (Ca), manganese (Mn), phosphorus (P) and strontium (Sr), as having statistically significant differences in concentrations between county type (anthrax occurrence versus no occurrence). Tentative threshold values of the lowest concentrations of each of these elements (Ca = 0.43 wt %, Mn = 142 mg/kg, P = 180 mg/kg and Sr = 51 mg/kg) and average concentrations (Ca = 1.3 wt %, Mn = 463 mg/kg, P = 580 mg/kg and Sr = 170 mg/kg) were identified from anthrax-positive counties as prospective investigative tools in determining whether an outbreak had “potential” or was “likely” at any given geographic location in the contiguous United States.

  19. Unusual contiguous soft tissue spread of advanced malignant mesothelioma detected by FDG PET/CT

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Yu Yang; Edwards, Jamie; Williams, Hadyn; Hao, Zhong Lin; Khleif, Samir; Pucar, Darko [Medical College of Georgia at Augusta UniversityAugusta (United States)


    Malignant pleural mesothelioma (MPM) is a tumor of mesodermal origin that arises from the serosa of the pleura, peritoneum, pericardium or tunica vaginalis. MPM is well known to have a poor prognosis with a median survival time of 12 months. Accurate diagnosis, staging and restaging of MPM are crucial with [18F] flurodeoxy-D-glucose positron emission tomography (FDG PET/CT) playing an increasingly important role. Here we report a case of MPM with unusual contiguous soft tissue spread of the tumor along the dermal and fascial planes characterized by PET/CT. Given that the loco-regional tumor in the thorax was under control on PET/CT, the death of the patient was most likely associated with physiologic or metabolic causes associated with an extra-thoracic tumor.

  20. Improving Children's Knowledge of Fraction Magnitudes (United States)

    Fazio, Lisa K.; Kennedy, Casey A.; Siegler, Robert S.


    We examined whether playing a computerized fraction game, based on the integrated theory of numerical development and on the Common Core State Standards' suggestions for teaching fractions, would improve children's fraction magnitude understanding. Fourth and fifth-graders were given brief instruction about unit fractions and played "Catch…